F496502
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2170 | 1463 | 4310 | 361 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2840764183|2840769232 |
| Length | 439 |
| Sequence | VREFWPVRWILLKYFLVISNDSMATPPLSLHVLDLDKRVCMVIPEIGRPGHNCPVIWAEELSSIVFGGELMDRRSFITKAGFAGVGAAAAATTLAAPAIAQSLPKVTWRCASSFPKSLDTIYGGAEVLSKYLKEATDGNFTIQPFAAGEIVPGLQAADATAAGTVELCHTVAYYYWGKDPTWALGAAVPFALNARGMNAWQYHGGGIDLMNEFFNKQGLQAYPGGNTGVQMGGWFRKEIKTVDDLKGLKMRVGGFAGKVLEKLGVVPQQIAGGDIYPSLEKGTIDAAEWVGPYDDEKLGFQKVAPFYYYPGWWEGGPTVSFMVNKEKWDSLPPAYQSLFRTAAQATDADMLQKYDSLNPAAIKRLVAGGAQLRPFSPEILNACFEAANGVYAEMEANNPAFKKIWESIKAFRNEHFLYAQVAEYSFDTFMMIQQRNGKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 7 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 8 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 9 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 10 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 11 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 12 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 13 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 14 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 15 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 16 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 17 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 18 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 19 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 20 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 21 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 22 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 23 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 24 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 33 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 35 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 36 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 78 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 84 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 91 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 93 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 94 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 95 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 97 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 98 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 99 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 100 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 101 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 102 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 103 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 104 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 105 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 106 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 107 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 108 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 109 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 110 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 112 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 113 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 114 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 115 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 116 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 117 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 118 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 119 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 120 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 121 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 123 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 124 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 125 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 126 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 127 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 128 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 129 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 130 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 131 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 133 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 134 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 135 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 136 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 137 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 138 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 152 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 153 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 154 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 161 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 169 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 173 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 174 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 175 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 176 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 178 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 179 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 180 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 181 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 182 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 186 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 188 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 198 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 201 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 268 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 269 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 271 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 272 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 273 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 274 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 276 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 278 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 282 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 283 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 284 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 285 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 286 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 287 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 288 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 289 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 290 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 291 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 292 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 293 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 294 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 295 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 296 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 297 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 298 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 299 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 300 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 301 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 302 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 303 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 304 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 305 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 306 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 307 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 308 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 309 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 310 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 311 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 312 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 313 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 314 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 315 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 316 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 317 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 318 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 319 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 320 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 321 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 322 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 323 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 324 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 325 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 326 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 327 | 3300041497 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT | Metatranscriptome | Unclassified |
| 328 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 329 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 330 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 331 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 332 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 333 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 334 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 335 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 336 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 337 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 338 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 406 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 407 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 408 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 409 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 410 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 411 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 412 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 413 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 415 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 416 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 417 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 418 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 419 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 420 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 421 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 422 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 423 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 424 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 425 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 426 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 427 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 428 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 429 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 430 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 431 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 432 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 441 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 442 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 443 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 444 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 445 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 446 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 451 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 455 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 459 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 460 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 461 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 462 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 463 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 464 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 465 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 466 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 475 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 478 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 480 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 481 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 482 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 483 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 484 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 485 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 486 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 487 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 488 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 489 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 490 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 491 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 492 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 493 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 494 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 495 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 496 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 497 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 498 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 499 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 500 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 501 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 502 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 503 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 504 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 505 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 506 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 507 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 508 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 509 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 510 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 511 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 512 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 513 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 514 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 515 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 516 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 517 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 518 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 519 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 520 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 521 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 522 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 523 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 524 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 525 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 526 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 527 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 528 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 529 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 530 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 531 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 532 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 533 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 534 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 535 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 536 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 537 | 2512875024 | |||
| 538 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 539 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 540 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 541 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 542 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 543 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 544 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 545 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 546 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 547 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 548 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 549 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 550 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 551 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 552 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 553 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 554 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 555 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 556 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 557 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 558 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 559 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 560 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 561 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 562 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 563 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 564 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 565 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 566 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 567 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 568 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 569 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 570 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 571 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 572 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 573 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 574 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 575 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 576 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 577 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 578 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 579 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 580 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 581 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 582 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 583 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 584 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 585 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 586 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 587 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 588 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 589 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 590 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 591 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 592 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 593 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 594 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 595 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 596 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 597 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 598 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 599 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 600 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 601 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 602 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 603 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 604 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 605 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 606 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 607 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 608 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 609 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 610 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 611 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 612 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 613 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 614 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 615 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 616 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 617 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 618 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 619 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 620 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 621 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 622 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 623 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 624 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 625 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 626 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 627 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 628 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 629 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 630 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 631 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 632 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 633 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 634 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 635 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 636 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 637 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 638 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 639 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 640 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 641 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 642 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 643 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 644 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 645 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 646 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 647 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 648 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 649 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 650 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 651 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 652 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 653 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 654 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 655 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 656 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 657 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 658 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 659 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 660 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 661 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 662 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 663 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 664 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 665 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 666 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 667 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 668 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 669 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 670 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 671 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 672 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 673 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 674 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 675 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 676 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 677 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 678 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 679 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 680 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 681 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 682 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 683 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 684 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 685 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 686 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 687 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 688 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 689 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 690 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 691 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 692 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 693 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 694 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 695 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 696 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 697 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 698 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 699 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 700 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 701 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 702 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 703 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 704 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 705 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 706 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 707 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 708 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 709 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 710 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 711 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 712 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 713 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 714 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 715 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 716 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 717 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 718 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 719 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 720 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 721 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 722 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 723 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 724 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 725 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 726 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 727 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 728 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 729 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 730 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 731 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 732 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 733 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 734 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 735 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 736 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 737 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 738 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 739 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 740 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 741 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 742 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 743 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 744 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 745 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 746 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 747 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 748 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 749 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 750 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 751 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 752 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 753 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 754 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 755 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 756 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 757 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 758 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 759 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 760 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 761 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 762 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 763 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 764 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 765 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 766 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 767 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 768 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 769 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 770 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 771 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 772 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 773 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 774 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 775 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 776 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 777 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 778 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 779 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 780 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 781 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 782 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 783 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 784 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 785 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 786 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 787 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 788 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 789 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 790 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 791 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 792 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 793 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 794 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 795 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 796 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 797 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 798 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 799 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 800 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 801 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 802 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 803 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 804 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 805 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 806 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 807 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 808 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 809 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 810 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 811 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 812 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 813 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 814 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 815 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 816 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 817 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 818 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 819 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 820 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 821 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 822 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 823 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 824 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 825 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 826 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 827 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 828 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 829 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 830 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 831 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 832 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 833 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 834 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 835 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 836 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 837 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 838 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 839 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 840 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 841 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 842 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 843 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 844 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 845 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 846 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 847 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 848 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 849 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 850 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 851 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 852 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 853 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 854 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 855 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 856 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 857 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 858 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 859 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 860 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 861 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 862 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 863 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 864 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 865 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 866 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 867 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 868 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 869 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 870 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 871 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 872 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 873 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 874 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 875 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 876 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 877 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 878 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 879 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 880 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 881 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 882 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 883 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 884 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 885 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 886 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 887 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 888 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 889 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 890 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 891 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 892 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 893 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 894 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 895 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 896 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 897 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 898 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 899 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 900 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 901 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 902 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 903 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 904 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 905 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 906 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 907 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 908 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 909 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 910 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 911 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 912 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 913 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 914 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 915 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 916 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 917 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 918 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 919 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 920 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 921 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 922 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 923 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 924 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 925 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 926 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 927 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 928 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 929 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 930 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 931 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 932 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 933 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 934 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 935 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 936 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 937 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 938 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 939 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 940 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 941 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 942 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 943 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 944 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 945 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 946 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 947 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 948 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 949 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 950 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 951 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 952 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 953 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 954 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 955 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 956 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 957 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 958 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 959 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 960 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 961 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 962 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 963 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 964 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 965 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 966 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 967 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 968 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 969 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 970 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 971 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 972 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 973 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 974 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 975 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 976 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 977 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 978 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 979 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 980 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 981 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 982 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 983 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 984 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 985 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 986 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 987 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 988 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 989 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 990 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 991 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 992 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 993 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 994 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 995 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 996 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 997 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 998 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 999 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 1000 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 1001 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 1002 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 1003 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 1004 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 1005 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 1006 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 1007 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 1008 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 1009 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 1010 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 1011 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 1012 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 1013 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 1014 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 1015 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 1016 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 1017 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 1018 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 1019 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 1020 | 2922368715 | |||
| 1021 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 1022 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 1023 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 1024 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 1025 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 1026 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 1027 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 1028 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 1029 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 1030 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 1031 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 1032 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 1033 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 1034 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 1035 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 1036 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 1037 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 1038 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 1039 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 1040 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 1041 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 1042 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 1043 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 1044 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 1045 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 1046 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 1047 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 1048 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 1049 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 1050 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 1051 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 1052 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 1053 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 1054 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 1055 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 1056 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 1057 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 1058 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 1059 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 1060 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 1061 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 1062 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 1063 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 1064 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 1065 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 1066 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 1067 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 1068 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 1069 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 1070 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 1071 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 1072 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 1073 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 1074 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 1075 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 1076 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 1077 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 1078 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 1079 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 1080 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 1081 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 1082 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 1083 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 1084 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 1085 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 1086 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 1087 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 1088 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 1089 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 1090 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 1091 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 1092 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 1093 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 1094 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 1095 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 1096 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 1097 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 1098 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 1099 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 1100 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 1101 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 1102 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 1103 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 1104 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 1105 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 1106 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 1107 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 1108 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 1109 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 1110 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 1111 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 1112 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 1113 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 1114 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 1115 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 1116 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 1117 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 1118 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 1119 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 1120 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 1121 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 1122 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 1123 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 1124 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 1125 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 1126 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 1127 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 1128 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 1129 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 1130 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 1131 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 1132 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 1133 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 1134 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 1135 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 1136 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 1137 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 1138 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 1139 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 1140 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 1141 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 1142 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 1143 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 1144 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 1145 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 1146 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 1147 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 1148 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 1149 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 1150 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 1151 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 1152 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 1153 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 1154 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 1155 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 1156 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 1157 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 1158 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 1159 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 1160 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 1161 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 1162 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 1163 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 1164 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 1165 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 1166 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 1167 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 1168 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 1169 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 1170 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 1171 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 1172 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 1173 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 1174 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 1175 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 1176 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 1177 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 1178 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 1179 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 1180 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 1181 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 1182 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 1183 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 1184 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 1185 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 1186 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 1187 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 1188 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 1189 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 1190 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 1191 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 1192 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 1193 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 1194 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 1195 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 1196 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 1197 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 1198 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 1199 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 1200 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 1201 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 1202 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 1203 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 1204 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 1205 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 1206 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 1207 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 1208 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 1209 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 1210 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 1211 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 1212 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 1213 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 1214 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 1215 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 1216 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 1217 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 1218 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 1219 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 1220 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 1221 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 1222 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 1223 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 1224 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 1225 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 1226 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 1227 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 1228 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 1229 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 1230 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 1231 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 1232 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 1233 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 1234 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 1235 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 1236 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 1237 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 1238 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 1239 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 1240 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 1241 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 1242 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 1243 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 1244 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 1245 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 1246 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 1247 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 1248 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 1249 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 1250 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 1251 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 1252 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 1253 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 1254 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 1255 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 1256 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 1257 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 1258 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 1259 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 1260 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 1261 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 1262 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 1263 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 1264 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 1265 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 1266 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 1267 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 1268 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 1269 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 1270 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 1271 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 1272 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 1273 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 1274 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 1275 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 1276 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 1277 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 1278 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 1279 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 1280 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 1281 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 1282 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 1283 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 1284 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 1285 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 1286 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 1287 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 1288 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 1289 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 1290 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 1291 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 1292 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 1293 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 1294 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 1295 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 1296 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 1297 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 1298 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 1299 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 1300 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 1301 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 1302 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 1303 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 1304 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 1305 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 1306 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 1307 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 1308 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 1309 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 1310 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 1311 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 1312 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 1313 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 1314 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 1315 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 1316 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 1317 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 1318 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 1319 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 1320 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 1321 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 1322 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 1323 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 1324 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 1325 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 1326 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 1327 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 1328 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 1329 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 1330 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 1331 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 1332 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 1333 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 1334 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 1335 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 1336 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 1337 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 1338 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 1339 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 1340 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 1341 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 1342 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 1343 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 1344 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 1345 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 1346 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 1347 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 1348 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 1349 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 1350 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 1351 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 1352 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 1353 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 1354 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 1355 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 1356 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 1357 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 1358 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 1359 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 1360 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 1361 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 1362 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 1363 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 1364 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 1365 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 1366 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 1367 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 1368 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 1369 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 1370 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 1371 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 1372 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 1373 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 1374 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 1375 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1376 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1377 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1378 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 1379 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 1380 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 1381 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1382 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1383 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1384 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 1385 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 1386 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 1387 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 1388 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 1389 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 1390 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 1391 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1392 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 1393 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1394 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 1395 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 1396 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 1397 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1398 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1399 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1400 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1401 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1402 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1403 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1404 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1405 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1406 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1407 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1408 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1409 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1410 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1411 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1412 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1413 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1414 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1415 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1416 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1417 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1418 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1419 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1420 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1421 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1422 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1423 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 1424 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 1425 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 1426 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 1427 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 1428 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 1429 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 1430 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 1431 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 1432 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 1433 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 1434 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 1435 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 1436 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1437 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 1438 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1439 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1440 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 1441 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 1442 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 1443 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 1444 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 1445 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 1446 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 1447 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 1448 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 1449 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 1450 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 1451 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1452 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1453 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1454 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1455 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 1456 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 1457 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1458 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 1459 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1460 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1461 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 1462 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 1463 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 55.51 |
| Metatranscriptomes | 0.23 |
| Isolates | 44.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.23 |
| Bulb | 0 |
| Endosphere | 13.09 |
| Nodule | 35.25 |
| Rhizoplane | 4.15 |
| Rhizosphere | 36.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1007941 | 3300001915 | Bacteria | 2028 |
| 2 | JGI24746J21847_1000755 | 3300001977 | Bacteria | 4961 |
| 3 | JGI24740J21852_10006190 | 3300001979 | Bacteria | 4984 |
| 4 | JGI24740J21852_10007518 | 3300001979 | Bacteria | 4422 |
| 5 | JGI24739J22299_10000344 | 3300001989 | Bacteria | 15875 |
| 6 | JGI24739J22299_10043423 | 3300001989 | Bacteria | 1487 |
| 7 | JGI24737J22298_10001079 | 3300001990 | Bacteria | 9595 |
| 8 | JGI24750J21931_1000255 | 3300002070 | Bacteria | 9058 |
| 9 | JGI24745J21846_1000003 | 3300002073 | Bacteria | 15974 |
| 10 | JGI24035J26624_1000595 | 3300002126 | Bacteria | 3360 |
| 11 | JGI24033J26618_1000489 | 3300002155 | Bacteria | 3895 |
| 12 | JGI24034J26672_10000322 | 3300002239 | Bacteria | 6170 |
| 13 | JGI24742J22300_10002875 | 3300002244 | Bacteria | 2782 |
| 14 | JGI24751J29686_10004924 | 3300002459 | Bacteria | 2720 |
| 15 | JGI24751J29686_10010970 | 3300002459 | Bacteria | 1868 |
| 16 | JGI25156J39149_1004063 | 3300002705 | Bacteria | 4574 |
| 17 | JGI25162J39368_1001169 | 3300002737 | Bacteria | 15592 |
| 18 | JGI25158J39367_1000393 | 3300002739 | Bacteria | 9201 |
| 19 | JGI25157J39369_1000738 | 3300002741 | Bacteria | 17379 |
| 20 | JGI25152J39213_1003706 | 3300002773 | Bacteria | 5121 |
| 21 | JGI25159J45721_1000508 | 3300002987 | Bacteria | 17749 |
| 22 | JGI25151J46595_10000585 | 3300003187 | Bacteria | 32381 |
| 23 | JGI25151J46595_10001084 | 3300003187 | Bacteria | 20208 |
| 24 | JGI25151J46595_10036025 | 3300003187 | Bacteria | 1871 |
| 25 | JGI25165J46597_1000147 | 3300003214 | Bacteria | 116564 |
| 26 | JGI25165J46597_1000630 | 3300003214 | Bacteria | 29232 |
| 27 | JGI25153J46596_10000428 | 3300003215 | Bacteria | 27370 |
| 28 | JGI25153J46596_10001318 | 3300003215 | Bacteria | 14872 |
| 29 | JGI25153J46596_10004290 | 3300003215 | Bacteria | 7708 |
| 30 | JGI25153J46596_10017933 | 3300003215 | Bacteria | 2768 |
| 31 | JGI25153J46596_10026971 | 3300003215 | Bacteria | 2022 |
| 32 | JGI25160J50197_1000015 | 3300003354 | Bacteria | 250902 |
| 33 | JGI25160J50197_1000216 | 3300003354 | Bacteria | 46708 |
| 34 | JGI25160J50197_1000438 | 3300003354 | Bacteria | 26112 |
| 35 | JGI25160J50197_1000463 | 3300003354 | Bacteria | 25108 |
| 36 | JGI25160J50197_1001146 | 3300003354 | Bacteria | 13557 |
| 37 | JGI25160J50197_1001518 | 3300003354 | Bacteria | 11518 |
| 38 | JGI25160J50197_1002737 | 3300003354 | Bacteria | 8089 |
| 39 | JGI25160J50197_1005355 | 3300003354 | Bacteria | 5357 |
| 40 | JGI25161J50226_1000005 | 3300003374 | Bacteria | 292548 |
| 41 | JGI25161J50226_1000120 | 3300003374 | Bacteria | 57896 |
| 42 | JGI25161J50226_1000412 | 3300003374 | Bacteria | 20844 |
| 43 | JGI25161J50226_1005409 | 3300003374 | Bacteria | 2482 |
| 44 | Ga0055542_1000252 | 3300003762 | Bacteria | 61157 |
| 45 | Ga0055526_1000594 | 3300003771 | Bacteria | 28489 |
| 46 | Ga0055526_1001753 | 3300003771 | Bacteria | 15048 |
| 47 | Ga0055526_1002151 | 3300003771 | Bacteria | 13515 |
| 48 | Ga0055524_1011640 | 3300003775 | Bacteria | 3426 |
| 49 | Ga0055524_1019832 | 3300003775 | Bacteria | 2285 |
| 50 | Ga0055524_1021731 | 3300003775 | Bacteria | 2116 |
| 51 | Ga0055536_1002870 | 3300003781 | Bacteria | 9487 |
| 52 | Ga0055536_1013021 | 3300003781 | Bacteria | 3034 |
| 53 | Ga0055528_1000693 | 3300003790 | Bacteria | 24016 |
| 54 | Ga0055528_1001185 | 3300003790 | Bacteria | 16837 |
| 55 | Ga0055528_1005562 | 3300003790 | Bacteria | 5836 |
| 56 | Ga0055530_10011385 | 3300003791 | Bacteria | 3196 |
| 57 | Ga0055530_10012693 | 3300003791 | Bacteria | 2920 |
| 58 | Ga0055540_1001134 | 3300003792 | Bacteria | 16613 |
| 59 | Ga0055540_1002011 | 3300003792 | Bacteria | 11312 |
| 60 | Ga0055540_1002353 | 3300003792 | Bacteria | 10116 |
| 61 | Ga0055540_1014218 | 3300003792 | Bacteria | 2384 |
| 62 | Ga0055531_10002835 | 3300003794 | Bacteria | 11346 |
| 63 | Ga0055531_10007059 | 3300003794 | Bacteria | 6214 |
| 64 | Ga0055531_10007361 | 3300003794 | Bacteria | 6029 |
| 65 | Ga0058692_1000689 | 3300003856 | Bacteria | 13918 |
| 66 | Ga0055543_1000012 | 3300004625 | Bacteria | 186581 |
| 67 | Ga0055543_1000155 | 3300004625 | Bacteria | 57253 |
| 68 | Ga0055543_1000301 | 3300004625 | Bacteria | 35189 |
| 69 | Ga0055543_1000631 | 3300004625 | Bacteria | 18905 |
| 70 | Ga0055543_1002832 | 3300004625 | Bacteria | 5481 |
| 71 | Ga0065165_1000125 | 3300005262 | Bacteria | 130283 |
| 72 | Ga0065165_1000717 | 3300005262 | Bacteria | 46746 |
| 73 | Ga0065165_1000780 | 3300005262 | Bacteria | 42673 |
| 74 | Ga0065165_1000826 | 3300005262 | Bacteria | 40863 |
| 75 | Ga0065165_1001465 | 3300005262 | Bacteria | 25288 |
| 76 | Ga0065165_1003182 | 3300005262 | Bacteria | 12014 |
| 77 | Ga0065165_1013609 | 3300005262 | Bacteria | 3221 |
| 78 | Ga0065712_10003725 | 3300005290 | Bacteria | 4760 |
| 79 | Ga0065712_10070614 | 3300005290 | Bacteria | 5849 |
| 80 | Ga0065712_10111484 | 3300005290 | Bacteria | 1817 |
| 81 | Ga0065715_10093037 | 3300005293 | Bacteria | 4831 |
| 82 | Ga0070658_10205856 | 3300005327 | Bacteria | 1661 |
| 83 | Ga0070676_10000784 | 3300005328 | Bacteria | 15682 |
| 84 | Ga0070683_100000114 | 3300005329 | Bacteria | 52980 |
| 85 | Ga0070683_100057598 | 3300005329 | Bacteria | 3610 |
| 86 | Ga0070690_100000064 | 3300005330 | Bacteria | 53027 |
| 87 | Ga0070690_100022010 | 3300005330 | Bacteria | 3897 |
| 88 | Ga0070670_100002373 | 3300005331 | Bacteria | 15518 |
| 89 | Ga0070677_10000193 | 3300005333 | Bacteria | 20923 |
| 90 | Ga0070677_10022088 | 3300005333 | Bacteria | 2339 |
| 91 | Ga0068869_100000020 | 3300005334 | Bacteria | 66561 |
| 92 | Ga0068869_100006431 | 3300005334 | Bacteria | 7452 |
| 93 | Ga0070666_10030214 | 3300005335 | Bacteria | 3568 |
| 94 | Ga0070680_100000242 | 3300005336 | Bacteria | 36144 |
| 95 | Ga0070682_100000224 | 3300005337 | Bacteria | 41040 |
| 96 | Ga0068868_100001773 | 3300005338 | Bacteria | 14779 |
| 97 | Ga0068868_100009208 | 3300005338 | Bacteria | 7095 |
| 98 | Ga0068868_100186489 | 3300005338 | Bacteria | 1724 |
| 99 | Ga0070660_100000123 | 3300005339 | Bacteria | 48796 |
| 100 | Ga0070660_100084487 | 3300005339 | Bacteria | 2495 |
| 101 | Ga0070689_100000685 | 3300005340 | Bacteria | 20556 |
| 102 | Ga0070689_100076641 | 3300005340 | Bacteria | 2620 |
| 103 | Ga0070689_100153949 | 3300005340 | Bacteria | 1855 |
| 104 | Ga0070691_10013336 | 3300005341 | Bacteria | 3764 |
| 105 | Ga0070687_100000351 | 3300005343 | Bacteria | 15646 |
| 106 | Ga0070687_100039459 | 3300005343 | Bacteria | 2373 |
| 107 | Ga0070661_100026596 | 3300005344 | Bacteria | 4162 |
| 108 | Ga0070661_100046186 | 3300005344 | Bacteria | 3186 |
| 109 | Ga0070661_100111987 | 3300005344 | Bacteria | 2039 |
| 110 | Ga0070692_10000108 | 3300005345 | Bacteria | 18900 |
| 111 | Ga0070668_100003586 | 3300005347 | Bacteria | 11452 |
| 112 | Ga0070668_100021775 | 3300005347 | Bacteria | 4843 |
| 113 | Ga0070668_100180266 | 3300005347 | Bacteria | 1725 |
| 114 | Ga0070669_100000176 | 3300005353 | Bacteria | 55540 |
| 115 | Ga0070669_100062083 | 3300005353 | Bacteria | 2747 |
| 116 | Ga0070675_100000259 | 3300005354 | Bacteria | 34661 |
| 117 | Ga0070675_100099529 | 3300005354 | Bacteria | 2448 |
| 118 | Ga0070675_100193875 | 3300005354 | Bacteria | 1761 |
| 119 | Ga0070671_100004849 | 3300005355 | Bacteria | 10694 |
| 120 | Ga0070671_100006467 | 3300005355 | Bacteria | 9367 |
| 121 | Ga0070671_100098198 | 3300005355 | Bacteria | 2456 |
| 122 | Ga0070671_100129759 | 3300005355 | Bacteria | 2123 |
| 123 | Ga0070671_100153294 | 3300005355 | Bacteria | 1946 |
| 124 | Ga0070674_100000099 | 3300005356 | Bacteria | 40231 |
| 125 | Ga0070674_100026259 | 3300005356 | Bacteria | 3801 |
| 126 | Ga0070674_100184190 | 3300005356 | Bacteria | 1602 |
| 127 | Ga0070673_100000042 | 3300005364 | Bacteria | 52952 |
| 128 | Ga0070673_100084549 | 3300005364 | Bacteria | 2581 |
| 129 | Ga0070673_100112291 | 3300005364 | Bacteria | 2262 |
| 130 | Ga0070688_100000329 | 3300005365 | Bacteria | 24316 |
| 131 | Ga0070688_100074173 | 3300005365 | Bacteria | 2184 |
| 132 | Ga0070659_100000348 | 3300005366 | Bacteria | 35172 |
| 133 | Ga0070667_100001075 | 3300005367 | Bacteria | 24994 |
| 134 | Ga0070667_100019257 | 3300005367 | Bacteria | 5662 |
| 135 | Ga0070667_100042027 | 3300005367 | Bacteria | 3834 |
| 136 | Ga0070703_10000878 | 3300005406 | Bacteria | 9648 |
| 137 | Ga0070709_10032295 | 3300005434 | Bacteria | 3155 |
| 138 | Ga0070709_10129479 | 3300005434 | Bacteria | 1721 |
| 139 | Ga0070714_100152101 | 3300005435 | Bacteria | 2086 |
| 140 | Ga0070713_100030475 | 3300005436 | Bacteria | 4284 |
| 141 | Ga0070713_100183785 | 3300005436 | Bacteria | 1880 |
| 142 | Ga0070710_10024016 | 3300005437 | Bacteria | 3211 |
| 143 | Ga0070710_10083034 | 3300005437 | Bacteria | 1874 |
| 144 | Ga0070701_10000025 | 3300005438 | Bacteria | 38966 |
| 145 | Ga0070711_100032827 | 3300005439 | Bacteria | 3454 |
| 146 | Ga0070705_100003281 | 3300005440 | Bacteria | 7960 |
| 147 | Ga0070705_100170695 | 3300005440 | Bacteria | 1464 |
| 148 | Ga0070694_100003777 | 3300005444 | Bacteria | 9035 |
| 149 | Ga0070694_100100151 | 3300005444 | Bacteria | 2049 |
| 150 | Ga0070708_100257647 | 3300005445 | Bacteria | 1640 |
| 151 | Ga0070663_100000064 | 3300005455 | Bacteria | 45232 |
| 152 | Ga0070663_100113712 | 3300005455 | Bacteria | 2037 |
| 153 | Ga0070678_100002536 | 3300005456 | Bacteria | 10015 |
| 154 | Ga0070662_100073373 | 3300005457 | Bacteria | 2528 |
| 155 | Ga0070662_100303483 | 3300005457 | Bacteria | 1298 |
| 156 | Ga0070681_10000435 | 3300005458 | Bacteria | 33975 |
| 157 | Ga0070681_10182879 | 3300005458 | Bacteria | 2017 |
| 158 | Ga0070681_10236072 | 3300005458 | Bacteria | 1742 |
| 159 | Ga0068867_100005677 | 3300005459 | Bacteria | 8842 |
| 160 | Ga0068867_100024391 | 3300005459 | Bacteria | 4333 |
| 161 | Ga0068867_100027110 | 3300005459 | Bacteria | 4116 |
| 162 | Ga0068867_100067298 | 3300005459 | Bacteria | 2670 |
| 163 | Ga0068867_100190588 | 3300005459 | Bacteria | 1636 |
| 164 | Ga0070706_100197584 | 3300005467 | Bacteria | 1879 |
| 165 | Ga0070698_100011265 | 3300005471 | Bacteria | 9494 |
| 166 | Ga0070699_100202435 | 3300005518 | Bacteria | 1766 |
| 167 | Ga0070684_100001610 | 3300005535 | Bacteria | 16308 |
| 168 | Ga0070684_100027140 | 3300005535 | Bacteria | 4831 |
| 169 | Ga0070697_100094045 | 3300005536 | Bacteria | 2483 |
| 170 | Ga0068853_100002463 | 3300005539 | Bacteria | 13860 |
| 171 | Ga0068853_100039010 | 3300005539 | Bacteria | 4049 |
| 172 | Ga0068853_100195647 | 3300005539 | Bacteria | 1839 |
| 173 | Ga0068853_100323306 | 3300005539 | Bacteria | 1430 |
| 174 | Ga0070672_100000011 | 3300005543 | Bacteria | 80761 |
| 175 | Ga0070672_100118231 | 3300005543 | Bacteria | 2167 |
| 176 | Ga0070672_100134004 | 3300005543 | Bacteria | 2039 |
| 177 | Ga0070686_100000076 | 3300005544 | Bacteria | 71207 |
| 178 | Ga0070686_100087073 | 3300005544 | Bacteria | 2081 |
| 179 | Ga0070695_100053966 | 3300005545 | Bacteria | 2585 |
| 180 | Ga0070696_100052443 | 3300005546 | Bacteria | 2837 |
| 181 | Ga0070696_100056200 | 3300005546 | Bacteria | 2745 |
| 182 | Ga0070693_100004777 | 3300005547 | Bacteria | 6450 |
| 183 | Ga0070665_100002816 | 3300005548 | Bacteria | 18830 |
| 184 | Ga0070665_100003012 | 3300005548 | Bacteria | 18172 |
| 185 | Ga0070665_100016716 | 3300005548 | Bacteria | 7353 |
| 186 | Ga0070665_100037641 | 3300005548 | Bacteria | 4864 |
| 187 | Ga0070665_100289398 | 3300005548 | Bacteria | 1641 |
| 188 | Ga0070665_100424974 | 3300005548 | Bacteria | 1337 |
| 189 | Ga0068855_100049447 | 3300005563 | Bacteria | 4959 |
| 190 | Ga0068855_100061125 | 3300005563 | Bacteria | 4402 |
| 191 | Ga0068855_100110372 | 3300005563 | Bacteria | 3158 |
| 192 | Ga0070664_100000112 | 3300005564 | Bacteria | 53506 |
| 193 | Ga0068857_100000023 | 3300005577 | Bacteria | 86999 |
| 194 | Ga0068857_100024933 | 3300005577 | Bacteria | 5267 |
| 195 | Ga0068857_100031521 | 3300005577 | Bacteria | 4685 |
| 196 | Ga0068854_100066891 | 3300005578 | Bacteria | 2616 |
| 197 | Ga0068854_100178454 | 3300005578 | Bacteria | 1658 |
| 198 | Ga0068856_100000099 | 3300005614 | Bacteria | 83061 |
| 199 | Ga0068856_100006276 | 3300005614 | Bacteria | 11671 |
| 200 | Ga0068856_100014002 | 3300005614 | Bacteria | 7755 |
| 201 | Ga0068856_100095048 | 3300005614 | Bacteria | 2968 |
| 202 | Ga0068856_100118811 | 3300005614 | Bacteria | 2644 |
| 203 | Ga0070702_100000005 | 3300005615 | Bacteria | 70200 |
| 204 | Ga0068852_100002886 | 3300005616 | Bacteria | 11926 |
| 205 | Ga0068852_100014911 | 3300005616 | Bacteria | 6005 |
| 206 | Ga0068859_100000503 | 3300005617 | Bacteria | 38475 |
| 207 | Ga0068859_100128696 | 3300005617 | Bacteria | 2602 |
| 208 | Ga0068859_100425277 | 3300005617 | Bacteria | 1425 |
| 209 | Ga0068864_100000112 | 3300005618 | Bacteria | 79688 |
| 210 | Ga0068864_100006199 | 3300005618 | Bacteria | 9804 |
| 211 | Ga0068864_100029277 | 3300005618 | Bacteria | 4661 |
| 212 | Ga0068866_10000977 | 3300005718 | Bacteria | 12586 |
| 213 | Ga0068866_10201434 | 3300005718 | Bacteria | 1190 |
| 214 | Ga0068861_100002096 | 3300005719 | Bacteria | 12937 |
| 215 | Ga0068870_10000021 | 3300005840 | Bacteria | 56319 |
| 216 | Ga0068863_100000227 | 3300005841 | Bacteria | 59675 |
| 217 | Ga0068863_100100507 | 3300005841 | Bacteria | 2749 |
| 218 | Ga0068858_100001279 | 3300005842 | Bacteria | 26017 |
| 219 | Ga0068858_100004153 | 3300005842 | Bacteria | 14249 |
| 220 | Ga0068858_100032557 | 3300005842 | Bacteria | 4840 |
| 221 | Ga0068858_100367623 | 3300005842 | Bacteria | 1379 |
| 222 | Ga0068860_100315040 | 3300005843 | Bacteria | 1535 |
| 223 | Ga0068862_100001866 | 3300005844 | Bacteria | 19089 |
| 224 | Ga0068862_100108483 | 3300005844 | Bacteria | 2435 |
| 225 | Ga0081455_10004237 | 3300005937 | Bacteria | 16172 |
| 226 | Ga0081455_10057110 | 3300005937 | Bacteria | 3310 |
| 227 | Ga0081538_10019358 | 3300005981 | Bacteria | 5062 |
| 228 | Ga0081540_1056049 | 3300005983 | Bacteria | 1915 |
| 229 | Ga0081539_10001300 | 3300005985 | Bacteria | 43786 |
| 230 | Ga0081539_10029652 | 3300005985 | Bacteria | 3412 |
| 231 | Ga0081539_10046429 | 3300005985 | Bacteria | 2489 |
| 232 | Ga0070717_10102440 | 3300006028 | Bacteria | 2432 |
| 233 | Ga0070717_10130840 | 3300006028 | Bacteria | 2158 |
| 234 | Ga0075365_10001809 | 3300006038 | Bacteria | 9990 |
| 235 | Ga0075365_10002327 | 3300006038 | Bacteria | 9249 |
| 236 | Ga0075365_10005519 | 3300006038 | Bacteria | 6829 |
| 237 | Ga0075365_10008458 | 3300006038 | Bacteria | 5846 |
| 238 | Ga0075365_10016973 | 3300006038 | Bacteria | 4445 |
| 239 | Ga0075365_10018202 | 3300006038 | Bacteria | 4315 |
| 240 | Ga0075365_10043121 | 3300006038 | Bacteria | 2952 |
| 241 | Ga0075365_10054915 | 3300006038 | Bacteria | 2642 |
| 242 | Ga0075365_10067884 | 3300006038 | Bacteria | 2395 |
| 243 | Ga0075365_10086187 | 3300006038 | Bacteria | 2134 |
| 244 | Ga0075365_10097891 | 3300006038 | Bacteria | 2006 |
| 245 | Ga0075365_10137785 | 3300006038 | Bacteria | 1692 |
| 246 | Ga0075365_10198465 | 3300006038 | Bacteria | 1405 |
| 247 | Ga0075368_10000391 | 3300006042 | Bacteria | 12927 |
| 248 | Ga0075368_10001480 | 3300006042 | Bacteria | 7524 |
| 249 | Ga0075363_100004780 | 3300006048 | Bacteria | 5970 |
| 250 | Ga0075363_100011783 | 3300006048 | Bacteria | 4195 |
| 251 | Ga0075363_100026888 | 3300006048 | Bacteria | 2947 |
| 252 | Ga0075364_10000060 | 3300006051 | Bacteria | 41109 |
| 253 | Ga0075364_10016981 | 3300006051 | Bacteria | 4536 |
| 254 | Ga0075364_10022672 | 3300006051 | Bacteria | 3968 |
| 255 | Ga0070715_10014553 | 3300006163 | Bacteria | 2915 |
| 256 | Ga0070712_100231222 | 3300006175 | Bacteria | 1468 |
| 257 | Ga0075362_10003906 | 3300006177 | Bacteria | 5293 |
| 258 | Ga0075362_10058503 | 3300006177 | Bacteria | 1738 |
| 259 | Ga0075367_10014606 | 3300006178 | Bacteria | 4252 |
| 260 | Ga0075367_10021848 | 3300006178 | Bacteria | 3582 |
| 261 | Ga0075367_10031807 | 3300006178 | Bacteria | 3032 |
| 262 | Ga0075367_10079464 | 3300006178 | Bacteria | 1982 |
| 263 | Ga0075369_10000420 | 3300006186 | Bacteria | 12842 |
| 264 | Ga0075369_10009712 | 3300006186 | Bacteria | 3745 |
| 265 | Ga0075369_10024616 | 3300006186 | Bacteria | 2496 |
| 266 | Ga0075369_10037369 | 3300006186 | Bacteria | 2068 |
| 267 | Ga0075369_10109517 | 3300006186 | Bacteria | 1244 |
| 268 | Ga0075366_10005612 | 3300006195 | Bacteria | 6803 |
| 269 | Ga0075366_10030387 | 3300006195 | Bacteria | 3176 |
| 270 | Ga0075366_10031004 | 3300006195 | Bacteria | 3145 |
| 271 | Ga0075366_10044168 | 3300006195 | Bacteria | 2640 |
| 272 | Ga0075366_10084443 | 3300006195 | Bacteria | 1898 |
| 273 | Ga0075366_10142134 | 3300006195 | Bacteria | 1451 |
| 274 | Ga0097621_100000115 | 3300006237 | Bacteria | 45694 |
| 275 | Ga0097621_100031095 | 3300006237 | Bacteria | 4233 |
| 276 | Ga0097621_100052758 | 3300006237 | Bacteria | 3313 |
| 277 | Ga0075370_10019433 | 3300006353 | Bacteria | 3700 |
| 278 | Ga0075370_10020715 | 3300006353 | Bacteria | 3597 |
| 279 | Ga0075370_10049519 | 3300006353 | Bacteria | 2382 |
| 280 | Ga0075370_10055381 | 3300006353 | Bacteria | 2253 |
| 281 | Ga0075370_10058432 | 3300006353 | Bacteria | 2193 |
| 282 | Ga0075370_10062341 | 3300006353 | Bacteria | 2124 |
| 283 | Ga0075370_10072847 | 3300006353 | Bacteria | 1967 |
| 284 | Ga0068871_100000064 | 3300006358 | Bacteria | 58283 |
| 285 | Ga0068871_100031695 | 3300006358 | Bacteria | 4170 |
| 286 | Ga0068871_100082934 | 3300006358 | Bacteria | 2659 |
| 287 | Ga0068871_100183985 | 3300006358 | Bacteria | 1797 |
| 288 | Ga0075428_100001096 | 3300006844 | Bacteria | 28836 |
| 289 | Ga0075428_100019624 | 3300006844 | Bacteria | 7480 |
| 290 | Ga0075428_100140962 | 3300006844 | Bacteria | 2621 |
| 291 | Ga0075430_100016424 | 3300006846 | Bacteria | 6302 |
| 292 | Ga0075430_100328763 | 3300006846 | Bacteria | 1263 |
| 293 | Ga0075431_100002284 | 3300006847 | Bacteria | 18392 |
| 294 | Ga0075431_100006045 | 3300006847 | Bacteria | 12001 |
| 295 | Ga0075431_100057368 | 3300006847 | Bacteria | 4016 |
| 296 | Ga0075433_10286206 | 3300006852 | Bacteria | 1460 |
| 297 | Ga0075434_100011648 | 3300006871 | Bacteria | 8305 |
| 298 | Ga0075429_100016045 | 3300006880 | Bacteria | 6488 |
| 299 | Ga0075429_100040905 | 3300006880 | Bacteria | 4036 |
| 300 | Ga0068865_100000088 | 3300006881 | Bacteria | 48315 |
| 301 | Ga0068865_100107695 | 3300006881 | Bacteria | 2050 |
| 302 | Ga0068865_100141135 | 3300006881 | Bacteria | 1817 |
| 303 | Ga0097620_100000503 | 3300006931 | Bacteria | 38475 |
| 304 | Ga0097620_100128696 | 3300006931 | Bacteria | 2602 |
| 305 | Ga0097620_100168187 | 3300006931 | Bacteria | 2273 |
| 306 | Ga0097620_100425243 | 3300006931 | Bacteria | 1425 |
| 307 | Ga0099825_1026228 | 3300006941 | Bacteria | 3132 |
| 308 | Ga0099824_1015882 | 3300006942 | Bacteria | 6981 |
| 309 | Ga0099823_1016643 | 3300006944 | Bacteria | 7202 |
| 310 | Ga0079104_1005313 | 3300006946 | Bacteria | 5180 |
| 311 | Ga0079104_1029960 | 3300006946 | Bacteria | 1365 |
| 312 | Ga0099826_10001162 | 3300006948 | Bacteria | 15168 |
| 313 | Ga0099826_10055826 | 3300006948 | Bacteria | 2611 |
| 314 | Ga0075435_100018640 | 3300007076 | Bacteria | 5285 |
| 315 | Ga0105244_10027369 | 3300009036 | Bacteria | 3073 |
| 316 | Ga0105244_10041442 | 3300009036 | Bacteria | 2386 |
| 317 | Ga0105240_10000032 | 3300009093 | Bacteria | 283907 |
| 318 | Ga0105240_10087091 | 3300009093 | Bacteria | 3825 |
| 319 | Ga0111539_10000835 | 3300009094 | Bacteria | 40036 |
| 320 | Ga0111539_10001836 | 3300009094 | Bacteria | 28237 |
| 321 | Ga0111539_10002131 | 3300009094 | Bacteria | 26474 |
| 322 | Ga0111539_10043003 | 3300009094 | Bacteria | 5420 |
| 323 | Ga0111539_10240090 | 3300009094 | Bacteria | 2109 |
| 324 | Ga0111539_10344038 | 3300009094 | Bacteria | 1736 |
| 325 | Ga0105245_10000556 | 3300009098 | Bacteria | 33858 |
| 326 | Ga0105245_10001381 | 3300009098 | Bacteria | 21973 |
| 327 | Ga0105245_10042958 | 3300009098 | Bacteria | 4032 |
| 328 | Ga0105247_10000474 | 3300009101 | Bacteria | 33690 |
| 329 | Ga0105247_10008685 | 3300009101 | Bacteria | 6192 |
| 330 | Ga0105247_10010587 | 3300009101 | Bacteria | 5571 |
| 331 | Ga0105247_10036214 | 3300009101 | Bacteria | 3009 |
| 332 | Ga0105247_10140550 | 3300009101 | Bacteria | 1582 |
| 333 | Ga0114129_10005100 | 3300009147 | Bacteria | 18497 |
| 334 | Ga0114129_10023557 | 3300009147 | Bacteria | 8726 |
| 335 | Ga0114129_10041080 | 3300009147 | Bacteria | 6519 |
| 336 | Ga0114129_10116705 | 3300009147 | Bacteria | 3678 |
| 337 | Ga0114129_10135026 | 3300009147 | Bacteria | 3385 |
| 338 | Ga0105243_10002817 | 3300009148 | Bacteria | 14441 |
| 339 | Ga0105243_10003276 | 3300009148 | Bacteria | 13158 |
| 340 | Ga0105243_10059291 | 3300009148 | Bacteria | 3054 |
| 341 | Ga0105243_10111788 | 3300009148 | Bacteria | 2287 |
| 342 | Ga0105243_10129972 | 3300009148 | Bacteria | 2135 |
| 343 | Ga0105241_10013940 | 3300009174 | Bacteria | 5891 |
| 344 | Ga0105242_10006548 | 3300009176 | Bacteria | 8967 |
| 345 | Ga0105242_10010176 | 3300009176 | Bacteria | 7205 |
| 346 | Ga0105242_10136056 | 3300009176 | Bacteria | 2127 |
| 347 | Ga0105248_10000500 | 3300009177 | Bacteria | 44664 |
| 348 | Ga0105248_10000873 | 3300009177 | Bacteria | 33799 |
| 349 | Ga0105248_10005607 | 3300009177 | Bacteria | 13792 |
| 350 | Ga0105248_10053120 | 3300009177 | Bacteria | 4547 |
| 351 | Ga0105248_10064008 | 3300009177 | Bacteria | 4128 |
| 352 | Ga0105248_10376789 | 3300009177 | Bacteria | 1598 |
| 353 | Ga0105237_10000754 | 3300009545 | Bacteria | 44371 |
| 354 | Ga0105237_10012593 | 3300009545 | Bacteria | 8908 |
| 355 | Ga0105237_10053311 | 3300009545 | Bacteria | 4057 |
| 356 | Ga0105238_10063446 | 3300009551 | Bacteria | 3695 |
| 357 | Ga0105238_10076419 | 3300009551 | Bacteria | 3340 |
| 358 | Ga0105238_10079722 | 3300009551 | Bacteria | 3264 |
| 359 | Ga0105238_10095640 | 3300009551 | Bacteria | 2957 |
| 360 | Ga0105249_10002423 | 3300009553 | Bacteria | 16185 |
| 361 | Ga0123341_1003307 | 3300009765 | Bacteria | 13754 |
| 362 | Ga0123342_1012832 | 3300009766 | Bacteria | 8595 |
| 363 | Ga0123342_1023961 | 3300009766 | Bacteria | 3886 |
| 364 | Ga0099796_10029332 | 3300010159 | Bacteria | 1774 |
| 365 | Ga0105239_10003796 | 3300010375 | Bacteria | 18390 |
| 366 | Ga0105239_10295074 | 3300010375 | Bacteria | 1825 |
| 367 | Ga0105246_10000016 | 3300011119 | Bacteria | 65781 |
| 368 | Ga0105246_10000220 | 3300011119 | Bacteria | 29009 |
| 369 | Ga0105246_10058075 | 3300011119 | Bacteria | 2680 |
| 370 | Ga0157373_10001237 | 3300013100 | Bacteria | 19540 |
| 371 | Ga0157373_10042861 | 3300013100 | Bacteria | 3233 |
| 372 | Ga0157373_10132801 | 3300013100 | Bacteria | 1750 |
| 373 | Ga0157373_10168919 | 3300013100 | Bacteria | 1539 |
| 374 | Ga0157371_10000004 | 3300013102 | Bacteria | 512593 |
| 375 | Ga0157371_10015495 | 3300013102 | Bacteria | 5717 |
| 376 | Ga0157370_10003636 | 3300013104 | Bacteria | 18019 |
| 377 | Ga0157370_10234385 | 3300013104 | Bacteria | 1698 |
| 378 | Ga0157369_10073358 | 3300013105 | Bacteria | 3672 |
| 379 | Ga0157369_10102912 | 3300013105 | Bacteria | 3042 |
| 380 | Ga0171463_1003 | 3300013249 | Bacteria | 695693 |
| 381 | Ga0157374_10000092 | 3300013296 | Bacteria | 85738 |
| 382 | Ga0157374_10000524 | 3300013296 | Bacteria | 34473 |
| 383 | Ga0157374_10010385 | 3300013296 | Bacteria | 8009 |
| 384 | Ga0157374_10030091 | 3300013296 | Bacteria | 4927 |
| 385 | Ga0157374_10202455 | 3300013296 | Bacteria | 1944 |
| 386 | Ga0157378_10000591 | 3300013297 | Bacteria | 34042 |
| 387 | Ga0157378_10023177 | 3300013297 | Bacteria | 5464 |
| 388 | Ga0157378_10271419 | 3300013297 | Bacteria | 1631 |
| 389 | Ga0163162_10023568 | 3300013306 | Bacteria | 6076 |
| 390 | Ga0163162_10075105 | 3300013306 | Bacteria | 3440 |
| 391 | Ga0163162_10115386 | 3300013306 | Bacteria | 2785 |
| 392 | Ga0163162_10375085 | 3300013306 | Bacteria | 1556 |
| 393 | Ga0163162_10380472 | 3300013306 | Bacteria | 1545 |
| 394 | Ga0157372_10006371 | 3300013307 | Bacteria | 12555 |
| 395 | Ga0157372_10163959 | 3300013307 | Bacteria | 2569 |
| 396 | Ga0157372_10314045 | 3300013307 | Bacteria | 1824 |
| 397 | Ga0157372_10395714 | 3300013307 | Bacteria | 1610 |
| 398 | Ga0157375_10000124 | 3300013308 | Bacteria | 76003 |
| 399 | Ga0157375_10001668 | 3300013308 | Bacteria | 19088 |
| 400 | Ga0157375_10006444 | 3300013308 | Bacteria | 10223 |
| 401 | Ga0157375_10025162 | 3300013308 | Bacteria | 5523 |
| 402 | Ga0163163_10003404 | 3300014325 | Bacteria | 13509 |
| 403 | Ga0163163_10058876 | 3300014325 | Bacteria | 3798 |
| 404 | Ga0157380_10001027 | 3300014326 | Bacteria | 17807 |
| 405 | Ga0157380_10004466 | 3300014326 | Bacteria | 9691 |
| 406 | Ga0157380_10102839 | 3300014326 | Bacteria | 2383 |
| 407 | Ga0157380_10125337 | 3300014326 | Bacteria | 2182 |
| 408 | Ga0157380_10131629 | 3300014326 | Bacteria | 2135 |
| 409 | Ga0157380_10205409 | 3300014326 | Bacteria | 1751 |
| 410 | Ga0157380_10363411 | 3300014326 | Bacteria | 1359 |
| 411 | Ga0182008_10051736 | 3300014497 | Bacteria | 2037 |
| 412 | Ga0157377_10000121 | 3300014745 | Bacteria | 51192 |
| 413 | Ga0157379_10000422 | 3300014968 | Bacteria | 34158 |
| 414 | Ga0157379_10040122 | 3300014968 | Bacteria | 4177 |
| 415 | Ga0157379_10077910 | 3300014968 | Bacteria | 2968 |
| 416 | Ga0157376_10000034 | 3300014969 | Bacteria | 161526 |
| 417 | Ga0157376_10000285 | 3300014969 | Bacteria | 34194 |
| 418 | Ga0157376_10409954 | 3300014969 | Bacteria | 1312 |
| 419 | Ga0182006_1015445 | 3300015261 | Bacteria | 3273 |
| 420 | Ga0182007_10062860 | 3300015262 | Bacteria | 1217 |
| 421 | Ga0182005_1004008 | 3300015265 | Bacteria | 4843 |
| 422 | Ga0183363_1047 | 3300015690 | Bacteria | 39413 |
| 423 | Ga0163161_10000801 | 3300017792 | Bacteria | 24605 |
| 424 | Ga0163161_10107639 | 3300017792 | Bacteria | 2081 |
| 425 | Ga0214544_1001682 | 3300021320 | Bacteria | 46508 |
| 426 | Ga0214542_1001614 | 3300021321 | Bacteria | 46380 |
| 427 | Ga0214542_1028780 | 3300021321 | Bacteria | 2357 |
| 428 | Ga0214543_1000078 | 3300021327 | Bacteria | 119775 |
| 429 | Ga0214543_1001395 | 3300021327 | Bacteria | 46435 |
| 430 | Ga0228711_1000016 | 3300022739 | Bacteria | 126351 |
| 431 | Ga0228710_1000013 | 3300022740 | Bacteria | 145976 |
| 432 | Ga0209436_100041 | 3300025208 | Bacteria | 74018 |
| 433 | Ga0209436_101133 | 3300025208 | Bacteria | 9873 |
| 434 | Ga0209437_100075 | 3300025233 | Bacteria | 297202 |
| 435 | Ga0207425_1008603 | 3300025245 | Bacteria | 2597 |
| 436 | Ga0209026_1000050 | 3300025250 | Bacteria | 254994 |
| 437 | Ga0209148_1000032 | 3300025254 | Bacteria | 557660 |
| 438 | Ga0209148_1000289 | 3300025254 | Bacteria | 75390 |
| 439 | Ga0209759_1015261 | 3300025256 | Bacteria | 1988 |
| 440 | Ga0209129_1001627 | 3300025258 | Bacteria | 12185 |
| 441 | Ga0209129_1003249 | 3300025258 | Bacteria | 7219 |
| 442 | Ga0209129_1006654 | 3300025258 | Bacteria | 3668 |
| 443 | Ga0209233_1000034 | 3300025261 | Bacteria | 578898 |
| 444 | Ga0209233_1000056 | 3300025261 | Bacteria | 438104 |
| 445 | Ga0209233_1002652 | 3300025261 | Bacteria | 6482 |
| 446 | Ga0207666_1000004 | 3300025271 | Bacteria | 56747 |
| 447 | Ga0209455_1000190 | 3300025272 | Bacteria | 92473 |
| 448 | Ga0209455_1001308 | 3300025272 | Bacteria | 11563 |
| 449 | Ga0209673_1000060 | 3300025273 | Bacteria | 263602 |
| 450 | Ga0209673_1004110 | 3300025273 | Bacteria | 7994 |
| 451 | Ga0209673_1011460 | 3300025273 | Bacteria | 3654 |
| 452 | Ga0209673_1017145 | 3300025273 | Bacteria | 2677 |
| 453 | Ga0209130_1000018 | 3300025284 | Bacteria | 388301 |
| 454 | Ga0209130_1000029 | 3300025284 | Bacteria | 323399 |
| 455 | Ga0209130_1000030 | 3300025284 | Bacteria | 323323 |
| 456 | Ga0207673_1000326 | 3300025290 | Bacteria | 4777 |
| 457 | Ga0209676_1000100 | 3300025292 | Bacteria | 229621 |
| 458 | Ga0209676_1002997 | 3300025292 | Bacteria | 10988 |
| 459 | Ga0209676_1031133 | 3300025292 | Bacteria | 1622 |
| 460 | Ga0209676_1038379 | 3300025292 | Bacteria | 1372 |
| 461 | Ga0209025_1000060 | 3300025294 | Bacteria | 305017 |
| 462 | Ga0209025_1000959 | 3300025294 | Bacteria | 43491 |
| 463 | Ga0209025_1001184 | 3300025294 | Bacteria | 36925 |
| 464 | Ga0209025_1023046 | 3300025294 | Bacteria | 3275 |
| 465 | Ga0209564_1000278 | 3300025295 | Bacteria | 105405 |
| 466 | Ga0209564_1000281 | 3300025295 | Bacteria | 104019 |
| 467 | Ga0209564_1000937 | 3300025295 | Bacteria | 37831 |
| 468 | Ga0209564_1001052 | 3300025295 | Bacteria | 33676 |
| 469 | Ga0209564_1004532 | 3300025295 | Bacteria | 8443 |
| 470 | Ga0209564_1017395 | 3300025295 | Bacteria | 2804 |
| 471 | Ga0209564_1033434 | 3300025295 | Bacteria | 1528 |
| 472 | Ga0209758_1000160 | 3300025297 | Bacteria | 154304 |
| 473 | Ga0209758_1000219 | 3300025297 | Bacteria | 124186 |
| 474 | Ga0209758_1000383 | 3300025297 | Bacteria | 76487 |
| 475 | Ga0209758_1000637 | 3300025297 | Bacteria | 53635 |
| 476 | Ga0209758_1000677 | 3300025297 | Bacteria | 50824 |
| 477 | Ga0209758_1001377 | 3300025297 | Bacteria | 29000 |
| 478 | Ga0209758_1009047 | 3300025297 | Bacteria | 6286 |
| 479 | Ga0209758_1009123 | 3300025297 | Bacteria | 6251 |
| 480 | Ga0209758_1012378 | 3300025297 | Bacteria | 4782 |
| 481 | Ga0209050_1006153 | 3300025298 | Bacteria | 7222 |
| 482 | Ga0209050_1009722 | 3300025298 | Bacteria | 4872 |
| 483 | Ga0209050_1019463 | 3300025298 | Bacteria | 2576 |
| 484 | Ga0209256_1000042 | 3300025299 | Bacteria | 341821 |
| 485 | Ga0209256_1001295 | 3300025299 | Bacteria | 26989 |
| 486 | Ga0209256_1002288 | 3300025299 | Bacteria | 16138 |
| 487 | Ga0209256_1002941 | 3300025299 | Bacteria | 12786 |
| 488 | Ga0209256_1003739 | 3300025299 | Bacteria | 10296 |
| 489 | Ga0209256_1009106 | 3300025299 | Bacteria | 4424 |
| 490 | Ga0209256_1024299 | 3300025299 | Bacteria | 1787 |
| 491 | Ga0207426_1000044 | 3300025302 | Bacteria | 428043 |
| 492 | Ga0207426_1000047 | 3300025302 | Bacteria | 417011 |
| 493 | Ga0207426_1000074 | 3300025302 | Bacteria | 323399 |
| 494 | Ga0207426_1000268 | 3300025302 | Bacteria | 109321 |
| 495 | Ga0207426_1000379 | 3300025302 | Bacteria | 76587 |
| 496 | Ga0207426_1000465 | 3300025302 | Bacteria | 62583 |
| 497 | Ga0207426_1003500 | 3300025302 | Bacteria | 8458 |
| 498 | Ga0207426_1016971 | 3300025302 | Bacteria | 2599 |
| 499 | Ga0209051_1000236 | 3300025303 | Bacteria | 92738 |
| 500 | Ga0209051_1003666 | 3300025303 | Bacteria | 9938 |
| 501 | Ga0209051_1004392 | 3300025303 | Bacteria | 8719 |
| 502 | Ga0209051_1008481 | 3300025303 | Bacteria | 5430 |
| 503 | Ga0209051_1008829 | 3300025303 | Bacteria | 5276 |
| 504 | Ga0209051_1012789 | 3300025303 | Bacteria | 4038 |
| 505 | Ga0209257_1000650 | 3300025304 | Bacteria | 55188 |
| 506 | Ga0209257_1002011 | 3300025304 | Bacteria | 21749 |
| 507 | Ga0209257_1002210 | 3300025304 | Bacteria | 20082 |
| 508 | Ga0209257_1005286 | 3300025304 | Bacteria | 9197 |
| 509 | Ga0209257_1029619 | 3300025304 | Bacteria | 1780 |
| 510 | Ga0207653_10001908 | 3300025885 | Bacteria | 6674 |
| 511 | Ga0207682_10000016 | 3300025893 | Bacteria | 78971 |
| 512 | Ga0207692_10013299 | 3300025898 | Bacteria | 3566 |
| 513 | Ga0207642_10000976 | 3300025899 | Bacteria | 8924 |
| 514 | Ga0207642_10078028 | 3300025899 | Bacteria | 1599 |
| 515 | Ga0207710_10001396 | 3300025900 | Bacteria | 12097 |
| 516 | Ga0207710_10001528 | 3300025900 | Bacteria | 11432 |
| 517 | Ga0207710_10003942 | 3300025900 | Bacteria | 6545 |
| 518 | Ga0207710_10009728 | 3300025900 | Bacteria | 4041 |
| 519 | Ga0207710_10026449 | 3300025900 | Bacteria | 2508 |
| 520 | Ga0207688_10002050 | 3300025901 | Bacteria | 10826 |
| 521 | Ga0207688_10064625 | 3300025901 | Bacteria | 2067 |
| 522 | Ga0207680_10002179 | 3300025903 | Bacteria | 9176 |
| 523 | Ga0207680_10059119 | 3300025903 | Bacteria | 2327 |
| 524 | Ga0207680_10135217 | 3300025903 | Bacteria | 1629 |
| 525 | Ga0207680_10219750 | 3300025903 | Bacteria | 1302 |
| 526 | Ga0207647_10003692 | 3300025904 | Bacteria | 11441 |
| 527 | Ga0207647_10059232 | 3300025904 | Bacteria | 2344 |
| 528 | Ga0207685_10083900 | 3300025905 | Bacteria | 1325 |
| 529 | Ga0207645_10001535 | 3300025907 | Bacteria | 18877 |
| 530 | Ga0207643_10000075 | 3300025908 | Bacteria | 64981 |
| 531 | Ga0207643_10085289 | 3300025908 | Bacteria | 1834 |
| 532 | Ga0207684_10099451 | 3300025910 | Bacteria | 2484 |
| 533 | Ga0207654_10006201 | 3300025911 | Bacteria | 6008 |
| 534 | Ga0207707_10003863 | 3300025912 | Bacteria | 13286 |
| 535 | Ga0207707_10153787 | 3300025912 | Bacteria | 2011 |
| 536 | Ga0207695_10000024 | 3300025913 | Bacteria | 632311 |
| 537 | Ga0207695_10009034 | 3300025913 | Bacteria | 12390 |
| 538 | Ga0207695_10146083 | 3300025913 | Bacteria | 2309 |
| 539 | Ga0207695_10196807 | 3300025913 | Bacteria | 1931 |
| 540 | Ga0207671_10000718 | 3300025914 | Bacteria | 42274 |
| 541 | Ga0207671_10009593 | 3300025914 | Bacteria | 8069 |
| 542 | Ga0207671_10116073 | 3300025914 | Bacteria | 2042 |
| 543 | Ga0207693_10046639 | 3300025915 | Bacteria | 3404 |
| 544 | Ga0207663_10112324 | 3300025916 | Bacteria | 1851 |
| 545 | Ga0207660_10000023 | 3300025917 | Bacteria | 71712 |
| 546 | Ga0207660_10103923 | 3300025917 | Bacteria | 2126 |
| 547 | Ga0207662_10001681 | 3300025918 | Bacteria | 10824 |
| 548 | Ga0207662_10029205 | 3300025918 | Bacteria | 3193 |
| 549 | Ga0207657_10001755 | 3300025919 | Bacteria | 23396 |
| 550 | Ga0207657_10073027 | 3300025919 | Bacteria | 2901 |
| 551 | Ga0207657_10114168 | 3300025919 | Bacteria | 2228 |
| 552 | Ga0207657_10217966 | 3300025919 | Bacteria | 1530 |
| 553 | Ga0207649_10000122 | 3300025920 | Bacteria | 65841 |
| 554 | Ga0207649_10015177 | 3300025920 | Bacteria | 4326 |
| 555 | Ga0207652_10001146 | 3300025921 | Bacteria | 23846 |
| 556 | Ga0207681_10000240 | 3300025923 | Bacteria | 42226 |
| 557 | Ga0207681_10049729 | 3300025923 | Bacteria | 2835 |
| 558 | Ga0207681_10076472 | 3300025923 | Bacteria | 2351 |
| 559 | Ga0207681_10195542 | 3300025923 | Bacteria | 1550 |
| 560 | Ga0207694_10020011 | 3300025924 | Bacteria | 5062 |
| 561 | Ga0207650_10012941 | 3300025925 | Bacteria | 5768 |
| 562 | Ga0207650_10088443 | 3300025925 | Bacteria | 2362 |
| 563 | Ga0207659_10000017 | 3300025926 | Bacteria | 159908 |
| 564 | Ga0207659_10085461 | 3300025926 | Bacteria | 2344 |
| 565 | Ga0207659_10094800 | 3300025926 | Bacteria | 2237 |
| 566 | Ga0207659_10096989 | 3300025926 | Bacteria | 2214 |
| 567 | Ga0207687_10000077 | 3300025927 | Bacteria | 71218 |
| 568 | Ga0207687_10001492 | 3300025927 | Bacteria | 16025 |
| 569 | Ga0207687_10211238 | 3300025927 | Bacteria | 1523 |
| 570 | Ga0207700_10046442 | 3300025928 | Bacteria | 3211 |
| 571 | Ga0207700_10148027 | 3300025928 | Bacteria | 1938 |
| 572 | Ga0207664_10045678 | 3300025929 | Bacteria | 3435 |
| 573 | Ga0207644_10001298 | 3300025931 | Bacteria | 16078 |
| 574 | Ga0207644_10003716 | 3300025931 | Bacteria | 9888 |
| 575 | Ga0207644_10027349 | 3300025931 | Bacteria | 3940 |
| 576 | Ga0207644_10106786 | 3300025931 | Bacteria | 2111 |
| 577 | Ga0207644_10263806 | 3300025931 | Bacteria | 1378 |
| 578 | Ga0207644_10371701 | 3300025931 | Bacteria | 1165 |
| 579 | Ga0207690_10000151 | 3300025932 | Bacteria | 54897 |
| 580 | Ga0207706_10005479 | 3300025933 | Bacteria | 11832 |
| 581 | Ga0207706_10010327 | 3300025933 | Bacteria | 8534 |
| 582 | Ga0207706_10354838 | 3300025933 | Bacteria | 1275 |
| 583 | Ga0207706_10354839 | 3300025933 | Bacteria | 1275 |
| 584 | Ga0207686_10000294 | 3300025934 | Bacteria | 36711 |
| 585 | Ga0207686_10017811 | 3300025934 | Bacteria | 4009 |
| 586 | Ga0207686_10031259 | 3300025934 | Bacteria | 3159 |
| 587 | Ga0207709_10000126 | 3300025935 | Bacteria | 114049 |
| 588 | Ga0207709_10045603 | 3300025935 | Bacteria | 2656 |
| 589 | Ga0207709_10060946 | 3300025935 | Bacteria | 2355 |
| 590 | Ga0207709_10090300 | 3300025935 | Bacteria | 2000 |
| 591 | Ga0207709_10097350 | 3300025935 | Bacteria | 1937 |
| 592 | Ga0207709_10114962 | 3300025935 | Bacteria | 1807 |
| 593 | Ga0207670_10000086 | 3300025936 | Bacteria | 63570 |
| 594 | Ga0207670_10080693 | 3300025936 | Bacteria | 2275 |
| 595 | Ga0207669_10000188 | 3300025937 | Bacteria | 28047 |
| 596 | Ga0207669_10014695 | 3300025937 | Bacteria | 3930 |
| 597 | Ga0207669_10026710 | 3300025937 | Bacteria | 3146 |
| 598 | Ga0207669_10156474 | 3300025937 | Bacteria | 1604 |
| 599 | Ga0207669_10207167 | 3300025937 | Bacteria | 1428 |
| 600 | Ga0207704_10001793 | 3300025938 | Bacteria | 9624 |
| 601 | Ga0207665_10268951 | 3300025939 | Bacteria | 1265 |
| 602 | Ga0207691_10007063 | 3300025940 | Bacteria | 10834 |
| 603 | Ga0207691_10016974 | 3300025940 | Bacteria | 6909 |
| 604 | Ga0207691_10183906 | 3300025940 | Bacteria | 1825 |
| 605 | Ga0207711_10004478 | 3300025941 | Bacteria | 11909 |
| 606 | Ga0207711_10005965 | 3300025941 | Bacteria | 10298 |
| 607 | Ga0207711_10039484 | 3300025941 | Bacteria | 4016 |
| 608 | Ga0207711_10316023 | 3300025941 | Bacteria | 1442 |
| 609 | Ga0207689_10000140 | 3300025942 | Bacteria | 62258 |
| 610 | Ga0207689_10047161 | 3300025942 | Bacteria | 3559 |
| 611 | Ga0207689_10109566 | 3300025942 | Bacteria | 2269 |
| 612 | Ga0207661_10000074 | 3300025944 | Bacteria | 68047 |
| 613 | Ga0207661_10130409 | 3300025944 | Bacteria | 2152 |
| 614 | Ga0207679_10000031 | 3300025945 | Bacteria | 165962 |
| 615 | Ga0207679_10031984 | 3300025945 | Bacteria | 3688 |
| 616 | Ga0207679_10221628 | 3300025945 | Bacteria | 1591 |
| 617 | Ga0207667_10013359 | 3300025949 | Bacteria | 9400 |
| 618 | Ga0207667_10045333 | 3300025949 | Bacteria | 4658 |
| 619 | Ga0207667_10232803 | 3300025949 | Bacteria | 1886 |
| 620 | Ga0207651_10000044 | 3300025960 | Bacteria | 58072 |
| 621 | Ga0207651_10061639 | 3300025960 | Bacteria | 2610 |
| 622 | Ga0207712_10000279 | 3300025961 | Bacteria | 48635 |
| 623 | Ga0207712_10038823 | 3300025961 | Bacteria | 3258 |
| 624 | Ga0207668_10000687 | 3300025972 | Bacteria | 20761 |
| 625 | Ga0207668_10092184 | 3300025972 | Bacteria | 2229 |
| 626 | Ga0207640_10000105 | 3300025981 | Bacteria | 64812 |
| 627 | Ga0207640_10000216 | 3300025981 | Bacteria | 40557 |
| 628 | Ga0207658_10001907 | 3300025986 | Bacteria | 15607 |
| 629 | Ga0207658_10039014 | 3300025986 | Bacteria | 3425 |
| 630 | Ga0207677_10000318 | 3300026023 | Bacteria | 35197 |
| 631 | Ga0207703_10000418 | 3300026035 | Bacteria | 45072 |
| 632 | Ga0207703_10006276 | 3300026035 | Bacteria | 9506 |
| 633 | Ga0207703_10035176 | 3300026035 | Bacteria | 3980 |
| 634 | Ga0207703_10374259 | 3300026035 | Bacteria | 1316 |
| 635 | Ga0207639_10007495 | 3300026041 | Bacteria | 7445 |
| 636 | Ga0207639_10246028 | 3300026041 | Bacteria | 1557 |
| 637 | Ga0207639_10264405 | 3300026041 | Bacteria | 1506 |
| 638 | Ga0207639_10278625 | 3300026041 | Bacteria | 1470 |
| 639 | Ga0207678_10005986 | 3300026067 | Bacteria | 10821 |
| 640 | Ga0207678_10007246 | 3300026067 | Bacteria | 9837 |
| 641 | Ga0207678_10008184 | 3300026067 | Bacteria | 9222 |
| 642 | Ga0207678_10014870 | 3300026067 | Bacteria | 6845 |
| 643 | Ga0207678_10033040 | 3300026067 | Bacteria | 4508 |
| 644 | Ga0207678_10087729 | 3300026067 | Bacteria | 2659 |
| 645 | Ga0207708_10004013 | 3300026075 | Bacteria | 10826 |
| 646 | Ga0207702_10000753 | 3300026078 | Bacteria | 34590 |
| 647 | Ga0207702_10081034 | 3300026078 | Bacteria | 2818 |
| 648 | Ga0207702_10159139 | 3300026078 | Bacteria | 2061 |
| 649 | Ga0207641_10001634 | 3300026088 | Bacteria | 21851 |
| 650 | Ga0207641_10068519 | 3300026088 | Bacteria | 3043 |
| 651 | Ga0207641_10423619 | 3300026088 | Bacteria | 1282 |
| 652 | Ga0207648_10007377 | 3300026089 | Bacteria | 10826 |
| 653 | Ga0207648_10056668 | 3300026089 | Bacteria | 3419 |
| 654 | Ga0207648_10161442 | 3300026089 | Bacteria | 1979 |
| 655 | Ga0207676_10000133 | 3300026095 | Bacteria | 65766 |
| 656 | Ga0207676_10015457 | 3300026095 | Bacteria | 5506 |
| 657 | Ga0207676_10078003 | 3300026095 | Bacteria | 2681 |
| 658 | Ga0207674_10001514 | 3300026116 | Bacteria | 29977 |
| 659 | Ga0207674_10037910 | 3300026116 | Bacteria | 5008 |
| 660 | Ga0207674_10066374 | 3300026116 | Bacteria | 3634 |
| 661 | Ga0207674_10083784 | 3300026116 | Bacteria | 3187 |
| 662 | Ga0207674_10428761 | 3300026116 | Bacteria | 1278 |
| 663 | Ga0207675_100011837 | 3300026118 | Bacteria | 8155 |
| 664 | Ga0207675_100152444 | 3300026118 | Bacteria | 2201 |
| 665 | Ga0207675_100252407 | 3300026118 | Bacteria | 1707 |
| 666 | Ga0207683_10000004 | 3300026121 | Bacteria | 188086 |
| 667 | Ga0207683_10003094 | 3300026121 | Bacteria | 14533 |
| 668 | Ga0207683_10035832 | 3300026121 | Bacteria | 4316 |
| 669 | Ga0207698_10009206 | 3300026142 | Bacteria | 6283 |
| 670 | Ga0209281_1000043 | 3300027111 | Bacteria | 341543 |
| 671 | Ga0209281_1000221 | 3300027111 | Bacteria | 122380 |
| 672 | Ga0209281_1000453 | 3300027111 | Bacteria | 58584 |
| 673 | Ga0209389_1000008 | 3300027296 | Bacteria | 227385 |
| 674 | Ga0209389_1000081 | 3300027296 | Bacteria | 89601 |
| 675 | Ga0209371_1000009 | 3300027312 | Bacteria | 963030 |
| 676 | Ga0209371_1000732 | 3300027312 | Bacteria | 27595 |
| 677 | Ga0209371_1001249 | 3300027312 | Bacteria | 18174 |
| 678 | Ga0209371_1002043 | 3300027312 | Bacteria | 12066 |
| 679 | Ga0209589_1000091 | 3300027357 | Bacteria | 89601 |
| 680 | Ga0209489_100096 | 3300027361 | Bacteria | 122075 |
| 681 | Ga0209489_103917 | 3300027361 | Bacteria | 28294 |
| 682 | Ga0209700_100036 | 3300027363 | Bacteria | 187888 |
| 683 | Ga0209282_1000041 | 3300027666 | Bacteria | 122268 |
| 684 | Ga0209282_1000179 | 3300027666 | Bacteria | 34839 |
| 685 | Ga0209282_1070112 | 3300027666 | Bacteria | 1913 |
| 686 | Ga0209998_10000939 | 3300027717 | Bacteria | 7414 |
| 687 | Ga0209813_10001432 | 3300027866 | Bacteria | 5390 |
| 688 | Ga0209813_10006967 | 3300027866 | Bacteria | 2806 |
| 689 | Ga0209974_10005431 | 3300027876 | Bacteria | 4482 |
| 690 | Ga0207428_10000218 | 3300027907 | Bacteria | 79728 |
| 691 | Ga0207428_10002942 | 3300027907 | Bacteria | 16869 |
| 692 | Ga0268266_10001063 | 3300028379 | Bacteria | 34421 |
| 693 | Ga0268266_10005424 | 3300028379 | Bacteria | 11894 |
| 694 | Ga0268266_10120870 | 3300028379 | Bacteria | 2331 |
| 695 | Ga0268266_10122747 | 3300028379 | Bacteria | 2313 |
| 696 | Ga0268265_10000194 | 3300028380 | Bacteria | 70928 |
| 697 | Ga0268265_10168309 | 3300028380 | Bacteria | 1870 |
| 698 | Ga0268264_10000393 | 3300028381 | Bacteria | 63015 |
| 699 | Ga0268264_10089016 | 3300028381 | Bacteria | 2658 |
| 700 | Ga0307515_10000023 | 3300028794 | Bacteria | 400846 |
| 701 | Ga0268256_1000010 | 3300030500 | Bacteria | 963034 |
| 702 | Ga0268256_1000660 | 3300030500 | Bacteria | 26255 |
| 703 | Ga0268256_1012387 | 3300030500 | Bacteria | 2638 |
| 704 | Ga0265320_10001570 | 3300031240 | Bacteria | 16415 |
| 705 | Ga0265325_10020399 | 3300031241 | Bacteria | 3654 |
| 706 | Ga0265340_10018115 | 3300031247 | Bacteria | 3636 |
| 707 | Ga0265316_10226754 | 3300031344 | Bacteria | 1377 |
| 708 | Ga0307513_10003030 | 3300031456 | Bacteria | 22903 |
| 709 | Ga0307513_10117119 | 3300031456 | Bacteria | 2642 |
| 710 | Ga0307508_10000235 | 3300031616 | Bacteria | 67350 |
| 711 | Ga0265314_10015333 | 3300031711 | Bacteria | 6085 |
| 712 | Ga0265342_10019097 | 3300031712 | Bacteria | 4423 |
| 713 | Ga0316578_10012241 | 3300031728 | Bacteria | 4520 |
| 714 | Ga0307516_10076539 | 3300031730 | Bacteria | 3198 |
| 715 | Ga0307412_10004217 | 3300031911 | Bacteria | 8016 |
| 716 | Ga0307412_10051473 | 3300031911 | Bacteria | 2722 |
| 717 | Ga0307412_10096618 | 3300031911 | Bacteria | 2080 |
| 718 | Ga0315914_1000030 | 3300031967 | Bacteria | 102599 |
| 719 | Ga0307409_100079130 | 3300031995 | Bacteria | 2648 |
| 720 | Ga0307414_10335036 | 3300032004 | Bacteria | 1293 |
| 721 | Ga0307415_100162107 | 3300032126 | Bacteria | 1734 |
| 722 | Ga0307510_10051197 | 3300033180 | Bacteria | 4370 |
| 723 | Ga0307510_10166871 | 3300033180 | Bacteria | 1787 |
| 724 | Ga0315913_1000017 | 3300033430 | Bacteria | 102835 |
| 725 | Ga0315915_1000017 | 3300033464 | Bacteria | 148111 |
| 726 | Ga0373926_0044621 | 3300035083 | Bacteria | 1588 |
| 727 | Ga0373951_0006498 | 3300035091 | Bacteria | 2674 |
| 728 | Ga0373952_0005697 | 3300035092 | Bacteria | 2282 |
| 729 | Ga0373932_0006740 | 3300035112 | Bacteria | 2723 |
| 730 | Ga0373939_0001147 | 3300035114 | Bacteria | 6475 |
| 731 | Ga0373941_0004127 | 3300035115 | Bacteria | 3334 |
| 732 | Ga0373945_0023874 | 3300035116 | Bacteria | 2115 |
| 733 | Ga0373960_0002301 | 3300035121 | Bacteria | 4300 |
| 734 | Ga0373942_0004747 | 3300035207 | Bacteria | 3155 |
| 735 | Ga0373961_0006340 | 3300035241 | Bacteria | 2844 |
| 736 | Ga0373962_0006222 | 3300035242 | Bacteria | 2887 |
| 737 | Ga0316574_0000447 | 3300035398 | Bacteria | 16491 |
| 738 | Ga0373931_0000034 | 3300035691 | Bacteria | 86665 |
| 739 | Ga0373931_0106047 | 3300035691 | Bacteria | 1588 |
| 740 | Ga0373935_0044469 | 3300035692 | Bacteria | 2798 |
| 741 | Ga0373927_0198628 | 3300035695 | Bacteria | 1316 |
| 742 | Ga0373947_0080704 | 3300035725 | Bacteria | 2013 |
| 743 | Ga0373947_0094196 | 3300035725 | Bacteria | 1872 |
| 744 | Ga0373925_0078900 | 3300037068 | Bacteria | 2500 |
| 745 | Ga0395899_0005212 | 3300037312 | Bacteria | 10109 |
| 746 | Ga0395899_0014217 | 3300037312 | Bacteria | 6074 |
| 747 | Ga0395900_0006809 | 3300037418 | Bacteria | 11854 |
| 748 | Ga0395900_0009382 | 3300037418 | Bacteria | 10032 |
| 749 | Ga0395900_0028204 | 3300037418 | Bacteria | 5750 |
| 750 | Ga0395900_0061357 | 3300037418 | Bacteria | 3865 |
| 751 | Ga0395900_0064342 | 3300037418 | Bacteria | 3769 |
| 752 | Ga0395900_0119882 | 3300037418 | Bacteria | 2700 |
| 753 | Ga0395898_0031310 | 3300037466 | Bacteria | 5317 |
| 754 | Ga0395898_0079159 | 3300037466 | Bacteria | 3170 |
| 755 | Ga0395905_0012635 | 3300037471 | Bacteria | 8123 |
| 756 | Ga0395905_0044671 | 3300037471 | Bacteria | 4157 |
| 757 | Ga0395905_0185194 | 3300037471 | Bacteria | 1954 |
| 758 | Ga0395905_0245905 | 3300037471 | Bacteria | 1671 |
| 759 | Ga0395901_0014741 | 3300038443 | Bacteria | 7946 |
| 760 | Ga0395901_0019762 | 3300038443 | Bacteria | 6888 |
| 761 | Ga0395901_0034031 | 3300038443 | Bacteria | 5261 |
| 762 | Ga0395901_0048672 | 3300038443 | Bacteria | 4402 |
| 763 | Ga0395901_0107512 | 3300038443 | Bacteria | 2928 |
| 764 | Ga0395901_0244469 | 3300038443 | Bacteria | 1871 |
| 765 | Ga0436365_0226566 | 3300039437 | Bacteria | 1228 |
| 766 | Ga0436360_0428998 | 3300039438 | Bacteria | 19607 |
| 767 | Ga0439439_0029670 | 3300041406 | Bacteria | 1388 |
| 768 | Ga0439465_0010381 | 3300041413 | Bacteria | 2926 |
| 769 | Ga0451840_11510 | 3300041497 | Bacteria | 1202 |
| 770 | Ga0451846_53461 | 3300041502 | Bacteria | 1961 |
| 771 | Ga0451849_0343204 | 3300041505 | Bacteria | 2254 |
| 772 | Ga0451854_38034 | 3300041510 | Bacteria | 1481 |
| 773 | Ga0452268_28007 | 3300041907 | Bacteria | 1563 |
| 774 | Ga0466972_0000142 | 3300044658 | Bacteria | 58711 |
| 775 | Ga0466965_0041923 | 3300044683 | Bacteria | 2256 |
| 776 | Ga0466966_0000743 | 3300044684 | Bacteria | 20686 |
| 777 | Ga0466961_0000013 | 3300044693 | Bacteria | 129640 |
| 778 | Ga0451576_0000108 | 3300045051 | Bacteria | 211233 |
| 779 | Ga0466967_0223783 | 3300045976 | Bacteria | 1789 |
| 780 | Ga0495617_038070 | 3300046452 | Bacteria | 1610 |
| 781 | Ga0495592_0026735 | 3300046454 | Bacteria | 4374 |
| 782 | Ga0495592_0035379 | 3300046454 | Bacteria | 3764 |
| 783 | Ga0495629_0010621 | 3300046459 | Bacteria | 6698 |
| 784 | Ga0495638_0000398 | 3300046460 | Bacteria | 53469 |
| 785 | Ga0495638_0000984 | 3300046460 | Bacteria | 28644 |
| 786 | Ga0495651_0001455 | 3300046462 | Bacteria | 18340 |
| 787 | Ga0495651_0041355 | 3300046462 | Bacteria | 3581 |
| 788 | Ga0495653_0054937 | 3300046463 | Bacteria | 3041 |
| 789 | Ga0495580_0038736 | 3300046472 | Bacteria | 3413 |
| 790 | Ga0495605_0027289 | 3300046474 | Bacteria | 2959 |
| 791 | Ga0495605_0061921 | 3300046474 | Bacteria | 1789 |
| 792 | Ga0495639_0090084 | 3300046475 | Bacteria | 1438 |
| 793 | Ga0495662_0023492 | 3300046476 | Bacteria | 2977 |
| 794 | Ga0495584_0038495 | 3300046491 | Bacteria | 2417 |
| 795 | Ga0495584_0066931 | 3300046491 | Bacteria | 1807 |
| 796 | Ga0495585_0008429 | 3300046492 | Bacteria | 6248 |
| 797 | Ga0495594_0053341 | 3300046499 | Bacteria | 2227 |
| 798 | Ga0495594_0189411 | 3300046499 | Bacteria | 1172 |
| 799 | Ga0495596_0031129 | 3300046500 | Bacteria | 2133 |
| 800 | Ga0495607_0031344 | 3300046501 | Bacteria | 3255 |
| 801 | Ga0495607_0120054 | 3300046501 | Bacteria | 1381 |
| 802 | Ga0495583_0033212 | 3300046506 | Bacteria | 2482 |
| 803 | Ga0495583_0043839 | 3300046506 | Bacteria | 2081 |
| 804 | Ga0495608_0060068 | 3300046511 | Bacteria | 2503 |
| 805 | Ga0495608_0064835 | 3300046511 | Bacteria | 2394 |
| 806 | Ga0495610_0005846 | 3300046512 | Bacteria | 8641 |
| 807 | Ga0495610_0033707 | 3300046512 | Bacteria | 2644 |
| 808 | Ga0495616_0019931 | 3300046513 | Bacteria | 3654 |
| 809 | Ga0495618_0090406 | 3300046514 | Bacteria | 1958 |
| 810 | Ga0495620_0005040 | 3300046515 | Bacteria | 7401 |
| 811 | Ga0495620_0050099 | 3300046515 | Bacteria | 1783 |
| 812 | Ga0495628_0012367 | 3300046516 | Bacteria | 7196 |
| 813 | Ga0495628_0064312 | 3300046516 | Bacteria | 2872 |
| 814 | Ga0495631_0002044 | 3300046518 | Bacteria | 11750 |
| 815 | Ga0495632_0014778 | 3300046519 | Bacteria | 4404 |
| 816 | Ga0495632_0025306 | 3300046519 | Bacteria | 3141 |
| 817 | Ga0495643_0034038 | 3300046522 | Bacteria | 2813 |
| 818 | Ga0495648_0023485 | 3300046524 | Bacteria | 4222 |
| 819 | Ga0495654_0012329 | 3300046530 | Bacteria | 4594 |
| 820 | Ga0495654_0042125 | 3300046530 | Bacteria | 2268 |
| 821 | Ga0495665_0093167 | 3300046531 | Bacteria | 1583 |
| 822 | Ga0495640_0081289 | 3300046533 | Bacteria | 2154 |
| 823 | Ga0495587_0054702 | 3300046536 | Bacteria | 2352 |
| 824 | Ga0495598_0010805 | 3300046537 | Bacteria | 2197 |
| 825 | Ga0495609_0035152 | 3300046538 | Bacteria | 2269 |
| 826 | Ga0495597_0034925 | 3300046542 | Bacteria | 2270 |
| 827 | Ga0495645_0006446 | 3300046543 | Bacteria | 8142 |
| 828 | Ga0495667_0178930 | 3300046559 | Bacteria | 1361 |
| 829 | Ga0495668_0006092 | 3300046616 | Bacteria | 7985 |
| 830 | Ga0495668_0093064 | 3300046616 | Bacteria | 1651 |
| 831 | Ga0495668_0151443 | 3300046616 | Bacteria | 1270 |
| 832 | Ga0495625_0005382 | 3300046660 | Bacteria | 11709 |
| 833 | Ga0495625_0006283 | 3300046660 | Bacteria | 10626 |
| 834 | Ga0495625_0132238 | 3300046660 | Bacteria | 1689 |
| 835 | Ga0495635_0008179 | 3300046663 | Bacteria | 7304 |
| 836 | Ga0495659_0009205 | 3300046664 | Bacteria | 3149 |
| 837 | Ga0495661_0052588 | 3300046665 | Bacteria | 2453 |
| 838 | Ga0495588_0001146 | 3300046674 | Bacteria | 11378 |
| 839 | Ga0495588_0085757 | 3300046674 | Bacteria | 1647 |
| 840 | Ga0495657_0010464 | 3300046675 | Bacteria | 6978 |
| 841 | Ga0495599_0009888 | 3300046678 | Bacteria | 5837 |
| 842 | Ga0495623_0006513 | 3300046679 | Bacteria | 7602 |
| 843 | Ga0495646_0019580 | 3300046680 | Bacteria | 4282 |
| 844 | Ga0495646_0055602 | 3300046680 | Bacteria | 2376 |
| 845 | Ga0495647_0025057 | 3300046681 | Bacteria | 2176 |
| 846 | Ga0495669_0003796 | 3300046684 | Bacteria | 6207 |
| 847 | Ga0495624_0069333 | 3300046690 | Bacteria | 2196 |
| 848 | Ga0495670_0016624 | 3300046691 | Bacteria | 3618 |
| 849 | Ga0495649_0130167 | 3300046694 | Bacteria | 1328 |
| 850 | Ga0495600_0005780 | 3300046809 | Bacteria | 7473 |
| 851 | Ga0495660_0036980 | 3300046810 | Bacteria | 2721 |
| 852 | Ga0495660_0049199 | 3300046810 | Bacteria | 2302 |
| 853 | Ga0495660_0060603 | 3300046810 | Bacteria | 2032 |
| 854 | Ga0495581_0060439 | 3300047315 | Bacteria | 2190 |
| 855 | Ga0495604_0000939 | 3300047317 | Bacteria | 24255 |
| 856 | Ga0495604_0004637 | 3300047317 | Bacteria | 10894 |
| 857 | Ga0495604_0024899 | 3300047317 | Bacteria | 4773 |
| 858 | Ga0495636_0040488 | 3300047318 | Bacteria | 1932 |
| 859 | Ga0495636_0066614 | 3300047318 | Bacteria | 1531 |
| 860 | Ga0495674_0008253 | 3300047319 | Bacteria | 9934 |
| 861 | Ga0495674_0017976 | 3300047319 | Bacteria | 6581 |
| 862 | Ga0495672_0118403 | 3300047320 | Bacteria | 1412 |
| 863 | Ga0495676_0049415 | 3300047321 | Bacteria | 3382 |
| 864 | Ga0495676_0080633 | 3300047321 | Bacteria | 2470 |
| 865 | Ga0495680_0008716 | 3300047322 | Bacteria | 9190 |
| 866 | Ga0495683_0044834 | 3300047323 | Bacteria | 2224 |
| 867 | Ga0495683_0112830 | 3300047323 | Bacteria | 1296 |
| 868 | Ga0495687_022010 | 3300047443 | Bacteria | 3069 |
| 869 | Ga0495685_048100 | 3300047447 | Bacteria | 1450 |
| 870 | Ga0495681_0004119 | 3300047470 | Bacteria | 9993 |
| 871 | Ga0495681_0068694 | 3300047470 | Bacteria | 1612 |
| 872 | Ga0495684_0054666 | 3300047471 | Bacteria | 3045 |
| 873 | Ga0495684_0064339 | 3300047471 | Bacteria | 2787 |
| 874 | Ga0495686_0014003 | 3300047472 | Bacteria | 5542 |
| 875 | Ga0495686_0062679 | 3300047472 | Bacteria | 2305 |
| 876 | Ga0495602_0022141 | 3300048088 | Bacteria | 6228 |
| 877 | Ga0495602_0153059 | 3300048088 | Bacteria | 1810 |
| 878 | Ga0495615_0005003 | 3300048090 | Bacteria | 2356 |
| 879 | Ga0496100_0000050 | 3300048903 | Bacteria | 75449 |
| 880 | Ga0496100_0000310 | 3300048903 | Bacteria | 24113 |
| 881 | Ga0496100_0042930 | 3300048903 | Bacteria | 2890 |
| 882 | Ga0496101_0000121 | 3300048904 | Bacteria | 76264 |
| 883 | Ga0496101_0010077 | 3300048904 | Bacteria | 6230 |
| 884 | Ga0496101_0051291 | 3300048904 | Bacteria | 2972 |
| 885 | Ga0496101_0124102 | 3300048904 | Bacteria | 1955 |
| 886 | Ga0496102_0000679 | 3300048905 | Bacteria | 34025 |
| 887 | Ga0496102_0002728 | 3300048905 | Bacteria | 15045 |
| 888 | Ga0496102_0010100 | 3300048905 | Bacteria | 8120 |
| 889 | Ga0496102_0090375 | 3300048905 | Bacteria | 2834 |
| 890 | Ga0496102_0224187 | 3300048905 | Bacteria | 1772 |
| 891 | Ga0496102_0269753 | 3300048905 | Bacteria | 1604 |
| 892 | Ga0496102_0471420 | 3300048905 | Bacteria | 1176 |
| 893 | Ga0496103_0000175 | 3300048906 | Bacteria | 65716 |
| 894 | Ga0496103_0000777 | 3300048906 | Bacteria | 23523 |
| 895 | Ga0496103_0137749 | 3300048906 | Bacteria | 1560 |
| 896 | Ga0496104_0000500 | 3300048907 | Bacteria | 33808 |
| 897 | Ga0496104_0000588 | 3300048907 | Bacteria | 31033 |
| 898 | Ga0496104_0011318 | 3300048907 | Bacteria | 7987 |
| 899 | Ga0496104_0014050 | 3300048907 | Bacteria | 7227 |
| 900 | Ga0496104_0020089 | 3300048907 | Bacteria | 6119 |
| 901 | Ga0496104_0021190 | 3300048907 | Bacteria | 5965 |
| 902 | Ga0496104_0182554 | 3300048907 | Bacteria | 2008 |
| 903 | Ga0496105_0002408 | 3300048908 | Bacteria | 13543 |
| 904 | Ga0496105_0002551 | 3300048908 | Bacteria | 13215 |
| 905 | Ga0496105_0003077 | 3300048908 | Bacteria | 12259 |
| 906 | Ga0496105_0006243 | 3300048908 | Bacteria | 9150 |
| 907 | Ga0496105_0009375 | 3300048908 | Bacteria | 7654 |
| 908 | Ga0496105_0009884 | 3300048908 | Bacteria | 7481 |
| 909 | Ga0496105_0016466 | 3300048908 | Bacteria | 5903 |
| 910 | Ga0496105_0045775 | 3300048908 | Bacteria | 3610 |
| 911 | Ga0496106_0000133 | 3300048909 | Bacteria | 55926 |
| 912 | Ga0496106_0000323 | 3300048909 | Bacteria | 33743 |
| 913 | Ga0496106_0043242 | 3300048909 | Bacteria | 3380 |
| 914 | Ga0496106_0055832 | 3300048909 | Bacteria | 2985 |
| 915 | Ga0496106_0186856 | 3300048909 | Bacteria | 1646 |
| 916 | Ga0496107_0000237 | 3300048910 | Bacteria | 29056 |
| 917 | Ga0496107_0006942 | 3300048910 | Bacteria | 7802 |
| 918 | Ga0496107_0008677 | 3300048910 | Bacteria | 7039 |
| 919 | Ga0496107_0013131 | 3300048910 | Bacteria | 5787 |
| 920 | Ga0496107_0148941 | 3300048910 | Bacteria | 1731 |
| 921 | Ga0496107_0162931 | 3300048910 | Bacteria | 1653 |
| 922 | Ga0496108_0001888 | 3300048911 | Bacteria | 16784 |
| 923 | Ga0496108_0024837 | 3300048911 | Bacteria | 4934 |
| 924 | Ga0496108_0038602 | 3300048911 | Bacteria | 3979 |
| 925 | Ga0496108_0057474 | 3300048911 | Bacteria | 3269 |
| 926 | Ga0496109_0000493 | 3300048912 | Bacteria | 33784 |
| 927 | Ga0496109_0000952 | 3300048912 | Bacteria | 23938 |
| 928 | Ga0496109_0001602 | 3300048912 | Bacteria | 18880 |
| 929 | Ga0496109_0041234 | 3300048912 | Bacteria | 4182 |
| 930 | Ga0496109_0049410 | 3300048912 | Bacteria | 3829 |
| 931 | Ga0496109_0190810 | 3300048912 | Bacteria | 1925 |
| 932 | Ga0496109_0192867 | 3300048912 | Bacteria | 1914 |
| 933 | Ga0496110_0003720 | 3300048913 | Bacteria | 11747 |
| 934 | Ga0496110_0003830 | 3300048913 | Bacteria | 11584 |
| 935 | Ga0496110_0014142 | 3300048913 | Bacteria | 6619 |
| 936 | Ga0496110_0064390 | 3300048913 | Bacteria | 3240 |
| 937 | Ga0496110_0152174 | 3300048913 | Bacteria | 2095 |
| 938 | Ga0496111_0001343 | 3300048914 | Bacteria | 13890 |
| 939 | Ga0496111_0009718 | 3300048914 | Bacteria | 6430 |
| 940 | Ga0496111_0066787 | 3300048914 | Bacteria | 2612 |
| 941 | Ga0496111_0184353 | 3300048914 | Bacteria | 1552 |
| 942 | Ga0496112_0011990 | 3300048915 | Bacteria | 7947 |
| 943 | Ga0496112_0033461 | 3300048915 | Bacteria | 4997 |
| 944 | Ga0496112_0042530 | 3300048915 | Bacteria | 4445 |
| 945 | Ga0496112_0047993 | 3300048915 | Bacteria | 4188 |
| 946 | Ga0496113_0000869 | 3300048916 | Bacteria | 15820 |
| 947 | Ga0496113_0012388 | 3300048916 | Bacteria | 5730 |
| 948 | Ga0496113_0032115 | 3300048916 | Bacteria | 3814 |
| 949 | Ga0496113_0090154 | 3300048916 | Bacteria | 2361 |
| 950 | Ga0496113_0124584 | 3300048916 | Bacteria | 2017 |
| 951 | Ga0496114_0002721 | 3300048917 | Bacteria | 13500 |
| 952 | Ga0496114_0026653 | 3300048917 | Bacteria | 4734 |
| 953 | Ga0496114_0137983 | 3300048917 | Bacteria | 2109 |
| 954 | Ga0496115_0001322 | 3300048918 | Bacteria | 17672 |
| 955 | Ga0496115_0001562 | 3300048918 | Bacteria | 16472 |
| 956 | Ga0496115_0009975 | 3300048918 | Bacteria | 7076 |
| 957 | Ga0496115_0041219 | 3300048918 | Bacteria | 3673 |
| 958 | Ga0496115_0064682 | 3300048918 | Bacteria | 2953 |
| 959 | Ga0496115_0146054 | 3300048918 | Bacteria | 1952 |
| 960 | Ga0496116_0000026 | 3300048919 | Bacteria | 450803 |
| 961 | Ga0496116_0051378 | 3300048919 | Bacteria | 2739 |
| 962 | Ga0496116_0060520 | 3300048919 | Bacteria | 2456 |
| 963 | Ga0496116_0076919 | 3300048919 | Bacteria | 2088 |
| 964 | Ga0496116_0082859 | 3300048919 | Bacteria | 1982 |
| 965 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 966 | Ga0496117_0028675 | 3300048920 | Bacteria | 4307 |
| 967 | Ga0496117_0083200 | 3300048920 | Bacteria | 2093 |
| 968 | Ga0496117_0110951 | 3300048920 | Bacteria | 1708 |
| 969 | Ga0496117_0162863 | 3300048920 | Bacteria | 1304 |
| 970 | Ga0496118_0002844 | 3300048921 | Bacteria | 22597 |
| 971 | Ga0496118_0014526 | 3300048921 | Bacteria | 7364 |
| 972 | Ga0496118_0016840 | 3300048921 | Bacteria | 6680 |
| 973 | Ga0496118_0022202 | 3300048921 | Bacteria | 5558 |
| 974 | Ga0496118_0048224 | 3300048921 | Bacteria | 3293 |
| 975 | Ga0496119_0010067 | 3300048922 | Bacteria | 7995 |
| 976 | Ga0496119_0014918 | 3300048922 | Bacteria | 6038 |
| 977 | Ga0496119_0021542 | 3300048922 | Bacteria | 4654 |
| 978 | Ga0496120_0000034 | 3300048923 | Bacteria | 215228 |
| 979 | Ga0496120_0000455 | 3300048923 | Bacteria | 64606 |
| 980 | Ga0496120_0025451 | 3300048923 | Bacteria | 3672 |
| 981 | Ga0496120_0077220 | 3300048923 | Bacteria | 1813 |
| 982 | Ga0496120_0152319 | 3300048923 | Bacteria | 1161 |
| 983 | Ga0496121_0000220 | 3300048924 | Bacteria | 123930 |
| 984 | Ga0496121_0071800 | 3300048924 | Bacteria | 2782 |
| 985 | Ga0496121_0080858 | 3300048924 | Bacteria | 2574 |
| 986 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 987 | Ga0496122_0035793 | 3300048925 | Bacteria | 4030 |
| 988 | Ga0496122_0059858 | 3300048925 | Bacteria | 2809 |
| 989 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 990 | Ga0496123_0014463 | 3300048926 | Bacteria | 6539 |
| 991 | Ga0496123_0045453 | 3300048926 | Bacteria | 2991 |
| 992 | Ga0496123_0142329 | 3300048926 | Bacteria | 1309 |
| 993 | Ga0496124_0000083 | 3300048927 | Bacteria | 207798 |
| 994 | Ga0496124_0002875 | 3300048927 | Bacteria | 21765 |
| 995 | Ga0496124_0013228 | 3300048927 | Bacteria | 8070 |
| 996 | Ga0496124_0102824 | 3300048927 | Bacteria | 2311 |
| 997 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 998 | Ga0496125_0009589 | 3300048928 | Bacteria | 9907 |
| 999 | Ga0496125_0029586 | 3300048928 | Bacteria | 4919 |
| 1000 | Ga0496125_0064016 | 3300048928 | Bacteria | 2927 |
| 1001 | Ga0496126_0000069 | 3300048929 | Bacteria | 246935 |
| 1002 | Ga0496126_0007323 | 3300048929 | Bacteria | 12119 |
| 1003 | Ga0496126_0057065 | 3300048929 | Bacteria | 3527 |
| 1004 | Ga0496126_0188432 | 3300048929 | Bacteria | 1748 |
| 1005 | Ga0496126_0262819 | 3300048929 | Bacteria | 1434 |
| 1006 | Ga0496126_0378317 | 3300048929 | Bacteria | 1153 |
| 1007 | Ga0495678_042185 | 3300049459 | Bacteria | 1820 |
| 1008 | Ga0495682_0045915 | 3300049460 | Bacteria | 1596 |
| 1009 | Ga0501031_0000006 | 3300049568 | Bacteria | 176019 |
| 1010 | Ga0501032_0000016 | 3300049569 | Bacteria | 174688 |
| 1011 | Ga0501032_0059787 | 3300049569 | Bacteria | 2557 |
| 1012 | Ga0501033_0000101 | 3300049570 | Bacteria | 81870 |
| 1013 | Ga0501033_0061814 | 3300049570 | Bacteria | 2759 |
| 1014 | Ga0501034_0000168 | 3300049571 | Bacteria | 122667 |
| 1015 | Ga0501034_0010519 | 3300049571 | Bacteria | 9635 |
| 1016 | Ga0501034_0030869 | 3300049571 | Bacteria | 5446 |
| 1017 | Ga0501034_0137323 | 3300049571 | Bacteria | 2425 |
| 1018 | Ga0501036_0000019 | 3300049572 | Bacteria | 118632 |
| 1019 | Ga0501036_0099560 | 3300049572 | Bacteria | 2458 |
| 1020 | Ga0501037_0000013 | 3300049573 | Bacteria | 174688 |
| 1021 | Ga0501037_0000895 | 3300049573 | Bacteria | 22218 |
| 1022 | Ga0501037_0143061 | 3300049573 | Bacteria | 1711 |
| 1023 | Ga0501038_0000012 | 3300049574 | Bacteria | 174688 |
| 1024 | Ga0501038_0011999 | 3300049574 | Bacteria | 7912 |
| 1025 | Ga0501038_0165827 | 3300049574 | Bacteria | 1792 |
| 1026 | Ga0501039_0000019 | 3300049575 | Bacteria | 174688 |
| 1027 | Ga0501039_0079324 | 3300049575 | Bacteria | 2554 |
| 1028 | Ga0501040_0148787 | 3300049576 | Bacteria | 1651 |
| 1029 | Ga0501042_0019008 | 3300049578 | Bacteria | 4768 |
| 1030 | Ga0501043_0000045 | 3300049579 | Bacteria | 114003 |
| 1031 | Ga0501043_0000209 | 3300049579 | Bacteria | 53858 |
| 1032 | Ga0501043_0048636 | 3300049579 | Bacteria | 3334 |
| 1033 | Ga0501043_0132686 | 3300049579 | Bacteria | 1952 |
| 1034 | Ga0501047_0003738 | 3300049581 | Bacteria | 14331 |
| 1035 | Ga0501047_0023848 | 3300049581 | Bacteria | 5875 |
| 1036 | Ga0501047_0234199 | 3300049581 | Bacteria | 1688 |
| 1037 | Ga0501069_0000007 | 3300049585 | Bacteria | 182820 |
| 1038 | Ga0501070_0000758 | 3300049586 | Bacteria | 29461 |
| 1039 | Ga0501070_0003344 | 3300049586 | Bacteria | 13925 |
| 1040 | Ga0501070_0021164 | 3300049586 | Bacteria | 5458 |
| 1041 | Ga0501070_0059883 | 3300049586 | Bacteria | 3156 |
| 1042 | Ga0501070_0084105 | 3300049586 | Bacteria | 2634 |
| 1043 | Ga0501070_0131515 | 3300049586 | Bacteria | 2067 |
| 1044 | Ga0501071_0013377 | 3300049587 | Bacteria | 5590 |
| 1045 | Ga0501071_0091102 | 3300049587 | Bacteria | 2240 |
| 1046 | Ga0501072_0036236 | 3300049588 | Bacteria | 3867 |
| 1047 | Ga0501074_0000047 | 3300049590 | Bacteria | 57039 |
| 1048 | Ga0501074_0010115 | 3300049590 | Bacteria | 6849 |
| 1049 | Ga0501074_0047884 | 3300049590 | Bacteria | 3089 |
| 1050 | Ga0501076_0006762 | 3300049592 | Bacteria | 8322 |
| 1051 | Ga0501080_0005487 | 3300049742 | Bacteria | 11319 |
| 1052 | Ga0501080_0009780 | 3300049742 | Bacteria | 8760 |
| 1053 | Ga0501080_0203467 | 3300049742 | Bacteria | 1817 |
| 1054 | Ga0501083_0000029 | 3300049744 | Bacteria | 107507 |
| 1055 | Ga0501280_002770 | 3300049776 | Bacteria | 2831 |
| 1056 | Ga0501035_0000060 | 3300049822 | Bacteria | 132293 |
| 1057 | Ga0501035_0000081 | 3300049822 | Bacteria | 117453 |
| 1058 | Ga0501035_0004420 | 3300049822 | Bacteria | 13345 |
| 1059 | Ga0501035_0029235 | 3300049822 | Bacteria | 5025 |
| 1060 | Ga0501035_0044246 | 3300049822 | Bacteria | 4010 |
| 1061 | Ga0501035_0092164 | 3300049822 | Bacteria | 2666 |
| 1062 | Ga0501044_0000009 | 3300049823 | Bacteria | 270072 |
| 1063 | Ga0501044_0000029 | 3300049823 | Bacteria | 176024 |
| 1064 | Ga0501044_0052912 | 3300049823 | Bacteria | 4179 |
| 1065 | Ga0501044_0252875 | 3300049823 | Bacteria | 1702 |
| 1066 | Ga0501045_0006727 | 3300049824 | Bacteria | 7965 |
| 1067 | nmdc:mga03683_1100_c1 | 3300050489 | Bacteria | 3363 |
| 1068 | nmdc:mga03683_409_c1 | 3300050489 | Bacteria | 12382 |
| 1069 | nmdc:mga03683_83526_c1 | 3300050489 | Bacteria | 1383 |
| 1070 | nmdc:mga03n38_12016_c1 | 3300050490 | Bacteria | 3245 |
| 1071 | nmdc:mga00v17_106281_c1 | 3300050491 | Bacteria | 1777 |
| 1072 | nmdc:mga00v17_108403_c1 | 3300050491 | Bacteria | 1760 |
| 1073 | nmdc:mga00v17_130499_c1 | 3300050491 | Bacteria | 1606 |
| 1074 | nmdc:mga00v17_180316_c1 | 3300050491 | Bacteria | 1363 |
| 1075 | nmdc:mga00v17_26_c1 | 3300050491 | Bacteria | 37082 |
| 1076 | nmdc:mga00v17_30112_c1 | 3300050491 | Bacteria | 3191 |
| 1077 | nmdc:mga00v17_47_c1 | 3300050491 | Bacteria | 77934 |
| 1078 | nmdc:mga0yw44_11106_c1 | 3300050492 | Bacteria | 4630 |
| 1079 | nmdc:mga0yw44_165685_c1 | 3300050492 | Bacteria | 1449 |
| 1080 | nmdc:mga0yw44_18361_c1 | 3300050492 | Bacteria | 3828 |
| 1081 | nmdc:mga0yw44_185747_c1 | 3300050492 | Bacteria | 1370 |
| 1082 | nmdc:mga0yw44_31900_c1 | 3300050492 | Bacteria | 3067 |
| 1083 | nmdc:mga0yw44_3820_c1 | 3300050492 | Bacteria | 6764 |
| 1084 | nmdc:mga0yw44_3977_c1 | 3300050492 | Bacteria | 6679 |
| 1085 | nmdc:mga0yw44_81306_c1 | 3300050492 | Bacteria | 2031 |
| 1086 | nmdc:mga0yw44_831_c1 | 3300050492 | Bacteria | 11561 |
| 1087 | nmdc:mga0yw44_8596_c1 | 3300050492 | Bacteria | 5098 |
| 1088 | nmdc:mga0k408_143738_c1 | 3300050493 | Bacteria | 1420 |
| 1089 | nmdc:mga0k408_40451_c1 | 3300050493 | Bacteria | 2682 |
| 1090 | nmdc:mga0k408_7428_c1 | 3300050493 | Bacteria | 5851 |
| 1091 | nmdc:mga0k408_9138_c1 | 3300050493 | Bacteria | 5339 |
| 1092 | nmdc:mga06z11_114704_c1 | 3300050494 | Bacteria | 1496 |
| 1093 | nmdc:mga06z11_16404_c1 | 3300050494 | Bacteria | 3336 |
| 1094 | nmdc:mga06z11_176767_c1 | 3300050494 | Bacteria | 1229 |
| 1095 | nmdc:mga06z11_18791_c1 | 3300050494 | Bacteria | 3165 |
| 1096 | nmdc:mga06z11_3255_c1 | 3300050494 | Bacteria | 6275 |
| 1097 | nmdc:mga06z11_91170_c1 | 3300050494 | Bacteria | 1655 |
| 1098 | nmdc:mga06z11_92439_c1 | 3300050494 | Bacteria | 1645 |
| 1099 | nmdc:mga04h51_23837_c1 | 3300050495 | Bacteria | 1868 |
| 1100 | nmdc:mga04h51_32896_c1 | 3300050495 | Bacteria | 1648 |
| 1101 | nmdc:mga04h51_4064_c1 | 3300050495 | Bacteria | 3606 |
| 1102 | nmdc:mga07m45_108881_c1 | 3300050496 | Bacteria | 1595 |
| 1103 | nmdc:mga07m45_23668_c2 | 3300050496 | Bacteria | 2490 |
| 1104 | nmdc:mga07m45_30403_c1 | 3300050496 | Bacteria | 2992 |
| 1105 | nmdc:mga07m45_3358_c1 | 3300050496 | Bacteria | 7713 |
| 1106 | nmdc:mga07m45_36073_c1 | 3300050496 | Bacteria | 2753 |
| 1107 | nmdc:mga07m45_50498_c1 | 3300050496 | Bacteria | 2344 |
| 1108 | nmdc:mga07m45_61401_c1 | 3300050496 | Bacteria | 2129 |
| 1109 | nmdc:mga07m45_64686_c1 | 3300050496 | Bacteria | 2076 |
| 1110 | nmdc:mga07m45_91680_c1 | 3300050496 | Bacteria | 1741 |
| 1111 | nmdc:mga05p37_41138_c1 | 3300050507 | Bacteria | 5675 |
| 1112 | nmdc:mga05p37_83860_c1 | 3300050507 | Bacteria | 3926 |
| 1113 | nmdc:mga05p37_94463_c1 | 3300050507 | Bacteria | 3684 |
| 1114 | nmdc:mga09592_17221_c1 | 3300050508 | Bacteria | 5918 |
| 1115 | nmdc:mga09592_76716_c1 | 3300050508 | Bacteria | 2842 |
| 1116 | nmdc:mga0qj67_34351_c1 | 3300050509 | Bacteria | 3961 |
| 1117 | nmdc:mga06r32_14671_c1 | 3300050510 | Bacteria | 7112 |
| 1118 | nmdc:mga06r32_272496_c1 | 3300050510 | Bacteria | 1680 |
| 1119 | nmdc:mga06r32_8869_c1 | 3300050510 | Bacteria | 9064 |
| 1120 | nmdc:mga08y16_202134_c1 | 3300050511 | Bacteria | 2059 |
| 1121 | nmdc:mga08y16_3032_c1 | 3300050511 | Bacteria | 17340 |
| 1122 | nmdc:mga08y16_409700_c1 | 3300050511 | Bacteria | 1386 |
| 1123 | nmdc:mga08y16_706_c1 | 3300050511 | Bacteria | 31784 |
| 1124 | nmdc:mga0n895_151399_c1 | 3300050512 | Bacteria | 2350 |
| 1125 | nmdc:mga0n895_2736_c1 | 3300050512 | Bacteria | 13917 |
| 1126 | nmdc:mga0rr50_54810_c1 | 3300050513 | Bacteria | 2972 |
| 1127 | nmdc:mga0a205_197_c1 | 3300050515 | Bacteria | 22634 |
| 1128 | nmdc:mga0sz30_148_c1 | 3300050516 | Bacteria | 26288 |
| 1129 | nmdc:mga0sz30_18723_c1 | 3300050516 | Bacteria | 2774 |
| 1130 | nmdc:mga0sz30_57771_c1 | 3300050516 | Bacteria | 1654 |
| 1131 | nmdc:mga0sz30_6454_c1 | 3300050516 | Bacteria | 4352 |
| 1132 | Ga0495601_0013325 | 3300053077 | Bacteria | 4942 |
| 1133 | Ga0495612_0003890 | 3300053078 | Bacteria | 6191 |
| 1134 | Ga0500610_0025694 | 3300053079 | Bacteria | 2940 |
| 1135 | Ga0500610_0072570 | 3300053079 | Bacteria | 1795 |
| 1136 | Ga0495619_0001328 | 3300053085 | Bacteria | 16220 |
| 1137 | Ga0495619_0013741 | 3300053085 | Bacteria | 5106 |
| 1138 | Ga0500578_0060890 | 3300053086 | Bacteria | 2410 |
| 1139 | Ga0500643_000015 | 3300053087 | Bacteria | 310312 |
| 1140 | Ga0500643_012824 | 3300053087 | Bacteria | 2988 |
| 1141 | Ga0500644_0040454 | 3300053088 | Bacteria | 1543 |
| 1142 | Ga0500581_120407 | 3300053089 | Bacteria | 1268 |
| 1143 | Ga0500566_0000082 | 3300053094 | Bacteria | 47150 |
| 1144 | Ga0500641_0000376 | 3300053096 | Bacteria | 16585 |
| 1145 | Ga0500641_0004622 | 3300053096 | Bacteria | 4866 |
| 1146 | Ga0500641_0017367 | 3300053096 | Bacteria | 2690 |
| 1147 | Ga0500641_0026306 | 3300053096 | Bacteria | 2258 |
| 1148 | Ga0500650_0013072 | 3300053098 | Bacteria | 3471 |
| 1149 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 1150 | Ga0500557_000022 | 3300053105 | Bacteria | 88506 |
| 1151 | Ga0500557_018021 | 3300053105 | Bacteria | 1962 |
| 1152 | Ga0500562_032766 | 3300053108 | Bacteria | 1372 |
| 1153 | Ga0500569_005635 | 3300053109 | Bacteria | 2700 |
| 1154 | Ga0500569_029724 | 3300053109 | Bacteria | 1524 |
| 1155 | Ga0500592_001501 | 3300053116 | Bacteria | 3780 |
| 1156 | Ga0500594_0015572 | 3300053118 | Bacteria | 1835 |
| 1157 | Ga0500642_0000016 | 3300053130 | Bacteria | 176560 |
| 1158 | Ga0500642_0000166 | 3300053130 | Bacteria | 27296 |
| 1159 | Ga0500658_0000625 | 3300053134 | Bacteria | 14656 |
| 1160 | Ga0500659_0043180 | 3300053135 | Bacteria | 2446 |
| 1161 | Ga0500559_0020582 | 3300053136 | Bacteria | 2790 |
| 1162 | Ga0500568_0000035 | 3300053139 | Bacteria | 137912 |
| 1163 | Ga0500568_0002154 | 3300053139 | Bacteria | 11868 |
| 1164 | Ga0500568_0013231 | 3300053139 | Bacteria | 3764 |
| 1165 | Ga0500568_0018845 | 3300053139 | Bacteria | 3010 |
| 1166 | Ga0500577_0000373 | 3300053142 | Bacteria | 11382 |
| 1167 | Ga0500577_0043761 | 3300053142 | Bacteria | 1647 |
| 1168 | Ga0500588_0072814 | 3300053146 | Bacteria | 1131 |
| 1169 | Ga0500604_0000742 | 3300053151 | Bacteria | 8922 |
| 1170 | Ga0500604_0020569 | 3300053151 | Bacteria | 1859 |
| 1171 | Ga0500616_0001686 | 3300053153 | Bacteria | 20346 |
| 1172 | Ga0500616_0014259 | 3300053153 | Bacteria | 4573 |
| 1173 | Ga0500622_0000668 | 3300053156 | Bacteria | 30285 |
| 1174 | Ga0500622_0010502 | 3300053156 | Bacteria | 5080 |
| 1175 | Ga0500624_001406 | 3300053157 | Bacteria | 3975 |
| 1176 | Ga0500627_0035377 | 3300053158 | Bacteria | 2121 |
| 1177 | Ga0500627_0039600 | 3300053158 | Bacteria | 2019 |
| 1178 | Ga0500627_0052474 | 3300053158 | Bacteria | 1780 |
| 1179 | Ga0500634_0004710 | 3300053161 | Bacteria | 6365 |
| 1180 | Ga0500636_0000036 | 3300053177 | Bacteria | 71714 |
| 1181 | Ga0500636_0003407 | 3300053177 | Bacteria | 8946 |
| 1182 | Ga0500611_006845 | 3300053727 | Bacteria | 1683 |
| 1183 | Ga0500625_006836 | 3300053729 | Bacteria | 4900 |
| 1184 | Ga0500645_012516 | 3300053730 | Bacteria | 2739 |
| 1185 | Ga0500645_028625 | 3300053730 | Bacteria | 1685 |
| 1186 | Ga0500645_039163 | 3300053730 | Bacteria | 1405 |
| 1187 | Ga0500609_003310 | 3300053731 | Bacteria | 2272 |
| 1188 | Ga0500601_000258 | 3300053737 | Bacteria | 10116 |
| 1189 | Ga0501084_0001734 | 3300054114 | Bacteria | 17311 |
| 1190 | Ga0587090_004716 | 3300059510 | Bacteria | 1671 |
| 1191 | Ga0501082_0000053 | 3300060353 | Bacteria | 82895 |
| 1192 | Ga0501082_0007228 | 3300060353 | Bacteria | 9573 |
| 1193 | Ga0501082_0360620 | 3300060353 | Bacteria | 1268 |
| 1194 | Ga0530510_0041559 | 3300061734 | Bacteria | 3320 |
| 1195 | 2840769232 | 2840764183 | Bacteria | 6358399 |
| 1196 | 2503198329 | 2503198000 | Bacteria | 6884444 |
| 1197 | 2507508584 | 2507262055 | Bacteria | 8048963 |
| 1198 | 2508542656 | 2508501009 | Bacteria | 7784016 |
| 1199 | 2508691568 | 2508501042 | Bacteria | 8719808 |
| 1200 | 2509079577 | 2508501114 | Bacteria | 7082538 |
| 1201 | 2509111394 | 2508501122 | Bacteria | 6292184 |
| 1202 | 2509114447 | 2508501123 | Bacteria | 6283661 |
| 1203 | 2509368395 | 2509276018 | Bacteria | 6910194 |
| 1204 | 2509375667 | 2509276019 | Bacteria | 6802256 |
| 1205 | 2509447931 | 2509276033 | Bacteria | 7180565 |
| 1206 | 2510134869 | 2510065019 | Bacteria | 6903379 |
| 1207 | 2510303293 | 2510065057 | Bacteria | 6649661 |
| 1208 | 2510314677 | 2510065059 | Bacteria | 6847884 |
| 1209 | 2510896275 | 2510461076 | Bacteria | 8618824 |
| 1210 | 2511137054 | 2510917022 | Bacteria | 6504556 |
| 1211 | 2511174201 | 2510917026 | Bacteria | 7046020 |
| 1212 | 2511390399 | 2511231027 | Bacteria | 5013807 |
| 1213 | 2511401273 | 2511231028 | Bacteria | 8046582 |
| 1214 | 2511501969 | 2511231052 | Bacteria | 6974333 |
| 1215 | 2512533337 | 2512047086 | Bacteria | 6850303 |
| 1216 | 2512934195 | 2512875016 | Bacteria | 6529530 |
| 1217 | 2512962495 | 2512875024 | Bacteria | 7195110 |
| 1218 | 2512971094 | 2512875026 | Bacteria | 6861065 |
| 1219 | 2513572632 | 2513237084 | Bacteria | 7231967 |
| 1220 | 2513580137 | 2513237085 | Bacteria | 7695351 |
| 1221 | 2513582634 | 2513237086 | Bacteria | 7265287 |
| 1222 | 2513604549 | 2513237089 | Bacteria | 6553624 |
| 1223 | 2513609801 | 2513237090 | Bacteria | 7096802 |
| 1224 | 2513615464 | 2513237091 | Bacteria | 6900273 |
| 1225 | 2513623046 | 2513237092 | Bacteria | 8341956 |
| 1226 | 2513631293 | 2513237093 | Bacteria | 7545552 |
| 1227 | 2513640447 | 2513237094 | Bacteria | 8789602 |
| 1228 | 2513645841 | 2513237095 | Bacteria | 8976980 |
| 1229 | 2513710812 | 2513237103 | Bacteria | 7647401 |
| 1230 | 2513872767 | 2513237139 | Bacteria | 8737671 |
| 1231 | 2513881253 | 2513237140 | Bacteria | 7076289 |
| 1232 | 2513902384 | 2513237143 | Bacteria | 6664116 |
| 1233 | 2513984597 | 2513237156 | Bacteria | 6402557 |
| 1234 | 2513997068 | 2513237159 | Bacteria | 6810126 |
| 1235 | 2514007602 | 2513237160 | Bacteria | 6650282 |
| 1236 | 2514011853 | 2513237161 | Bacteria | 8871253 |
| 1237 | 2514022310 | 2513237162 | Bacteria | 7468464 |
| 1238 | 2514037866 | 2513237164 | Bacteria | 7563725 |
| 1239 | 2514587362 | 2513237351 | Bacteria | 6968952 |
| 1240 | 2515113952 | 2515075009 | Bacteria | 7288508 |
| 1241 | 2515608762 | 2515154107 | Bacteria | 6795637 |
| 1242 | 2515628365 | 2515154112 | Bacteria | 8294334 |
| 1243 | 2515636974 | 2515154113 | Bacteria | 7807172 |
| 1244 | 2515643003 | 2515154114 | Bacteria | 7848616 |
| 1245 | 2515656752 | 2515154116 | Bacteria | 7552979 |
| 1246 | 2515743691 | 2515154134 | Bacteria | 7220242 |
| 1247 | 2516209689 | 2516143018 | Bacteria | 6951533 |
| 1248 | 2516893265 | 2516653046 | Bacteria | 6989037 |
| 1249 | 2517037583 | 2516653077 | Bacteria | 7555578 |
| 1250 | 2517077870 | 2516653085 | Bacteria | 7346596 |
| 1251 | 2517096667 | 2517093000 | Bacteria | 7412387 |
| 1252 | 2517102527 | 2517093001 | Bacteria | 9002274 |
| 1253 | 2517106751 | 2517093001 | Bacteria | 9002274 |
| 1254 | 2517410381 | 2517287029 | Bacteria | 6905599 |
| 1255 | 2517570022 | 2517487022 | Bacteria | 7227575 |
| 1256 | 2520377947 | 2519899620 | Bacteria | 6499161 |
| 1257 | 2524443297 | 2524023205 | Bacteria | 8918781 |
| 1258 | 2524448835 | 2524023207 | Bacteria | 6813453 |
| 1259 | 2524460624 | 2524023209 | Bacteria | 6679728 |
| 1260 | 2528854928 | 2528768022 | Bacteria | 10457665 |
| 1261 | 2530646980 | 2529292951 | Bacteria | 6916614 |
| 1262 | 2535519405 | 2534681796 | Bacteria | 7146037 |
| 1263 | 2537877385 | 2537561587 | Bacteria | 5425293 |
| 1264 | 2551675157 | 2551306084 | Bacteria | 8942552 |
| 1265 | 2551680517 | 2551306084 | Bacteria | 8942552 |
| 1266 | 2551688050 | 2551306085 | Bacteria | 7347181 |
| 1267 | 2551691142 | 2551306086 | Bacteria | 6843938 |
| 1268 | 2551693968 | 2551306086 | Bacteria | 6843938 |
| 1269 | 2551713208 | 2551306089 | Bacteria | 7162724 |
| 1270 | 2551745077 | 2551306093 | Bacteria | 7064773 |
| 1271 | 2554246281 | 2554235003 | Bacteria | 5877155 |
| 1272 | 2558867983 | 2558860100 | Bacteria | 8458965 |
| 1273 | 2559293503 | 2558860242 | Bacteria | 5568029 |
| 1274 | 2585166129 | 2582581283 | Bacteria | 6030556 |
| 1275 | 2585202444 | 2582581294 | Bacteria | 6626667 |
| 1276 | 2585273236 | 2582581307 | Bacteria | 6597605 |
| 1277 | 2585278930 | 2582581308 | Bacteria | 7413247 |
| 1278 | 2585325455 | 2582581315 | Bacteria | 7318924 |
| 1279 | 2585393047 | 2582581866 | Bacteria | 6859583 |
| 1280 | 2585402245 | 2582581867 | Bacteria | 7184437 |
| 1281 | 2585529053 | 2585427526 | Bacteria | 7258840 |
| 1282 | 2585530727 | 2585427527 | Bacteria | 7273426 |
| 1283 | 2585540993 | 2585427528 | Bacteria | 6842387 |
| 1284 | 2585554907 | 2585427530 | Bacteria | 7383882 |
| 1285 | 2585559464 | 2585427531 | Bacteria | 6992870 |
| 1286 | 2585822455 | 2585427590 | Bacteria | 6824633 |
| 1287 | 2585839755 | 2585427593 | Bacteria | 7141551 |
| 1288 | 2585902135 | 2585427608 | Bacteria | 6544331 |
| 1289 | 2585905160 | 2585427609 | Bacteria | 6667127 |
| 1290 | 2585998486 | 2585427633 | Bacteria | 6413184 |
| 1291 | 2586003050 | 2585427634 | Bacteria | 6455027 |
| 1292 | 2587979725 | 2585428125 | Bacteria | 6662905 |
| 1293 | 2588520344 | 2588253730 | Bacteria | 6881675 |
| 1294 | 2597810534 | 2597489875 | Bacteria | 7010078 |
| 1295 | 2599331579 | 2599185156 | Bacteria | 5403036 |
| 1296 | 2599604385 | 2599185210 | Bacteria | 5624189 |
| 1297 | 2599935464 | 2599185301 | Bacteria | 6161860 |
| 1298 | 2600193092 | 2599185352 | Bacteria | 7228948 |
| 1299 | 2601609478 | 2600255279 | Bacteria | 5605316 |
| 1300 | 2601746253 | 2600255308 | Bacteria | 5611129 |
| 1301 | 2616295586 | 2615840624 | Bacteria | 6557588 |
| 1302 | 2616305797 | 2615840626 | Bacteria | 7921970 |
| 1303 | 2617349020 | 2617270735 | Bacteria | 9163226 |
| 1304 | 2643772430 | 2643221550 | Bacteria | 4619371 |
| 1305 | 2643803592 | 2643221557 | Bacteria | 7184309 |
| 1306 | 2643838345 | 2643221564 | Bacteria | 4193379 |
| 1307 | 2643857896 | 2643221568 | Bacteria | 5187270 |
| 1308 | 2643920662 | 2643221582 | Bacteria | 5804683 |
| 1309 | 2643983922 | 2643221595 | Bacteria | 6565519 |
| 1310 | 2644050739 | 2643221607 | Bacteria | 6314006 |
| 1311 | 2644067559 | 2643221610 | Bacteria | 7480339 |
| 1312 | 2644107705 | 2643221618 | Bacteria | 7717186 |
| 1313 | 2644133353 | 2643221623 | Bacteria | 5239945 |
| 1314 | 2644148624 | 2643221626 | Bacteria | 8069654 |
| 1315 | 2644156052 | 2643221627 | Bacteria | 6761570 |
| 1316 | 2644205213 | 2643221636 | Bacteria | 6583769 |
| 1317 | 2644210227 | 2643221637 | Bacteria | 5345260 |
| 1318 | 2644298042 | 2643221653 | Bacteria | 4569637 |
| 1319 | 2644309099 | 2643221655 | Bacteria | 7722067 |
| 1320 | 2644332927 | 2643221659 | Bacteria | 7890716 |
| 1321 | 2644375239 | 2643221668 | Bacteria | 7306521 |
| 1322 | 2644418612 | 2643221675 | Bacteria | 7473456 |
| 1323 | 2644451979 | 2643221680 | Bacteria | 7473610 |
| 1324 | 2644483657 | 2643221686 | Bacteria | 6310811 |
| 1325 | 2644491797 | 2643221688 | Bacteria | 5260751 |
| 1326 | 2644501345 | 2643221689 | Bacteria | 6042950 |
| 1327 | 2644519530 | 2643221693 | Bacteria | 5513853 |
| 1328 | 2644545901 | 2643221698 | Bacteria | 7756764 |
| 1329 | 2644615041 | 2643221712 | Bacteria | 7729434 |
| 1330 | 2644653779 | 2643221718 | Bacteria | 5345506 |
| 1331 | 2644656294 | 2643221719 | Bacteria | 4568197 |
| 1332 | 2644676578 | 2643221723 | Bacteria | 7095460 |
| 1333 | 2644690741 | 2643221726 | Bacteria | 7455827 |
| 1334 | 2657681192 | 2657244999 | Bacteria | 5946535 |
| 1335 | 2671115284 | 2667528174 | Bacteria | 6435400 |
| 1336 | 2688595651 | 2687453392 | Bacteria | 6880454 |
| 1337 | 2694628186 | 2693429783 | Bacteria | 7019804 |
| 1338 | 2694640957 | 2693429784 | Bacteria | 7241525 |
| 1339 | 2719387293 | 2718217927 | Bacteria | 6972593 |
| 1340 | 2720493355 | 2718218199 | Bacteria | 6740745 |
| 1341 | 2720614829 | 2718218232 | Bacteria | 6720332 |
| 1342 | 2720621602 | 2718218233 | Bacteria | 6662049 |
| 1343 | 2720632930 | 2718218235 | Bacteria | 6630699 |
| 1344 | 2720776654 | 2718218269 | Bacteria | 6906114 |
| 1345 | 2721400928 | 2718218423 | Bacteria | 6438183 |
| 1346 | 2723028242 | 2721755556 | Bacteria | 6745503 |
| 1347 | 2723561870 | 2721755684 | Bacteria | 6859907 |
| 1348 | 2723568502 | 2721755685 | Bacteria | 6704835 |
| 1349 | 2723572937 | 2721755686 | Bacteria | 7343952 |
| 1350 | 2723848000 | 2721755755 | Bacteria | 8322773 |
| 1351 | 2724039741 | 2721755809 | Bacteria | 6438790 |
| 1352 | 2724091261 | 2721755819 | Bacteria | 6906405 |
| 1353 | 2724105767 | 2721755822 | Bacteria | 6726041 |
| 1354 | 2724111593 | 2721755823 | Bacteria | 6752556 |
| 1355 | 2725945441 | 2724679232 | Bacteria | 7646494 |
| 1356 | 2730109178 | 2728369352 | Bacteria | 6745171 |
| 1357 | 2738800404 | 2738541293 | Bacteria | 7065685 |
| 1358 | 2738948748 | 2738541317 | Bacteria | 5340176 |
| 1359 | 2739035550 | 2738541333 | Bacteria | 7106503 |
| 1360 | 2739309537 | 2738543024 | Bacteria | 5603683 |
| 1361 | 2745076657 | 2744054633 | Bacteria | 8678936 |
| 1362 | 2756674264 | 2756170246 | Bacteria | 7451806 |
| 1363 | 2765469412 | 2765235802 | Bacteria | 5618596 |
| 1364 | 2766065296 | 2765235942 | Bacteria | 7445910 |
| 1365 | 2770200143 | 2767802442 | Bacteria | 5747986 |
| 1366 | 2774868707 | 2773857925 | Bacteria | 6472445 |
| 1367 | 2774871196 | 2773857925 | Bacteria | 6472445 |
| 1368 | 2776261404 | 2775506901 | Bacteria | 9631051 |
| 1369 | 2776264471 | 2775506901 | Bacteria | 9631051 |
| 1370 | 2776270195 | 2775506902 | Bacteria | 6208009 |
| 1371 | 2776285078 | 2775506904 | Bacteria | 5954060 |
| 1372 | 2776916135 | 2775507049 | Bacteria | 6284736 |
| 1373 | 2792581765 | 2791355082 | Bacteria | 5973319 |
| 1374 | 2792620165 | 2791355091 | Bacteria | 6135441 |
| 1375 | 2792626415 | 2791355092 | Bacteria | 6248105 |
| 1376 | 2792639364 | 2791355094 | Bacteria | 7011481 |
| 1377 | 2792746838 | 2791355123 | Bacteria | 8049106 |
| 1378 | 2793062393 | 2791355196 | Bacteria | 7323613 |
| 1379 | 2793293610 | 2791355256 | Bacteria | 6798008 |
| 1380 | 2793313050 | 2791355259 | Bacteria | 7254731 |
| 1381 | 2793327796 | 2791355261 | Bacteria | 6661293 |
| 1382 | 2793333405 | 2791355262 | Bacteria | 6774204 |
| 1383 | 2793353726 | 2791355265 | Bacteria | 6539969 |
| 1384 | 2793359676 | 2791355266 | Bacteria | 7116587 |
| 1385 | 2793369429 | 2791355267 | Bacteria | 7222458 |
| 1386 | 2802719517 | 2802428858 | Bacteria | 6636079 |
| 1387 | 2802726890 | 2802428859 | Bacteria | 6667919 |
| 1388 | 2802732251 | 2802428860 | Bacteria | 6525526 |
| 1389 | 2802739854 | 2802428861 | Bacteria | 6534206 |
| 1390 | 2802745360 | 2802428862 | Bacteria | 6633353 |
| 1391 | 2802752752 | 2802428863 | Bacteria | 6410669 |
| 1392 | 2804752392 | 2802429268 | Bacteria | 6094027 |
| 1393 | 2805915335 | 2802429603 | Bacteria | 8777136 |
| 1394 | 2805929431 | 2802429605 | Bacteria | 6875453 |
| 1395 | 2805935387 | 2802429606 | Bacteria | 6346811 |
| 1396 | 2806044536 | 2802429633 | Bacteria | 7341974 |
| 1397 | 2806052737 | 2802429634 | Bacteria | 7083200 |
| 1398 | 2806059037 | 2802429635 | Bacteria | 7650140 |
| 1399 | 2806068300 | 2802429636 | Bacteria | 7597525 |
| 1400 | 2806074420 | 2802429637 | Bacteria | 7067217 |
| 1401 | 2808986726 | 2808606387 | Bacteria | 5697198 |
| 1402 | 2818238887 | 2816332527 | Bacteria | 8933356 |
| 1403 | 2819244365 | 2818991272 | Bacteria | 4622173 |
| 1404 | 2819556800 | 2818991439 | Bacteria | 6907412 |
| 1405 | 2819612185 | 2818991448 | Bacteria | 6772224 |
| 1406 | 2819639226 | 2818991453 | Bacteria | 7181617 |
| 1407 | 2821123279 | 2821123053 | Bacteria | 7836056 |
| 1408 | 2824605745 | 2824600985 | Bacteria | 8488197 |
| 1409 | 2824614458 | 2824609381 | Bacteria | 8672835 |
| 1410 | 2824623239 | 2824617872 | Bacteria | 8814715 |
| 1411 | 2824633177 | 2824626560 | Bacteria | 8813858 |
| 1412 | 2824640014 | 2824635225 | Bacteria | 8785348 |
| 1413 | 2824649699 | 2824644064 | Bacteria | 8743947 |
| 1414 | 2824657749 | 2824653114 | Bacteria | 8493680 |
| 1415 | 2824667126 | 2824661429 | Bacteria | 9877870 |
| 1416 | 2824677394 | 2824671348 | Bacteria | 8369588 |
| 1417 | 2824685260 | 2824679649 | Bacteria | 8248951 |
| 1418 | 2824693056 | 2824687955 | Bacteria | 8360029 |
| 1419 | 2824700757 | 2824696289 | Bacteria | 8335049 |
| 1420 | 2824711336 | 2824704595 | Bacteria | 9667483 |
| 1421 | 2824722402 | 2824714736 | Bacteria | 8717648 |
| 1422 | 2824732061 | 2824723954 | Bacteria | 8758240 |
| 1423 | 2824758195 | 2824753945 | Bacteria | 9787441 |
| 1424 | 2824768176 | 2824763712 | Bacteria | 9792355 |
| 1425 | 2824779545 | 2824773399 | Bacteria | 8360218 |
| 1426 | 2835314675 | 2835312727 | Bacteria | 7413381 |
| 1427 | 2835315267 | 2835312727 | Bacteria | 7413381 |
| 1428 | 2837683087 | 2837678835 | Bacteria | 5252418 |
| 1429 | 2838019132 | 2838016132 | Bacteria | 6577831 |
| 1430 | 2838031451 | 2838029111 | Bacteria | 6603031 |
| 1431 | 2838051150 | 2838048938 | Bacteria | 6044578 |
| 1432 | 2838063873 | 2838061910 | Bacteria | 6794874 |
| 1433 | 2838073357 | 2838068647 | Bacteria | 6208656 |
| 1434 | 2838079594 | 2838074704 | Bacteria | 6785777 |
| 1435 | 2838123749 | 2838122688 | Bacteria | 8803140 |
| 1436 | 2838677535 | 2838675328 | Bacteria | 4909118 |
| 1437 | 2838684936 | 2838680041 | Bacteria | 6545511 |
| 1438 | 2838691295 | 2838686498 | Bacteria | 7807632 |
| 1439 | 2838699227 | 2838694306 | Bacteria | 6853137 |
| 1440 | 2838703709 | 2838701080 | Bacteria | 6669771 |
| 1441 | 2838712708 | 2838707686 | Bacteria | 6619912 |
| 1442 | 2838716424 | 2838714209 | Bacteria | 5525906 |
| 1443 | 2838719776 | 2838719591 | Bacteria | 5523910 |
| 1444 | 2838727175 | 2838724970 | Bacteria | 4908691 |
| 1445 | 2838735778 | 2838729681 | Bacteria | 7400765 |
| 1446 | 2838739698 | 2838736955 | Bacteria | 5760694 |
| 1447 | 2838748680 | 2838742623 | Bacteria | 7396178 |
| 1448 | 2839998355 | 2839993093 | Bacteria | 5512535 |
| 1449 | 2841736075 | 2841734538 | Bacteria | 6784580 |
| 1450 | 2841844178 | 2841840854 | Bacteria | 5761912 |
| 1451 | 2841846707 | 2841846520 | Bacteria | 5345850 |
| 1452 | 2841853885 | 2841851746 | Bacteria | 7532261 |
| 1453 | 2841860764 | 2841859092 | Bacteria | 5436171 |
| 1454 | 2841868146 | 2841864319 | Bacteria | 6742987 |
| 1455 | 2841948642 | 2841941048 | Bacteria | 8688029 |
| 1456 | 2841949850 | 2841949485 | Bacteria | 8680857 |
| 1457 | 2841958666 | 2841957949 | Bacteria | 8652217 |
| 1458 | 2841966268 | 2841966195 | Bacteria | 8673214 |
| 1459 | 2841975005 | 2841974524 | Bacteria | 8931498 |
| 1460 | 2841983427 | 2841983080 | Bacteria | 8395090 |
| 1461 | 2842039066 | 2842038055 | Bacteria | 8002051 |
| 1462 | 2842047987 | 2842045827 | Bacteria | 8006841 |
| 1463 | 2842082185 | 2842077413 | Bacteria | 6508645 |
| 1464 | 2842113410 | 2842110456 | Bacteria | 7656360 |
| 1465 | 2842123108 | 2842118031 | Bacteria | 7033875 |
| 1466 | 2842127264 | 2842124991 | Bacteria | 5346824 |
| 1467 | 2842132428 | 2842130223 | Bacteria | 4909145 |
| 1468 | 2842143899 | 2842140634 | Bacteria | 5759631 |
| 1469 | 2842151218 | 2842146304 | Bacteria | 5957337 |
| 1470 | 2842152403 | 2842152218 | Bacteria | 4908957 |
| 1471 | 2842162597 | 2842156927 | Bacteria | 6894975 |
| 1472 | 2842169975 | 2842163707 | Bacteria | 6916235 |
| 1473 | 2842172669 | 2842170452 | Bacteria | 5525737 |
| 1474 | 2842176022 | 2842175837 | Bacteria | 4908771 |
| 1475 | 2842185034 | 2842180545 | Bacteria | 6888678 |
| 1476 | 2842189531 | 2842187318 | Bacteria | 5524014 |
| 1477 | 2842198237 | 2842192696 | Bacteria | 6147454 |
| 1478 | 2842208330 | 2842205361 | Bacteria | 6340321 |
| 1479 | 2842213845 | 2842211629 | Bacteria | 5523832 |
| 1480 | 2842224537 | 2842224351 | Bacteria | 5524473 |
| 1481 | 2842235593 | 2842229732 | Bacteria | 7475766 |
| 1482 | 2842241990 | 2842237096 | Bacteria | 6620661 |
| 1483 | 2842249373 | 2842243621 | Bacteria | 7421798 |
| 1484 | 2842256274 | 2842250916 | Bacteria | 6579627 |
| 1485 | 2842263490 | 2842257432 | Bacteria | 7401195 |
| 1486 | 2842266633 | 2842264693 | Bacteria | 6472963 |
| 1487 | 2842275770 | 2842271015 | Bacteria | 7807131 |
| 1488 | 2842281661 | 2842278818 | Bacteria | 6340002 |
| 1489 | 2842296185 | 2842291075 | Bacteria | 7076806 |
| 1490 | 2842302428 | 2842298080 | Bacteria | 6123127 |
| 1491 | 2842308246 | 2842304105 | Bacteria | 7023636 |
| 1492 | 2842316473 | 2842311132 | Bacteria | 6616990 |
| 1493 | 2842321362 | 2842317721 | Bacteria | 6793725 |
| 1494 | 2842345029 | 2842341865 | Bacteria | 7003929 |
| 1495 | 2842360839 | 2842357229 | Bacteria | 6485165 |
| 1496 | 2842369148 | 2842363717 | Bacteria | 6844742 |
| 1497 | 2842375613 | 2842370503 | Bacteria | 7038661 |
| 1498 | 2842382585 | 2842377471 | Bacteria | 7140707 |
| 1499 | 2842389986 | 2842384541 | Bacteria | 7057858 |
| 1500 | 2842398485 | 2842395702 | Bacteria | 6780583 |
| 1501 | 2842426992 | 2842422224 | Bacteria | 6239196 |
| 1502 | 2842429952 | 2842428310 | Bacteria | 6767288 |
| 1503 | 2842436388 | 2842434925 | Bacteria | 6502746 |
| 1504 | 2842444091 | 2842441272 | Bacteria | 6769273 |
| 1505 | 2842451055 | 2842447887 | Bacteria | 6754142 |
| 1506 | 2842464373 | 2842462802 | Bacteria | 6588055 |
| 1507 | 2842470717 | 2842469257 | Bacteria | 6752936 |
| 1508 | 2842477954 | 2842475841 | Bacteria | 6603183 |
| 1509 | 2842493302 | 2842489311 | Bacteria | 6620893 |
| 1510 | 2842499128 | 2842495871 | Bacteria | 6820686 |
| 1511 | 2842504763 | 2842502639 | Bacteria | 6604161 |
| 1512 | 2842517549 | 2842515876 | Bacteria | 5436280 |
| 1513 | 2842522690 | 2842521101 | Bacteria | 6569494 |
| 1514 | 2842872368 | 2842871566 | Bacteria | 4827117 |
| 1515 | 2842923976 | 2842922631 | Bacteria | 5824079 |
| 1516 | 2844003818 | 2844002411 | Bacteria | 7168230 |
| 1517 | 2844010450 | 2844009547 | Bacteria | 6728125 |
| 1518 | 2844167582 | 2844163670 | Bacteria | 7266046 |
| 1519 | 2844319500 | 2844315083 | Bacteria | 8138177 |
| 1520 | 2844457469 | 2844454524 | Bacteria | 7952546 |
| 1521 | 2847673181 | 2847670302 | Bacteria | 6165597 |
| 1522 | 2847689695 | 2847686936 | Bacteria | 6278406 |
| 1523 | 2847936209 | 2847930680 | Bacteria | 9342022 |
| 1524 | 2847946565 | 2847939898 | Bacteria | 8606328 |
| 1525 | 2849079310 | 2849076700 | Bacteria | 7039503 |
| 1526 | 2850081157 | 2850079185 | Bacteria | 6848280 |
| 1527 | 2852389098 | 2852387548 | Bacteria | 8025568 |
| 1528 | 2854682063 | 2854681122 | Bacteria | 4548679 |
| 1529 | 2854900802 | 2854896431 | Bacteria | 5869725 |
| 1530 | 2854918831 | 2854916844 | Bacteria | 5725939 |
| 1531 | 2855825988 | 2855825444 | Bacteria | 6785811 |
| 1532 | 2855841333 | 2855839649 | Bacteria | 7135830 |
| 1533 | 2856319786 | 2856314179 | Bacteria | 6477897 |
| 1534 | 2856320892 | 2856320880 | Bacteria | 7263508 |
| 1535 | 2856332866 | 2856328259 | Bacteria | 6528202 |
| 1536 | 2856340247 | 2856334872 | Bacteria | 7037011 |
| 1537 | 2856342172 | 2856342000 | Bacteria | 7176905 |
| 1538 | 2856353700 | 2856349417 | Bacteria | 6230045 |
| 1539 | 2856363311 | 2856356410 | Bacteria | 6297484 |
| 1540 | 2856366157 | 2856364286 | Bacteria | 6939991 |
| 1541 | 2857352623 | 2857349434 | Bacteria | 7926032 |
| 1542 | 2857371115 | 2857367948 | Bacteria | 6965560 |
| 1543 | 2857518877 | 2857516855 | Bacteria | 7787325 |
| 1544 | 2857533769 | 2857531043 | Bacteria | 6754041 |
| 1545 | 2858802320 | 2858800743 | Bacteria | 6603254 |
| 1546 | 2869165868 | 2869162929 | Bacteria | 6399702 |
| 1547 | 2869171985 | 2869169390 | Bacteria | 6659796 |
| 1548 | 2869239355 | 2869234852 | Bacteria | 6654993 |
| 1549 | 2869249017 | 2869242130 | Bacteria | 6609239 |
| 1550 | 2869254940 | 2869249662 | Bacteria | 6868783 |
| 1551 | 2869260691 | 2869256925 | Bacteria | 6981691 |
| 1552 | 2869267204 | 2869264136 | Bacteria | 6880765 |
| 1553 | 2869275465 | 2869271264 | Bacteria | 6908218 |
| 1554 | 2869280138 | 2869278585 | Bacteria | 7077053 |
| 1555 | 2869290988 | 2869285874 | Bacteria | 6901219 |
| 1556 | 2871433270 | 2871429161 | Bacteria | 6547891 |
| 1557 | 2871441977 | 2871435913 | Bacteria | 6880295 |
| 1558 | 2871463507 | 2871459585 | Bacteria | 6866887 |
| 1559 | 2871468359 | 2871466892 | Bacteria | 6923287 |
| 1560 | 2871475039 | 2871474448 | Bacteria | 6806570 |
| 1561 | 2871488368 | 2871481445 | Bacteria | 6700002 |
| 1562 | 2871491170 | 2871488783 | Bacteria | 6929816 |
| 1563 | 2871498916 | 2871495908 | Bacteria | 6935695 |
| 1564 | 2874105934 | 2874102143 | Bacteria | 6342645 |
| 1565 | 2874120873 | 2874116593 | Bacteria | 6674494 |
| 1566 | 2874131425 | 2874123672 | Bacteria | 7238285 |
| 1567 | 2874132980 | 2874131515 | Bacteria | 6820270 |
| 1568 | 2874143309 | 2874139085 | Bacteria | 7021506 |
| 1569 | 2874148788 | 2874146452 | Bacteria | 7533118 |
| 1570 | 2874160834 | 2874155637 | Bacteria | 6724144 |
| 1571 | 2874164783 | 2874162495 | Bacteria | 6174670 |
| 1572 | 2874172064 | 2874168670 | Bacteria | 8062617 |
| 1573 | 2874598047 | 2874590934 | Bacteria | 8299676 |
| 1574 | 2874615408 | 2874612657 | Bacteria | 8252029 |
| 1575 | 2874627828 | 2874620515 | Bacteria | 8290088 |
| 1576 | 2874631855 | 2874628541 | Bacteria | 8630250 |
| 1577 | 2874647507 | 2874645413 | Bacteria | 8214782 |
| 1578 | 2876363543 | 2876363079 | Bacteria | 6544991 |
| 1579 | 2876373026 | 2876369609 | Bacteria | 6807521 |
| 1580 | 2876382929 | 2876377896 | Bacteria | 6565995 |
| 1581 | 2876391354 | 2876386047 | Bacteria | 6698674 |
| 1582 | 2876397340 | 2876392853 | Bacteria | 6660880 |
| 1583 | 2876403926 | 2876399893 | Bacteria | 6927900 |
| 1584 | 2876410068 | 2876406927 | Bacteria | 6191900 |
| 1585 | 2876418874 | 2876413966 | Bacteria | 6831344 |
| 1586 | 2876426048 | 2876420981 | Bacteria | 6687741 |
| 1587 | 2876766943 | 2876761206 | Bacteria | 10111113 |
| 1588 | 2876778475 | 2876771140 | Bacteria | 8287509 |
| 1589 | 2876820421 | 2876818435 | Bacteria | 8274608 |
| 1590 | 2878039739 | 2878035449 | Bacteria | 6555736 |
| 1591 | 2878733682 | 2878730984 | Bacteria | 6380721 |
| 1592 | 2878740624 | 2878738818 | Bacteria | 7136951 |
| 1593 | 2878750883 | 2878745973 | Bacteria | 6867388 |
| 1594 | 2878755579 | 2878753008 | Bacteria | 6922523 |
| 1595 | 2878763129 | 2878760144 | Bacteria | 6823465 |
| 1596 | 2878770104 | 2878767105 | Bacteria | 6898628 |
| 1597 | 2878780050 | 2878774303 | Bacteria | 6108671 |
| 1598 | 2878781873 | 2878781027 | Bacteria | 6834456 |
| 1599 | 2878795242 | 2878788777 | Bacteria | 6567085 |
| 1600 | 2879082269 | 2879074833 | Bacteria | 8279565 |
| 1601 | 2879083705 | 2879083081 | Bacteria | 8587928 |
| 1602 | 2879101241 | 2879099564 | Bacteria | 10442239 |
| 1603 | 2879135416 | 2879127579 | Bacteria | 8294491 |
| 1604 | 2879150624 | 2879142872 | Bacteria | 8267021 |
| 1605 | 2881147898 | 2881147464 | Bacteria | 7779814 |
| 1606 | 2881159071 | 2881155292 | Bacteria | 6461656 |
| 1607 | 2881164678 | 2881161766 | Bacteria | 7127907 |
| 1608 | 2881671171 | 2881665667 | Bacteria | 8175609 |
| 1609 | 2881847929 | 2881845957 | Bacteria | 6611900 |
| 1610 | 2881859601 | 2881853255 | Bacteria | 6698367 |
| 1611 | 2881867237 | 2881861095 | Bacteria | 7128710 |
| 1612 | 2882457510 | 2882456835 | Bacteria | 6863978 |
| 1613 | 2882457540 | 2882456835 | Bacteria | 6863978 |
| 1614 | 2882457711 | 2882456835 | Bacteria | 6863978 |
| 1615 | 2882634694 | 2882632389 | Bacteria | 8154593 |
| 1616 | 2882918198 | 2882912400 | Bacteria | 6801539 |
| 1617 | 2884300795 | 2884298095 | Bacteria | 3823049 |
| 1618 | 2885306520 | 2885305155 | Bacteria | 7348390 |
| 1619 | 2885314468 | 2885312484 | Bacteria | 6415165 |
| 1620 | 2885324216 | 2885318864 | Bacteria | 6729568 |
| 1621 | 2885333295 | 2885326080 | Bacteria | 7134805 |
| 1622 | 2885337006 | 2885334103 | Bacteria | 7216818 |
| 1623 | 2885352224 | 2885350715 | Bacteria | 6787678 |
| 1624 | 2885413692 | 2885409591 | Bacteria | 9235467 |
| 1625 | 2888342995 | 2888337043 | Bacteria | 6629336 |
| 1626 | 2888344044 | 2888343758 | Bacteria | 6611049 |
| 1627 | 2888352805 | 2888350351 | Bacteria | 7372807 |
| 1628 | 2888384063 | 2888378607 | Bacteria | 9652610 |
| 1629 | 2888393794 | 2888388044 | Bacteria | 7304136 |
| 1630 | 2888424475 | 2888419890 | Bacteria | 7857137 |
| 1631 | 2889014580 | 2889010040 | Bacteria | 6749192 |
| 1632 | 2889020438 | 2889016732 | Bacteria | 6700763 |
| 1633 | 2889919154 | 2889914905 | Bacteria | 5702301 |
| 1634 | 2894239106 | 2894232714 | Bacteria | 8834183 |
| 1635 | 2894655527 | 2894652903 | Bacteria | 4587256 |
| 1636 | 2896389937 | 2896384573 | Bacteria | 7700774 |
| 1637 | 2898798926 | 2898795034 | Bacteria | 4294459 |
| 1638 | 2899794409 | 2899792073 | Bacteria | 4926588 |
| 1639 | 2899808658 | 2899803654 | Bacteria | 5577784 |
| 1640 | 2899845792 | 2899845264 | Bacteria | 5672268 |
| 1641 | 2903454374 | 2903448605 | Bacteria | 7357801 |
| 1642 | 2903498946 | 2903492973 | Bacteria | 13473544 |
| 1643 | 2903501539 | 2903492973 | Bacteria | 13473544 |
| 1644 | 2903525493 | 2903521522 | Bacteria | 6525694 |
| 1645 | 2903531762 | 2903528002 | Bacteria | 6586099 |
| 1646 | 2903543715 | 2903540706 | Bacteria | 7062119 |
| 1647 | 2903734436 | 2903727486 | Bacteria | 8281579 |
| 1648 | 2904584140 | 2904578770 | Bacteria | 5302906 |
| 1649 | 2904664094 | 2904659560 | Bacteria | 6685615 |
| 1650 | 2904672852 | 2904666416 | Bacteria | 8226587 |
| 1651 | 2904714618 | 2904711408 | Bacteria | 9771557 |
| 1652 | 2906313808 | 2906308376 | Bacteria | 6841989 |
| 1653 | 2906326517 | 2906321335 | Bacteria | 6579571 |
| 1654 | 2906334889 | 2906328253 | Bacteria | 6585166 |
| 1655 | 2906354969 | 2906354277 | Bacteria | 6991324 |
| 1656 | 2906367875 | 2906363423 | Bacteria | 6856682 |
| 1657 | 2906375568 | 2906370794 | Bacteria | 6881062 |
| 1658 | 2906380841 | 2906378014 | Bacteria | 6911440 |
| 1659 | 2906398191 | 2906393657 | Bacteria | 6790866 |
| 1660 | 2906401483 | 2906401398 | Bacteria | 6693206 |
| 1661 | 2906411273 | 2906408224 | Bacteria | 6162342 |
| 1662 | 2906420562 | 2906414383 | Bacteria | 6580790 |
| 1663 | 2906432778 | 2906427513 | Bacteria | 6375796 |
| 1664 | 2906609232 | 2906602504 | Bacteria | 8295279 |
| 1665 | 2906633266 | 2906626472 | Bacteria | 8826946 |
| 1666 | 2906651447 | 2906643746 | Bacteria | 8722424 |
| 1667 | 2913300841 | 2913295892 | Bacteria | 6333755 |
| 1668 | 2913313844 | 2913308742 | Bacteria | 5350706 |
| 1669 | 2915981890 | 2915980308 | Bacteria | 6624279 |
| 1670 | 2915991341 | 2915986958 | Bacteria | 6739310 |
| 1671 | 2915994365 | 2915993759 | Bacteria | 7016183 |
| 1672 | 2916004386 | 2916000859 | Bacteria | 6865702 |
| 1673 | 2916008150 | 2916007675 | Bacteria | 6898660 |
| 1674 | 2916015089 | 2916014648 | Bacteria | 6946486 |
| 1675 | 2916024236 | 2916021584 | Bacteria | 6854472 |
| 1676 | 2916031768 | 2916028427 | Bacteria | 6748433 |
| 1677 | 2916041270 | 2916035215 | Bacteria | 6755766 |
| 1678 | 2916042536 | 2916041962 | Bacteria | 6820487 |
| 1679 | 2916052276 | 2916048683 | Bacteria | 6543552 |
| 1680 | 2916056437 | 2916055098 | Bacteria | 6758838 |
| 1681 | 2916067576 | 2916061851 | Bacteria | 6737736 |
| 1682 | 2916075702 | 2916068649 | Bacteria | 6943657 |
| 1683 | 2916080863 | 2916076590 | Bacteria | 6596108 |
| 1684 | 2919075731 | 2919073203 | Bacteria | 6531949 |
| 1685 | 2919116641 | 2919114240 | Bacteria | 5700270 |
| 1686 | 2919125020 | 2919119836 | Bacteria | 5208557 |
| 1687 | 2919168460 | 2919166419 | Bacteria | 4952238 |
| 1688 | 2919172424 | 2919171160 | Bacteria | 6499771 |
| 1689 | 2919409333 | 2919408235 | Bacteria | 6149349 |
| 1690 | 2919454316 | 2919450847 | Bacteria | 5631160 |
| 1691 | 2920766095 | 2920760137 | Bacteria | 7427611 |
| 1692 | 2920824721 | 2920822456 | Bacteria | 6897201 |
| 1693 | 2921201938 | 2921201388 | Bacteria | 6926299 |
| 1694 | 2921211204 | 2921208531 | Bacteria | 6745326 |
| 1695 | 2921240723 | 2921237296 | Bacteria | 6876710 |
| 1696 | 2921244634 | 2921244191 | Bacteria | 6568419 |
| 1697 | 2921251173 | 2921250672 | Bacteria | 6677771 |
| 1698 | 2921262468 | 2921257292 | Bacteria | 6808382 |
| 1699 | 2921265116 | 2921263974 | Bacteria | 6864552 |
| 1700 | 2921283767 | 2921282425 | Bacteria | 6826397 |
| 1701 | 2921296325 | 2921289301 | Bacteria | 7316391 |
| 1702 | 2921303773 | 2921296804 | Bacteria | 7176999 |
| 1703 | 2922135182 | 2922130491 | Bacteria | 7173936 |
| 1704 | 2922155086 | 2922151315 | Bacteria | 6902399 |
| 1705 | 2922165083 | 2922158528 | Bacteria | 6573167 |
| 1706 | 2922177911 | 2922172374 | Bacteria | 6167644 |
| 1707 | 2922184595 | 2922178524 | Bacteria | 6025201 |
| 1708 | 2922186354 | 2922185730 | Bacteria | 7113964 |
| 1709 | 2922374395 | |||
| 1710 | 2922396239 | 2922393267 | Bacteria | 8285685 |
| 1711 | 2923558760 | 2923556063 | Bacteria | 6793593 |
| 1712 | 2924147098 | 2924144063 | Bacteria | 6883928 |
| 1713 | 2924155258 | 2924150972 | Bacteria | 7169444 |
| 1714 | 2924160763 | 2924158325 | Bacteria | 7188855 |
| 1715 | 2924167341 | 2924165586 | Bacteria | 7260590 |
| 1716 | 2924178982 | 2924172951 | Bacteria | 6749356 |
| 1717 | 2924184070 | 2924179722 | Bacteria | 6843264 |
| 1718 | 2924189069 | 2924186466 | Bacteria | 6876637 |
| 1719 | 2924194796 | 2924193448 | Bacteria | 6955718 |
| 1720 | 2924203356 | 2924200457 | Bacteria | 6757188 |
| 1721 | 2924208830 | 2924207177 | Bacteria | 6917007 |
| 1722 | 2924217920 | 2924214083 | Bacteria | 7080103 |
| 1723 | 2924226508 | 2924221636 | Bacteria | 7113495 |
| 1724 | 2924229950 | 2924228884 | Bacteria | 6633132 |
| 1725 | 2924723133 | 2924718760 | Bacteria | 6331356 |
| 1726 | 2924728230 | 2924726620 | Bacteria | 6271473 |
| 1727 | 2924736665 | 2924733363 | Bacteria | 7574837 |
| 1728 | 2924741501 | 2924741084 | Bacteria | 6661321 |
| 1729 | 2924754607 | 2924748358 | Bacteria | 6154725 |
| 1730 | 2924764011 | 2924762789 | Bacteria | 6561353 |
| 1731 | 2924778225 | 2924776078 | Bacteria | 7492003 |
| 1732 | 2924785569 | 2924784321 | Bacteria | 7416538 |
| 1733 | 2926754650 | 2926754445 | Bacteria | 5964435 |
| 1734 | 2926761818 | 2926760298 | Bacteria | 5505990 |
| 1735 | 2928524268 | 2928521798 | Bacteria | 4960112 |
| 1736 | 2929142117 | 2929138655 | Bacteria | 5810547 |
| 1737 | 2929618065 | 2929615660 | Bacteria | 9193770 |
| 1738 | 2929627746 | 2929624759 | Bacteria | 9339455 |
| 1739 | 2932790355 | 2932784394 | Bacteria | 9704911 |
| 1740 | 2932810775 | 2932809354 | Bacteria | 9135765 |
| 1741 | 2932823894 | 2932818245 | Bacteria | 9955613 |
| 1742 | 2933007050 | 2933006813 | Bacteria | 4912075 |
| 1743 | 2933015360 | 2933011516 | Bacteria | 5439334 |
| 1744 | 2933574695 | 2933570622 | Bacteria | 7023390 |
| 1745 | 2933579993 | 2933577622 | Bacteria | 9116884 |
| 1746 | 2933589300 | 2933586486 | Bacteria | 7667493 |
| 1747 | 2933594252 | 2933594066 | Bacteria | 5594265 |
| 1748 | 2933603512 | 2933599457 | Bacteria | 5858799 |
| 1749 | 2935608885 | 2935608549 | Bacteria | 8203142 |
| 1750 | 2935623052 | 2935616580 | Bacteria | 9032984 |
| 1751 | 2935642416 | 2935638405 | Bacteria | 10015038 |
| 1752 | 2935650051 | 2935648319 | Bacteria | 8801166 |
| 1753 | 2935661797 | 2935656913 | Bacteria | 8965014 |
| 1754 | 2935668281 | 2935665750 | Bacteria | 9571747 |
| 1755 | 2935676312 | 2935675223 | Bacteria | 9928132 |
| 1756 | 2935692919 | 2935684952 | Bacteria | 9590419 |
| 1757 | 2935701078 | 2935694250 | Bacteria | 9291695 |
| 1758 | 2935706141 | 2935703347 | Bacteria | 10242284 |
| 1759 | 2935721356 | 2935713505 | Bacteria | 9608509 |
| 1760 | 2935730274 | 2935722832 | Bacteria | 9608746 |
| 1761 | 2935740287 | 2935732158 | Bacteria | 9706831 |
| 1762 | 2935749551 | 2935741537 | Bacteria | 9707219 |
| 1763 | 2935759136 | 2935750917 | Bacteria | 9590372 |
| 1764 | 2935762536 | 2935760218 | Bacteria | 9817913 |
| 1765 | 2935773297 | 2935769743 | Bacteria | 7878163 |
| 1766 | 2935778538 | 2935777560 | Bacteria | 8077691 |
| 1767 | 2935792749 | 2935785616 | Bacteria | 7962367 |
| 1768 | 2935800776 | 2935793552 | Bacteria | 8012592 |
| 1769 | 2935803140 | 2935801545 | Bacteria | 9301974 |
| 1770 | 2935814456 | 2935810662 | Bacteria | 9401221 |
| 1771 | 2935822045 | 2935819856 | Bacteria | 8261050 |
| 1772 | 2935831594 | 2935827899 | Bacteria | 10038562 |
| 1773 | 2935838454 | 2935837841 | Bacteria | 9454360 |
| 1774 | 2935847627 | 2935847175 | Bacteria | 8228321 |
| 1775 | 2935861300 | 2935855204 | Bacteria | 9035059 |
| 1776 | 2935865838 | 2935864058 | Bacteria | 9784707 |
| 1777 | 2935878339 | 2935873716 | Bacteria | 9632195 |
| 1778 | 2935899711 | 2935894831 | Bacteria | 6620579 |
| 1779 | 2935907530 | 2935901341 | Bacteria | 7341747 |
| 1780 | 2935909102 | 2935908558 | Bacteria | 8568796 |
| 1781 | 2935919823 | 2935916978 | Bacteria | 9113783 |
| 1782 | 2935926324 | 2935926038 | Bacteria | 8601059 |
| 1783 | 2935934774 | 2935934488 | Bacteria | 8602579 |
| 1784 | 2935943224 | 2935942939 | Bacteria | 8599779 |
| 1785 | 2935951662 | 2935951376 | Bacteria | 8602333 |
| 1786 | 2935967787 | 2935967501 | Bacteria | 8603075 |
| 1787 | 2935982671 | 2935975950 | Bacteria | 8347125 |
| 1788 | 2935988165 | 2935984226 | Bacteria | 8302647 |
| 1789 | 2935994652 | 2935992306 | Bacteria | 9802711 |
| 1790 | 2936007549 | 2936002035 | Bacteria | 9362176 |
| 1791 | 2936012465 | 2936011229 | Bacteria | 8801034 |
| 1792 | 2936021030 | 2936019824 | Bacteria | 8804134 |
| 1793 | 2936029758 | 2936028420 | Bacteria | 8965941 |
| 1794 | 2936040013 | 2936037263 | Bacteria | 9446081 |
| 1795 | 2936047223 | 2936046547 | Bacteria | 8903709 |
| 1796 | 2936057618 | 2936055302 | Bacteria | 8785755 |
| 1797 | 2936374846 | 2936367885 | Bacteria | 7324495 |
| 1798 | 2936380538 | 2936375103 | Bacteria | 6652732 |
| 1799 | 2936998124 | 2936996657 | Bacteria | 6298727 |
| 1800 | 2937005064 | 2937002841 | Bacteria | 6934057 |
| 1801 | 2937012208 | 2937009748 | Bacteria | 6746052 |
| 1802 | 2937018633 | 2937016420 | Bacteria | 6782579 |
| 1803 | 2937028972 | 2937023124 | Bacteria | 6815156 |
| 1804 | 2937031276 | 2937029754 | Bacteria | 6424026 |
| 1805 | 2937038583 | 2937036028 | Bacteria | 6846469 |
| 1806 | 2937045881 | 2937042894 | Bacteria | 6741576 |
| 1807 | 2937050950 | 2937049772 | Bacteria | 6757901 |
| 1808 | 2937061544 | 2937056579 | Bacteria | 7107896 |
| 1809 | 2937065229 | 2937063883 | Bacteria | 7199456 |
| 1810 | 2937073048 | 2937071275 | Bacteria | 6984483 |
| 1811 | 2937079798 | 2937078374 | Bacteria | 6610289 |
| 1812 | 2937085166 | 2937084907 | Bacteria | 6618516 |
| 1813 | 2937097588 | 2937091812 | Bacteria | 6979387 |
| 1814 | 2937099535 | 2937098957 | Bacteria | 7249374 |
| 1815 | 2937110009 | 2937106411 | Bacteria | 6947143 |
| 1816 | 2937116269 | 2937113482 | Bacteria | 6505872 |
| 1817 | 2937123079 | 2937119839 | Bacteria | 6597547 |
| 1818 | 2937128708 | 2937126314 | Bacteria | 6771275 |
| 1819 | 2937819887 | 2937813078 | Bacteria | 7783518 |
| 1820 | 2937826378 | 2937822353 | Bacteria | 7290551 |
| 1821 | 2937836691 | 2937836603 | Bacteria | 6811263 |
| 1822 | 2937847812 | 2937843397 | Bacteria | 5256375 |
| 1823 | 2937847813 | 2937843397 | Bacteria | 5256375 |
| 1824 | 2937854682 | 2937848649 | Bacteria | 6983481 |
| 1825 | 2937861906 | 2937861824 | Bacteria | 6660327 |
| 1826 | 2937878346 | 2937877337 | Bacteria | 7246526 |
| 1827 | 2937892192 | 2937891427 | Bacteria | 6357007 |
| 1828 | 2937980258 | 2937972304 | Bacteria | 7532020 |
| 1829 | 2937982872 | 2937980651 | Bacteria | 6517427 |
| 1830 | 2937997564 | 2937994558 | Bacteria | 7036190 |
| 1831 | 2938018158 | 2938014810 | Bacteria | 6700592 |
| 1832 | 2939672400 | 2939669807 | Bacteria | 5028511 |
| 1833 | 2940564859 | 2940556831 | Bacteria | 9590747 |
| 1834 | 2941504977 | 2941499720 | Bacteria | 7599444 |
| 1835 | 2941533285 | 2941531003 | Bacteria | 7653939 |
| 1836 | 2941538878 | 2941538514 | Bacteria | 9402094 |
| 1837 | 2954013218 | 2954011201 | Bacteria | 4762601 |
| 1838 | 2957384802 | 2957382221 | Bacteria | 6737050 |
| 1839 | 2957394844 | 2957388812 | Bacteria | 6778072 |
| 1840 | 2957398270 | 2957395598 | Bacteria | 6822399 |
| 1841 | 2957403206 | 2957402308 | Bacteria | 6741770 |
| 1842 | 2957411599 | 2957408893 | Bacteria | 6558585 |
| 1843 | 2957418323 | 2957415311 | Bacteria | 6991633 |
| 1844 | 2957423296 | 2957422303 | Bacteria | 7172205 |
| 1845 | 2957432799 | 2957430029 | Bacteria | 7022557 |
| 1846 | 2957441264 | 2957437181 | Bacteria | 6568994 |
| 1847 | 2957444988 | 2957443900 | Bacteria | 6869977 |
| 1848 | 2957455969 | 2957450854 | Bacteria | 6765715 |
| 1849 | 2957459920 | 2957457609 | Bacteria | 6967680 |
| 1850 | 2957465992 | 2957464669 | Bacteria | 6568877 |
| 1851 | 2957477087 | 2957471148 | Bacteria | 6797643 |
| 1852 | 2957479219 | 2957478035 | Bacteria | 6756658 |
| 1853 | 2957486256 | 2957484790 | Bacteria | 6703082 |
| 1854 | 2957492868 | 2957491536 | Bacteria | 6695180 |
| 1855 | 2957498692 | 2957498199 | Bacteria | 7126688 |
| 1856 | 2957507657 | 2957505466 | Bacteria | 7253085 |
| 1857 | 2958036004 | 2958034702 | Bacteria | 6989922 |
| 1858 | 2958045310 | 2958041894 | Bacteria | 13082850 |
| 1859 | 2958068017 | 2958064165 | Bacteria | 7158582 |
| 1860 | 2958076059 | 2958071322 | Bacteria | 6815895 |
| 1861 | 2958085462 | 2958084443 | Bacteria | 7312792 |
| 1862 | 2958098827 | 2958092219 | Bacteria | 6861151 |
| 1863 | 2958101736 | 2958100919 | Bacteria | 6800575 |
| 1864 | 2958108961 | 2958108152 | Bacteria | 6681128 |
| 1865 | 2958119418 | 2958115193 | Bacteria | 6923548 |
| 1866 | 2958127179 | 2958122699 | Bacteria | 7280457 |
| 1867 | 2958135388 | 2958130278 | Bacteria | 6897202 |
| 1868 | 2958139459 | 2958137437 | Bacteria | 6050276 |
| 1869 | 2958145512 | 2958144490 | Bacteria | 6677056 |
| 1870 | 2958161411 | 2958158011 | Bacteria | 6058449 |
| 1871 | 2958168037 | 2958165035 | Bacteria | 6906348 |
| 1872 | 2958178982 | 2958172287 | Bacteria | 6716688 |
| 1873 | 2958184417 | 2958179912 | Bacteria | 6874908 |
| 1874 | 2960584303 | 2960584000 | Bacteria | 6864594 |
| 1875 | 2960592717 | 2960591022 | Bacteria | 6622873 |
| 1876 | 2960602687 | 2960597568 | Bacteria | 6550735 |
| 1877 | 2960605934 | 2960603979 | Bacteria | 6898737 |
| 1878 | 2960612420 | 2960610863 | Bacteria | 6691244 |
| 1879 | 2960620014 | 2960617483 | Bacteria | 6727748 |
| 1880 | 2960629228 | 2960624210 | Bacteria | 6875384 |
| 1881 | 2960632834 | 2960631154 | Bacteria | 6732508 |
| 1882 | 2960639852 | 2960637947 | Bacteria | 7296468 |
| 1883 | 2960650504 | 2960645483 | Bacteria | 7211087 |
| 1884 | 2960660039 | 2960652885 | Bacteria | 7083688 |
| 1885 | 2960660850 | 2960660292 | Bacteria | 7041660 |
| 1886 | 2960670966 | 2960667422 | Bacteria | 6763020 |
| 1887 | 2960675913 | 2960674078 | Bacteria | 6609048 |
| 1888 | 2960681859 | 2960680706 | Bacteria | 6624464 |
| 1889 | 2960688014 | 2960687367 | Bacteria | 6535474 |
| 1890 | 2960694661 | 2960693952 | Bacteria | 6749742 |
| 1891 | 2961082472 | 2961077736 | Bacteria | 7079850 |
| 1892 | 2961118766 | 2961114664 | Bacteria | 6680456 |
| 1893 | 2961129736 | 2961127735 | Bacteria | 7196641 |
| 1894 | 2961166503 | 2961163497 | Bacteria | 6901077 |
| 1895 | 2961176477 | 2961170736 | Bacteria | 7072258 |
| 1896 | 2961190417 | 2961183825 | Bacteria | 6688536 |
| 1897 | 2963645003 | 2963644680 | Bacteria | 6530403 |
| 1898 | 2964611615 | 2964607997 | Bacteria | 7101408 |
| 1899 | 2964616576 | 2964615318 | Bacteria | 6809089 |
| 1900 | 2964622582 | 2964621998 | Bacteria | 6834995 |
| 1901 | 2964635803 | 2964628898 | Bacteria | 7083044 |
| 1902 | 2964640947 | 2964636051 | Bacteria | 7091832 |
| 1903 | 2964649473 | 2964643177 | Bacteria | 6820887 |
| 1904 | 2964651787 | 2964649959 | Bacteria | 6675118 |
| 1905 | 2964661011 | 2964656573 | Bacteria | 7100150 |
| 1906 | 2964667043 | 2964663802 | Bacteria | 7019362 |
| 1907 | 2964677501 | 2964670856 | Bacteria | 6851364 |
| 1908 | 2964684091 | 2964678106 | Bacteria | 6792020 |
| 1909 | 2964687675 | 2964685014 | Bacteria | 6839111 |
| 1910 | 2964692863 | 2964691889 | Bacteria | 6802758 |
| 1911 | 2964702322 | 2964698721 | Bacteria | 6765331 |
| 1912 | 2964711844 | 2964705432 | Bacteria | 7114648 |
| 1913 | 2964716771 | 2964712639 | Bacteria | 6695970 |
| 1914 | 2964723890 | 2964719344 | Bacteria | 7286602 |
| 1915 | 2965021323 | 2965018300 | Bacteria | 6883036 |
| 1916 | 2965030313 | 2965025482 | Bacteria | 6532201 |
| 1917 | 2965038417 | 2965032056 | Bacteria | 6887443 |
| 1918 | 2965046986 | 2965040258 | Bacteria | 6855979 |
| 1919 | 2965054068 | 2965047637 | Bacteria | 6623551 |
| 1920 | 2965066309 | 2965062239 | Bacteria | 7412989 |
| 1921 | 2965094312 | 2965089291 | Bacteria | 6866420 |
| 1922 | 2965107799 | 2965102966 | Bacteria | 6800987 |
| 1923 | 2965126747 | 2965119406 | Bacteria | 6956431 |
| 1924 | 2967665501 | 2967664464 | Bacteria | 6948836 |
| 1925 | 2967672560 | 2967671571 | Bacteria | 7021409 |
| 1926 | 2967681857 | 2967678726 | Bacteria | 7264382 |
| 1927 | 2967691700 | 2967686174 | Bacteria | 6678622 |
| 1928 | 2967695255 | 2967693043 | Bacteria | 6804451 |
| 1929 | 2967703245 | 2967699805 | Bacteria | 6854538 |
| 1930 | 2967707788 | 2967706974 | Bacteria | 7186053 |
| 1931 | 2967716661 | 2967714385 | Bacteria | 7000047 |
| 1932 | 2967721662 | 2967721400 | Bacteria | 7073753 |
| 1933 | 2967734983 | 2967728569 | Bacteria | 6641507 |
| 1934 | 2967736860 | 2967735183 | Bacteria | 6827012 |
| 1935 | 2967744128 | 2967742019 | Bacteria | 6794534 |
| 1936 | 2967755481 | 2967748971 | Bacteria | 6733771 |
| 1937 | 2967758749 | 2967755722 | Bacteria | 6814706 |
| 1938 | 2967765379 | 2967762386 | Bacteria | 6923502 |
| 1939 | 2967775657 | 2967769361 | Bacteria | 6587838 |
| 1940 | 2967782292 | 2967775926 | Bacteria | 6738189 |
| 1941 | 2968001506 | 2967996073 | Bacteria | 6787468 |
| 1942 | 2968007559 | 2968003550 | Bacteria | 6929263 |
| 1943 | 2968017258 | 2968016561 | Bacteria | 7022047 |
| 1944 | 2968088715 | 2968083720 | Bacteria | 7351627 |
| 1945 | 2968093852 | 2968091066 | Bacteria | 6052692 |
| 1946 | 2968097725 | 2968097103 | Bacteria | 6107094 |
| 1947 | 2968115233 | 2968110612 | Bacteria | 6814636 |
| 1948 | 2968121968 | 2968117919 | Bacteria | 6536078 |
| 1949 | 2968134129 | 2968128360 | Bacteria | 6270294 |
| 1950 | 2968142241 | 2968138860 | Bacteria | 6605449 |
| 1951 | 2968174907 | 2968171901 | Bacteria | 6894245 |
| 1952 | 2970026519 | 2970019648 | Bacteria | 7072033 |
| 1953 | 2970031011 | 2970026789 | Bacteria | 6785236 |
| 1954 | 2970039721 | 2970033650 | Bacteria | 7118744 |
| 1955 | 2970041328 | 2970040964 | Bacteria | 6731123 |
| 1956 | 2970054421 | 2970047711 | Bacteria | 7088379 |
| 1957 | 2970057812 | 2970054988 | Bacteria | 6611507 |
| 1958 | 2970066697 | 2970061556 | Bacteria | 7099761 |
| 1959 | 2970073000 | 2970068827 | Bacteria | 7123112 |
| 1960 | 2970077458 | 2970076120 | Bacteria | 6697332 |
| 1961 | 2970083746 | 2970082768 | Bacteria | 6183754 |
| 1962 | 2970091173 | 2970088815 | Bacteria | 6933825 |
| 1963 | 2970097288 | 2970095765 | Bacteria | 6936963 |
| 1964 | 2970107499 | 2970102677 | Bacteria | 6812532 |
| 1965 | 2970110866 | 2970109326 | Bacteria | 6863976 |
| 1966 | 2970122166 | 2970116247 | Bacteria | 6501857 |
| 1967 | 2970122980 | 2970122695 | Bacteria | 6625855 |
| 1968 | 2970131683 | 2970129317 | Bacteria | 6806560 |
| 1969 | 2970138581 | 2970136068 | Bacteria | 7207982 |
| 1970 | 2970144100 | 2970143518 | Bacteria | 6446480 |
| 1971 | 2970154256 | 2970149975 | Bacteria | 6779706 |
| 1972 | 2970160120 | 2970156795 | Bacteria | 7168044 |
| 1973 | 2970167122 | 2970164137 | Bacteria | 6861252 |
| 1974 | 2970173284 | 2970170962 | Bacteria | 6876229 |
| 1975 | 2970178377 | 2970177841 | Bacteria | 6768001 |
| 1976 | 2970187579 | 2970184632 | Bacteria | 7054431 |
| 1977 | 2970193336 | 2970191845 | Bacteria | 7032787 |
| 1978 | 2970470615 | 2970469710 | Bacteria | 6969209 |
| 1979 | 2970490168 | 2970489779 | Bacteria | 6517260 |
| 1980 | 2970509148 | 2970503327 | Bacteria | 7099517 |
| 1981 | 2970514787 | 2970510686 | Bacteria | 7006402 |
| 1982 | 2970525748 | 2970524798 | Bacteria | 6840927 |
| 1983 | 2970536594 | 2970532167 | Bacteria | 6553173 |
| 1984 | 2970544000 | 2970540015 | Bacteria | 6977556 |
| 1985 | 2970550468 | 2970547951 | Bacteria | 6931819 |
| 1986 | 2970557977 | 2970554993 | Bacteria | 6814252 |
| 1987 | 2970594735 | 2970593180 | Bacteria | 7073582 |
| 1988 | 2970623981 | 2970619444 | Bacteria | 6986144 |
| 1989 | 2977522403 | 2977516862 | Bacteria | 6940108 |
| 1990 | 2977529043 | 2977523885 | Bacteria | 6960446 |
| 1991 | 2977531669 | 2977530762 | Bacteria | 6951399 |
| 1992 | 2977540564 | 2977537788 | Bacteria | 6929320 |
| 1993 | 2977549084 | 2977544691 | Bacteria | 6875412 |
| 1994 | 2977554418 | 2977551784 | Bacteria | 7125765 |
| 1995 | 2977560182 | 2977558990 | Bacteria | 6863948 |
| 1996 | 2977572260 | 2977565890 | Bacteria | 6901543 |
| 1997 | 2977575289 | 2977572785 | Bacteria | 6763888 |
| 1998 | 2977580173 | 2977579622 | Bacteria | 6772100 |
| 1999 | 2977824719 | 2977821940 | Bacteria | 6906439 |
| 2000 | 2977835715 | 2977828996 | Bacteria | 7007971 |
| 2001 | 2977845485 | 2977843712 | Bacteria | 6753583 |
| 2002 | 2977857594 | 2977851361 | Bacteria | 6694324 |
| 2003 | 2977864368 | 2977858184 | Bacteria | 6215359 |
| 2004 | 2977866508 | 2977864932 | Bacteria | 7534097 |
| 2005 | 2977873694 | 2977872689 | Bacteria | 7270173 |
| 2006 | 2977905298 | 2977898635 | Bacteria | 6675551 |
| 2007 | 2977908976 | 2977907340 | Bacteria | 6577984 |
| 2008 | 2977918008 | 2977915119 | Bacteria | 6829656 |
| 2009 | 2977925870 | 2977922695 | Bacteria | 6956781 |
| 2010 | 2977939515 | 2977935797 | Bacteria | 6252826 |
| 2011 | 2977944147 | 2977942078 | Bacteria | 7570577 |
| 2012 | 2977951496 | 2977950692 | Bacteria | 6893264 |
| 2013 | 2977963420 | 2977957713 | Bacteria | 6877875 |
| 2014 | 2977978799 | 2977971508 | Bacteria | 7472917 |
| 2015 | 2977991602 | 2977986579 | Bacteria | 6581278 |
| 2016 | 2978971135 | 2978969890 | Bacteria | 5400756 |
| 2017 | 2979092916 | 2979089926 | Bacteria | 5670289 |
| 2018 | 2979099695 | 2979095461 | Bacteria | 5669583 |
| 2019 | 2979104885 | 2979100975 | Bacteria | 5423623 |
| 2020 | 2979712958 | 2979710463 | Bacteria | 6785254 |
| 2021 | 2979751194 | 2979742915 | Bacteria | 7301278 |
| 2022 | 2979771573 | 2979764755 | Bacteria | 6610066 |
| 2023 | 2979776490 | 2979772303 | Bacteria | 6618277 |
| 2024 | 2979782582 | 2979779861 | Bacteria | 6219781 |
| 2025 | 2979794707 | 2979793036 | Bacteria | 6808957 |
| 2026 | 2979813827 | 2979808191 | Bacteria | 7179355 |
| 2027 | 2984513314 | 2984509177 | Bacteria | 5274802 |
| 2028 | 2984520317 | 2984518228 | Bacteria | 5277463 |
| 2029 | 2984539615 | 2984537506 | Bacteria | 5277481 |
| 2030 | 2984588296 | 2984587000 | Bacteria | 5263363 |
| 2031 | 2984601841 | 2984601300 | Bacteria | 5455244 |
| 2032 | 2987641216 | 2987636660 | Bacteria | 8088555 |
| 2033 | 2987646125 | 2987645492 | Bacteria | 6117018 |
| 2034 | 2987656608 | 2987652177 | Bacteria | 6969023 |
| 2035 | 2987662513 | 2987659509 | Bacteria | 6966464 |
| 2036 | 2987667547 | 2987666974 | Bacteria | 6509233 |
| 2037 | 2987677285 | 2987673487 | Bacteria | 6884027 |
| 2038 | 2989354132 | 2989349275 | Bacteria | 6349068 |
| 2039 | 2989777012 | 2989776772 | Bacteria | 4843317 |
| 2040 | 2996311828 | 2996310559 | Bacteria | 6357320 |
| 2041 | 2996338547 | 2996336353 | Bacteria | 5511628 |
| 2042 | 2996346800 | 2996341866 | Bacteria | 6643098 |
| 2043 | 2996349945 | 2996348954 | Bacteria | 7239054 |
| 2044 | 2996391656 | 2996386984 | Bacteria | 6978667 |
| 2045 | 2996889227 | 2996887358 | Bacteria | 5795980 |
| 2046 | 2996894710 | 2996893221 | Bacteria | 5823108 |
| 2047 | 3000142582 | 3000135777 | Bacteria | 6891109 |
| 2048 | 3002145180 | 3002141150 | Bacteria | 5254435 |
| 2049 | 3003932697 | 3003930520 | Bacteria | 5667563 |
| 2050 | 3004172866 | 3004167301 | Bacteria | 8330599 |
| 2051 | 3004191563 | 3004188549 | Bacteria | 6952365 |
| 2052 | 3004198194 | 3004195979 | Bacteria | 6776956 |
| 2053 | 3004210023 | 3004203850 | Bacteria | 7307914 |
| 2054 | 3004216424 | 3004211236 | Bacteria | 7417683 |
| 2055 | 3004218635 | 3004218560 | Bacteria | 7421728 |
| 2056 | 3004239420 | 3004232784 | Bacteria | 6662140 |
| 2057 | 3004255195 | 3004248173 | Bacteria | 6563236 |
| 2058 | 3004272554 | 3004268573 | Bacteria | 7043476 |
| 2059 | 3004276647 | 3004275668 | Bacteria | 7114440 |
| 2060 | 3004293723 | 3004289098 | Bacteria | 6135450 |
| 2061 | 3004337751 | 3004334049 | Bacteria | 8449246 |
| 2062 | 3005417164 | 3005416602 | Bacteria | 7064308 |
| 2063 | 3005722735 | 3005718088 | Bacteria | 8283608 |
| 2064 | 637077346 | 637000159 | Bacteria | 7596297 |
| 2065 | 639650021 | 639633055 | Bacteria | 7751309 |
| 2066 | 643825975 | 643692032 | Bacteria | 6891900 |
| 2067 | 648739557 | 648276728 | Bacteria | 6968865 |
| 2068 | 649870218 | 649633066 | Bacteria | 6690028 |
| 2069 | 650738741 | 650716007 | Bacteria | 5573770 |
| 2070 | 8002287118 | 8002285264 | Bacteria | 6717907 |
| 2071 | 8003572287 | 8003570095 | Bacteria | 5747666 |
| 2072 | 8003993848 | 8003992118 | Bacteria | 7266902 |
| 2073 | 8004001393 | 8003999396 | Bacteria | 7063185 |
| 2074 | 8004301013 | 8004300914 | Bacteria | 6132239 |
| 2075 | 8004315020 | 8004312739 | Bacteria | 7444653 |
| 2076 | 8004363417 | 8004361976 | Bacteria | 6858373 |
| 2077 | 8004377158 | 8004374579 | Bacteria | 6898112 |
| 2078 | 8004393277 | 8004387939 | Bacteria | 7049250 |
| 2079 | 8004451485 | 8004445564 | Bacteria | 6322258 |
| 2080 | 8004637718 | 8004633249 | Bacteria | 6723080 |
| 2081 | 8004644241 | 8004640170 | Bacteria | 6723001 |
| 2082 | 8004697698 | 8004695233 | Bacteria | 6731676 |
| 2083 | 8004707002 | 8004703790 | Bacteria | 8006957 |
| 2084 | 8004720064 | 8004714634 | Bacteria | 6776161 |
| 2085 | 8004729718 | 8004727605 | Bacteria | 6643904 |
| 2086 | 8005247960 | 8005246636 | Bacteria | 4933972 |
| 2087 | 8005264195 | 8005258706 | Bacteria | 6184835 |
| 2088 | 8005282039 | 8005275841 | Bacteria | 6929066 |
| 2089 | 8005288486 | 8005282627 | Bacteria | 6675747 |
| 2090 | 8005294242 | 8005289223 | Bacteria | 6634003 |
| 2091 | 8005306653 | 8005301065 | Bacteria | 6614431 |
| 2092 | 8005309411 | 8005307578 | Bacteria | 7395396 |
| 2093 | 8005315225 | 8005314921 | Bacteria | 7072929 |
| 2094 | 8005323754 | 8005321885 | Bacteria | 5795980 |
| 2095 | 8005382762 | 8005376324 | Bacteria | 6590079 |
| 2096 | 8005383819 | 8005382845 | Bacteria | 6732062 |
| 2097 | 8005401145 | 8005395548 | Bacteria | 6806915 |
| 2098 | 8005434098 | 8005430974 | Bacteria | 6689030 |
| 2099 | 8005464639 | 8005460587 | Bacteria | 7157962 |
| 2100 | 8005485605 | 8005484373 | Bacteria | 6297373 |
| 2101 | 8005501689 | 8005497431 | Bacteria | 6477605 |
| 2102 | 8005547094 | 8005542996 | Bacteria | 7077758 |
| 2103 | 8005559142 | 8005556819 | Bacteria | 6908598 |
| 2104 | 8005566799 | 8005563573 | Bacteria | 7153261 |
| 2105 | 8005574923 | 8005570704 | Bacteria | 6957481 |
| 2106 | 8005623043 | 8005619151 | Bacteria | 7030230 |
| 2107 | 8005631653 | 8005626139 | Bacteria | 6534237 |
| 2108 | 8005648378 | 8005645114 | Bacteria | 6950293 |
| 2109 | 8005673111 | 8005668836 | Bacteria | 6953162 |
| 2110 | 8005684545 | 8005682033 | Bacteria | 6726518 |
| 2111 | 8005693651 | 8005688590 | Bacteria | 6610080 |
| 2112 | 8005700889 | 8005695170 | Bacteria | 6912330 |
| 2113 | 8016522331 | 8016511872 | Bacteria | 9921665 |
| 2114 | 8016529612 | 8016522445 | Bacteria | 8156687 |
| 2115 | 8016534829 | 8016530956 | Bacteria | 8155261 |
| 2116 | 8016548040 | 8016539877 | Bacteria | 8155419 |
| 2117 | 8016554087 | 8016548790 | Bacteria | 8155074 |
| 2118 | 8016562462 | 8016557553 | Bacteria | 8154380 |
| 2119 | 8016573177 | 8016566248 | Bacteria | 8158151 |
| 2120 | 8016577319 | 8016575299 | Bacteria | 8154085 |
| 2121 | 8016600257 | 8016595262 | Bacteria | 8149947 |
| 2122 | 8016614442 | 8016613128 | Bacteria | 8794220 |
| 2123 | 8016626554 | 8016622563 | Bacteria | 7999408 |
| 2124 | 8016640339 | 8016630954 | Bacteria | 9217207 |
| 2125 | 8017063228 | 8017057580 | Bacteria | 10023680 |
| 2126 | 8018133594 | 8018127388 | Bacteria | 7351159 |
| 2127 | 8018154626 | 8018150411 | Bacteria | 5549903 |
| 2128 | 8018170242 | 8018163183 | Bacteria | 7277977 |
| 2129 | 8018178441 | 8018176218 | Bacteria | 6896178 |
| 2130 | 8019534593 | 8019530166 | Bacteria | 8155624 |
| 2131 | 8019544879 | 8019538911 | Bacteria | 7872763 |
| 2132 | 8019553655 | 8019547302 | Bacteria | 7996444 |
| 2133 | 8019582654 | 8019576017 | Bacteria | 10049540 |
| 2134 | 8019600907 | 8019597564 | Bacteria | 10041141 |
| 2135 | 8019617643 | 8019608314 | Bacteria | 10042931 |
| 2136 | 8019634457 | 8019629233 | Bacteria | 8687553 |
| 2137 | 8019645272 | 8019638758 | Bacteria | 9062356 |
| 2138 | 8019662348 | 8019659431 | Bacteria | 8577854 |
| 2139 | 8019671849 | 8019668869 | Bacteria | 8791617 |
| 2140 | 8019690079 | 8019687851 | Bacteria | 8712826 |
| 2141 | 8023687524 | 8023680758 | Bacteria | 7729763 |
| 2142 | 8024481973 | 8024479707 | Bacteria | 6954785 |
| 2143 | 8024505914 | 8024501048 | Bacteria | 6427847 |
| 2144 | 8049294959 | 8049293176 | Bacteria | 6128433 |
| 2145 | 8054461050 | 8054460903 | Bacteria | 4872905 |
| 2146 | 8054562059 | 8054558443 | Bacteria | 5204801 |
| 2147 | 8055617561 | 8055617313 | Bacteria | 7548464 |
| 2148 | 8055746346 | 8055742211 | Bacteria | 9226248 |
| 2149 | 8056381606 | 8056375014 | Bacteria | 7006639 |
| 2150 | 8056387047 | 8056382006 | Bacteria | 6408074 |
| 2151 | 8056878716 | 8056875544 | Bacteria | 4355797 |
| 2152 | 8056878717 | 8056875544 | Bacteria | 4355797 |
| 2153 | 8056968040 | 8056967851 | Bacteria | 9038162 |
| 2154 | 8056968483 | 8056967851 | Bacteria | 9038162 |
| 2155 | 8057877014 | 8057874678 | Bacteria | 7494653 |
| 2156 | JGI24741J21665_1007941 | |||
| 2157 | JGI24746J21847_1000755 | |||
| 2158 | JGI24740J21852_10006190 | |||
| 2159 | JGI24740J21852_10007518 | |||
| 2160 | JGI24739J22299_10000344 | |||
| 2161 | JGI24739J22299_10043423 | |||
| 2162 | JGI24737J22298_10001079 | |||
| 2163 | JGI24750J21931_1000255 | |||
| 2164 | JGI24745J21846_1000003 | |||
| 2165 | JGI24035J26624_1000595 | |||
| 2166 | JGI24033J26618_1000489 | |||
| 2167 | JGI24034J26672_10000322 | |||
| 2168 | JGI24742J22300_10002875 | |||
| 2169 | JGI24751J29686_10004924 | |||
| 2170 | JGI24751J29686_10010970 | |||
| 2171 | JGI25156J39149_1004063 | |||
| 2172 | JGI25162J39368_1001169 | |||
| 2173 | JGI25158J39367_1000393 | |||
| 2174 | JGI25157J39369_1000738 | |||
| 2175 | JGI25152J39213_1003706 | |||
| 2176 | JGI25159J45721_1000508 | |||
| 2177 | JGI25151J46595_10000585 | |||
| 2178 | JGI25151J46595_10001084 | |||
| 2179 | JGI25151J46595_10036025 | |||
| 2180 | JGI25165J46597_1000147 | |||
| 2181 | JGI25165J46597_1000630 | |||
| 2182 | JGI25153J46596_10000428 | |||
| 2183 | JGI25153J46596_10001318 | |||
| 2184 | JGI25153J46596_10004290 | |||
| 2185 | JGI25153J46596_10017933 | |||
| 2186 | JGI25153J46596_10026971 | |||
| 2187 | JGI25160J50197_1000015 | |||
| 2188 | JGI25160J50197_1000216 | |||
| 2189 | JGI25160J50197_1000438 | |||
| 2190 | JGI25160J50197_1000463 | |||
| 2191 | JGI25160J50197_1001146 | |||
| 2192 | JGI25160J50197_1001518 | |||
| 2193 | JGI25160J50197_1002737 | |||
| 2194 | JGI25160J50197_1005355 | |||
| 2195 | JGI25161J50226_1000005 | |||
| 2196 | JGI25161J50226_1000120 | |||
| 2197 | JGI25161J50226_1000412 | |||
| 2198 | JGI25161J50226_1005409 | |||
| 2199 | Ga0055542_1000252 | |||
| 2200 | Ga0055526_1000594 | |||
| 2201 | Ga0055526_1001753 | |||
| 2202 | Ga0055526_1002151 | |||
| 2203 | Ga0055524_1011640 | |||
| 2204 | Ga0055524_1019832 | |||
| 2205 | Ga0055524_1021731 | |||
| 2206 | Ga0055536_1002870 | |||
| 2207 | Ga0055536_1013021 | |||
| 2208 | Ga0055528_1000693 | |||
| 2209 | Ga0055528_1001185 | |||
| 2210 | Ga0055528_1005562 | |||
| 2211 | Ga0055530_10011385 | |||
| 2212 | Ga0055530_10012693 | |||
| 2213 | Ga0055540_1001134 | |||
| 2214 | Ga0055540_1002011 | |||
| 2215 | Ga0055540_1002353 | |||
| 2216 | Ga0055540_1014218 | |||
| 2217 | Ga0055531_10002835 | |||
| 2218 | Ga0055531_10007059 | |||
| 2219 | Ga0055531_10007361 | |||
| 2220 | Ga0058692_1000689 | |||
| 2221 | Ga0055543_1000012 | |||
| 2222 | Ga0055543_1000155 | |||
| 2223 | Ga0055543_1000301 | |||
| 2224 | Ga0055543_1000631 | |||
| 2225 | Ga0055543_1002832 | |||
| 2226 | Ga0065165_1000125 | |||
| 2227 | Ga0065165_1000717 | |||
| 2228 | Ga0065165_1000780 | |||
| 2229 | Ga0065165_1000826 | |||
| 2230 | Ga0065165_1001465 | |||
| 2231 | Ga0065165_1003182 | |||
| 2232 | Ga0065165_1013609 | |||
| 2233 | Ga0065712_10003725 | |||
| 2234 | Ga0065712_10070614 | |||
| 2235 | Ga0065712_10111484 | |||
| 2236 | Ga0065715_10093037 | |||
| 2237 | Ga0070658_10205856 | |||
| 2238 | Ga0070676_10000784 | |||
| 2239 | Ga0070683_100000114 | |||
| 2240 | Ga0070683_100057598 | |||
| 2241 | Ga0070690_100000064 | |||
| 2242 | Ga0070690_100022010 | |||
| 2243 | Ga0070670_100002373 | |||
| 2244 | Ga0070677_10000193 | |||
| 2245 | Ga0070677_10022088 | |||
| 2246 | Ga0068869_100000020 | |||
| 2247 | Ga0068869_100006431 | |||
| 2248 | Ga0070666_10030214 | |||
| 2249 | Ga0070680_100000242 | |||
| 2250 | Ga0070682_100000224 | |||
| 2251 | Ga0068868_100001773 | |||
| 2252 | Ga0068868_100009208 | |||
| 2253 | Ga0068868_100186489 | |||
| 2254 | Ga0070660_100000123 | |||
| 2255 | Ga0070660_100084487 | |||
| 2256 | Ga0070689_100000685 | |||
| 2257 | Ga0070689_100076641 | |||
| 2258 | Ga0070689_100153949 | |||
| 2259 | Ga0070691_10013336 | |||
| 2260 | Ga0070687_100000351 | |||
| 2261 | Ga0070687_100039459 | |||
| 2262 | Ga0070661_100026596 | |||
| 2263 | Ga0070661_100046186 | |||
| 2264 | Ga0070661_100111987 | |||
| 2265 | Ga0070692_10000108 | |||
| 2266 | Ga0070668_100003586 | |||
| 2267 | Ga0070668_100021775 | |||
| 2268 | Ga0070668_100180266 | |||
| 2269 | Ga0070669_100000176 | |||
| 2270 | Ga0070669_100062083 | |||
| 2271 | Ga0070675_100000259 | |||
| 2272 | Ga0070675_100099529 | |||
| 2273 | Ga0070675_100193875 | |||
| 2274 | Ga0070671_100004849 | |||
| 2275 | Ga0070671_100006467 | |||
| 2276 | Ga0070671_100098198 | |||
| 2277 | Ga0070671_100129759 | |||
| 2278 | Ga0070671_100153294 | |||
| 2279 | Ga0070674_100000099 | |||
| 2280 | Ga0070674_100026259 | |||
| 2281 | Ga0070674_100184190 | |||
| 2282 | Ga0070673_100000042 | |||
| 2283 | Ga0070673_100084549 | |||
| 2284 | Ga0070673_100112291 | |||
| 2285 | Ga0070688_100000329 | |||
| 2286 | Ga0070688_100074173 | |||
| 2287 | Ga0070659_100000348 | |||
| 2288 | Ga0070667_100001075 | |||
| 2289 | Ga0070667_100019257 | |||
| 2290 | Ga0070667_100042027 | |||
| 2291 | Ga0070703_10000878 | |||
| 2292 | Ga0070709_10032295 | |||
| 2293 | Ga0070709_10129479 | |||
| 2294 | Ga0070714_100152101 | |||
| 2295 | Ga0070713_100030475 | |||
| 2296 | Ga0070713_100183785 | |||
| 2297 | Ga0070710_10024016 | |||
| 2298 | Ga0070710_10083034 | |||
| 2299 | Ga0070701_10000025 | |||
| 2300 | Ga0070711_100032827 | |||
| 2301 | Ga0070705_100003281 | |||
| 2302 | Ga0070705_100170695 | |||
| 2303 | Ga0070694_100003777 | |||
| 2304 | Ga0070694_100100151 | |||
| 2305 | Ga0070708_100257647 | |||
| 2306 | Ga0070663_100000064 | |||
| 2307 | Ga0070663_100113712 | |||
| 2308 | Ga0070678_100002536 | |||
| 2309 | Ga0070662_100073373 | |||
| 2310 | Ga0070662_100303483 | |||
| 2311 | Ga0070681_10000435 | |||
| 2312 | Ga0070681_10182879 | |||
| 2313 | Ga0070681_10236072 | |||
| 2314 | Ga0068867_100005677 | |||
| 2315 | Ga0068867_100024391 | |||
| 2316 | Ga0068867_100027110 | |||
| 2317 | Ga0068867_100067298 | |||
| 2318 | Ga0068867_100190588 | |||
| 2319 | Ga0070706_100197584 | |||
| 2320 | Ga0070698_100011265 | |||
| 2321 | Ga0070699_100202435 | |||
| 2322 | Ga0070684_100001610 | |||
| 2323 | Ga0070684_100027140 | |||
| 2324 | Ga0070697_100094045 | |||
| 2325 | Ga0068853_100002463 | |||
| 2326 | Ga0068853_100039010 | |||
| 2327 | Ga0068853_100195647 | |||
| 2328 | Ga0068853_100323306 | |||
| 2329 | Ga0070672_100000011 | |||
| 2330 | Ga0070672_100118231 | |||
| 2331 | Ga0070672_100134004 | |||
| 2332 | Ga0070686_100000076 | |||
| 2333 | Ga0070686_100087073 | |||
| 2334 | Ga0070695_100053966 | |||
| 2335 | Ga0070696_100052443 | |||
| 2336 | Ga0070696_100056200 | |||
| 2337 | Ga0070693_100004777 | |||
| 2338 | Ga0070665_100002816 | |||
| 2339 | Ga0070665_100003012 | |||
| 2340 | Ga0070665_100016716 | |||
| 2341 | Ga0070665_100037641 | |||
| 2342 | Ga0070665_100289398 | |||
| 2343 | Ga0070665_100424974 | |||
| 2344 | Ga0068855_100049447 | |||
| 2345 | Ga0068855_100061125 | |||
| 2346 | Ga0068855_100110372 | |||
| 2347 | Ga0070664_100000112 | |||
| 2348 | Ga0068857_100000023 | |||
| 2349 | Ga0068857_100024933 | |||
| 2350 | Ga0068857_100031521 | |||
| 2351 | Ga0068854_100066891 | |||
| 2352 | Ga0068854_100178454 | |||
| 2353 | Ga0068856_100000099 | |||
| 2354 | Ga0068856_100006276 | |||
| 2355 | Ga0068856_100014002 | |||
| 2356 | Ga0068856_100095048 | |||
| 2357 | Ga0068856_100118811 | |||
| 2358 | Ga0070702_100000005 | |||
| 2359 | Ga0068852_100002886 | |||
| 2360 | Ga0068852_100014911 | |||
| 2361 | Ga0068859_100000503 | |||
| 2362 | Ga0068859_100128696 | |||
| 2363 | Ga0068859_100425277 | |||
| 2364 | Ga0068864_100000112 | |||
| 2365 | Ga0068864_100006199 | |||
| 2366 | Ga0068864_100029277 | |||
| 2367 | Ga0068866_10000977 | |||
| 2368 | Ga0068866_10201434 | |||
| 2369 | Ga0068861_100002096 | |||
| 2370 | Ga0068870_10000021 | |||
| 2371 | Ga0068863_100000227 | |||
| 2372 | Ga0068863_100100507 | |||
| 2373 | Ga0068858_100001279 | |||
| 2374 | Ga0068858_100004153 | |||
| 2375 | Ga0068858_100032557 | |||
| 2376 | Ga0068858_100367623 | |||
| 2377 | Ga0068860_100315040 | |||
| 2378 | Ga0068862_100001866 | |||
| 2379 | Ga0068862_100108483 | |||
| 2380 | Ga0081455_10004237 | |||
| 2381 | Ga0081455_10057110 | |||
| 2382 | Ga0081538_10019358 | |||
| 2383 | Ga0081540_1056049 | |||
| 2384 | Ga0081539_10001300 | |||
| 2385 | Ga0081539_10029652 | |||
| 2386 | Ga0081539_10046429 | |||
| 2387 | Ga0070717_10102440 | |||
| 2388 | Ga0070717_10130840 | |||
| 2389 | Ga0075365_10001809 | |||
| 2390 | Ga0075365_10002327 | |||
| 2391 | Ga0075365_10005519 | |||
| 2392 | Ga0075365_10008458 | |||
| 2393 | Ga0075365_10016973 | |||
| 2394 | Ga0075365_10018202 | |||
| 2395 | Ga0075365_10043121 | |||
| 2396 | Ga0075365_10054915 | |||
| 2397 | Ga0075365_10067884 | |||
| 2398 | Ga0075365_10086187 | |||
| 2399 | Ga0075365_10097891 | |||
| 2400 | Ga0075365_10137785 | |||
| 2401 | Ga0075365_10198465 | |||
| 2402 | Ga0075368_10000391 | |||
| 2403 | Ga0075368_10001480 | |||
| 2404 | Ga0075363_100004780 | |||
| 2405 | Ga0075363_100011783 | |||
| 2406 | Ga0075363_100026888 | |||
| 2407 | Ga0075364_10000060 | |||
| 2408 | Ga0075364_10016981 | |||
| 2409 | Ga0075364_10022672 | |||
| 2410 | Ga0070715_10014553 | |||
| 2411 | Ga0070712_100231222 | |||
| 2412 | Ga0075362_10003906 | |||
| 2413 | Ga0075362_10058503 | |||
| 2414 | Ga0075367_10014606 | |||
| 2415 | Ga0075367_10021848 | |||
| 2416 | Ga0075367_10031807 | |||
| 2417 | Ga0075367_10079464 | |||
| 2418 | Ga0075369_10000420 | |||
| 2419 | Ga0075369_10009712 | |||
| 2420 | Ga0075369_10024616 | |||
| 2421 | Ga0075369_10037369 | |||
| 2422 | Ga0075369_10109517 | |||
| 2423 | Ga0075366_10005612 | |||
| 2424 | Ga0075366_10030387 | |||
| 2425 | Ga0075366_10031004 | |||
| 2426 | Ga0075366_10044168 | |||
| 2427 | Ga0075366_10084443 | |||
| 2428 | Ga0075366_10142134 | |||
| 2429 | Ga0097621_100000115 | |||
| 2430 | Ga0097621_100031095 | |||
| 2431 | Ga0097621_100052758 | |||
| 2432 | Ga0075370_10019433 | |||
| 2433 | Ga0075370_10020715 | |||
| 2434 | Ga0075370_10049519 | |||
| 2435 | Ga0075370_10055381 | |||
| 2436 | Ga0075370_10058432 | |||
| 2437 | Ga0075370_10062341 | |||
| 2438 | Ga0075370_10072847 | |||
| 2439 | Ga0068871_100000064 | |||
| 2440 | Ga0068871_100031695 | |||
| 2441 | Ga0068871_100082934 | |||
| 2442 | Ga0068871_100183985 | |||
| 2443 | Ga0075428_100001096 | |||
| 2444 | Ga0075428_100019624 | |||
| 2445 | Ga0075428_100140962 | |||
| 2446 | Ga0075430_100016424 | |||
| 2447 | Ga0075430_100328763 | |||
| 2448 | Ga0075431_100002284 | |||
| 2449 | Ga0075431_100006045 | |||
| 2450 | Ga0075431_100057368 | |||
| 2451 | Ga0075433_10286206 | |||
| 2452 | Ga0075434_100011648 | |||
| 2453 | Ga0075429_100016045 | |||
| 2454 | Ga0075429_100040905 | |||
| 2455 | Ga0068865_100000088 | |||
| 2456 | Ga0068865_100107695 | |||
| 2457 | Ga0068865_100141135 | |||
| 2458 | Ga0097620_100000503 | |||
| 2459 | Ga0097620_100128696 | |||
| 2460 | Ga0097620_100168187 | |||
| 2461 | Ga0097620_100425243 | |||
| 2462 | Ga0099825_1026228 | |||
| 2463 | Ga0099824_1015882 | |||
| 2464 | Ga0099823_1016643 | |||
| 2465 | Ga0079104_1005313 | |||
| 2466 | Ga0079104_1029960 | |||
| 2467 | Ga0099826_10001162 | |||
| 2468 | Ga0099826_10055826 | |||
| 2469 | Ga0075435_100018640 | |||
| 2470 | Ga0105244_10027369 | |||
| 2471 | Ga0105244_10041442 | |||
| 2472 | Ga0105240_10000032 | |||
| 2473 | Ga0105240_10087091 | |||
| 2474 | Ga0111539_10000835 | |||
| 2475 | Ga0111539_10001836 | |||
| 2476 | Ga0111539_10002131 | |||
| 2477 | Ga0111539_10043003 | |||
| 2478 | Ga0111539_10240090 | |||
| 2479 | Ga0111539_10344038 | |||
| 2480 | Ga0105245_10000556 | |||
| 2481 | Ga0105245_10001381 | |||
| 2482 | Ga0105245_10042958 | |||
| 2483 | Ga0105247_10000474 | |||
| 2484 | Ga0105247_10008685 | |||
| 2485 | Ga0105247_10010587 | |||
| 2486 | Ga0105247_10036214 | |||
| 2487 | Ga0105247_10140550 | |||
| 2488 | Ga0114129_10005100 | |||
| 2489 | Ga0114129_10023557 | |||
| 2490 | Ga0114129_10041080 | |||
| 2491 | Ga0114129_10116705 | |||
| 2492 | Ga0114129_10135026 | |||
| 2493 | Ga0105243_10002817 | |||
| 2494 | Ga0105243_10003276 | |||
| 2495 | Ga0105243_10059291 | |||
| 2496 | Ga0105243_10111788 | |||
| 2497 | Ga0105243_10129972 | |||
| 2498 | Ga0105241_10013940 | |||
| 2499 | Ga0105242_10006548 | |||
| 2500 | Ga0105242_10010176 | |||
| 2501 | Ga0105242_10136056 | |||
| 2502 | Ga0105248_10000500 | |||
| 2503 | Ga0105248_10000873 | |||
| 2504 | Ga0105248_10005607 | |||
| 2505 | Ga0105248_10053120 | |||
| 2506 | Ga0105248_10064008 | |||
| 2507 | Ga0105248_10376789 | |||
| 2508 | Ga0105237_10000754 | |||
| 2509 | Ga0105237_10012593 | |||
| 2510 | Ga0105237_10053311 | |||
| 2511 | Ga0105238_10063446 | |||
| 2512 | Ga0105238_10076419 | |||
| 2513 | Ga0105238_10079722 | |||
| 2514 | Ga0105238_10095640 | |||
| 2515 | Ga0105249_10002423 | |||
| 2516 | Ga0123341_1003307 | |||
| 2517 | Ga0123342_1012832 | |||
| 2518 | Ga0123342_1023961 | |||
| 2519 | Ga0099796_10029332 | |||
| 2520 | Ga0105239_10003796 | |||
| 2521 | Ga0105239_10295074 | |||
| 2522 | Ga0105246_10000016 | |||
| 2523 | Ga0105246_10000220 | |||
| 2524 | Ga0105246_10058075 | |||
| 2525 | Ga0157373_10001237 | |||
| 2526 | Ga0157373_10042861 | |||
| 2527 | Ga0157373_10132801 | |||
| 2528 | Ga0157373_10168919 | |||
| 2529 | Ga0157371_10000004 | |||
| 2530 | Ga0157371_10015495 | |||
| 2531 | Ga0157370_10003636 | |||
| 2532 | Ga0157370_10234385 | |||
| 2533 | Ga0157369_10073358 | |||
| 2534 | Ga0157369_10102912 | |||
| 2535 | Ga0171463_1003 | |||
| 2536 | Ga0157374_10000092 | |||
| 2537 | Ga0157374_10000524 | |||
| 2538 | Ga0157374_10010385 | |||
| 2539 | Ga0157374_10030091 | |||
| 2540 | Ga0157374_10202455 | |||
| 2541 | Ga0157378_10000591 | |||
| 2542 | Ga0157378_10023177 | |||
| 2543 | Ga0157378_10271419 | |||
| 2544 | Ga0163162_10023568 | |||
| 2545 | Ga0163162_10075105 | |||
| 2546 | Ga0163162_10115386 | |||
| 2547 | Ga0163162_10375085 | |||
| 2548 | Ga0163162_10380472 | |||
| 2549 | Ga0157372_10006371 | |||
| 2550 | Ga0157372_10163959 | |||
| 2551 | Ga0157372_10314045 | |||
| 2552 | Ga0157372_10395714 | |||
| 2553 | Ga0157375_10000124 | |||
| 2554 | Ga0157375_10001668 | |||
| 2555 | Ga0157375_10006444 | |||
| 2556 | Ga0157375_10025162 | |||
| 2557 | Ga0163163_10003404 | |||
| 2558 | Ga0163163_10058876 | |||
| 2559 | Ga0157380_10001027 | |||
| 2560 | Ga0157380_10004466 | |||
| 2561 | Ga0157380_10102839 | |||
| 2562 | Ga0157380_10125337 | |||
| 2563 | Ga0157380_10131629 | |||
| 2564 | Ga0157380_10205409 | |||
| 2565 | Ga0157380_10363411 | |||
| 2566 | Ga0182008_10051736 | |||
| 2567 | Ga0157377_10000121 | |||
| 2568 | Ga0157379_10000422 | |||
| 2569 | Ga0157379_10040122 | |||
| 2570 | Ga0157379_10077910 | |||
| 2571 | Ga0157376_10000034 | |||
| 2572 | Ga0157376_10000285 | |||
| 2573 | Ga0157376_10409954 | |||
| 2574 | Ga0182006_1015445 | |||
| 2575 | Ga0182007_10062860 | |||
| 2576 | Ga0182005_1004008 | |||
| 2577 | Ga0183363_1047 | |||
| 2578 | Ga0163161_10000801 | |||
| 2579 | Ga0163161_10107639 | |||
| 2580 | Ga0214544_1001682 | |||
| 2581 | Ga0214542_1001614 | |||
| 2582 | Ga0214542_1028780 | |||
| 2583 | Ga0214543_1000078 | |||
| 2584 | Ga0214543_1001395 | |||
| 2585 | Ga0228711_1000016 | |||
| 2586 | Ga0228710_1000013 | |||
| 2587 | Ga0209436_100041 | |||
| 2588 | Ga0209436_101133 | |||
| 2589 | Ga0209437_100075 | |||
| 2590 | Ga0207425_1008603 | |||
| 2591 | Ga0209026_1000050 | |||
| 2592 | Ga0209148_1000032 | |||
| 2593 | Ga0209148_1000289 | |||
| 2594 | Ga0209759_1015261 | |||
| 2595 | Ga0209129_1001627 | |||
| 2596 | Ga0209129_1003249 | |||
| 2597 | Ga0209129_1006654 | |||
| 2598 | Ga0209233_1000034 | |||
| 2599 | Ga0209233_1000056 | |||
| 2600 | Ga0209233_1002652 | |||
| 2601 | Ga0207666_1000004 | |||
| 2602 | Ga0209455_1000190 | |||
| 2603 | Ga0209455_1001308 | |||
| 2604 | Ga0209673_1000060 | |||
| 2605 | Ga0209673_1004110 | |||
| 2606 | Ga0209673_1011460 | |||
| 2607 | Ga0209673_1017145 | |||
| 2608 | Ga0209130_1000018 | |||
| 2609 | Ga0209130_1000029 | |||
| 2610 | Ga0209130_1000030 | |||
| 2611 | Ga0207673_1000326 | |||
| 2612 | Ga0209676_1000100 | |||
| 2613 | Ga0209676_1002997 | |||
| 2614 | Ga0209676_1031133 | |||
| 2615 | Ga0209676_1038379 | |||
| 2616 | Ga0209025_1000060 | |||
| 2617 | Ga0209025_1000959 | |||
| 2618 | Ga0209025_1001184 | |||
| 2619 | Ga0209025_1023046 | |||
| 2620 | Ga0209564_1000278 | |||
| 2621 | Ga0209564_1000281 | |||
| 2622 | Ga0209564_1000937 | |||
| 2623 | Ga0209564_1001052 | |||
| 2624 | Ga0209564_1004532 | |||
| 2625 | Ga0209564_1017395 | |||
| 2626 | Ga0209564_1033434 | |||
| 2627 | Ga0209758_1000160 | |||
| 2628 | Ga0209758_1000219 | |||
| 2629 | Ga0209758_1000383 | |||
| 2630 | Ga0209758_1000637 | |||
| 2631 | Ga0209758_1000677 | |||
| 2632 | Ga0209758_1001377 | |||
| 2633 | Ga0209758_1009047 | |||
| 2634 | Ga0209758_1009123 | |||
| 2635 | Ga0209758_1012378 | |||
| 2636 | Ga0209050_1006153 | |||
| 2637 | Ga0209050_1009722 | |||
| 2638 | Ga0209050_1019463 | |||
| 2639 | Ga0209256_1000042 | |||
| 2640 | Ga0209256_1001295 | |||
| 2641 | Ga0209256_1002288 | |||
| 2642 | Ga0209256_1002941 | |||
| 2643 | Ga0209256_1003739 | |||
| 2644 | Ga0209256_1009106 | |||
| 2645 | Ga0209256_1024299 | |||
| 2646 | Ga0207426_1000044 | |||
| 2647 | Ga0207426_1000047 | |||
| 2648 | Ga0207426_1000074 | |||
| 2649 | Ga0207426_1000268 | |||
| 2650 | Ga0207426_1000379 | |||
| 2651 | Ga0207426_1000465 | |||
| 2652 | Ga0207426_1003500 | |||
| 2653 | Ga0207426_1016971 | |||
| 2654 | Ga0209051_1000236 | |||
| 2655 | Ga0209051_1003666 | |||
| 2656 | Ga0209051_1004392 | |||
| 2657 | Ga0209051_1008481 | |||
| 2658 | Ga0209051_1008829 | |||
| 2659 | Ga0209051_1012789 | |||
| 2660 | Ga0209257_1000650 | |||
| 2661 | Ga0209257_1002011 | |||
| 2662 | Ga0209257_1002210 | |||
| 2663 | Ga0209257_1005286 | |||
| 2664 | Ga0209257_1029619 | |||
| 2665 | Ga0207653_10001908 | |||
| 2666 | Ga0207682_10000016 | |||
| 2667 | Ga0207692_10013299 | |||
| 2668 | Ga0207642_10000976 | |||
| 2669 | Ga0207642_10078028 | |||
| 2670 | Ga0207710_10001396 | |||
| 2671 | Ga0207710_10001528 | |||
| 2672 | Ga0207710_10003942 | |||
| 2673 | Ga0207710_10009728 | |||
| 2674 | Ga0207710_10026449 | |||
| 2675 | Ga0207688_10002050 | |||
| 2676 | Ga0207688_10064625 | |||
| 2677 | Ga0207680_10002179 | |||
| 2678 | Ga0207680_10059119 | |||
| 2679 | Ga0207680_10135217 | |||
| 2680 | Ga0207680_10219750 | |||
| 2681 | Ga0207647_10003692 | |||
| 2682 | Ga0207647_10059232 | |||
| 2683 | Ga0207685_10083900 | |||
| 2684 | Ga0207645_10001535 | |||
| 2685 | Ga0207643_10000075 | |||
| 2686 | Ga0207643_10085289 | |||
| 2687 | Ga0207684_10099451 | |||
| 2688 | Ga0207654_10006201 | |||
| 2689 | Ga0207707_10003863 | |||
| 2690 | Ga0207707_10153787 | |||
| 2691 | Ga0207695_10000024 | |||
| 2692 | Ga0207695_10009034 | |||
| 2693 | Ga0207695_10146083 | |||
| 2694 | Ga0207695_10196807 | |||
| 2695 | Ga0207671_10000718 | |||
| 2696 | Ga0207671_10009593 | |||
| 2697 | Ga0207671_10116073 | |||
| 2698 | Ga0207693_10046639 | |||
| 2699 | Ga0207663_10112324 | |||
| 2700 | Ga0207660_10000023 | |||
| 2701 | Ga0207660_10103923 | |||
| 2702 | Ga0207662_10001681 | |||
| 2703 | Ga0207662_10029205 | |||
| 2704 | Ga0207657_10001755 | |||
| 2705 | Ga0207657_10073027 | |||
| 2706 | Ga0207657_10114168 | |||
| 2707 | Ga0207657_10217966 | |||
| 2708 | Ga0207649_10000122 | |||
| 2709 | Ga0207649_10015177 | |||
| 2710 | Ga0207652_10001146 | |||
| 2711 | Ga0207681_10000240 | |||
| 2712 | Ga0207681_10049729 | |||
| 2713 | Ga0207681_10076472 | |||
| 2714 | Ga0207681_10195542 | |||
| 2715 | Ga0207694_10020011 | |||
| 2716 | Ga0207650_10012941 | |||
| 2717 | Ga0207650_10088443 | |||
| 2718 | Ga0207659_10000017 | |||
| 2719 | Ga0207659_10085461 | |||
| 2720 | Ga0207659_10094800 | |||
| 2721 | Ga0207659_10096989 | |||
| 2722 | Ga0207687_10000077 | |||
| 2723 | Ga0207687_10001492 | |||
| 2724 | Ga0207687_10211238 | |||
| 2725 | Ga0207700_10046442 | |||
| 2726 | Ga0207700_10148027 | |||
| 2727 | Ga0207664_10045678 | |||
| 2728 | Ga0207644_10001298 | |||
| 2729 | Ga0207644_10003716 | |||
| 2730 | Ga0207644_10027349 | |||
| 2731 | Ga0207644_10106786 | |||
| 2732 | Ga0207644_10263806 | |||
| 2733 | Ga0207644_10371701 | |||
| 2734 | Ga0207690_10000151 | |||
| 2735 | Ga0207706_10005479 | |||
| 2736 | Ga0207706_10010327 | |||
| 2737 | Ga0207706_10354838 | |||
| 2738 | Ga0207706_10354839 | |||
| 2739 | Ga0207686_10000294 | |||
| 2740 | Ga0207686_10017811 | |||
| 2741 | Ga0207686_10031259 | |||
| 2742 | Ga0207709_10000126 | |||
| 2743 | Ga0207709_10045603 | |||
| 2744 | Ga0207709_10060946 | |||
| 2745 | Ga0207709_10090300 | |||
| 2746 | Ga0207709_10097350 | |||
| 2747 | Ga0207709_10114962 | |||
| 2748 | Ga0207670_10000086 | |||
| 2749 | Ga0207670_10080693 | |||
| 2750 | Ga0207669_10000188 | |||
| 2751 | Ga0207669_10014695 | |||
| 2752 | Ga0207669_10026710 | |||
| 2753 | Ga0207669_10156474 | |||
| 2754 | Ga0207669_10207167 | |||
| 2755 | Ga0207704_10001793 | |||
| 2756 | Ga0207665_10268951 | |||
| 2757 | Ga0207691_10007063 | |||
| 2758 | Ga0207691_10016974 | |||
| 2759 | Ga0207691_10183906 | |||
| 2760 | Ga0207711_10004478 | |||
| 2761 | Ga0207711_10005965 | |||
| 2762 | Ga0207711_10039484 | |||
| 2763 | Ga0207711_10316023 | |||
| 2764 | Ga0207689_10000140 | |||
| 2765 | Ga0207689_10047161 | |||
| 2766 | Ga0207689_10109566 | |||
| 2767 | Ga0207661_10000074 | |||
| 2768 | Ga0207661_10130409 | |||
| 2769 | Ga0207679_10000031 | |||
| 2770 | Ga0207679_10031984 | |||
| 2771 | Ga0207679_10221628 | |||
| 2772 | Ga0207667_10013359 | |||
| 2773 | Ga0207667_10045333 | |||
| 2774 | Ga0207667_10232803 | |||
| 2775 | Ga0207651_10000044 | |||
| 2776 | Ga0207651_10061639 | |||
| 2777 | Ga0207712_10000279 | |||
| 2778 | Ga0207712_10038823 | |||
| 2779 | Ga0207668_10000687 | |||
| 2780 | Ga0207668_10092184 | |||
| 2781 | Ga0207640_10000105 | |||
| 2782 | Ga0207640_10000216 | |||
| 2783 | Ga0207658_10001907 | |||
| 2784 | Ga0207658_10039014 | |||
| 2785 | Ga0207677_10000318 | |||
| 2786 | Ga0207703_10000418 | |||
| 2787 | Ga0207703_10006276 | |||
| 2788 | Ga0207703_10035176 | |||
| 2789 | Ga0207703_10374259 | |||
| 2790 | Ga0207639_10007495 | |||
| 2791 | Ga0207639_10246028 | |||
| 2792 | Ga0207639_10264405 | |||
| 2793 | Ga0207639_10278625 | |||
| 2794 | Ga0207678_10005986 | |||
| 2795 | Ga0207678_10007246 | |||
| 2796 | Ga0207678_10008184 | |||
| 2797 | Ga0207678_10014870 | |||
| 2798 | Ga0207678_10033040 | |||
| 2799 | Ga0207678_10087729 | |||
| 2800 | Ga0207708_10004013 | |||
| 2801 | Ga0207702_10000753 | |||
| 2802 | Ga0207702_10081034 | |||
| 2803 | Ga0207702_10159139 | |||
| 2804 | Ga0207641_10001634 | |||
| 2805 | Ga0207641_10068519 | |||
| 2806 | Ga0207641_10423619 | |||
| 2807 | Ga0207648_10007377 | |||
| 2808 | Ga0207648_10056668 | |||
| 2809 | Ga0207648_10161442 | |||
| 2810 | Ga0207676_10000133 | |||
| 2811 | Ga0207676_10015457 | |||
| 2812 | Ga0207676_10078003 | |||
| 2813 | Ga0207674_10001514 | |||
| 2814 | Ga0207674_10037910 | |||
| 2815 | Ga0207674_10066374 | |||
| 2816 | Ga0207674_10083784 | |||
| 2817 | Ga0207674_10428761 | |||
| 2818 | Ga0207675_100011837 | |||
| 2819 | Ga0207675_100152444 | |||
| 2820 | Ga0207675_100252407 | |||
| 2821 | Ga0207683_10000004 | |||
| 2822 | Ga0207683_10003094 | |||
| 2823 | Ga0207683_10035832 | |||
| 2824 | Ga0207698_10009206 | |||
| 2825 | Ga0209281_1000043 | |||
| 2826 | Ga0209281_1000221 | |||
| 2827 | Ga0209281_1000453 | |||
| 2828 | Ga0209389_1000008 | |||
| 2829 | Ga0209389_1000081 | |||
| 2830 | Ga0209371_1000009 | |||
| 2831 | Ga0209371_1000732 | |||
| 2832 | Ga0209371_1001249 | |||
| 2833 | Ga0209371_1002043 | |||
| 2834 | Ga0209589_1000091 | |||
| 2835 | Ga0209489_100096 | |||
| 2836 | Ga0209489_103917 | |||
| 2837 | Ga0209700_100036 | |||
| 2838 | Ga0209282_1000041 | |||
| 2839 | Ga0209282_1000179 | |||
| 2840 | Ga0209282_1070112 | |||
| 2841 | Ga0209998_10000939 | |||
| 2842 | Ga0209813_10001432 | |||
| 2843 | Ga0209813_10006967 | |||
| 2844 | Ga0209974_10005431 | |||
| 2845 | Ga0207428_10000218 | |||
| 2846 | Ga0207428_10002942 | |||
| 2847 | Ga0268266_10001063 | |||
| 2848 | Ga0268266_10005424 | |||
| 2849 | Ga0268266_10120870 | |||
| 2850 | Ga0268266_10122747 | |||
| 2851 | Ga0268265_10000194 | |||
| 2852 | Ga0268265_10168309 | |||
| 2853 | Ga0268264_10000393 | |||
| 2854 | Ga0268264_10089016 | |||
| 2855 | Ga0307515_10000023 | |||
| 2856 | Ga0268256_1000010 | |||
| 2857 | Ga0268256_1000660 | |||
| 2858 | Ga0268256_1012387 | |||
| 2859 | Ga0265320_10001570 | |||
| 2860 | Ga0265325_10020399 | |||
| 2861 | Ga0265340_10018115 | |||
| 2862 | Ga0265316_10226754 | |||
| 2863 | Ga0307513_10003030 | |||
| 2864 | Ga0307513_10117119 | |||
| 2865 | Ga0307508_10000235 | |||
| 2866 | Ga0265314_10015333 | |||
| 2867 | Ga0265342_10019097 | |||
| 2868 | Ga0316578_10012241 | |||
| 2869 | Ga0307516_10076539 | |||
| 2870 | Ga0307412_10004217 | |||
| 2871 | Ga0307412_10051473 | |||
| 2872 | Ga0307412_10096618 | |||
| 2873 | Ga0315914_1000030 | |||
| 2874 | Ga0307409_100079130 | |||
| 2875 | Ga0307414_10335036 | |||
| 2876 | Ga0307415_100162107 | |||
| 2877 | Ga0307510_10051197 | |||
| 2878 | Ga0307510_10166871 | |||
| 2879 | Ga0315913_1000017 | |||
| 2880 | Ga0315915_1000017 | |||
| 2881 | Ga0373926_0044621 | |||
| 2882 | Ga0373951_0006498 | |||
| 2883 | Ga0373952_0005697 | |||
| 2884 | Ga0373932_0006740 | |||
| 2885 | Ga0373939_0001147 | |||
| 2886 | Ga0373941_0004127 | |||
| 2887 | Ga0373945_0023874 | |||
| 2888 | Ga0373960_0002301 | |||
| 2889 | Ga0373942_0004747 | |||
| 2890 | Ga0373961_0006340 | |||
| 2891 | Ga0373962_0006222 | |||
| 2892 | Ga0316574_0000447 | |||
| 2893 | Ga0373931_0000034 | |||
| 2894 | Ga0373931_0106047 | |||
| 2895 | Ga0373935_0044469 | |||
| 2896 | Ga0373927_0198628 | |||
| 2897 | Ga0373947_0080704 | |||
| 2898 | Ga0373947_0094196 | |||
| 2899 | Ga0373925_0078900 | |||
| 2900 | Ga0395899_0005212 | |||
| 2901 | Ga0395899_0014217 | |||
| 2902 | Ga0395900_0006809 | |||
| 2903 | Ga0395900_0009382 | |||
| 2904 | Ga0395900_0028204 | |||
| 2905 | Ga0395900_0061357 | |||
| 2906 | Ga0395900_0064342 | |||
| 2907 | Ga0395900_0119882 | |||
| 2908 | Ga0395898_0031310 | |||
| 2909 | Ga0395898_0079159 | |||
| 2910 | Ga0395905_0012635 | |||
| 2911 | Ga0395905_0044671 | |||
| 2912 | Ga0395905_0185194 | |||
| 2913 | Ga0395905_0245905 | |||
| 2914 | Ga0395901_0014741 | |||
| 2915 | Ga0395901_0019762 | |||
| 2916 | Ga0395901_0034031 | |||
| 2917 | Ga0395901_0048672 | |||
| 2918 | Ga0395901_0107512 | |||
| 2919 | Ga0395901_0244469 | |||
| 2920 | Ga0436365_0226566 | |||
| 2921 | Ga0436360_0428998 | |||
| 2922 | Ga0439439_0029670 | |||
| 2923 | Ga0439465_0010381 | |||
| 2924 | Ga0451840_11510 | |||
| 2925 | Ga0451846_53461 | |||
| 2926 | Ga0451849_0343204 | |||
| 2927 | Ga0451854_38034 | |||
| 2928 | Ga0452268_28007 | |||
| 2929 | Ga0466972_0000142 | |||
| 2930 | Ga0466965_0041923 | |||
| 2931 | Ga0466966_0000743 | |||
| 2932 | Ga0466961_0000013 | |||
| 2933 | Ga0451576_0000108 | |||
| 2934 | Ga0466967_0223783 | |||
| 2935 | Ga0495617_038070 | |||
| 2936 | Ga0495592_0026735 | |||
| 2937 | Ga0495592_0035379 | |||
| 2938 | Ga0495629_0010621 | |||
| 2939 | Ga0495638_0000398 | |||
| 2940 | Ga0495638_0000984 | |||
| 2941 | Ga0495651_0001455 | |||
| 2942 | Ga0495651_0041355 | |||
| 2943 | Ga0495653_0054937 | |||
| 2944 | Ga0495580_0038736 | |||
| 2945 | Ga0495605_0027289 | |||
| 2946 | Ga0495605_0061921 | |||
| 2947 | Ga0495639_0090084 | |||
| 2948 | Ga0495662_0023492 | |||
| 2949 | Ga0495584_0038495 | |||
| 2950 | Ga0495584_0066931 | |||
| 2951 | Ga0495585_0008429 | |||
| 2952 | Ga0495594_0053341 | |||
| 2953 | Ga0495594_0189411 | |||
| 2954 | Ga0495596_0031129 | |||
| 2955 | Ga0495607_0031344 | |||
| 2956 | Ga0495607_0120054 | |||
| 2957 | Ga0495583_0033212 | |||
| 2958 | Ga0495583_0043839 | |||
| 2959 | Ga0495608_0060068 | |||
| 2960 | Ga0495608_0064835 | |||
| 2961 | Ga0495610_0005846 | |||
| 2962 | Ga0495610_0033707 | |||
| 2963 | Ga0495616_0019931 | |||
| 2964 | Ga0495618_0090406 | |||
| 2965 | Ga0495620_0005040 | |||
| 2966 | Ga0495620_0050099 | |||
| 2967 | Ga0495628_0012367 | |||
| 2968 | Ga0495628_0064312 | |||
| 2969 | Ga0495631_0002044 | |||
| 2970 | Ga0495632_0014778 | |||
| 2971 | Ga0495632_0025306 | |||
| 2972 | Ga0495643_0034038 | |||
| 2973 | Ga0495648_0023485 | |||
| 2974 | Ga0495654_0012329 | |||
| 2975 | Ga0495654_0042125 | |||
| 2976 | Ga0495665_0093167 | |||
| 2977 | Ga0495640_0081289 | |||
| 2978 | Ga0495587_0054702 | |||
| 2979 | Ga0495598_0010805 | |||
| 2980 | Ga0495609_0035152 | |||
| 2981 | Ga0495597_0034925 | |||
| 2982 | Ga0495645_0006446 | |||
| 2983 | Ga0495667_0178930 | |||
| 2984 | Ga0495668_0006092 | |||
| 2985 | Ga0495668_0093064 | |||
| 2986 | Ga0495668_0151443 | |||
| 2987 | Ga0495625_0005382 | |||
| 2988 | Ga0495625_0006283 | |||
| 2989 | Ga0495625_0132238 | |||
| 2990 | Ga0495635_0008179 | |||
| 2991 | Ga0495659_0009205 | |||
| 2992 | Ga0495661_0052588 | |||
| 2993 | Ga0495588_0001146 | |||
| 2994 | Ga0495588_0085757 | |||
| 2995 | Ga0495657_0010464 | |||
| 2996 | Ga0495599_0009888 | |||
| 2997 | Ga0495623_0006513 | |||
| 2998 | Ga0495646_0019580 | |||
| 2999 | Ga0495646_0055602 | |||
| 3000 | Ga0495647_0025057 | |||
| 3001 | Ga0495669_0003796 | |||
| 3002 | Ga0495624_0069333 | |||
| 3003 | Ga0495670_0016624 | |||
| 3004 | Ga0495649_0130167 | |||
| 3005 | Ga0495600_0005780 | |||
| 3006 | Ga0495660_0036980 | |||
| 3007 | Ga0495660_0049199 | |||
| 3008 | Ga0495660_0060603 | |||
| 3009 | Ga0495581_0060439 | |||
| 3010 | Ga0495604_0000939 | |||
| 3011 | Ga0495604_0004637 | |||
| 3012 | Ga0495604_0024899 | |||
| 3013 | Ga0495636_0040488 | |||
| 3014 | Ga0495636_0066614 | |||
| 3015 | Ga0495674_0008253 | |||
| 3016 | Ga0495674_0017976 | |||
| 3017 | Ga0495672_0118403 | |||
| 3018 | Ga0495676_0049415 | |||
| 3019 | Ga0495676_0080633 | |||
| 3020 | Ga0495680_0008716 | |||
| 3021 | Ga0495683_0044834 | |||
| 3022 | Ga0495683_0112830 | |||
| 3023 | Ga0495687_022010 | |||
| 3024 | Ga0495685_048100 | |||
| 3025 | Ga0495681_0004119 | |||
| 3026 | Ga0495681_0068694 | |||
| 3027 | Ga0495684_0054666 | |||
| 3028 | Ga0495684_0064339 | |||
| 3029 | Ga0495686_0014003 | |||
| 3030 | Ga0495686_0062679 | |||
| 3031 | Ga0495602_0022141 | |||
| 3032 | Ga0495602_0153059 | |||
| 3033 | Ga0495615_0005003 | |||
| 3034 | Ga0496100_0000050 | |||
| 3035 | Ga0496100_0000310 | |||
| 3036 | Ga0496100_0042930 | |||
| 3037 | Ga0496101_0000121 | |||
| 3038 | Ga0496101_0010077 | |||
| 3039 | Ga0496101_0051291 | |||
| 3040 | Ga0496101_0124102 | |||
| 3041 | Ga0496102_0000679 | |||
| 3042 | Ga0496102_0002728 | |||
| 3043 | Ga0496102_0010100 | |||
| 3044 | Ga0496102_0090375 | |||
| 3045 | Ga0496102_0224187 | |||
| 3046 | Ga0496102_0269753 | |||
| 3047 | Ga0496102_0471420 | |||
| 3048 | Ga0496103_0000175 | |||
| 3049 | Ga0496103_0000777 | |||
| 3050 | Ga0496103_0137749 | |||
| 3051 | Ga0496104_0000500 | |||
| 3052 | Ga0496104_0000588 | |||
| 3053 | Ga0496104_0011318 | |||
| 3054 | Ga0496104_0014050 | |||
| 3055 | Ga0496104_0020089 | |||
| 3056 | Ga0496104_0021190 | |||
| 3057 | Ga0496104_0182554 | |||
| 3058 | Ga0496105_0002408 | |||
| 3059 | Ga0496105_0002551 | |||
| 3060 | Ga0496105_0003077 | |||
| 3061 | Ga0496105_0006243 | |||
| 3062 | Ga0496105_0009375 | |||
| 3063 | Ga0496105_0009884 | |||
| 3064 | Ga0496105_0016466 | |||
| 3065 | Ga0496105_0045775 | |||
| 3066 | Ga0496106_0000133 | |||
| 3067 | Ga0496106_0000323 | |||
| 3068 | Ga0496106_0043242 | |||
| 3069 | Ga0496106_0055832 | |||
| 3070 | Ga0496106_0186856 | |||
| 3071 | Ga0496107_0000237 | |||
| 3072 | Ga0496107_0006942 | |||
| 3073 | Ga0496107_0008677 | |||
| 3074 | Ga0496107_0013131 | |||
| 3075 | Ga0496107_0148941 | |||
| 3076 | Ga0496107_0162931 | |||
| 3077 | Ga0496108_0001888 | |||
| 3078 | Ga0496108_0024837 | |||
| 3079 | Ga0496108_0038602 | |||
| 3080 | Ga0496108_0057474 | |||
| 3081 | Ga0496109_0000493 | |||
| 3082 | Ga0496109_0000952 | |||
| 3083 | Ga0496109_0001602 | |||
| 3084 | Ga0496109_0041234 | |||
| 3085 | Ga0496109_0049410 | |||
| 3086 | Ga0496109_0190810 | |||
| 3087 | Ga0496109_0192867 | |||
| 3088 | Ga0496110_0003720 | |||
| 3089 | Ga0496110_0003830 | |||
| 3090 | Ga0496110_0014142 | |||
| 3091 | Ga0496110_0064390 | |||
| 3092 | Ga0496110_0152174 | |||
| 3093 | Ga0496111_0001343 | |||
| 3094 | Ga0496111_0009718 | |||
| 3095 | Ga0496111_0066787 | |||
| 3096 | Ga0496111_0184353 | |||
| 3097 | Ga0496112_0011990 | |||
| 3098 | Ga0496112_0033461 | |||
| 3099 | Ga0496112_0042530 | |||
| 3100 | Ga0496112_0047993 | |||
| 3101 | Ga0496113_0000869 | |||
| 3102 | Ga0496113_0012388 | |||
| 3103 | Ga0496113_0032115 | |||
| 3104 | Ga0496113_0090154 | |||
| 3105 | Ga0496113_0124584 | |||
| 3106 | Ga0496114_0002721 | |||
| 3107 | Ga0496114_0026653 | |||
| 3108 | Ga0496114_0137983 | |||
| 3109 | Ga0496115_0001322 | |||
| 3110 | Ga0496115_0001562 | |||
| 3111 | Ga0496115_0009975 | |||
| 3112 | Ga0496115_0041219 | |||
| 3113 | Ga0496115_0064682 | |||
| 3114 | Ga0496115_0146054 | |||
| 3115 | Ga0496116_0000026 | |||
| 3116 | Ga0496116_0051378 | |||
| 3117 | Ga0496116_0060520 | |||
| 3118 | Ga0496116_0076919 | |||
| 3119 | Ga0496116_0082859 | |||
| 3120 | Ga0496117_0000002 | |||
| 3121 | Ga0496117_0028675 | |||
| 3122 | Ga0496117_0083200 | |||
| 3123 | Ga0496117_0110951 | |||
| 3124 | Ga0496117_0162863 | |||
| 3125 | Ga0496118_0002844 | |||
| 3126 | Ga0496118_0014526 | |||
| 3127 | Ga0496118_0016840 | |||
| 3128 | Ga0496118_0022202 | |||
| 3129 | Ga0496118_0048224 | |||
| 3130 | Ga0496119_0010067 | |||
| 3131 | Ga0496119_0014918 | |||
| 3132 | Ga0496119_0021542 | |||
| 3133 | Ga0496120_0000034 | |||
| 3134 | Ga0496120_0000455 | |||
| 3135 | Ga0496120_0025451 | |||
| 3136 | Ga0496120_0077220 | |||
| 3137 | Ga0496120_0152319 | |||
| 3138 | Ga0496121_0000220 | |||
| 3139 | Ga0496121_0071800 | |||
| 3140 | Ga0496121_0080858 | |||
| 3141 | Ga0496122_0000001 | |||
| 3142 | Ga0496122_0035793 | |||
| 3143 | Ga0496122_0059858 | |||
| 3144 | Ga0496123_0000001 | |||
| 3145 | Ga0496123_0014463 | |||
| 3146 | Ga0496123_0045453 | |||
| 3147 | Ga0496123_0142329 | |||
| 3148 | Ga0496124_0000083 | |||
| 3149 | Ga0496124_0002875 | |||
| 3150 | Ga0496124_0013228 | |||
| 3151 | Ga0496124_0102824 | |||
| 3152 | Ga0496125_0000001 | |||
| 3153 | Ga0496125_0009589 | |||
| 3154 | Ga0496125_0029586 | |||
| 3155 | Ga0496125_0064016 | |||
| 3156 | Ga0496126_0000069 | |||
| 3157 | Ga0496126_0007323 | |||
| 3158 | Ga0496126_0057065 | |||
| 3159 | Ga0496126_0188432 | |||
| 3160 | Ga0496126_0262819 | |||
| 3161 | Ga0496126_0378317 | |||
| 3162 | Ga0495678_042185 | |||
| 3163 | Ga0495682_0045915 | |||
| 3164 | Ga0501031_0000006 | |||
| 3165 | Ga0501032_0000016 | |||
| 3166 | Ga0501032_0059787 | |||
| 3167 | Ga0501033_0000101 | |||
| 3168 | Ga0501033_0061814 | |||
| 3169 | Ga0501034_0000168 | |||
| 3170 | Ga0501034_0010519 | |||
| 3171 | Ga0501034_0030869 | |||
| 3172 | Ga0501034_0137323 | |||
| 3173 | Ga0501036_0000019 | |||
| 3174 | Ga0501036_0099560 | |||
| 3175 | Ga0501037_0000013 | |||
| 3176 | Ga0501037_0000895 | |||
| 3177 | Ga0501037_0143061 | |||
| 3178 | Ga0501038_0000012 | |||
| 3179 | Ga0501038_0011999 | |||
| 3180 | Ga0501038_0165827 | |||
| 3181 | Ga0501039_0000019 | |||
| 3182 | Ga0501039_0079324 | |||
| 3183 | Ga0501040_0148787 | |||
| 3184 | Ga0501042_0019008 | |||
| 3185 | Ga0501043_0000045 | |||
| 3186 | Ga0501043_0000209 | |||
| 3187 | Ga0501043_0048636 | |||
| 3188 | Ga0501043_0132686 | |||
| 3189 | Ga0501047_0003738 | |||
| 3190 | Ga0501047_0023848 | |||
| 3191 | Ga0501047_0234199 | |||
| 3192 | Ga0501069_0000007 | |||
| 3193 | Ga0501070_0000758 | |||
| 3194 | Ga0501070_0003344 | |||
| 3195 | Ga0501070_0021164 | |||
| 3196 | Ga0501070_0059883 | |||
| 3197 | Ga0501070_0084105 | |||
| 3198 | Ga0501070_0131515 | |||
| 3199 | Ga0501071_0013377 | |||
| 3200 | Ga0501071_0091102 | |||
| 3201 | Ga0501072_0036236 | |||
| 3202 | Ga0501074_0000047 | |||
| 3203 | Ga0501074_0010115 | |||
| 3204 | Ga0501074_0047884 | |||
| 3205 | Ga0501076_0006762 | |||
| 3206 | Ga0501080_0005487 | |||
| 3207 | Ga0501080_0009780 | |||
| 3208 | Ga0501080_0203467 | |||
| 3209 | Ga0501083_0000029 | |||
| 3210 | Ga0501280_002770 | |||
| 3211 | Ga0501035_0000060 | |||
| 3212 | Ga0501035_0000081 | |||
| 3213 | Ga0501035_0004420 | |||
| 3214 | Ga0501035_0029235 | |||
| 3215 | Ga0501035_0044246 | |||
| 3216 | Ga0501035_0092164 | |||
| 3217 | Ga0501044_0000009 | |||
| 3218 | Ga0501044_0000029 | |||
| 3219 | Ga0501044_0052912 | |||
| 3220 | Ga0501044_0252875 | |||
| 3221 | Ga0501045_0006727 | |||
| 3222 | nmdc:mga03683_1100_c1 | |||
| 3223 | nmdc:mga03683_409_c1 | |||
| 3224 | nmdc:mga03683_83526_c1 | |||
| 3225 | nmdc:mga03n38_12016_c1 | |||
| 3226 | nmdc:mga00v17_106281_c1 | |||
| 3227 | nmdc:mga00v17_108403_c1 | |||
| 3228 | nmdc:mga00v17_130499_c1 | |||
| 3229 | nmdc:mga00v17_180316_c1 | |||
| 3230 | nmdc:mga00v17_26_c1 | |||
| 3231 | nmdc:mga00v17_30112_c1 | |||
| 3232 | nmdc:mga00v17_47_c1 | |||
| 3233 | nmdc:mga0yw44_11106_c1 | |||
| 3234 | nmdc:mga0yw44_165685_c1 | |||
| 3235 | nmdc:mga0yw44_18361_c1 | |||
| 3236 | nmdc:mga0yw44_185747_c1 | |||
| 3237 | nmdc:mga0yw44_31900_c1 | |||
| 3238 | nmdc:mga0yw44_3820_c1 | |||
| 3239 | nmdc:mga0yw44_3977_c1 | |||
| 3240 | nmdc:mga0yw44_81306_c1 | |||
| 3241 | nmdc:mga0yw44_831_c1 | |||
| 3242 | nmdc:mga0yw44_8596_c1 | |||
| 3243 | nmdc:mga0k408_143738_c1 | |||
| 3244 | nmdc:mga0k408_40451_c1 | |||
| 3245 | nmdc:mga0k408_7428_c1 | |||
| 3246 | nmdc:mga0k408_9138_c1 | |||
| 3247 | nmdc:mga06z11_114704_c1 | |||
| 3248 | nmdc:mga06z11_16404_c1 | |||
| 3249 | nmdc:mga06z11_176767_c1 | |||
| 3250 | nmdc:mga06z11_18791_c1 | |||
| 3251 | nmdc:mga06z11_3255_c1 | |||
| 3252 | nmdc:mga06z11_91170_c1 | |||
| 3253 | nmdc:mga06z11_92439_c1 | |||
| 3254 | nmdc:mga04h51_23837_c1 | |||
| 3255 | nmdc:mga04h51_32896_c1 | |||
| 3256 | nmdc:mga04h51_4064_c1 | |||
| 3257 | nmdc:mga07m45_108881_c1 | |||
| 3258 | nmdc:mga07m45_23668_c2 | |||
| 3259 | nmdc:mga07m45_30403_c1 | |||
| 3260 | nmdc:mga07m45_3358_c1 | |||
| 3261 | nmdc:mga07m45_36073_c1 | |||
| 3262 | nmdc:mga07m45_50498_c1 | |||
| 3263 | nmdc:mga07m45_61401_c1 | |||
| 3264 | nmdc:mga07m45_64686_c1 | |||
| 3265 | nmdc:mga07m45_91680_c1 | |||
| 3266 | nmdc:mga05p37_41138_c1 | |||
| 3267 | nmdc:mga05p37_83860_c1 | |||
| 3268 | nmdc:mga05p37_94463_c1 | |||
| 3269 | nmdc:mga09592_17221_c1 | |||
| 3270 | nmdc:mga09592_76716_c1 | |||
| 3271 | nmdc:mga0qj67_34351_c1 | |||
| 3272 | nmdc:mga06r32_14671_c1 | |||
| 3273 | nmdc:mga06r32_272496_c1 | |||
| 3274 | nmdc:mga06r32_8869_c1 | |||
| 3275 | nmdc:mga08y16_202134_c1 | |||
| 3276 | nmdc:mga08y16_3032_c1 | |||
| 3277 | nmdc:mga08y16_409700_c1 | |||
| 3278 | nmdc:mga08y16_706_c1 | |||
| 3279 | nmdc:mga0n895_151399_c1 | |||
| 3280 | nmdc:mga0n895_2736_c1 | |||
| 3281 | nmdc:mga0rr50_54810_c1 | |||
| 3282 | nmdc:mga0a205_197_c1 | |||
| 3283 | nmdc:mga0sz30_148_c1 | |||
| 3284 | nmdc:mga0sz30_18723_c1 | |||
| 3285 | nmdc:mga0sz30_57771_c1 | |||
| 3286 | nmdc:mga0sz30_6454_c1 | |||
| 3287 | Ga0495601_0013325 | |||
| 3288 | Ga0495612_0003890 | |||
| 3289 | Ga0500610_0025694 | |||
| 3290 | Ga0500610_0072570 | |||
| 3291 | Ga0495619_0001328 | |||
| 3292 | Ga0495619_0013741 | |||
| 3293 | Ga0500578_0060890 | |||
| 3294 | Ga0500643_000015 | |||
| 3295 | Ga0500643_012824 | |||
| 3296 | Ga0500644_0040454 | |||
| 3297 | Ga0500581_120407 | |||
| 3298 | Ga0500566_0000082 | |||
| 3299 | Ga0500641_0000376 | |||
| 3300 | Ga0500641_0004622 | |||
| 3301 | Ga0500641_0017367 | |||
| 3302 | Ga0500641_0026306 | |||
| 3303 | Ga0500650_0013072 | |||
| 3304 | Ga0500556_0000002 | |||
| 3305 | Ga0500557_000022 | |||
| 3306 | Ga0500557_018021 | |||
| 3307 | Ga0500562_032766 | |||
| 3308 | Ga0500569_005635 | |||
| 3309 | Ga0500569_029724 | |||
| 3310 | Ga0500592_001501 | |||
| 3311 | Ga0500594_0015572 | |||
| 3312 | Ga0500642_0000016 | |||
| 3313 | Ga0500642_0000166 | |||
| 3314 | Ga0500658_0000625 | |||
| 3315 | Ga0500659_0043180 | |||
| 3316 | Ga0500559_0020582 | |||
| 3317 | Ga0500568_0000035 | |||
| 3318 | Ga0500568_0002154 | |||
| 3319 | Ga0500568_0013231 | |||
| 3320 | Ga0500568_0018845 | |||
| 3321 | Ga0500577_0000373 | |||
| 3322 | Ga0500577_0043761 | |||
| 3323 | Ga0500588_0072814 | |||
| 3324 | Ga0500604_0000742 | |||
| 3325 | Ga0500604_0020569 | |||
| 3326 | Ga0500616_0001686 | |||
| 3327 | Ga0500616_0014259 | |||
| 3328 | Ga0500622_0000668 | |||
| 3329 | Ga0500622_0010502 | |||
| 3330 | Ga0500624_001406 | |||
| 3331 | Ga0500627_0035377 | |||
| 3332 | Ga0500627_0039600 | |||
| 3333 | Ga0500627_0052474 | |||
| 3334 | Ga0500634_0004710 | |||
| 3335 | Ga0500636_0000036 | |||
| 3336 | Ga0500636_0003407 | |||
| 3337 | Ga0500611_006845 | |||
| 3338 | Ga0500625_006836 | |||
| 3339 | Ga0500645_012516 | |||
| 3340 | Ga0500645_028625 | |||
| 3341 | Ga0500645_039163 | |||
| 3342 | Ga0500609_003310 | |||
| 3343 | Ga0500601_000258 | |||
| 3344 | Ga0501084_0001734 | |||
| 3345 | Ga0587090_004716 | |||
| 3346 | Ga0501082_0000053 | |||
| 3347 | Ga0501082_0007228 | |||
| 3348 | Ga0501082_0360620 | |||
| 3349 | Ga0530510_0041559 | |||
| 3350 | 2840769232 | |||
| 3351 | 2503198329 | |||
| 3352 | 2507508584 | |||
| 3353 | 2508542656 | |||
| 3354 | 2508691568 | |||
| 3355 | 2509079577 | |||
| 3356 | 2509111394 | |||
| 3357 | 2509114447 | |||
| 3358 | 2509368395 | |||
| 3359 | 2509375667 | |||
| 3360 | 2509447931 | |||
| 3361 | 2510134869 | |||
| 3362 | 2510303293 | |||
| 3363 | 2510314677 | |||
| 3364 | 2510896275 | |||
| 3365 | 2511137054 | |||
| 3366 | 2511174201 | |||
| 3367 | 2511390399 | |||
| 3368 | 2511401273 | |||
| 3369 | 2511501969 | |||
| 3370 | 2512533337 | |||
| 3371 | 2512934195 | |||
| 3372 | 2512962495 | |||
| 3373 | 2512971094 | |||
| 3374 | 2513572632 | |||
| 3375 | 2513580137 | |||
| 3376 | 2513582634 | |||
| 3377 | 2513604549 | |||
| 3378 | 2513609801 | |||
| 3379 | 2513615464 | |||
| 3380 | 2513623046 | |||
| 3381 | 2513631293 | |||
| 3382 | 2513640447 | |||
| 3383 | 2513645841 | |||
| 3384 | 2513710812 | |||
| 3385 | 2513872767 | |||
| 3386 | 2513881253 | |||
| 3387 | 2513902384 | |||
| 3388 | 2513984597 | |||
| 3389 | 2513997068 | |||
| 3390 | 2514007602 | |||
| 3391 | 2514011853 | |||
| 3392 | 2514022310 | |||
| 3393 | 2514037866 | |||
| 3394 | 2514587362 | |||
| 3395 | 2515113952 | |||
| 3396 | 2515608762 | |||
| 3397 | 2515628365 | |||
| 3398 | 2515636974 | |||
| 3399 | 2515643003 | |||
| 3400 | 2515656752 | |||
| 3401 | 2515743691 | |||
| 3402 | 2516209689 | |||
| 3403 | 2516893265 | |||
| 3404 | 2517037583 | |||
| 3405 | 2517077870 | |||
| 3406 | 2517096667 | |||
| 3407 | 2517102527 | |||
| 3408 | 2517106751 | |||
| 3409 | 2517410381 | |||
| 3410 | 2517570022 | |||
| 3411 | 2520377947 | |||
| 3412 | 2524443297 | |||
| 3413 | 2524448835 | |||
| 3414 | 2524460624 | |||
| 3415 | 2528854928 | |||
| 3416 | 2530646980 | |||
| 3417 | 2535519405 | |||
| 3418 | 2537877385 | |||
| 3419 | 2551675157 | |||
| 3420 | 2551680517 | |||
| 3421 | 2551688050 | |||
| 3422 | 2551691142 | |||
| 3423 | 2551693968 | |||
| 3424 | 2551713208 | |||
| 3425 | 2551745077 | |||
| 3426 | 2554246281 | |||
| 3427 | 2558867983 | |||
| 3428 | 2559293503 | |||
| 3429 | 2585166129 | |||
| 3430 | 2585202444 | |||
| 3431 | 2585273236 | |||
| 3432 | 2585278930 | |||
| 3433 | 2585325455 | |||
| 3434 | 2585393047 | |||
| 3435 | 2585402245 | |||
| 3436 | 2585529053 | |||
| 3437 | 2585530727 | |||
| 3438 | 2585540993 | |||
| 3439 | 2585554907 | |||
| 3440 | 2585559464 | |||
| 3441 | 2585822455 | |||
| 3442 | 2585839755 | |||
| 3443 | 2585902135 | |||
| 3444 | 2585905160 | |||
| 3445 | 2585998486 | |||
| 3446 | 2586003050 | |||
| 3447 | 2587979725 | |||
| 3448 | 2588520344 | |||
| 3449 | 2597810534 | |||
| 3450 | 2599331579 | |||
| 3451 | 2599604385 | |||
| 3452 | 2599935464 | |||
| 3453 | 2600193092 | |||
| 3454 | 2601609478 | |||
| 3455 | 2601746253 | |||
| 3456 | 2616295586 | |||
| 3457 | 2616305797 | |||
| 3458 | 2617349020 | |||
| 3459 | 2643772430 | |||
| 3460 | 2643803592 | |||
| 3461 | 2643838345 | |||
| 3462 | 2643857896 | |||
| 3463 | 2643920662 | |||
| 3464 | 2643983922 | |||
| 3465 | 2644050739 | |||
| 3466 | 2644067559 | |||
| 3467 | 2644107705 | |||
| 3468 | 2644133353 | |||
| 3469 | 2644148624 | |||
| 3470 | 2644156052 | |||
| 3471 | 2644205213 | |||
| 3472 | 2644210227 | |||
| 3473 | 2644298042 | |||
| 3474 | 2644309099 | |||
| 3475 | 2644332927 | |||
| 3476 | 2644375239 | |||
| 3477 | 2644418612 | |||
| 3478 | 2644451979 | |||
| 3479 | 2644483657 | |||
| 3480 | 2644491797 | |||
| 3481 | 2644501345 | |||
| 3482 | 2644519530 | |||
| 3483 | 2644545901 | |||
| 3484 | 2644615041 | |||
| 3485 | 2644653779 | |||
| 3486 | 2644656294 | |||
| 3487 | 2644676578 | |||
| 3488 | 2644690741 | |||
| 3489 | 2657681192 | |||
| 3490 | 2671115284 | |||
| 3491 | 2688595651 | |||
| 3492 | 2694628186 | |||
| 3493 | 2694640957 | |||
| 3494 | 2719387293 | |||
| 3495 | 2720493355 | |||
| 3496 | 2720614829 | |||
| 3497 | 2720621602 | |||
| 3498 | 2720632930 | |||
| 3499 | 2720776654 | |||
| 3500 | 2721400928 | |||
| 3501 | 2723028242 | |||
| 3502 | 2723561870 | |||
| 3503 | 2723568502 | |||
| 3504 | 2723572937 | |||
| 3505 | 2723848000 | |||
| 3506 | 2724039741 | |||
| 3507 | 2724091261 | |||
| 3508 | 2724105767 | |||
| 3509 | 2724111593 | |||
| 3510 | 2725945441 | |||
| 3511 | 2730109178 | |||
| 3512 | 2738800404 | |||
| 3513 | 2738948748 | |||
| 3514 | 2739035550 | |||
| 3515 | 2739309537 | |||
| 3516 | 2745076657 | |||
| 3517 | 2756674264 | |||
| 3518 | 2765469412 | |||
| 3519 | 2766065296 | |||
| 3520 | 2770200143 | |||
| 3521 | 2774868707 | |||
| 3522 | 2774871196 | |||
| 3523 | 2776261404 | |||
| 3524 | 2776264471 | |||
| 3525 | 2776270195 | |||
| 3526 | 2776285078 | |||
| 3527 | 2776916135 | |||
| 3528 | 2792581765 | |||
| 3529 | 2792620165 | |||
| 3530 | 2792626415 | |||
| 3531 | 2792639364 | |||
| 3532 | 2792746838 | |||
| 3533 | 2793062393 | |||
| 3534 | 2793293610 | |||
| 3535 | 2793313050 | |||
| 3536 | 2793327796 | |||
| 3537 | 2793333405 | |||
| 3538 | 2793353726 | |||
| 3539 | 2793359676 | |||
| 3540 | 2793369429 | |||
| 3541 | 2802719517 | |||
| 3542 | 2802726890 | |||
| 3543 | 2802732251 | |||
| 3544 | 2802739854 | |||
| 3545 | 2802745360 | |||
| 3546 | 2802752752 | |||
| 3547 | 2804752392 | |||
| 3548 | 2805915335 | |||
| 3549 | 2805929431 | |||
| 3550 | 2805935387 | |||
| 3551 | 2806044536 | |||
| 3552 | 2806052737 | |||
| 3553 | 2806059037 | |||
| 3554 | 2806068300 | |||
| 3555 | 2806074420 | |||
| 3556 | 2808986726 | |||
| 3557 | 2818238887 | |||
| 3558 | 2819244365 | |||
| 3559 | 2819556800 | |||
| 3560 | 2819612185 | |||
| 3561 | 2819639226 | |||
| 3562 | 2821123279 | |||
| 3563 | 2824605745 | |||
| 3564 | 2824614458 | |||
| 3565 | 2824623239 | |||
| 3566 | 2824633177 | |||
| 3567 | 2824640014 | |||
| 3568 | 2824649699 | |||
| 3569 | 2824657749 | |||
| 3570 | 2824667126 | |||
| 3571 | 2824677394 | |||
| 3572 | 2824685260 | |||
| 3573 | 2824693056 | |||
| 3574 | 2824700757 | |||
| 3575 | 2824711336 | |||
| 3576 | 2824722402 | |||
| 3577 | 2824732061 | |||
| 3578 | 2824758195 | |||
| 3579 | 2824768176 | |||
| 3580 | 2824779545 | |||
| 3581 | 2835314675 | |||
| 3582 | 2835315267 | |||
| 3583 | 2837683087 | |||
| 3584 | 2838019132 | |||
| 3585 | 2838031451 | |||
| 3586 | 2838051150 | |||
| 3587 | 2838063873 | |||
| 3588 | 2838073357 | |||
| 3589 | 2838079594 | |||
| 3590 | 2838123749 | |||
| 3591 | 2838677535 | |||
| 3592 | 2838684936 | |||
| 3593 | 2838691295 | |||
| 3594 | 2838699227 | |||
| 3595 | 2838703709 | |||
| 3596 | 2838712708 | |||
| 3597 | 2838716424 | |||
| 3598 | 2838719776 | |||
| 3599 | 2838727175 | |||
| 3600 | 2838735778 | |||
| 3601 | 2838739698 | |||
| 3602 | 2838748680 | |||
| 3603 | 2839998355 | |||
| 3604 | 2841736075 | |||
| 3605 | 2841844178 | |||
| 3606 | 2841846707 | |||
| 3607 | 2841853885 | |||
| 3608 | 2841860764 | |||
| 3609 | 2841868146 | |||
| 3610 | 2841948642 | |||
| 3611 | 2841949850 | |||
| 3612 | 2841958666 | |||
| 3613 | 2841966268 | |||
| 3614 | 2841975005 | |||
| 3615 | 2841983427 | |||
| 3616 | 2842039066 | |||
| 3617 | 2842047987 | |||
| 3618 | 2842082185 | |||
| 3619 | 2842113410 | |||
| 3620 | 2842123108 | |||
| 3621 | 2842127264 | |||
| 3622 | 2842132428 | |||
| 3623 | 2842143899 | |||
| 3624 | 2842151218 | |||
| 3625 | 2842152403 | |||
| 3626 | 2842162597 | |||
| 3627 | 2842169975 | |||
| 3628 | 2842172669 | |||
| 3629 | 2842176022 | |||
| 3630 | 2842185034 | |||
| 3631 | 2842189531 | |||
| 3632 | 2842198237 | |||
| 3633 | 2842208330 | |||
| 3634 | 2842213845 | |||
| 3635 | 2842224537 | |||
| 3636 | 2842235593 | |||
| 3637 | 2842241990 | |||
| 3638 | 2842249373 | |||
| 3639 | 2842256274 | |||
| 3640 | 2842263490 | |||
| 3641 | 2842266633 | |||
| 3642 | 2842275770 | |||
| 3643 | 2842281661 | |||
| 3644 | 2842296185 | |||
| 3645 | 2842302428 | |||
| 3646 | 2842308246 | |||
| 3647 | 2842316473 | |||
| 3648 | 2842321362 | |||
| 3649 | 2842345029 | |||
| 3650 | 2842360839 | |||
| 3651 | 2842369148 | |||
| 3652 | 2842375613 | |||
| 3653 | 2842382585 | |||
| 3654 | 2842389986 | |||
| 3655 | 2842398485 | |||
| 3656 | 2842426992 | |||
| 3657 | 2842429952 | |||
| 3658 | 2842436388 | |||
| 3659 | 2842444091 | |||
| 3660 | 2842451055 | |||
| 3661 | 2842464373 | |||
| 3662 | 2842470717 | |||
| 3663 | 2842477954 | |||
| 3664 | 2842493302 | |||
| 3665 | 2842499128 | |||
| 3666 | 2842504763 | |||
| 3667 | 2842517549 | |||
| 3668 | 2842522690 | |||
| 3669 | 2842872368 | |||
| 3670 | 2842923976 | |||
| 3671 | 2844003818 | |||
| 3672 | 2844010450 | |||
| 3673 | 2844167582 | |||
| 3674 | 2844319500 | |||
| 3675 | 2844457469 | |||
| 3676 | 2847673181 | |||
| 3677 | 2847689695 | |||
| 3678 | 2847936209 | |||
| 3679 | 2847946565 | |||
| 3680 | 2849079310 | |||
| 3681 | 2850081157 | |||
| 3682 | 2852389098 | |||
| 3683 | 2854682063 | |||
| 3684 | 2854900802 | |||
| 3685 | 2854918831 | |||
| 3686 | 2855825988 | |||
| 3687 | 2855841333 | |||
| 3688 | 2856319786 | |||
| 3689 | 2856320892 | |||
| 3690 | 2856332866 | |||
| 3691 | 2856340247 | |||
| 3692 | 2856342172 | |||
| 3693 | 2856353700 | |||
| 3694 | 2856363311 | |||
| 3695 | 2856366157 | |||
| 3696 | 2857352623 | |||
| 3697 | 2857371115 | |||
| 3698 | 2857518877 | |||
| 3699 | 2857533769 | |||
| 3700 | 2858802320 | |||
| 3701 | 2869165868 | |||
| 3702 | 2869171985 | |||
| 3703 | 2869239355 | |||
| 3704 | 2869249017 | |||
| 3705 | 2869254940 | |||
| 3706 | 2869260691 | |||
| 3707 | 2869267204 | |||
| 3708 | 2869275465 | |||
| 3709 | 2869280138 | |||
| 3710 | 2869290988 | |||
| 3711 | 2871433270 | |||
| 3712 | 2871441977 | |||
| 3713 | 2871463507 | |||
| 3714 | 2871468359 | |||
| 3715 | 2871475039 | |||
| 3716 | 2871488368 | |||
| 3717 | 2871491170 | |||
| 3718 | 2871498916 | |||
| 3719 | 2874105934 | |||
| 3720 | 2874120873 | |||
| 3721 | 2874131425 | |||
| 3722 | 2874132980 | |||
| 3723 | 2874143309 | |||
| 3724 | 2874148788 | |||
| 3725 | 2874160834 | |||
| 3726 | 2874164783 | |||
| 3727 | 2874172064 | |||
| 3728 | 2874598047 | |||
| 3729 | 2874615408 | |||
| 3730 | 2874627828 | |||
| 3731 | 2874631855 | |||
| 3732 | 2874647507 | |||
| 3733 | 2876363543 | |||
| 3734 | 2876373026 | |||
| 3735 | 2876382929 | |||
| 3736 | 2876391354 | |||
| 3737 | 2876397340 | |||
| 3738 | 2876403926 | |||
| 3739 | 2876410068 | |||
| 3740 | 2876418874 | |||
| 3741 | 2876426048 | |||
| 3742 | 2876766943 | |||
| 3743 | 2876778475 | |||
| 3744 | 2876820421 | |||
| 3745 | 2878039739 | |||
| 3746 | 2878733682 | |||
| 3747 | 2878740624 | |||
| 3748 | 2878750883 | |||
| 3749 | 2878755579 | |||
| 3750 | 2878763129 | |||
| 3751 | 2878770104 | |||
| 3752 | 2878780050 | |||
| 3753 | 2878781873 | |||
| 3754 | 2878795242 | |||
| 3755 | 2879082269 | |||
| 3756 | 2879083705 | |||
| 3757 | 2879101241 | |||
| 3758 | 2879135416 | |||
| 3759 | 2879150624 | |||
| 3760 | 2881147898 | |||
| 3761 | 2881159071 | |||
| 3762 | 2881164678 | |||
| 3763 | 2881671171 | |||
| 3764 | 2881847929 | |||
| 3765 | 2881859601 | |||
| 3766 | 2881867237 | |||
| 3767 | 2882457510 | |||
| 3768 | 2882457540 | |||
| 3769 | 2882457711 | |||
| 3770 | 2882634694 | |||
| 3771 | 2882918198 | |||
| 3772 | 2884300795 | |||
| 3773 | 2885306520 | |||
| 3774 | 2885314468 | |||
| 3775 | 2885324216 | |||
| 3776 | 2885333295 | |||
| 3777 | 2885337006 | |||
| 3778 | 2885352224 | |||
| 3779 | 2885413692 | |||
| 3780 | 2888342995 | |||
| 3781 | 2888344044 | |||
| 3782 | 2888352805 | |||
| 3783 | 2888384063 | |||
| 3784 | 2888393794 | |||
| 3785 | 2888424475 | |||
| 3786 | 2889014580 | |||
| 3787 | 2889020438 | |||
| 3788 | 2889919154 | |||
| 3789 | 2894239106 | |||
| 3790 | 2894655527 | |||
| 3791 | 2896389937 | |||
| 3792 | 2898798926 | |||
| 3793 | 2899794409 | |||
| 3794 | 2899808658 | |||
| 3795 | 2899845792 | |||
| 3796 | 2903454374 | |||
| 3797 | 2903498946 | |||
| 3798 | 2903501539 | |||
| 3799 | 2903525493 | |||
| 3800 | 2903531762 | |||
| 3801 | 2903543715 | |||
| 3802 | 2903734436 | |||
| 3803 | 2904584140 | |||
| 3804 | 2904664094 | |||
| 3805 | 2904672852 | |||
| 3806 | 2904714618 | |||
| 3807 | 2906313808 | |||
| 3808 | 2906326517 | |||
| 3809 | 2906334889 | |||
| 3810 | 2906354969 | |||
| 3811 | 2906367875 | |||
| 3812 | 2906375568 | |||
| 3813 | 2906380841 | |||
| 3814 | 2906398191 | |||
| 3815 | 2906401483 | |||
| 3816 | 2906411273 | |||
| 3817 | 2906420562 | |||
| 3818 | 2906432778 | |||
| 3819 | 2906609232 | |||
| 3820 | 2906633266 | |||
| 3821 | 2906651447 | |||
| 3822 | 2913300841 | |||
| 3823 | 2913313844 | |||
| 3824 | 2915981890 | |||
| 3825 | 2915991341 | |||
| 3826 | 2915994365 | |||
| 3827 | 2916004386 | |||
| 3828 | 2916008150 | |||
| 3829 | 2916015089 | |||
| 3830 | 2916024236 | |||
| 3831 | 2916031768 | |||
| 3832 | 2916041270 | |||
| 3833 | 2916042536 | |||
| 3834 | 2916052276 | |||
| 3835 | 2916056437 | |||
| 3836 | 2916067576 | |||
| 3837 | 2916075702 | |||
| 3838 | 2916080863 | |||
| 3839 | 2919075731 | |||
| 3840 | 2919116641 | |||
| 3841 | 2919125020 | |||
| 3842 | 2919168460 | |||
| 3843 | 2919172424 | |||
| 3844 | 2919409333 | |||
| 3845 | 2919454316 | |||
| 3846 | 2920766095 | |||
| 3847 | 2920824721 | |||
| 3848 | 2921201938 | |||
| 3849 | 2921211204 | |||
| 3850 | 2921240723 | |||
| 3851 | 2921244634 | |||
| 3852 | 2921251173 | |||
| 3853 | 2921262468 | |||
| 3854 | 2921265116 | |||
| 3855 | 2921283767 | |||
| 3856 | 2921296325 | |||
| 3857 | 2921303773 | |||
| 3858 | 2922135182 | |||
| 3859 | 2922155086 | |||
| 3860 | 2922165083 | |||
| 3861 | 2922177911 | |||
| 3862 | 2922184595 | |||
| 3863 | 2922186354 | |||
| 3864 | 2922374395 | |||
| 3865 | 2922396239 | |||
| 3866 | 2923558760 | |||
| 3867 | 2924147098 | |||
| 3868 | 2924155258 | |||
| 3869 | 2924160763 | |||
| 3870 | 2924167341 | |||
| 3871 | 2924178982 | |||
| 3872 | 2924184070 | |||
| 3873 | 2924189069 | |||
| 3874 | 2924194796 | |||
| 3875 | 2924203356 | |||
| 3876 | 2924208830 | |||
| 3877 | 2924217920 | |||
| 3878 | 2924226508 | |||
| 3879 | 2924229950 | |||
| 3880 | 2924723133 | |||
| 3881 | 2924728230 | |||
| 3882 | 2924736665 | |||
| 3883 | 2924741501 | |||
| 3884 | 2924754607 | |||
| 3885 | 2924764011 | |||
| 3886 | 2924778225 | |||
| 3887 | 2924785569 | |||
| 3888 | 2926754650 | |||
| 3889 | 2926761818 | |||
| 3890 | 2928524268 | |||
| 3891 | 2929142117 | |||
| 3892 | 2929618065 | |||
| 3893 | 2929627746 | |||
| 3894 | 2932790355 | |||
| 3895 | 2932810775 | |||
| 3896 | 2932823894 | |||
| 3897 | 2933007050 | |||
| 3898 | 2933015360 | |||
| 3899 | 2933574695 | |||
| 3900 | 2933579993 | |||
| 3901 | 2933589300 | |||
| 3902 | 2933594252 | |||
| 3903 | 2933603512 | |||
| 3904 | 2935608885 | |||
| 3905 | 2935623052 | |||
| 3906 | 2935642416 | |||
| 3907 | 2935650051 | |||
| 3908 | 2935661797 | |||
| 3909 | 2935668281 | |||
| 3910 | 2935676312 | |||
| 3911 | 2935692919 | |||
| 3912 | 2935701078 | |||
| 3913 | 2935706141 | |||
| 3914 | 2935721356 | |||
| 3915 | 2935730274 | |||
| 3916 | 2935740287 | |||
| 3917 | 2935749551 | |||
| 3918 | 2935759136 | |||
| 3919 | 2935762536 | |||
| 3920 | 2935773297 | |||
| 3921 | 2935778538 | |||
| 3922 | 2935792749 | |||
| 3923 | 2935800776 | |||
| 3924 | 2935803140 | |||
| 3925 | 2935814456 | |||
| 3926 | 2935822045 | |||
| 3927 | 2935831594 | |||
| 3928 | 2935838454 | |||
| 3929 | 2935847627 | |||
| 3930 | 2935861300 | |||
| 3931 | 2935865838 | |||
| 3932 | 2935878339 | |||
| 3933 | 2935899711 | |||
| 3934 | 2935907530 | |||
| 3935 | 2935909102 | |||
| 3936 | 2935919823 | |||
| 3937 | 2935926324 | |||
| 3938 | 2935934774 | |||
| 3939 | 2935943224 | |||
| 3940 | 2935951662 | |||
| 3941 | 2935967787 | |||
| 3942 | 2935982671 | |||
| 3943 | 2935988165 | |||
| 3944 | 2935994652 | |||
| 3945 | 2936007549 | |||
| 3946 | 2936012465 | |||
| 3947 | 2936021030 | |||
| 3948 | 2936029758 | |||
| 3949 | 2936040013 | |||
| 3950 | 2936047223 | |||
| 3951 | 2936057618 | |||
| 3952 | 2936374846 | |||
| 3953 | 2936380538 | |||
| 3954 | 2936998124 | |||
| 3955 | 2937005064 | |||
| 3956 | 2937012208 | |||
| 3957 | 2937018633 | |||
| 3958 | 2937028972 | |||
| 3959 | 2937031276 | |||
| 3960 | 2937038583 | |||
| 3961 | 2937045881 | |||
| 3962 | 2937050950 | |||
| 3963 | 2937061544 | |||
| 3964 | 2937065229 | |||
| 3965 | 2937073048 | |||
| 3966 | 2937079798 | |||
| 3967 | 2937085166 | |||
| 3968 | 2937097588 | |||
| 3969 | 2937099535 | |||
| 3970 | 2937110009 | |||
| 3971 | 2937116269 | |||
| 3972 | 2937123079 | |||
| 3973 | 2937128708 | |||
| 3974 | 2937819887 | |||
| 3975 | 2937826378 | |||
| 3976 | 2937836691 | |||
| 3977 | 2937847812 | |||
| 3978 | 2937847813 | |||
| 3979 | 2937854682 | |||
| 3980 | 2937861906 | |||
| 3981 | 2937878346 | |||
| 3982 | 2937892192 | |||
| 3983 | 2937980258 | |||
| 3984 | 2937982872 | |||
| 3985 | 2937997564 | |||
| 3986 | 2938018158 | |||
| 3987 | 2939672400 | |||
| 3988 | 2940564859 | |||
| 3989 | 2941504977 | |||
| 3990 | 2941533285 | |||
| 3991 | 2941538878 | |||
| 3992 | 2954013218 | |||
| 3993 | 2957384802 | |||
| 3994 | 2957394844 | |||
| 3995 | 2957398270 | |||
| 3996 | 2957403206 | |||
| 3997 | 2957411599 | |||
| 3998 | 2957418323 | |||
| 3999 | 2957423296 | |||
| 4000 | 2957432799 | |||
| 4001 | 2957441264 | |||
| 4002 | 2957444988 | |||
| 4003 | 2957455969 | |||
| 4004 | 2957459920 | |||
| 4005 | 2957465992 | |||
| 4006 | 2957477087 | |||
| 4007 | 2957479219 | |||
| 4008 | 2957486256 | |||
| 4009 | 2957492868 | |||
| 4010 | 2957498692 | |||
| 4011 | 2957507657 | |||
| 4012 | 2958036004 | |||
| 4013 | 2958045310 | |||
| 4014 | 2958068017 | |||
| 4015 | 2958076059 | |||
| 4016 | 2958085462 | |||
| 4017 | 2958098827 | |||
| 4018 | 2958101736 | |||
| 4019 | 2958108961 | |||
| 4020 | 2958119418 | |||
| 4021 | 2958127179 | |||
| 4022 | 2958135388 | |||
| 4023 | 2958139459 | |||
| 4024 | 2958145512 | |||
| 4025 | 2958161411 | |||
| 4026 | 2958168037 | |||
| 4027 | 2958178982 | |||
| 4028 | 2958184417 | |||
| 4029 | 2960584303 | |||
| 4030 | 2960592717 | |||
| 4031 | 2960602687 | |||
| 4032 | 2960605934 | |||
| 4033 | 2960612420 | |||
| 4034 | 2960620014 | |||
| 4035 | 2960629228 | |||
| 4036 | 2960632834 | |||
| 4037 | 2960639852 | |||
| 4038 | 2960650504 | |||
| 4039 | 2960660039 | |||
| 4040 | 2960660850 | |||
| 4041 | 2960670966 | |||
| 4042 | 2960675913 | |||
| 4043 | 2960681859 | |||
| 4044 | 2960688014 | |||
| 4045 | 2960694661 | |||
| 4046 | 2961082472 | |||
| 4047 | 2961118766 | |||
| 4048 | 2961129736 | |||
| 4049 | 2961166503 | |||
| 4050 | 2961176477 | |||
| 4051 | 2961190417 | |||
| 4052 | 2963645003 | |||
| 4053 | 2964611615 | |||
| 4054 | 2964616576 | |||
| 4055 | 2964622582 | |||
| 4056 | 2964635803 | |||
| 4057 | 2964640947 | |||
| 4058 | 2964649473 | |||
| 4059 | 2964651787 | |||
| 4060 | 2964661011 | |||
| 4061 | 2964667043 | |||
| 4062 | 2964677501 | |||
| 4063 | 2964684091 | |||
| 4064 | 2964687675 | |||
| 4065 | 2964692863 | |||
| 4066 | 2964702322 | |||
| 4067 | 2964711844 | |||
| 4068 | 2964716771 | |||
| 4069 | 2964723890 | |||
| 4070 | 2965021323 | |||
| 4071 | 2965030313 | |||
| 4072 | 2965038417 | |||
| 4073 | 2965046986 | |||
| 4074 | 2965054068 | |||
| 4075 | 2965066309 | |||
| 4076 | 2965094312 | |||
| 4077 | 2965107799 | |||
| 4078 | 2965126747 | |||
| 4079 | 2967665501 | |||
| 4080 | 2967672560 | |||
| 4081 | 2967681857 | |||
| 4082 | 2967691700 | |||
| 4083 | 2967695255 | |||
| 4084 | 2967703245 | |||
| 4085 | 2967707788 | |||
| 4086 | 2967716661 | |||
| 4087 | 2967721662 | |||
| 4088 | 2967734983 | |||
| 4089 | 2967736860 | |||
| 4090 | 2967744128 | |||
| 4091 | 2967755481 | |||
| 4092 | 2967758749 | |||
| 4093 | 2967765379 | |||
| 4094 | 2967775657 | |||
| 4095 | 2967782292 | |||
| 4096 | 2968001506 | |||
| 4097 | 2968007559 | |||
| 4098 | 2968017258 | |||
| 4099 | 2968088715 | |||
| 4100 | 2968093852 | |||
| 4101 | 2968097725 | |||
| 4102 | 2968115233 | |||
| 4103 | 2968121968 | |||
| 4104 | 2968134129 | |||
| 4105 | 2968142241 | |||
| 4106 | 2968174907 | |||
| 4107 | 2970026519 | |||
| 4108 | 2970031011 | |||
| 4109 | 2970039721 | |||
| 4110 | 2970041328 | |||
| 4111 | 2970054421 | |||
| 4112 | 2970057812 | |||
| 4113 | 2970066697 | |||
| 4114 | 2970073000 | |||
| 4115 | 2970077458 | |||
| 4116 | 2970083746 | |||
| 4117 | 2970091173 | |||
| 4118 | 2970097288 | |||
| 4119 | 2970107499 | |||
| 4120 | 2970110866 | |||
| 4121 | 2970122166 | |||
| 4122 | 2970122980 | |||
| 4123 | 2970131683 | |||
| 4124 | 2970138581 | |||
| 4125 | 2970144100 | |||
| 4126 | 2970154256 | |||
| 4127 | 2970160120 | |||
| 4128 | 2970167122 | |||
| 4129 | 2970173284 | |||
| 4130 | 2970178377 | |||
| 4131 | 2970187579 | |||
| 4132 | 2970193336 | |||
| 4133 | 2970470615 | |||
| 4134 | 2970490168 | |||
| 4135 | 2970509148 | |||
| 4136 | 2970514787 | |||
| 4137 | 2970525748 | |||
| 4138 | 2970536594 | |||
| 4139 | 2970544000 | |||
| 4140 | 2970550468 | |||
| 4141 | 2970557977 | |||
| 4142 | 2970594735 | |||
| 4143 | 2970623981 | |||
| 4144 | 2977522403 | |||
| 4145 | 2977529043 | |||
| 4146 | 2977531669 | |||
| 4147 | 2977540564 | |||
| 4148 | 2977549084 | |||
| 4149 | 2977554418 | |||
| 4150 | 2977560182 | |||
| 4151 | 2977572260 | |||
| 4152 | 2977575289 | |||
| 4153 | 2977580173 | |||
| 4154 | 2977824719 | |||
| 4155 | 2977835715 | |||
| 4156 | 2977845485 | |||
| 4157 | 2977857594 | |||
| 4158 | 2977864368 | |||
| 4159 | 2977866508 | |||
| 4160 | 2977873694 | |||
| 4161 | 2977905298 | |||
| 4162 | 2977908976 | |||
| 4163 | 2977918008 | |||
| 4164 | 2977925870 | |||
| 4165 | 2977939515 | |||
| 4166 | 2977944147 | |||
| 4167 | 2977951496 | |||
| 4168 | 2977963420 | |||
| 4169 | 2977978799 | |||
| 4170 | 2977991602 | |||
| 4171 | 2978971135 | |||
| 4172 | 2979092916 | |||
| 4173 | 2979099695 | |||
| 4174 | 2979104885 | |||
| 4175 | 2979712958 | |||
| 4176 | 2979751194 | |||
| 4177 | 2979771573 | |||
| 4178 | 2979776490 | |||
| 4179 | 2979782582 | |||
| 4180 | 2979794707 | |||
| 4181 | 2979813827 | |||
| 4182 | 2984513314 | |||
| 4183 | 2984520317 | |||
| 4184 | 2984539615 | |||
| 4185 | 2984588296 | |||
| 4186 | 2984601841 | |||
| 4187 | 2987641216 | |||
| 4188 | 2987646125 | |||
| 4189 | 2987656608 | |||
| 4190 | 2987662513 | |||
| 4191 | 2987667547 | |||
| 4192 | 2987677285 | |||
| 4193 | 2989354132 | |||
| 4194 | 2989777012 | |||
| 4195 | 2996311828 | |||
| 4196 | 2996338547 | |||
| 4197 | 2996346800 | |||
| 4198 | 2996349945 | |||
| 4199 | 2996391656 | |||
| 4200 | 2996889227 | |||
| 4201 | 2996894710 | |||
| 4202 | 3000142582 | |||
| 4203 | 3002145180 | |||
| 4204 | 3003932697 | |||
| 4205 | 3004172866 | |||
| 4206 | 3004191563 | |||
| 4207 | 3004198194 | |||
| 4208 | 3004210023 | |||
| 4209 | 3004216424 | |||
| 4210 | 3004218635 | |||
| 4211 | 3004239420 | |||
| 4212 | 3004255195 | |||
| 4213 | 3004272554 | |||
| 4214 | 3004276647 | |||
| 4215 | 3004293723 | |||
| 4216 | 3004337751 | |||
| 4217 | 3005417164 | |||
| 4218 | 3005722735 | |||
| 4219 | 637077346 | |||
| 4220 | 639650021 | |||
| 4221 | 643825975 | |||
| 4222 | 648739557 | |||
| 4223 | 649870218 | |||
| 4224 | 650738741 | |||
| 4225 | 8002287118 | |||
| 4226 | 8003572287 | |||
| 4227 | 8003993848 | |||
| 4228 | 8004001393 | |||
| 4229 | 8004301013 | |||
| 4230 | 8004315020 | |||
| 4231 | 8004363417 | |||
| 4232 | 8004377158 | |||
| 4233 | 8004393277 | |||
| 4234 | 8004451485 | |||
| 4235 | 8004637718 | |||
| 4236 | 8004644241 | |||
| 4237 | 8004697698 | |||
| 4238 | 8004707002 | |||
| 4239 | 8004720064 | |||
| 4240 | 8004729718 | |||
| 4241 | 8005247960 | |||
| 4242 | 8005264195 | |||
| 4243 | 8005282039 | |||
| 4244 | 8005288486 | |||
| 4245 | 8005294242 | |||
| 4246 | 8005306653 | |||
| 4247 | 8005309411 | |||
| 4248 | 8005315225 | |||
| 4249 | 8005323754 | |||
| 4250 | 8005382762 | |||
| 4251 | 8005383819 | |||
| 4252 | 8005401145 | |||
| 4253 | 8005434098 | |||
| 4254 | 8005464639 | |||
| 4255 | 8005485605 | |||
| 4256 | 8005501689 | |||
| 4257 | 8005547094 | |||
| 4258 | 8005559142 | |||
| 4259 | 8005566799 | |||
| 4260 | 8005574923 | |||
| 4261 | 8005623043 | |||
| 4262 | 8005631653 | |||
| 4263 | 8005648378 | |||
| 4264 | 8005673111 | |||
| 4265 | 8005684545 | |||
| 4266 | 8005693651 | |||
| 4267 | 8005700889 | |||
| 4268 | 8016522331 | |||
| 4269 | 8016529612 | |||
| 4270 | 8016534829 | |||
| 4271 | 8016548040 | |||
| 4272 | 8016554087 | |||
| 4273 | 8016562462 | |||
| 4274 | 8016573177 | |||
| 4275 | 8016577319 | |||
| 4276 | 8016600257 | |||
| 4277 | 8016614442 | |||
| 4278 | 8016626554 | |||
| 4279 | 8016640339 | |||
| 4280 | 8017063228 | |||
| 4281 | 8018133594 | |||
| 4282 | 8018154626 | |||
| 4283 | 8018170242 | |||
| 4284 | 8018178441 | |||
| 4285 | 8019534593 | |||
| 4286 | 8019544879 | |||
| 4287 | 8019553655 | |||
| 4288 | 8019582654 | |||
| 4289 | 8019600907 | |||
| 4290 | 8019617643 | |||
| 4291 | 8019634457 | |||
| 4292 | 8019645272 | |||
| 4293 | 8019662348 | |||
| 4294 | 8019671849 | |||
| 4295 | 8019690079 | |||
| 4296 | 8023687524 | |||
| 4297 | 8024481973 | |||
| 4298 | 8024505914 | |||
| 4299 | 8049294959 | |||
| 4300 | 8054461050 | |||
| 4301 | 8054562059 | |||
| 4302 | 8055617561 | |||
| 4303 | 8055746346 | |||
| 4304 | 8056381606 | |||
| 4305 | 8056387047 | |||
| 4306 | 8056878716 | |||
| 4307 | 8056878717 | |||
| 4308 | 8056968040 | |||
| 4309 | 8056968483 | |||
| 4310 | 8057877014 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2hzl-assembly1.cif.gz_A | crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms | 0.9906 | 23 | 352 |
| 4yzz-assembly1.cif.gz_A | crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi-500035) mixed occupancy dimer, copurified calcium and picolinate bound active site versus apo site | 0.9814 | 21 | 352 |
| 7ug8-assembly1.cif.gz_A | crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium | 0.9773 | 20 | 345 |
| 2hzl-assembly1.cif.gz_A | crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms | 0.9759 | 23 | 352 |
| 5cm6-assembly1.cif.gz_B | crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate | 0.9708 | 22 | 343 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2hzkC01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9786 | 23 | 349 | 3.40.190.170 |
| 4yzzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9682 | 21 | 351 | 3.40.190.170 |
| 2hzkC01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.965 | 23 | 349 | 3.40.190.170 |
| 4yicB02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.956 | 145 | 313 | 3.40.190.10 |
| 4yzzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9551 | 21 | 351 | 3.40.190.170 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0D7EEV2-F1-model_v4 | ABC transporter substrate-binding protein | 0.9886 | 23 | 353 |
GO:0015849
GO:0031317 GO:0043177 GO:0046872 GO:0055085 |
| AF-A0A3N5FTX4-F1-model_v4 | ABC transporter substrate-binding protein | 0.9886 | 41 | 347 |
GO:0055085
|
| AF-A0A537VVV0-F1-model_v4 | ABC transporter substrate-binding protein | 0.9855 | 65 | 353 |
GO:0055085
|
| AF-A0A0D7EEV2-F1-model_v4 | ABC transporter substrate-binding protein | 0.9827 | 23 | 353 |
GO:0015849
GO:0031317 GO:0043177 GO:0046872 GO:0055085 |
| AF-A0A527HEM5-F1-model_v4 | ABC transporter substrate-binding protein | 0.9823 | 167 | 352 |
GO:0055085
|