F496502

General Info

Members Datasets Scaffolds Average Seq Length
2170 1463 4310 361

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2840764183|2840769232
Length 439
Sequence VREFWPVRWILLKYFLVISNDSMATPPLSLHVLDLDKRVCMVIPEIGRPGHNCPVIWAEELSSIVFGGELMDRRSFITKAGFAGVGAAAAATTLAAPAIAQSLPKVTWRCASSFPKSLDTIYGGAEVLSKYLKEATDGNFTIQPFAAGEIVPGLQAADATAAGTVELCHTVAYYYWGKDPTWALGAAVPFALNARGMNAWQYHGGGIDLMNEFFNKQGLQAYPGGNTGVQMGGWFRKEIKTVDDLKGLKMRVGGFAGKVLEKLGVVPQQIAGGDIYPSLEKGTIDAAEWVGPYDDEKLGFQKVAPFYYYPGWWEGGPTVSFMVNKEKWDSLPPAYQSLFRTAAQATDADMLQKYDSLNPAAIKRLVAGGAQLRPFSPEILNACFEAANGVYAEMEANNPAFKKIWESIKAFRNEHFLYAQVAEYSFDTFMMIQQRNGKL

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
9 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
14 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
15 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
16 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
17 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
18 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
19 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
23 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
24 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
33 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
36 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
51 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
54 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
55 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
56 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
57 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
58 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
61 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
64 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
65 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
66 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
67 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
68 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
69 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
70 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
71 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
72 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
79 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
80 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
81 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
82 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
86 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
87 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
88 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
92 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
93 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
94 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
95 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
98 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
99 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
100 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
101 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
102 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
103 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
104 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
107 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
108 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
109 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
110 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
111 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
112 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
113 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
114 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
115 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
116 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
117 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
118 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
119 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
120 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
121 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
123 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
124 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
125 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
126 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
127 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
128 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
129 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
130 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
131 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
132 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
133 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
134 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
135 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
136 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
137 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
138 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
139 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
140 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
142 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
143 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
145 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
146 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
147 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
148 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
149 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
150 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
151 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
152 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
153 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
154 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
155 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
156 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
157 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
158 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
159 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
160 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
161 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
162 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
163 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
164 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
165 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
166 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
167 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
168 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
169 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
170 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
171 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
172 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
173 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
174 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
175 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
176 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
177 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
178 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
179 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
180 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
181 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
182 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
183 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
184 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
185 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
186 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
188 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
189 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
190 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
194 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
195 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
197 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
199 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
201 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
202 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
268 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
269 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
271 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
272 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
273 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
274 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
276 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
278 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
282 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
283 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
284 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
285 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
286 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
287 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
288 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
289 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
290 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
291 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
292 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
293 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
294 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
295 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
296 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
297 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
298 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
299 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
300 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
301 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
302 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
303 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
304 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
305 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
306 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
307 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
308 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
309 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
310 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
311 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
312 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
313 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
314 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
315 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
316 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
317 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
318 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
319 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
320 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
321 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
322 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
323 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
324 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
325 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
326 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
327 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
328 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
329 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
330 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
331 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
332 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
333 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
334 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
335 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
336 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
337 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
338 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
339 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
340 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
341 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
342 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
343 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
344 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
345 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
346 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
347 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
348 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
349 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
350 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
351 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
352 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
353 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
354 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
355 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
356 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
357 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
358 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
359 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
360 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
361 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
362 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
363 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
364 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
365 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
366 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
367 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
368 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
369 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
370 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
371 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
372 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
373 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
374 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
375 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
376 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
377 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
378 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
379 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
380 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
381 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
382 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
383 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
384 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
385 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
386 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
387 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
388 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
389 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
390 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
391 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
392 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
393 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
394 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
395 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
396 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
397 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
398 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
399 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
400 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
401 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
402 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
403 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
404 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
405 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
406 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
407 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
408 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
409 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
410 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
411 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
412 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
413 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
414 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
415 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
416 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
417 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
418 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
419 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
420 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
421 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
422 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
423 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
424 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
425 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
426 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
427 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
428 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
429 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
430 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
431 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
432 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
433 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
434 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
441 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
442 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
446 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
447 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
448 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
449 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
450 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
451 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
452 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
453 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
454 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
455 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
456 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
458 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
459 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
460 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
461 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
462 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
463 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
464 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
465 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
466 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
467 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
468 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
469 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
470 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
471 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
472 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
473 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
474 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
475 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
476 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
477 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
478 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
479 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
480 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
481 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
482 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
483 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
484 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
485 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
486 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
487 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
488 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
489 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
490 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
491 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
492 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
493 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
494 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
495 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
496 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
497 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
498 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
499 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
500 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
501 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
502 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
503 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
504 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
505 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
506 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
507 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
508 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
509 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
510 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
511 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
512 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
513 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
514 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
515 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
516 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
517 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
518 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
519 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
520 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
521 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
522 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
523 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
524 2509276019 Ensifer aridi TW10 Isolate Nodule
525 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
526 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
527 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
528 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
529 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
530 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
531 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
532 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
533 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
534 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
535 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
536 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
537 2512875024
538 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
539 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
540 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
541 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
542 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
543 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
544 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
545 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
546 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
547 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
548 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
549 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
550 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
551 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
552 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
553 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
554 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
555 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
556 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
557 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
558 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
559 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
560 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
561 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
562 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
563 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
564 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
565 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
566 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
567 2516143018 Ensifer sp. BR816 Isolate Nodule
568 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
569 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
570 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
571 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
572 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
573 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
574 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
575 2519899620 Rhizobium sp. Pop5 Isolate Nodule
576 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
577 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
578 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
579 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
580 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
581 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
582 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
583 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
584 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
585 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
586 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
587 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
588 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
589 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
590 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
591 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
592 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
593 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
594 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
595 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
596 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
597 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
598 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
599 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
600 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
601 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
602 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
603 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
604 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
605 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
606 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
607 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
608 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
609 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
610 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
611 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
612 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
613 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
614 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
615 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
616 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
617 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
618 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
619 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
620 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
621 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
622 2643221557 Ensifer sp. Root558 Isolate Unclassified
623 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
624 2643221568 Rhizobium sp. Root564 Isolate Unclassified
625 2643221582 Rhizobium sp. Root651 Isolate Unclassified
626 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
627 2643221607 Rhizobium sp. Root73 Isolate Unclassified
628 2643221610 Ensifer sp. Root74 Isolate Unclassified
629 2643221618 Ensifer sp. Root231 Isolate Unclassified
630 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
631 2643221626 Ensifer sp. Root31 Isolate Unclassified
632 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
633 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
634 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
635 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
636 2643221655 Ensifer sp. Root1252 Isolate Unclassified
637 2643221659 Ensifer sp. Root127 Isolate Unclassified
638 2643221668 Ensifer sp. Root423 Isolate Unclassified
639 2643221675 Ensifer sp. Root1298 Isolate Unclassified
640 2643221680 Ensifer sp. Root1312 Isolate Unclassified
641 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
642 2643221688 Rhizobium sp. Root482 Isolate Unclassified
643 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
644 2643221693 Rhizobium sp. Root491 Isolate Unclassified
645 2643221698 Ensifer sp. Root142 Isolate Unclassified
646 2643221712 Ensifer sp. Root258 Isolate Unclassified
647 2643221718 Rhizobium sp. Root268 Isolate Unclassified
648 2643221719 Rhizobium sp. Root274 Isolate Unclassified
649 2643221723 Ensifer sp. Root278 Isolate Unclassified
650 2643221726 Ensifer sp. Root954 Isolate Unclassified
651 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
652 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
653 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
654 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
655 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
656 2718217927 Rhizobium sp. N324 Isolate Nodule
657 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
658 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
659 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
660 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
661 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
662 2718218423 Rhizobium sp. N941 Isolate Nodule
663 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
664 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
665 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
666 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
667 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
668 2721755809 Rhizobium sp. N541 Isolate Nodule
669 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
670 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
671 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
672 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
673 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
674 2738541293 Rhizobium sp. GV031 Isolate Unclassified
675 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
676 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
677 2738543024 Aminobacter sp. AP02 Isolate Unclassified
678 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
679 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
680 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
681 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
682 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
683 2773857925 Microvirga vignae BR3299 Isolate Unclassified
684 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
685 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
686 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
687 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
688 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
689 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
690 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
691 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
692 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
693 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
694 2791355256 Rhizobium sp. M10 Isolate Nodule
695 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
696 2791355261 Rhizobium sp. J15 Isolate Nodule
697 2791355262 Rhizobium sp. M1 Isolate Nodule
698 2791355265 Rhizobium sp. H4 Isolate Nodule
699 2791355266 Rhizobium sp. L43 Isolate Nodule
700 2791355267 Rhizobium sp. L18 Isolate Nodule
701 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
702 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
703 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
704 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
705 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
706 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
707 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
708 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
709 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
710 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
711 2802429633 Rhizobium anhuiense J3 Isolate Nodule
712 2802429634 Rhizobium anhuiense S10 Isolate Nodule
713 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
714 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
715 2802429637 Rhizobium anhuiense C15 Isolate Nodule
716 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
717 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
718 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
719 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
720 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
721 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
722 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
723 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
724 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
725 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
726 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
727 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
728 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
729 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
730 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
731 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
732 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
733 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
734 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
735 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
736 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
737 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
738 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
739 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
740 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
741 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
742 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
743 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
744 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
745 2838048938 Rhizobium pisi 27/80 Isolate Nodule
746 2838061910 Rhizobium phaseoli L15 Isolate Nodule
747 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
748 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
749 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
750 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
751 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
752 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
753 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
754 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
755 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
756 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
757 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
758 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
759 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
760 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
761 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
762 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
763 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
764 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
765 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
766 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
767 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
768 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
769 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
770 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
771 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
772 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
773 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
774 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
775 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
776 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
777 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
778 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
779 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
780 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
781 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
782 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
783 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
784 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
785 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
786 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
787 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
788 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
789 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
790 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
791 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
792 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
793 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
794 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
795 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
796 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
797 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
798 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
799 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
800 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
801 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
802 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
803 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
804 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
805 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
806 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
807 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
808 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
809 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
810 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
811 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
812 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
813 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
814 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
815 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
816 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
817 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
818 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
819 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
820 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
821 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
822 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
823 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
824 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
825 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
826 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
827 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
828 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
829 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
830 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
831 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
832 2844163670 Ensifer sp. 1H6 Isolate Unclassified
833 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
834 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
835 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
836 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
837 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
838 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
839 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
840 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
841 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
842 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
843 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
844 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
845 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
846 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
847 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
848 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
849 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
850 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
851 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
852 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
853 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
854 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
855 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
856 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
857 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
858 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
859 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
860 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
861 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
862 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
863 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
864 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
865 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
866 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
867 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
868 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
869 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
870 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
871 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
872 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
873 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
874 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
875 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
876 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
877 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
878 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
879 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
880 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
881 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
882 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
883 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
884 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
885 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
886 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
887 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
888 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
889 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
890 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
891 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
892 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
893 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
894 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
895 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
896 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
897 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
898 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
899 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
900 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
901 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
902 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
903 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
904 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
905 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
906 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
907 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
908 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
909 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
910 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
911 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
912 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
913 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
914 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
915 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
916 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
917 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
918 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
919 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
920 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
921 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
922 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
923 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
924 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
925 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
926 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
927 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
928 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
929 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
930 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
931 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
932 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
933 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
934 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
935 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
936 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
937 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
938 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
939 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
940 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
941 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
942 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
943 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
944 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
945 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
946 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
947 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
948 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
949 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
950 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
951 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
952 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
953 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
954 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
955 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
956 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
957 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
958 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
959 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
960 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
961 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
962 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
963 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
964 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
965 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
966 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
967 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
968 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
969 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
970 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
971 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
972 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
973 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
974 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
975 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
976 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
977 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
978 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
979 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
980 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
981 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
982 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
983 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
984 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
985 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
986 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
987 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
988 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
989 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
990 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
991 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
992 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
993 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
994 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
995 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
996 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
997 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
998 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
999 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
1000 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
1001 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
1002 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
1003 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
1004 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
1005 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
1006 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
1007 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
1008 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
1009 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
1010 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
1011 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
1012 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
1013 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
1014 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
1015 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
1016 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
1017 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
1018 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
1019 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
1020 2922368715
1021 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
1022 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
1023 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
1024 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
1025 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
1026 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
1027 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
1028 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
1029 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
1030 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
1031 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
1032 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
1033 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
1034 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
1035 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
1036 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
1037 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
1038 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
1039 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
1040 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
1041 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
1042 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
1043 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
1044 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
1045 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
1046 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
1047 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
1048 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
1049 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
1050 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
1051 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
1052 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
1053 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
1054 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
1055 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
1056 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
1057 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
1058 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
1059 2933599457 Rhizobium phaseoli M3 Isolate Nodule
1060 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
1061 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
1062 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
1063 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
1064 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
1065 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
1066 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
1067 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
1068 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
1069 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
1070 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
1071 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
1072 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
1073 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
1074 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
1075 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
1076 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
1077 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
1078 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
1079 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
1080 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
1081 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
1082 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
1083 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
1084 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
1085 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
1086 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
1087 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
1088 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
1089 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
1090 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
1091 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
1092 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
1093 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
1094 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
1095 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
1096 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
1097 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
1098 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
1099 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
1100 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
1101 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
1102 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
1103 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
1104 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
1105 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
1106 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
1107 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
1108 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
1109 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
1110 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
1111 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
1112 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
1113 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
1114 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
1115 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
1116 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
1117 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
1118 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
1119 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
1120 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
1121 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
1122 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
1123 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
1124 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
1125 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
1126 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
1127 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
1128 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
1129 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
1130 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
1131 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
1132 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
1133 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
1134 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
1135 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
1136 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
1137 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
1138 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
1139 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
1140 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
1141 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
1142 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
1143 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
1144 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
1145 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
1146 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
1147 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
1148 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
1149 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
1150 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
1151 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
1152 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
1153 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
1154 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
1155 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
1156 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
1157 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
1158 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
1159 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
1160 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
1161 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
1162 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
1163 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
1164 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
1165 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
1166 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
1167 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
1168 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
1169 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
1170 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
1171 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
1172 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
1173 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
1174 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
1175 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
1176 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
1177 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
1178 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
1179 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
1180 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
1181 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
1182 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
1183 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
1184 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
1185 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
1186 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
1187 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
1188 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
1189 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
1190 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
1191 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
1192 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
1193 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
1194 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
1195 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
1196 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
1197 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
1198 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
1199 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
1200 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
1201 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
1202 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
1203 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
1204 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
1205 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
1206 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
1207 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
1208 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
1209 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
1210 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
1211 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
1212 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
1213 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
1214 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
1215 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
1216 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
1217 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
1218 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
1219 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
1220 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
1221 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
1222 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
1223 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
1224 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
1225 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
1226 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
1227 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
1228 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
1229 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
1230 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
1231 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
1232 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
1233 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
1234 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
1235 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
1236 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
1237 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
1238 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
1239 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
1240 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
1241 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
1242 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
1243 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
1244 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
1245 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
1246 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
1247 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
1248 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
1249 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
1250 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
1251 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
1252 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
1253 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
1254 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
1255 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
1256 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
1257 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
1258 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
1259 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
1260 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
1261 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
1262 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
1263 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
1264 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
1265 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
1266 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
1267 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
1268 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
1269 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
1270 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
1271 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
1272 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
1273 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
1274 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
1275 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
1276 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
1277 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
1278 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
1279 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
1280 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
1281 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
1282 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
1283 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
1284 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
1285 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
1286 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
1287 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
1288 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
1289 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
1290 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
1291 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
1292 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
1293 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
1294 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
1295 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
1296 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
1297 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
1298 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
1299 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
1300 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
1301 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
1302 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
1303 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
1304 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
1305 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
1306 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
1307 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
1308 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
1309 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
1310 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
1311 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
1312 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
1313 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
1314 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
1315 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
1316 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
1317 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
1318 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
1319 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
1320 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
1321 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
1322 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
1323 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
1324 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
1325 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
1326 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
1327 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
1328 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
1329 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
1330 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
1331 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
1332 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
1333 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
1334 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
1335 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
1336 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
1337 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
1338 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
1339 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
1340 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
1341 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
1342 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
1343 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
1344 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
1345 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
1346 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
1347 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
1348 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
1349 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
1350 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
1351 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
1352 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
1353 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
1354 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
1355 2996887358 Rhizobium sp. R711 Isolate Nodule
1356 2996893221 Rhizobium sp. R635 Isolate Nodule
1357 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
1358 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
1359 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
1360 3004167301 Mesorhizobium loti 582 Isolate Unclassified
1361 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
1362 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
1363 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
1364 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
1365 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
1366 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
1367 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
1368 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
1369 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
1370 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
1371 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
1372 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
1373 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
1374 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1375 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1376 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1377 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1378 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1379 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1380 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1381 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1382 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1383 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1384 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1385 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1386 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1387 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1388 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1389 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1390 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1391 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1392 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1393 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1394 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1395 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1396 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1397 8005258706 Rhizobium sp. R693 Isolate Nodule
1398 8005275841 Rhizobium sp. N4311 Isolate Nodule
1399 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1400 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1401 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1402 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1403 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1404 8005321885 Rhizobium sp. R72 Isolate Nodule
1405 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1406 8005382845 Rhizobium sp. R634 Isolate Nodule
1407 8005395548 Rhizobium sp. R339 Isolate Nodule
1408 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1409 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1410 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1411 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1412 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1413 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1414 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1415 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1416 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1417 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1418 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1419 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1420 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1421 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1422 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1423 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
1424 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
1425 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
1426 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
1427 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
1428 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
1429 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
1430 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
1431 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
1432 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
1433 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
1434 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
1435 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
1436 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1437 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1438 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1439 8018176218 Rhizobium sp. N122 Isolate Nodule
1440 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
1441 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
1442 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
1443 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
1444 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
1445 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
1446 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
1447 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
1448 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
1449 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
1450 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
1451 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1452 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1453 8024501048 Rhizobium sp. H4 Isolate Nodule
1454 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1455 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1456 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1457 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1458 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
1459 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1460 8056382006 Rhizobium croatiense 13T Isolate Nodule
1461 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1462 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
1463 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 55.51
Metatranscriptomes 0.23
Isolates 44.26

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 13.09
Nodule 35.25
Rhizoplane 4.15
Rhizosphere 36.82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1007941 3300001915 Bacteria 2028
2 JGI24746J21847_1000755 3300001977 Bacteria 4961
3 JGI24740J21852_10006190 3300001979 Bacteria 4984
4 JGI24740J21852_10007518 3300001979 Bacteria 4422
5 JGI24739J22299_10000344 3300001989 Bacteria 15875
6 JGI24739J22299_10043423 3300001989 Bacteria 1487
7 JGI24737J22298_10001079 3300001990 Bacteria 9595
8 JGI24750J21931_1000255 3300002070 Bacteria 9058
9 JGI24745J21846_1000003 3300002073 Bacteria 15974
10 JGI24035J26624_1000595 3300002126 Bacteria 3360
11 JGI24033J26618_1000489 3300002155 Bacteria 3895
12 JGI24034J26672_10000322 3300002239 Bacteria 6170
13 JGI24742J22300_10002875 3300002244 Bacteria 2782
14 JGI24751J29686_10004924 3300002459 Bacteria 2720
15 JGI24751J29686_10010970 3300002459 Bacteria 1868
16 JGI25156J39149_1004063 3300002705 Bacteria 4574
17 JGI25162J39368_1001169 3300002737 Bacteria 15592
18 JGI25158J39367_1000393 3300002739 Bacteria 9201
19 JGI25157J39369_1000738 3300002741 Bacteria 17379
20 JGI25152J39213_1003706 3300002773 Bacteria 5121
21 JGI25159J45721_1000508 3300002987 Bacteria 17749
22 JGI25151J46595_10000585 3300003187 Bacteria 32381
23 JGI25151J46595_10001084 3300003187 Bacteria 20208
24 JGI25151J46595_10036025 3300003187 Bacteria 1871
25 JGI25165J46597_1000147 3300003214 Bacteria 116564
26 JGI25165J46597_1000630 3300003214 Bacteria 29232
27 JGI25153J46596_10000428 3300003215 Bacteria 27370
28 JGI25153J46596_10001318 3300003215 Bacteria 14872
29 JGI25153J46596_10004290 3300003215 Bacteria 7708
30 JGI25153J46596_10017933 3300003215 Bacteria 2768
31 JGI25153J46596_10026971 3300003215 Bacteria 2022
32 JGI25160J50197_1000015 3300003354 Bacteria 250902
33 JGI25160J50197_1000216 3300003354 Bacteria 46708
34 JGI25160J50197_1000438 3300003354 Bacteria 26112
35 JGI25160J50197_1000463 3300003354 Bacteria 25108
36 JGI25160J50197_1001146 3300003354 Bacteria 13557
37 JGI25160J50197_1001518 3300003354 Bacteria 11518
38 JGI25160J50197_1002737 3300003354 Bacteria 8089
39 JGI25160J50197_1005355 3300003354 Bacteria 5357
40 JGI25161J50226_1000005 3300003374 Bacteria 292548
41 JGI25161J50226_1000120 3300003374 Bacteria 57896
42 JGI25161J50226_1000412 3300003374 Bacteria 20844
43 JGI25161J50226_1005409 3300003374 Bacteria 2482
44 Ga0055542_1000252 3300003762 Bacteria 61157
45 Ga0055526_1000594 3300003771 Bacteria 28489
46 Ga0055526_1001753 3300003771 Bacteria 15048
47 Ga0055526_1002151 3300003771 Bacteria 13515
48 Ga0055524_1011640 3300003775 Bacteria 3426
49 Ga0055524_1019832 3300003775 Bacteria 2285
50 Ga0055524_1021731 3300003775 Bacteria 2116
51 Ga0055536_1002870 3300003781 Bacteria 9487
52 Ga0055536_1013021 3300003781 Bacteria 3034
53 Ga0055528_1000693 3300003790 Bacteria 24016
54 Ga0055528_1001185 3300003790 Bacteria 16837
55 Ga0055528_1005562 3300003790 Bacteria 5836
56 Ga0055530_10011385 3300003791 Bacteria 3196
57 Ga0055530_10012693 3300003791 Bacteria 2920
58 Ga0055540_1001134 3300003792 Bacteria 16613
59 Ga0055540_1002011 3300003792 Bacteria 11312
60 Ga0055540_1002353 3300003792 Bacteria 10116
61 Ga0055540_1014218 3300003792 Bacteria 2384
62 Ga0055531_10002835 3300003794 Bacteria 11346
63 Ga0055531_10007059 3300003794 Bacteria 6214
64 Ga0055531_10007361 3300003794 Bacteria 6029
65 Ga0058692_1000689 3300003856 Bacteria 13918
66 Ga0055543_1000012 3300004625 Bacteria 186581
67 Ga0055543_1000155 3300004625 Bacteria 57253
68 Ga0055543_1000301 3300004625 Bacteria 35189
69 Ga0055543_1000631 3300004625 Bacteria 18905
70 Ga0055543_1002832 3300004625 Bacteria 5481
71 Ga0065165_1000125 3300005262 Bacteria 130283
72 Ga0065165_1000717 3300005262 Bacteria 46746
73 Ga0065165_1000780 3300005262 Bacteria 42673
74 Ga0065165_1000826 3300005262 Bacteria 40863
75 Ga0065165_1001465 3300005262 Bacteria 25288
76 Ga0065165_1003182 3300005262 Bacteria 12014
77 Ga0065165_1013609 3300005262 Bacteria 3221
78 Ga0065712_10003725 3300005290 Bacteria 4760
79 Ga0065712_10070614 3300005290 Bacteria 5849
80 Ga0065712_10111484 3300005290 Bacteria 1817
81 Ga0065715_10093037 3300005293 Bacteria 4831
82 Ga0070658_10205856 3300005327 Bacteria 1661
83 Ga0070676_10000784 3300005328 Bacteria 15682
84 Ga0070683_100000114 3300005329 Bacteria 52980
85 Ga0070683_100057598 3300005329 Bacteria 3610
86 Ga0070690_100000064 3300005330 Bacteria 53027
87 Ga0070690_100022010 3300005330 Bacteria 3897
88 Ga0070670_100002373 3300005331 Bacteria 15518
89 Ga0070677_10000193 3300005333 Bacteria 20923
90 Ga0070677_10022088 3300005333 Bacteria 2339
91 Ga0068869_100000020 3300005334 Bacteria 66561
92 Ga0068869_100006431 3300005334 Bacteria 7452
93 Ga0070666_10030214 3300005335 Bacteria 3568
94 Ga0070680_100000242 3300005336 Bacteria 36144
95 Ga0070682_100000224 3300005337 Bacteria 41040
96 Ga0068868_100001773 3300005338 Bacteria 14779
97 Ga0068868_100009208 3300005338 Bacteria 7095
98 Ga0068868_100186489 3300005338 Bacteria 1724
99 Ga0070660_100000123 3300005339 Bacteria 48796
100 Ga0070660_100084487 3300005339 Bacteria 2495
101 Ga0070689_100000685 3300005340 Bacteria 20556
102 Ga0070689_100076641 3300005340 Bacteria 2620
103 Ga0070689_100153949 3300005340 Bacteria 1855
104 Ga0070691_10013336 3300005341 Bacteria 3764
105 Ga0070687_100000351 3300005343 Bacteria 15646
106 Ga0070687_100039459 3300005343 Bacteria 2373
107 Ga0070661_100026596 3300005344 Bacteria 4162
108 Ga0070661_100046186 3300005344 Bacteria 3186
109 Ga0070661_100111987 3300005344 Bacteria 2039
110 Ga0070692_10000108 3300005345 Bacteria 18900
111 Ga0070668_100003586 3300005347 Bacteria 11452
112 Ga0070668_100021775 3300005347 Bacteria 4843
113 Ga0070668_100180266 3300005347 Bacteria 1725
114 Ga0070669_100000176 3300005353 Bacteria 55540
115 Ga0070669_100062083 3300005353 Bacteria 2747
116 Ga0070675_100000259 3300005354 Bacteria 34661
117 Ga0070675_100099529 3300005354 Bacteria 2448
118 Ga0070675_100193875 3300005354 Bacteria 1761
119 Ga0070671_100004849 3300005355 Bacteria 10694
120 Ga0070671_100006467 3300005355 Bacteria 9367
121 Ga0070671_100098198 3300005355 Bacteria 2456
122 Ga0070671_100129759 3300005355 Bacteria 2123
123 Ga0070671_100153294 3300005355 Bacteria 1946
124 Ga0070674_100000099 3300005356 Bacteria 40231
125 Ga0070674_100026259 3300005356 Bacteria 3801
126 Ga0070674_100184190 3300005356 Bacteria 1602
127 Ga0070673_100000042 3300005364 Bacteria 52952
128 Ga0070673_100084549 3300005364 Bacteria 2581
129 Ga0070673_100112291 3300005364 Bacteria 2262
130 Ga0070688_100000329 3300005365 Bacteria 24316
131 Ga0070688_100074173 3300005365 Bacteria 2184
132 Ga0070659_100000348 3300005366 Bacteria 35172
133 Ga0070667_100001075 3300005367 Bacteria 24994
134 Ga0070667_100019257 3300005367 Bacteria 5662
135 Ga0070667_100042027 3300005367 Bacteria 3834
136 Ga0070703_10000878 3300005406 Bacteria 9648
137 Ga0070709_10032295 3300005434 Bacteria 3155
138 Ga0070709_10129479 3300005434 Bacteria 1721
139 Ga0070714_100152101 3300005435 Bacteria 2086
140 Ga0070713_100030475 3300005436 Bacteria 4284
141 Ga0070713_100183785 3300005436 Bacteria 1880
142 Ga0070710_10024016 3300005437 Bacteria 3211
143 Ga0070710_10083034 3300005437 Bacteria 1874
144 Ga0070701_10000025 3300005438 Bacteria 38966
145 Ga0070711_100032827 3300005439 Bacteria 3454
146 Ga0070705_100003281 3300005440 Bacteria 7960
147 Ga0070705_100170695 3300005440 Bacteria 1464
148 Ga0070694_100003777 3300005444 Bacteria 9035
149 Ga0070694_100100151 3300005444 Bacteria 2049
150 Ga0070708_100257647 3300005445 Bacteria 1640
151 Ga0070663_100000064 3300005455 Bacteria 45232
152 Ga0070663_100113712 3300005455 Bacteria 2037
153 Ga0070678_100002536 3300005456 Bacteria 10015
154 Ga0070662_100073373 3300005457 Bacteria 2528
155 Ga0070662_100303483 3300005457 Bacteria 1298
156 Ga0070681_10000435 3300005458 Bacteria 33975
157 Ga0070681_10182879 3300005458 Bacteria 2017
158 Ga0070681_10236072 3300005458 Bacteria 1742
159 Ga0068867_100005677 3300005459 Bacteria 8842
160 Ga0068867_100024391 3300005459 Bacteria 4333
161 Ga0068867_100027110 3300005459 Bacteria 4116
162 Ga0068867_100067298 3300005459 Bacteria 2670
163 Ga0068867_100190588 3300005459 Bacteria 1636
164 Ga0070706_100197584 3300005467 Bacteria 1879
165 Ga0070698_100011265 3300005471 Bacteria 9494
166 Ga0070699_100202435 3300005518 Bacteria 1766
167 Ga0070684_100001610 3300005535 Bacteria 16308
168 Ga0070684_100027140 3300005535 Bacteria 4831
169 Ga0070697_100094045 3300005536 Bacteria 2483
170 Ga0068853_100002463 3300005539 Bacteria 13860
171 Ga0068853_100039010 3300005539 Bacteria 4049
172 Ga0068853_100195647 3300005539 Bacteria 1839
173 Ga0068853_100323306 3300005539 Bacteria 1430
174 Ga0070672_100000011 3300005543 Bacteria 80761
175 Ga0070672_100118231 3300005543 Bacteria 2167
176 Ga0070672_100134004 3300005543 Bacteria 2039
177 Ga0070686_100000076 3300005544 Bacteria 71207
178 Ga0070686_100087073 3300005544 Bacteria 2081
179 Ga0070695_100053966 3300005545 Bacteria 2585
180 Ga0070696_100052443 3300005546 Bacteria 2837
181 Ga0070696_100056200 3300005546 Bacteria 2745
182 Ga0070693_100004777 3300005547 Bacteria 6450
183 Ga0070665_100002816 3300005548 Bacteria 18830
184 Ga0070665_100003012 3300005548 Bacteria 18172
185 Ga0070665_100016716 3300005548 Bacteria 7353
186 Ga0070665_100037641 3300005548 Bacteria 4864
187 Ga0070665_100289398 3300005548 Bacteria 1641
188 Ga0070665_100424974 3300005548 Bacteria 1337
189 Ga0068855_100049447 3300005563 Bacteria 4959
190 Ga0068855_100061125 3300005563 Bacteria 4402
191 Ga0068855_100110372 3300005563 Bacteria 3158
192 Ga0070664_100000112 3300005564 Bacteria 53506
193 Ga0068857_100000023 3300005577 Bacteria 86999
194 Ga0068857_100024933 3300005577 Bacteria 5267
195 Ga0068857_100031521 3300005577 Bacteria 4685
196 Ga0068854_100066891 3300005578 Bacteria 2616
197 Ga0068854_100178454 3300005578 Bacteria 1658
198 Ga0068856_100000099 3300005614 Bacteria 83061
199 Ga0068856_100006276 3300005614 Bacteria 11671
200 Ga0068856_100014002 3300005614 Bacteria 7755
201 Ga0068856_100095048 3300005614 Bacteria 2968
202 Ga0068856_100118811 3300005614 Bacteria 2644
203 Ga0070702_100000005 3300005615 Bacteria 70200
204 Ga0068852_100002886 3300005616 Bacteria 11926
205 Ga0068852_100014911 3300005616 Bacteria 6005
206 Ga0068859_100000503 3300005617 Bacteria 38475
207 Ga0068859_100128696 3300005617 Bacteria 2602
208 Ga0068859_100425277 3300005617 Bacteria 1425
209 Ga0068864_100000112 3300005618 Bacteria 79688
210 Ga0068864_100006199 3300005618 Bacteria 9804
211 Ga0068864_100029277 3300005618 Bacteria 4661
212 Ga0068866_10000977 3300005718 Bacteria 12586
213 Ga0068866_10201434 3300005718 Bacteria 1190
214 Ga0068861_100002096 3300005719 Bacteria 12937
215 Ga0068870_10000021 3300005840 Bacteria 56319
216 Ga0068863_100000227 3300005841 Bacteria 59675
217 Ga0068863_100100507 3300005841 Bacteria 2749
218 Ga0068858_100001279 3300005842 Bacteria 26017
219 Ga0068858_100004153 3300005842 Bacteria 14249
220 Ga0068858_100032557 3300005842 Bacteria 4840
221 Ga0068858_100367623 3300005842 Bacteria 1379
222 Ga0068860_100315040 3300005843 Bacteria 1535
223 Ga0068862_100001866 3300005844 Bacteria 19089
224 Ga0068862_100108483 3300005844 Bacteria 2435
225 Ga0081455_10004237 3300005937 Bacteria 16172
226 Ga0081455_10057110 3300005937 Bacteria 3310
227 Ga0081538_10019358 3300005981 Bacteria 5062
228 Ga0081540_1056049 3300005983 Bacteria 1915
229 Ga0081539_10001300 3300005985 Bacteria 43786
230 Ga0081539_10029652 3300005985 Bacteria 3412
231 Ga0081539_10046429 3300005985 Bacteria 2489
232 Ga0070717_10102440 3300006028 Bacteria 2432
233 Ga0070717_10130840 3300006028 Bacteria 2158
234 Ga0075365_10001809 3300006038 Bacteria 9990
235 Ga0075365_10002327 3300006038 Bacteria 9249
236 Ga0075365_10005519 3300006038 Bacteria 6829
237 Ga0075365_10008458 3300006038 Bacteria 5846
238 Ga0075365_10016973 3300006038 Bacteria 4445
239 Ga0075365_10018202 3300006038 Bacteria 4315
240 Ga0075365_10043121 3300006038 Bacteria 2952
241 Ga0075365_10054915 3300006038 Bacteria 2642
242 Ga0075365_10067884 3300006038 Bacteria 2395
243 Ga0075365_10086187 3300006038 Bacteria 2134
244 Ga0075365_10097891 3300006038 Bacteria 2006
245 Ga0075365_10137785 3300006038 Bacteria 1692
246 Ga0075365_10198465 3300006038 Bacteria 1405
247 Ga0075368_10000391 3300006042 Bacteria 12927
248 Ga0075368_10001480 3300006042 Bacteria 7524
249 Ga0075363_100004780 3300006048 Bacteria 5970
250 Ga0075363_100011783 3300006048 Bacteria 4195
251 Ga0075363_100026888 3300006048 Bacteria 2947
252 Ga0075364_10000060 3300006051 Bacteria 41109
253 Ga0075364_10016981 3300006051 Bacteria 4536
254 Ga0075364_10022672 3300006051 Bacteria 3968
255 Ga0070715_10014553 3300006163 Bacteria 2915
256 Ga0070712_100231222 3300006175 Bacteria 1468
257 Ga0075362_10003906 3300006177 Bacteria 5293
258 Ga0075362_10058503 3300006177 Bacteria 1738
259 Ga0075367_10014606 3300006178 Bacteria 4252
260 Ga0075367_10021848 3300006178 Bacteria 3582
261 Ga0075367_10031807 3300006178 Bacteria 3032
262 Ga0075367_10079464 3300006178 Bacteria 1982
263 Ga0075369_10000420 3300006186 Bacteria 12842
264 Ga0075369_10009712 3300006186 Bacteria 3745
265 Ga0075369_10024616 3300006186 Bacteria 2496
266 Ga0075369_10037369 3300006186 Bacteria 2068
267 Ga0075369_10109517 3300006186 Bacteria 1244
268 Ga0075366_10005612 3300006195 Bacteria 6803
269 Ga0075366_10030387 3300006195 Bacteria 3176
270 Ga0075366_10031004 3300006195 Bacteria 3145
271 Ga0075366_10044168 3300006195 Bacteria 2640
272 Ga0075366_10084443 3300006195 Bacteria 1898
273 Ga0075366_10142134 3300006195 Bacteria 1451
274 Ga0097621_100000115 3300006237 Bacteria 45694
275 Ga0097621_100031095 3300006237 Bacteria 4233
276 Ga0097621_100052758 3300006237 Bacteria 3313
277 Ga0075370_10019433 3300006353 Bacteria 3700
278 Ga0075370_10020715 3300006353 Bacteria 3597
279 Ga0075370_10049519 3300006353 Bacteria 2382
280 Ga0075370_10055381 3300006353 Bacteria 2253
281 Ga0075370_10058432 3300006353 Bacteria 2193
282 Ga0075370_10062341 3300006353 Bacteria 2124
283 Ga0075370_10072847 3300006353 Bacteria 1967
284 Ga0068871_100000064 3300006358 Bacteria 58283
285 Ga0068871_100031695 3300006358 Bacteria 4170
286 Ga0068871_100082934 3300006358 Bacteria 2659
287 Ga0068871_100183985 3300006358 Bacteria 1797
288 Ga0075428_100001096 3300006844 Bacteria 28836
289 Ga0075428_100019624 3300006844 Bacteria 7480
290 Ga0075428_100140962 3300006844 Bacteria 2621
291 Ga0075430_100016424 3300006846 Bacteria 6302
292 Ga0075430_100328763 3300006846 Bacteria 1263
293 Ga0075431_100002284 3300006847 Bacteria 18392
294 Ga0075431_100006045 3300006847 Bacteria 12001
295 Ga0075431_100057368 3300006847 Bacteria 4016
296 Ga0075433_10286206 3300006852 Bacteria 1460
297 Ga0075434_100011648 3300006871 Bacteria 8305
298 Ga0075429_100016045 3300006880 Bacteria 6488
299 Ga0075429_100040905 3300006880 Bacteria 4036
300 Ga0068865_100000088 3300006881 Bacteria 48315
301 Ga0068865_100107695 3300006881 Bacteria 2050
302 Ga0068865_100141135 3300006881 Bacteria 1817
303 Ga0097620_100000503 3300006931 Bacteria 38475
304 Ga0097620_100128696 3300006931 Bacteria 2602
305 Ga0097620_100168187 3300006931 Bacteria 2273
306 Ga0097620_100425243 3300006931 Bacteria 1425
307 Ga0099825_1026228 3300006941 Bacteria 3132
308 Ga0099824_1015882 3300006942 Bacteria 6981
309 Ga0099823_1016643 3300006944 Bacteria 7202
310 Ga0079104_1005313 3300006946 Bacteria 5180
311 Ga0079104_1029960 3300006946 Bacteria 1365
312 Ga0099826_10001162 3300006948 Bacteria 15168
313 Ga0099826_10055826 3300006948 Bacteria 2611
314 Ga0075435_100018640 3300007076 Bacteria 5285
315 Ga0105244_10027369 3300009036 Bacteria 3073
316 Ga0105244_10041442 3300009036 Bacteria 2386
317 Ga0105240_10000032 3300009093 Bacteria 283907
318 Ga0105240_10087091 3300009093 Bacteria 3825
319 Ga0111539_10000835 3300009094 Bacteria 40036
320 Ga0111539_10001836 3300009094 Bacteria 28237
321 Ga0111539_10002131 3300009094 Bacteria 26474
322 Ga0111539_10043003 3300009094 Bacteria 5420
323 Ga0111539_10240090 3300009094 Bacteria 2109
324 Ga0111539_10344038 3300009094 Bacteria 1736
325 Ga0105245_10000556 3300009098 Bacteria 33858
326 Ga0105245_10001381 3300009098 Bacteria 21973
327 Ga0105245_10042958 3300009098 Bacteria 4032
328 Ga0105247_10000474 3300009101 Bacteria 33690
329 Ga0105247_10008685 3300009101 Bacteria 6192
330 Ga0105247_10010587 3300009101 Bacteria 5571
331 Ga0105247_10036214 3300009101 Bacteria 3009
332 Ga0105247_10140550 3300009101 Bacteria 1582
333 Ga0114129_10005100 3300009147 Bacteria 18497
334 Ga0114129_10023557 3300009147 Bacteria 8726
335 Ga0114129_10041080 3300009147 Bacteria 6519
336 Ga0114129_10116705 3300009147 Bacteria 3678
337 Ga0114129_10135026 3300009147 Bacteria 3385
338 Ga0105243_10002817 3300009148 Bacteria 14441
339 Ga0105243_10003276 3300009148 Bacteria 13158
340 Ga0105243_10059291 3300009148 Bacteria 3054
341 Ga0105243_10111788 3300009148 Bacteria 2287
342 Ga0105243_10129972 3300009148 Bacteria 2135
343 Ga0105241_10013940 3300009174 Bacteria 5891
344 Ga0105242_10006548 3300009176 Bacteria 8967
345 Ga0105242_10010176 3300009176 Bacteria 7205
346 Ga0105242_10136056 3300009176 Bacteria 2127
347 Ga0105248_10000500 3300009177 Bacteria 44664
348 Ga0105248_10000873 3300009177 Bacteria 33799
349 Ga0105248_10005607 3300009177 Bacteria 13792
350 Ga0105248_10053120 3300009177 Bacteria 4547
351 Ga0105248_10064008 3300009177 Bacteria 4128
352 Ga0105248_10376789 3300009177 Bacteria 1598
353 Ga0105237_10000754 3300009545 Bacteria 44371
354 Ga0105237_10012593 3300009545 Bacteria 8908
355 Ga0105237_10053311 3300009545 Bacteria 4057
356 Ga0105238_10063446 3300009551 Bacteria 3695
357 Ga0105238_10076419 3300009551 Bacteria 3340
358 Ga0105238_10079722 3300009551 Bacteria 3264
359 Ga0105238_10095640 3300009551 Bacteria 2957
360 Ga0105249_10002423 3300009553 Bacteria 16185
361 Ga0123341_1003307 3300009765 Bacteria 13754
362 Ga0123342_1012832 3300009766 Bacteria 8595
363 Ga0123342_1023961 3300009766 Bacteria 3886
364 Ga0099796_10029332 3300010159 Bacteria 1774
365 Ga0105239_10003796 3300010375 Bacteria 18390
366 Ga0105239_10295074 3300010375 Bacteria 1825
367 Ga0105246_10000016 3300011119 Bacteria 65781
368 Ga0105246_10000220 3300011119 Bacteria 29009
369 Ga0105246_10058075 3300011119 Bacteria 2680
370 Ga0157373_10001237 3300013100 Bacteria 19540
371 Ga0157373_10042861 3300013100 Bacteria 3233
372 Ga0157373_10132801 3300013100 Bacteria 1750
373 Ga0157373_10168919 3300013100 Bacteria 1539
374 Ga0157371_10000004 3300013102 Bacteria 512593
375 Ga0157371_10015495 3300013102 Bacteria 5717
376 Ga0157370_10003636 3300013104 Bacteria 18019
377 Ga0157370_10234385 3300013104 Bacteria 1698
378 Ga0157369_10073358 3300013105 Bacteria 3672
379 Ga0157369_10102912 3300013105 Bacteria 3042
380 Ga0171463_1003 3300013249 Bacteria 695693
381 Ga0157374_10000092 3300013296 Bacteria 85738
382 Ga0157374_10000524 3300013296 Bacteria 34473
383 Ga0157374_10010385 3300013296 Bacteria 8009
384 Ga0157374_10030091 3300013296 Bacteria 4927
385 Ga0157374_10202455 3300013296 Bacteria 1944
386 Ga0157378_10000591 3300013297 Bacteria 34042
387 Ga0157378_10023177 3300013297 Bacteria 5464
388 Ga0157378_10271419 3300013297 Bacteria 1631
389 Ga0163162_10023568 3300013306 Bacteria 6076
390 Ga0163162_10075105 3300013306 Bacteria 3440
391 Ga0163162_10115386 3300013306 Bacteria 2785
392 Ga0163162_10375085 3300013306 Bacteria 1556
393 Ga0163162_10380472 3300013306 Bacteria 1545
394 Ga0157372_10006371 3300013307 Bacteria 12555
395 Ga0157372_10163959 3300013307 Bacteria 2569
396 Ga0157372_10314045 3300013307 Bacteria 1824
397 Ga0157372_10395714 3300013307 Bacteria 1610
398 Ga0157375_10000124 3300013308 Bacteria 76003
399 Ga0157375_10001668 3300013308 Bacteria 19088
400 Ga0157375_10006444 3300013308 Bacteria 10223
401 Ga0157375_10025162 3300013308 Bacteria 5523
402 Ga0163163_10003404 3300014325 Bacteria 13509
403 Ga0163163_10058876 3300014325 Bacteria 3798
404 Ga0157380_10001027 3300014326 Bacteria 17807
405 Ga0157380_10004466 3300014326 Bacteria 9691
406 Ga0157380_10102839 3300014326 Bacteria 2383
407 Ga0157380_10125337 3300014326 Bacteria 2182
408 Ga0157380_10131629 3300014326 Bacteria 2135
409 Ga0157380_10205409 3300014326 Bacteria 1751
410 Ga0157380_10363411 3300014326 Bacteria 1359
411 Ga0182008_10051736 3300014497 Bacteria 2037
412 Ga0157377_10000121 3300014745 Bacteria 51192
413 Ga0157379_10000422 3300014968 Bacteria 34158
414 Ga0157379_10040122 3300014968 Bacteria 4177
415 Ga0157379_10077910 3300014968 Bacteria 2968
416 Ga0157376_10000034 3300014969 Bacteria 161526
417 Ga0157376_10000285 3300014969 Bacteria 34194
418 Ga0157376_10409954 3300014969 Bacteria 1312
419 Ga0182006_1015445 3300015261 Bacteria 3273
420 Ga0182007_10062860 3300015262 Bacteria 1217
421 Ga0182005_1004008 3300015265 Bacteria 4843
422 Ga0183363_1047 3300015690 Bacteria 39413
423 Ga0163161_10000801 3300017792 Bacteria 24605
424 Ga0163161_10107639 3300017792 Bacteria 2081
425 Ga0214544_1001682 3300021320 Bacteria 46508
426 Ga0214542_1001614 3300021321 Bacteria 46380
427 Ga0214542_1028780 3300021321 Bacteria 2357
428 Ga0214543_1000078 3300021327 Bacteria 119775
429 Ga0214543_1001395 3300021327 Bacteria 46435
430 Ga0228711_1000016 3300022739 Bacteria 126351
431 Ga0228710_1000013 3300022740 Bacteria 145976
432 Ga0209436_100041 3300025208 Bacteria 74018
433 Ga0209436_101133 3300025208 Bacteria 9873
434 Ga0209437_100075 3300025233 Bacteria 297202
435 Ga0207425_1008603 3300025245 Bacteria 2597
436 Ga0209026_1000050 3300025250 Bacteria 254994
437 Ga0209148_1000032 3300025254 Bacteria 557660
438 Ga0209148_1000289 3300025254 Bacteria 75390
439 Ga0209759_1015261 3300025256 Bacteria 1988
440 Ga0209129_1001627 3300025258 Bacteria 12185
441 Ga0209129_1003249 3300025258 Bacteria 7219
442 Ga0209129_1006654 3300025258 Bacteria 3668
443 Ga0209233_1000034 3300025261 Bacteria 578898
444 Ga0209233_1000056 3300025261 Bacteria 438104
445 Ga0209233_1002652 3300025261 Bacteria 6482
446 Ga0207666_1000004 3300025271 Bacteria 56747
447 Ga0209455_1000190 3300025272 Bacteria 92473
448 Ga0209455_1001308 3300025272 Bacteria 11563
449 Ga0209673_1000060 3300025273 Bacteria 263602
450 Ga0209673_1004110 3300025273 Bacteria 7994
451 Ga0209673_1011460 3300025273 Bacteria 3654
452 Ga0209673_1017145 3300025273 Bacteria 2677
453 Ga0209130_1000018 3300025284 Bacteria 388301
454 Ga0209130_1000029 3300025284 Bacteria 323399
455 Ga0209130_1000030 3300025284 Bacteria 323323
456 Ga0207673_1000326 3300025290 Bacteria 4777
457 Ga0209676_1000100 3300025292 Bacteria 229621
458 Ga0209676_1002997 3300025292 Bacteria 10988
459 Ga0209676_1031133 3300025292 Bacteria 1622
460 Ga0209676_1038379 3300025292 Bacteria 1372
461 Ga0209025_1000060 3300025294 Bacteria 305017
462 Ga0209025_1000959 3300025294 Bacteria 43491
463 Ga0209025_1001184 3300025294 Bacteria 36925
464 Ga0209025_1023046 3300025294 Bacteria 3275
465 Ga0209564_1000278 3300025295 Bacteria 105405
466 Ga0209564_1000281 3300025295 Bacteria 104019
467 Ga0209564_1000937 3300025295 Bacteria 37831
468 Ga0209564_1001052 3300025295 Bacteria 33676
469 Ga0209564_1004532 3300025295 Bacteria 8443
470 Ga0209564_1017395 3300025295 Bacteria 2804
471 Ga0209564_1033434 3300025295 Bacteria 1528
472 Ga0209758_1000160 3300025297 Bacteria 154304
473 Ga0209758_1000219 3300025297 Bacteria 124186
474 Ga0209758_1000383 3300025297 Bacteria 76487
475 Ga0209758_1000637 3300025297 Bacteria 53635
476 Ga0209758_1000677 3300025297 Bacteria 50824
477 Ga0209758_1001377 3300025297 Bacteria 29000
478 Ga0209758_1009047 3300025297 Bacteria 6286
479 Ga0209758_1009123 3300025297 Bacteria 6251
480 Ga0209758_1012378 3300025297 Bacteria 4782
481 Ga0209050_1006153 3300025298 Bacteria 7222
482 Ga0209050_1009722 3300025298 Bacteria 4872
483 Ga0209050_1019463 3300025298 Bacteria 2576
484 Ga0209256_1000042 3300025299 Bacteria 341821
485 Ga0209256_1001295 3300025299 Bacteria 26989
486 Ga0209256_1002288 3300025299 Bacteria 16138
487 Ga0209256_1002941 3300025299 Bacteria 12786
488 Ga0209256_1003739 3300025299 Bacteria 10296
489 Ga0209256_1009106 3300025299 Bacteria 4424
490 Ga0209256_1024299 3300025299 Bacteria 1787
491 Ga0207426_1000044 3300025302 Bacteria 428043
492 Ga0207426_1000047 3300025302 Bacteria 417011
493 Ga0207426_1000074 3300025302 Bacteria 323399
494 Ga0207426_1000268 3300025302 Bacteria 109321
495 Ga0207426_1000379 3300025302 Bacteria 76587
496 Ga0207426_1000465 3300025302 Bacteria 62583
497 Ga0207426_1003500 3300025302 Bacteria 8458
498 Ga0207426_1016971 3300025302 Bacteria 2599
499 Ga0209051_1000236 3300025303 Bacteria 92738
500 Ga0209051_1003666 3300025303 Bacteria 9938
501 Ga0209051_1004392 3300025303 Bacteria 8719
502 Ga0209051_1008481 3300025303 Bacteria 5430
503 Ga0209051_1008829 3300025303 Bacteria 5276
504 Ga0209051_1012789 3300025303 Bacteria 4038
505 Ga0209257_1000650 3300025304 Bacteria 55188
506 Ga0209257_1002011 3300025304 Bacteria 21749
507 Ga0209257_1002210 3300025304 Bacteria 20082
508 Ga0209257_1005286 3300025304 Bacteria 9197
509 Ga0209257_1029619 3300025304 Bacteria 1780
510 Ga0207653_10001908 3300025885 Bacteria 6674
511 Ga0207682_10000016 3300025893 Bacteria 78971
512 Ga0207692_10013299 3300025898 Bacteria 3566
513 Ga0207642_10000976 3300025899 Bacteria 8924
514 Ga0207642_10078028 3300025899 Bacteria 1599
515 Ga0207710_10001396 3300025900 Bacteria 12097
516 Ga0207710_10001528 3300025900 Bacteria 11432
517 Ga0207710_10003942 3300025900 Bacteria 6545
518 Ga0207710_10009728 3300025900 Bacteria 4041
519 Ga0207710_10026449 3300025900 Bacteria 2508
520 Ga0207688_10002050 3300025901 Bacteria 10826
521 Ga0207688_10064625 3300025901 Bacteria 2067
522 Ga0207680_10002179 3300025903 Bacteria 9176
523 Ga0207680_10059119 3300025903 Bacteria 2327
524 Ga0207680_10135217 3300025903 Bacteria 1629
525 Ga0207680_10219750 3300025903 Bacteria 1302
526 Ga0207647_10003692 3300025904 Bacteria 11441
527 Ga0207647_10059232 3300025904 Bacteria 2344
528 Ga0207685_10083900 3300025905 Bacteria 1325
529 Ga0207645_10001535 3300025907 Bacteria 18877
530 Ga0207643_10000075 3300025908 Bacteria 64981
531 Ga0207643_10085289 3300025908 Bacteria 1834
532 Ga0207684_10099451 3300025910 Bacteria 2484
533 Ga0207654_10006201 3300025911 Bacteria 6008
534 Ga0207707_10003863 3300025912 Bacteria 13286
535 Ga0207707_10153787 3300025912 Bacteria 2011
536 Ga0207695_10000024 3300025913 Bacteria 632311
537 Ga0207695_10009034 3300025913 Bacteria 12390
538 Ga0207695_10146083 3300025913 Bacteria 2309
539 Ga0207695_10196807 3300025913 Bacteria 1931
540 Ga0207671_10000718 3300025914 Bacteria 42274
541 Ga0207671_10009593 3300025914 Bacteria 8069
542 Ga0207671_10116073 3300025914 Bacteria 2042
543 Ga0207693_10046639 3300025915 Bacteria 3404
544 Ga0207663_10112324 3300025916 Bacteria 1851
545 Ga0207660_10000023 3300025917 Bacteria 71712
546 Ga0207660_10103923 3300025917 Bacteria 2126
547 Ga0207662_10001681 3300025918 Bacteria 10824
548 Ga0207662_10029205 3300025918 Bacteria 3193
549 Ga0207657_10001755 3300025919 Bacteria 23396
550 Ga0207657_10073027 3300025919 Bacteria 2901
551 Ga0207657_10114168 3300025919 Bacteria 2228
552 Ga0207657_10217966 3300025919 Bacteria 1530
553 Ga0207649_10000122 3300025920 Bacteria 65841
554 Ga0207649_10015177 3300025920 Bacteria 4326
555 Ga0207652_10001146 3300025921 Bacteria 23846
556 Ga0207681_10000240 3300025923 Bacteria 42226
557 Ga0207681_10049729 3300025923 Bacteria 2835
558 Ga0207681_10076472 3300025923 Bacteria 2351
559 Ga0207681_10195542 3300025923 Bacteria 1550
560 Ga0207694_10020011 3300025924 Bacteria 5062
561 Ga0207650_10012941 3300025925 Bacteria 5768
562 Ga0207650_10088443 3300025925 Bacteria 2362
563 Ga0207659_10000017 3300025926 Bacteria 159908
564 Ga0207659_10085461 3300025926 Bacteria 2344
565 Ga0207659_10094800 3300025926 Bacteria 2237
566 Ga0207659_10096989 3300025926 Bacteria 2214
567 Ga0207687_10000077 3300025927 Bacteria 71218
568 Ga0207687_10001492 3300025927 Bacteria 16025
569 Ga0207687_10211238 3300025927 Bacteria 1523
570 Ga0207700_10046442 3300025928 Bacteria 3211
571 Ga0207700_10148027 3300025928 Bacteria 1938
572 Ga0207664_10045678 3300025929 Bacteria 3435
573 Ga0207644_10001298 3300025931 Bacteria 16078
574 Ga0207644_10003716 3300025931 Bacteria 9888
575 Ga0207644_10027349 3300025931 Bacteria 3940
576 Ga0207644_10106786 3300025931 Bacteria 2111
577 Ga0207644_10263806 3300025931 Bacteria 1378
578 Ga0207644_10371701 3300025931 Bacteria 1165
579 Ga0207690_10000151 3300025932 Bacteria 54897
580 Ga0207706_10005479 3300025933 Bacteria 11832
581 Ga0207706_10010327 3300025933 Bacteria 8534
582 Ga0207706_10354838 3300025933 Bacteria 1275
583 Ga0207706_10354839 3300025933 Bacteria 1275
584 Ga0207686_10000294 3300025934 Bacteria 36711
585 Ga0207686_10017811 3300025934 Bacteria 4009
586 Ga0207686_10031259 3300025934 Bacteria 3159
587 Ga0207709_10000126 3300025935 Bacteria 114049
588 Ga0207709_10045603 3300025935 Bacteria 2656
589 Ga0207709_10060946 3300025935 Bacteria 2355
590 Ga0207709_10090300 3300025935 Bacteria 2000
591 Ga0207709_10097350 3300025935 Bacteria 1937
592 Ga0207709_10114962 3300025935 Bacteria 1807
593 Ga0207670_10000086 3300025936 Bacteria 63570
594 Ga0207670_10080693 3300025936 Bacteria 2275
595 Ga0207669_10000188 3300025937 Bacteria 28047
596 Ga0207669_10014695 3300025937 Bacteria 3930
597 Ga0207669_10026710 3300025937 Bacteria 3146
598 Ga0207669_10156474 3300025937 Bacteria 1604
599 Ga0207669_10207167 3300025937 Bacteria 1428
600 Ga0207704_10001793 3300025938 Bacteria 9624
601 Ga0207665_10268951 3300025939 Bacteria 1265
602 Ga0207691_10007063 3300025940 Bacteria 10834
603 Ga0207691_10016974 3300025940 Bacteria 6909
604 Ga0207691_10183906 3300025940 Bacteria 1825
605 Ga0207711_10004478 3300025941 Bacteria 11909
606 Ga0207711_10005965 3300025941 Bacteria 10298
607 Ga0207711_10039484 3300025941 Bacteria 4016
608 Ga0207711_10316023 3300025941 Bacteria 1442
609 Ga0207689_10000140 3300025942 Bacteria 62258
610 Ga0207689_10047161 3300025942 Bacteria 3559
611 Ga0207689_10109566 3300025942 Bacteria 2269
612 Ga0207661_10000074 3300025944 Bacteria 68047
613 Ga0207661_10130409 3300025944 Bacteria 2152
614 Ga0207679_10000031 3300025945 Bacteria 165962
615 Ga0207679_10031984 3300025945 Bacteria 3688
616 Ga0207679_10221628 3300025945 Bacteria 1591
617 Ga0207667_10013359 3300025949 Bacteria 9400
618 Ga0207667_10045333 3300025949 Bacteria 4658
619 Ga0207667_10232803 3300025949 Bacteria 1886
620 Ga0207651_10000044 3300025960 Bacteria 58072
621 Ga0207651_10061639 3300025960 Bacteria 2610
622 Ga0207712_10000279 3300025961 Bacteria 48635
623 Ga0207712_10038823 3300025961 Bacteria 3258
624 Ga0207668_10000687 3300025972 Bacteria 20761
625 Ga0207668_10092184 3300025972 Bacteria 2229
626 Ga0207640_10000105 3300025981 Bacteria 64812
627 Ga0207640_10000216 3300025981 Bacteria 40557
628 Ga0207658_10001907 3300025986 Bacteria 15607
629 Ga0207658_10039014 3300025986 Bacteria 3425
630 Ga0207677_10000318 3300026023 Bacteria 35197
631 Ga0207703_10000418 3300026035 Bacteria 45072
632 Ga0207703_10006276 3300026035 Bacteria 9506
633 Ga0207703_10035176 3300026035 Bacteria 3980
634 Ga0207703_10374259 3300026035 Bacteria 1316
635 Ga0207639_10007495 3300026041 Bacteria 7445
636 Ga0207639_10246028 3300026041 Bacteria 1557
637 Ga0207639_10264405 3300026041 Bacteria 1506
638 Ga0207639_10278625 3300026041 Bacteria 1470
639 Ga0207678_10005986 3300026067 Bacteria 10821
640 Ga0207678_10007246 3300026067 Bacteria 9837
641 Ga0207678_10008184 3300026067 Bacteria 9222
642 Ga0207678_10014870 3300026067 Bacteria 6845
643 Ga0207678_10033040 3300026067 Bacteria 4508
644 Ga0207678_10087729 3300026067 Bacteria 2659
645 Ga0207708_10004013 3300026075 Bacteria 10826
646 Ga0207702_10000753 3300026078 Bacteria 34590
647 Ga0207702_10081034 3300026078 Bacteria 2818
648 Ga0207702_10159139 3300026078 Bacteria 2061
649 Ga0207641_10001634 3300026088 Bacteria 21851
650 Ga0207641_10068519 3300026088 Bacteria 3043
651 Ga0207641_10423619 3300026088 Bacteria 1282
652 Ga0207648_10007377 3300026089 Bacteria 10826
653 Ga0207648_10056668 3300026089 Bacteria 3419
654 Ga0207648_10161442 3300026089 Bacteria 1979
655 Ga0207676_10000133 3300026095 Bacteria 65766
656 Ga0207676_10015457 3300026095 Bacteria 5506
657 Ga0207676_10078003 3300026095 Bacteria 2681
658 Ga0207674_10001514 3300026116 Bacteria 29977
659 Ga0207674_10037910 3300026116 Bacteria 5008
660 Ga0207674_10066374 3300026116 Bacteria 3634
661 Ga0207674_10083784 3300026116 Bacteria 3187
662 Ga0207674_10428761 3300026116 Bacteria 1278
663 Ga0207675_100011837 3300026118 Bacteria 8155
664 Ga0207675_100152444 3300026118 Bacteria 2201
665 Ga0207675_100252407 3300026118 Bacteria 1707
666 Ga0207683_10000004 3300026121 Bacteria 188086
667 Ga0207683_10003094 3300026121 Bacteria 14533
668 Ga0207683_10035832 3300026121 Bacteria 4316
669 Ga0207698_10009206 3300026142 Bacteria 6283
670 Ga0209281_1000043 3300027111 Bacteria 341543
671 Ga0209281_1000221 3300027111 Bacteria 122380
672 Ga0209281_1000453 3300027111 Bacteria 58584
673 Ga0209389_1000008 3300027296 Bacteria 227385
674 Ga0209389_1000081 3300027296 Bacteria 89601
675 Ga0209371_1000009 3300027312 Bacteria 963030
676 Ga0209371_1000732 3300027312 Bacteria 27595
677 Ga0209371_1001249 3300027312 Bacteria 18174
678 Ga0209371_1002043 3300027312 Bacteria 12066
679 Ga0209589_1000091 3300027357 Bacteria 89601
680 Ga0209489_100096 3300027361 Bacteria 122075
681 Ga0209489_103917 3300027361 Bacteria 28294
682 Ga0209700_100036 3300027363 Bacteria 187888
683 Ga0209282_1000041 3300027666 Bacteria 122268
684 Ga0209282_1000179 3300027666 Bacteria 34839
685 Ga0209282_1070112 3300027666 Bacteria 1913
686 Ga0209998_10000939 3300027717 Bacteria 7414
687 Ga0209813_10001432 3300027866 Bacteria 5390
688 Ga0209813_10006967 3300027866 Bacteria 2806
689 Ga0209974_10005431 3300027876 Bacteria 4482
690 Ga0207428_10000218 3300027907 Bacteria 79728
691 Ga0207428_10002942 3300027907 Bacteria 16869
692 Ga0268266_10001063 3300028379 Bacteria 34421
693 Ga0268266_10005424 3300028379 Bacteria 11894
694 Ga0268266_10120870 3300028379 Bacteria 2331
695 Ga0268266_10122747 3300028379 Bacteria 2313
696 Ga0268265_10000194 3300028380 Bacteria 70928
697 Ga0268265_10168309 3300028380 Bacteria 1870
698 Ga0268264_10000393 3300028381 Bacteria 63015
699 Ga0268264_10089016 3300028381 Bacteria 2658
700 Ga0307515_10000023 3300028794 Bacteria 400846
701 Ga0268256_1000010 3300030500 Bacteria 963034
702 Ga0268256_1000660 3300030500 Bacteria 26255
703 Ga0268256_1012387 3300030500 Bacteria 2638
704 Ga0265320_10001570 3300031240 Bacteria 16415
705 Ga0265325_10020399 3300031241 Bacteria 3654
706 Ga0265340_10018115 3300031247 Bacteria 3636
707 Ga0265316_10226754 3300031344 Bacteria 1377
708 Ga0307513_10003030 3300031456 Bacteria 22903
709 Ga0307513_10117119 3300031456 Bacteria 2642
710 Ga0307508_10000235 3300031616 Bacteria 67350
711 Ga0265314_10015333 3300031711 Bacteria 6085
712 Ga0265342_10019097 3300031712 Bacteria 4423
713 Ga0316578_10012241 3300031728 Bacteria 4520
714 Ga0307516_10076539 3300031730 Bacteria 3198
715 Ga0307412_10004217 3300031911 Bacteria 8016
716 Ga0307412_10051473 3300031911 Bacteria 2722
717 Ga0307412_10096618 3300031911 Bacteria 2080
718 Ga0315914_1000030 3300031967 Bacteria 102599
719 Ga0307409_100079130 3300031995 Bacteria 2648
720 Ga0307414_10335036 3300032004 Bacteria 1293
721 Ga0307415_100162107 3300032126 Bacteria 1734
722 Ga0307510_10051197 3300033180 Bacteria 4370
723 Ga0307510_10166871 3300033180 Bacteria 1787
724 Ga0315913_1000017 3300033430 Bacteria 102835
725 Ga0315915_1000017 3300033464 Bacteria 148111
726 Ga0373926_0044621 3300035083 Bacteria 1588
727 Ga0373951_0006498 3300035091 Bacteria 2674
728 Ga0373952_0005697 3300035092 Bacteria 2282
729 Ga0373932_0006740 3300035112 Bacteria 2723
730 Ga0373939_0001147 3300035114 Bacteria 6475
731 Ga0373941_0004127 3300035115 Bacteria 3334
732 Ga0373945_0023874 3300035116 Bacteria 2115
733 Ga0373960_0002301 3300035121 Bacteria 4300
734 Ga0373942_0004747 3300035207 Bacteria 3155
735 Ga0373961_0006340 3300035241 Bacteria 2844
736 Ga0373962_0006222 3300035242 Bacteria 2887
737 Ga0316574_0000447 3300035398 Bacteria 16491
738 Ga0373931_0000034 3300035691 Bacteria 86665
739 Ga0373931_0106047 3300035691 Bacteria 1588
740 Ga0373935_0044469 3300035692 Bacteria 2798
741 Ga0373927_0198628 3300035695 Bacteria 1316
742 Ga0373947_0080704 3300035725 Bacteria 2013
743 Ga0373947_0094196 3300035725 Bacteria 1872
744 Ga0373925_0078900 3300037068 Bacteria 2500
745 Ga0395899_0005212 3300037312 Bacteria 10109
746 Ga0395899_0014217 3300037312 Bacteria 6074
747 Ga0395900_0006809 3300037418 Bacteria 11854
748 Ga0395900_0009382 3300037418 Bacteria 10032
749 Ga0395900_0028204 3300037418 Bacteria 5750
750 Ga0395900_0061357 3300037418 Bacteria 3865
751 Ga0395900_0064342 3300037418 Bacteria 3769
752 Ga0395900_0119882 3300037418 Bacteria 2700
753 Ga0395898_0031310 3300037466 Bacteria 5317
754 Ga0395898_0079159 3300037466 Bacteria 3170
755 Ga0395905_0012635 3300037471 Bacteria 8123
756 Ga0395905_0044671 3300037471 Bacteria 4157
757 Ga0395905_0185194 3300037471 Bacteria 1954
758 Ga0395905_0245905 3300037471 Bacteria 1671
759 Ga0395901_0014741 3300038443 Bacteria 7946
760 Ga0395901_0019762 3300038443 Bacteria 6888
761 Ga0395901_0034031 3300038443 Bacteria 5261
762 Ga0395901_0048672 3300038443 Bacteria 4402
763 Ga0395901_0107512 3300038443 Bacteria 2928
764 Ga0395901_0244469 3300038443 Bacteria 1871
765 Ga0436365_0226566 3300039437 Bacteria 1228
766 Ga0436360_0428998 3300039438 Bacteria 19607
767 Ga0439439_0029670 3300041406 Bacteria 1388
768 Ga0439465_0010381 3300041413 Bacteria 2926
769 Ga0451840_11510 3300041497 Bacteria 1202
770 Ga0451846_53461 3300041502 Bacteria 1961
771 Ga0451849_0343204 3300041505 Bacteria 2254
772 Ga0451854_38034 3300041510 Bacteria 1481
773 Ga0452268_28007 3300041907 Bacteria 1563
774 Ga0466972_0000142 3300044658 Bacteria 58711
775 Ga0466965_0041923 3300044683 Bacteria 2256
776 Ga0466966_0000743 3300044684 Bacteria 20686
777 Ga0466961_0000013 3300044693 Bacteria 129640
778 Ga0451576_0000108 3300045051 Bacteria 211233
779 Ga0466967_0223783 3300045976 Bacteria 1789
780 Ga0495617_038070 3300046452 Bacteria 1610
781 Ga0495592_0026735 3300046454 Bacteria 4374
782 Ga0495592_0035379 3300046454 Bacteria 3764
783 Ga0495629_0010621 3300046459 Bacteria 6698
784 Ga0495638_0000398 3300046460 Bacteria 53469
785 Ga0495638_0000984 3300046460 Bacteria 28644
786 Ga0495651_0001455 3300046462 Bacteria 18340
787 Ga0495651_0041355 3300046462 Bacteria 3581
788 Ga0495653_0054937 3300046463 Bacteria 3041
789 Ga0495580_0038736 3300046472 Bacteria 3413
790 Ga0495605_0027289 3300046474 Bacteria 2959
791 Ga0495605_0061921 3300046474 Bacteria 1789
792 Ga0495639_0090084 3300046475 Bacteria 1438
793 Ga0495662_0023492 3300046476 Bacteria 2977
794 Ga0495584_0038495 3300046491 Bacteria 2417
795 Ga0495584_0066931 3300046491 Bacteria 1807
796 Ga0495585_0008429 3300046492 Bacteria 6248
797 Ga0495594_0053341 3300046499 Bacteria 2227
798 Ga0495594_0189411 3300046499 Bacteria 1172
799 Ga0495596_0031129 3300046500 Bacteria 2133
800 Ga0495607_0031344 3300046501 Bacteria 3255
801 Ga0495607_0120054 3300046501 Bacteria 1381
802 Ga0495583_0033212 3300046506 Bacteria 2482
803 Ga0495583_0043839 3300046506 Bacteria 2081
804 Ga0495608_0060068 3300046511 Bacteria 2503
805 Ga0495608_0064835 3300046511 Bacteria 2394
806 Ga0495610_0005846 3300046512 Bacteria 8641
807 Ga0495610_0033707 3300046512 Bacteria 2644
808 Ga0495616_0019931 3300046513 Bacteria 3654
809 Ga0495618_0090406 3300046514 Bacteria 1958
810 Ga0495620_0005040 3300046515 Bacteria 7401
811 Ga0495620_0050099 3300046515 Bacteria 1783
812 Ga0495628_0012367 3300046516 Bacteria 7196
813 Ga0495628_0064312 3300046516 Bacteria 2872
814 Ga0495631_0002044 3300046518 Bacteria 11750
815 Ga0495632_0014778 3300046519 Bacteria 4404
816 Ga0495632_0025306 3300046519 Bacteria 3141
817 Ga0495643_0034038 3300046522 Bacteria 2813
818 Ga0495648_0023485 3300046524 Bacteria 4222
819 Ga0495654_0012329 3300046530 Bacteria 4594
820 Ga0495654_0042125 3300046530 Bacteria 2268
821 Ga0495665_0093167 3300046531 Bacteria 1583
822 Ga0495640_0081289 3300046533 Bacteria 2154
823 Ga0495587_0054702 3300046536 Bacteria 2352
824 Ga0495598_0010805 3300046537 Bacteria 2197
825 Ga0495609_0035152 3300046538 Bacteria 2269
826 Ga0495597_0034925 3300046542 Bacteria 2270
827 Ga0495645_0006446 3300046543 Bacteria 8142
828 Ga0495667_0178930 3300046559 Bacteria 1361
829 Ga0495668_0006092 3300046616 Bacteria 7985
830 Ga0495668_0093064 3300046616 Bacteria 1651
831 Ga0495668_0151443 3300046616 Bacteria 1270
832 Ga0495625_0005382 3300046660 Bacteria 11709
833 Ga0495625_0006283 3300046660 Bacteria 10626
834 Ga0495625_0132238 3300046660 Bacteria 1689
835 Ga0495635_0008179 3300046663 Bacteria 7304
836 Ga0495659_0009205 3300046664 Bacteria 3149
837 Ga0495661_0052588 3300046665 Bacteria 2453
838 Ga0495588_0001146 3300046674 Bacteria 11378
839 Ga0495588_0085757 3300046674 Bacteria 1647
840 Ga0495657_0010464 3300046675 Bacteria 6978
841 Ga0495599_0009888 3300046678 Bacteria 5837
842 Ga0495623_0006513 3300046679 Bacteria 7602
843 Ga0495646_0019580 3300046680 Bacteria 4282
844 Ga0495646_0055602 3300046680 Bacteria 2376
845 Ga0495647_0025057 3300046681 Bacteria 2176
846 Ga0495669_0003796 3300046684 Bacteria 6207
847 Ga0495624_0069333 3300046690 Bacteria 2196
848 Ga0495670_0016624 3300046691 Bacteria 3618
849 Ga0495649_0130167 3300046694 Bacteria 1328
850 Ga0495600_0005780 3300046809 Bacteria 7473
851 Ga0495660_0036980 3300046810 Bacteria 2721
852 Ga0495660_0049199 3300046810 Bacteria 2302
853 Ga0495660_0060603 3300046810 Bacteria 2032
854 Ga0495581_0060439 3300047315 Bacteria 2190
855 Ga0495604_0000939 3300047317 Bacteria 24255
856 Ga0495604_0004637 3300047317 Bacteria 10894
857 Ga0495604_0024899 3300047317 Bacteria 4773
858 Ga0495636_0040488 3300047318 Bacteria 1932
859 Ga0495636_0066614 3300047318 Bacteria 1531
860 Ga0495674_0008253 3300047319 Bacteria 9934
861 Ga0495674_0017976 3300047319 Bacteria 6581
862 Ga0495672_0118403 3300047320 Bacteria 1412
863 Ga0495676_0049415 3300047321 Bacteria 3382
864 Ga0495676_0080633 3300047321 Bacteria 2470
865 Ga0495680_0008716 3300047322 Bacteria 9190
866 Ga0495683_0044834 3300047323 Bacteria 2224
867 Ga0495683_0112830 3300047323 Bacteria 1296
868 Ga0495687_022010 3300047443 Bacteria 3069
869 Ga0495685_048100 3300047447 Bacteria 1450
870 Ga0495681_0004119 3300047470 Bacteria 9993
871 Ga0495681_0068694 3300047470 Bacteria 1612
872 Ga0495684_0054666 3300047471 Bacteria 3045
873 Ga0495684_0064339 3300047471 Bacteria 2787
874 Ga0495686_0014003 3300047472 Bacteria 5542
875 Ga0495686_0062679 3300047472 Bacteria 2305
876 Ga0495602_0022141 3300048088 Bacteria 6228
877 Ga0495602_0153059 3300048088 Bacteria 1810
878 Ga0495615_0005003 3300048090 Bacteria 2356
879 Ga0496100_0000050 3300048903 Bacteria 75449
880 Ga0496100_0000310 3300048903 Bacteria 24113
881 Ga0496100_0042930 3300048903 Bacteria 2890
882 Ga0496101_0000121 3300048904 Bacteria 76264
883 Ga0496101_0010077 3300048904 Bacteria 6230
884 Ga0496101_0051291 3300048904 Bacteria 2972
885 Ga0496101_0124102 3300048904 Bacteria 1955
886 Ga0496102_0000679 3300048905 Bacteria 34025
887 Ga0496102_0002728 3300048905 Bacteria 15045
888 Ga0496102_0010100 3300048905 Bacteria 8120
889 Ga0496102_0090375 3300048905 Bacteria 2834
890 Ga0496102_0224187 3300048905 Bacteria 1772
891 Ga0496102_0269753 3300048905 Bacteria 1604
892 Ga0496102_0471420 3300048905 Bacteria 1176
893 Ga0496103_0000175 3300048906 Bacteria 65716
894 Ga0496103_0000777 3300048906 Bacteria 23523
895 Ga0496103_0137749 3300048906 Bacteria 1560
896 Ga0496104_0000500 3300048907 Bacteria 33808
897 Ga0496104_0000588 3300048907 Bacteria 31033
898 Ga0496104_0011318 3300048907 Bacteria 7987
899 Ga0496104_0014050 3300048907 Bacteria 7227
900 Ga0496104_0020089 3300048907 Bacteria 6119
901 Ga0496104_0021190 3300048907 Bacteria 5965
902 Ga0496104_0182554 3300048907 Bacteria 2008
903 Ga0496105_0002408 3300048908 Bacteria 13543
904 Ga0496105_0002551 3300048908 Bacteria 13215
905 Ga0496105_0003077 3300048908 Bacteria 12259
906 Ga0496105_0006243 3300048908 Bacteria 9150
907 Ga0496105_0009375 3300048908 Bacteria 7654
908 Ga0496105_0009884 3300048908 Bacteria 7481
909 Ga0496105_0016466 3300048908 Bacteria 5903
910 Ga0496105_0045775 3300048908 Bacteria 3610
911 Ga0496106_0000133 3300048909 Bacteria 55926
912 Ga0496106_0000323 3300048909 Bacteria 33743
913 Ga0496106_0043242 3300048909 Bacteria 3380
914 Ga0496106_0055832 3300048909 Bacteria 2985
915 Ga0496106_0186856 3300048909 Bacteria 1646
916 Ga0496107_0000237 3300048910 Bacteria 29056
917 Ga0496107_0006942 3300048910 Bacteria 7802
918 Ga0496107_0008677 3300048910 Bacteria 7039
919 Ga0496107_0013131 3300048910 Bacteria 5787
920 Ga0496107_0148941 3300048910 Bacteria 1731
921 Ga0496107_0162931 3300048910 Bacteria 1653
922 Ga0496108_0001888 3300048911 Bacteria 16784
923 Ga0496108_0024837 3300048911 Bacteria 4934
924 Ga0496108_0038602 3300048911 Bacteria 3979
925 Ga0496108_0057474 3300048911 Bacteria 3269
926 Ga0496109_0000493 3300048912 Bacteria 33784
927 Ga0496109_0000952 3300048912 Bacteria 23938
928 Ga0496109_0001602 3300048912 Bacteria 18880
929 Ga0496109_0041234 3300048912 Bacteria 4182
930 Ga0496109_0049410 3300048912 Bacteria 3829
931 Ga0496109_0190810 3300048912 Bacteria 1925
932 Ga0496109_0192867 3300048912 Bacteria 1914
933 Ga0496110_0003720 3300048913 Bacteria 11747
934 Ga0496110_0003830 3300048913 Bacteria 11584
935 Ga0496110_0014142 3300048913 Bacteria 6619
936 Ga0496110_0064390 3300048913 Bacteria 3240
937 Ga0496110_0152174 3300048913 Bacteria 2095
938 Ga0496111_0001343 3300048914 Bacteria 13890
939 Ga0496111_0009718 3300048914 Bacteria 6430
940 Ga0496111_0066787 3300048914 Bacteria 2612
941 Ga0496111_0184353 3300048914 Bacteria 1552
942 Ga0496112_0011990 3300048915 Bacteria 7947
943 Ga0496112_0033461 3300048915 Bacteria 4997
944 Ga0496112_0042530 3300048915 Bacteria 4445
945 Ga0496112_0047993 3300048915 Bacteria 4188
946 Ga0496113_0000869 3300048916 Bacteria 15820
947 Ga0496113_0012388 3300048916 Bacteria 5730
948 Ga0496113_0032115 3300048916 Bacteria 3814
949 Ga0496113_0090154 3300048916 Bacteria 2361
950 Ga0496113_0124584 3300048916 Bacteria 2017
951 Ga0496114_0002721 3300048917 Bacteria 13500
952 Ga0496114_0026653 3300048917 Bacteria 4734
953 Ga0496114_0137983 3300048917 Bacteria 2109
954 Ga0496115_0001322 3300048918 Bacteria 17672
955 Ga0496115_0001562 3300048918 Bacteria 16472
956 Ga0496115_0009975 3300048918 Bacteria 7076
957 Ga0496115_0041219 3300048918 Bacteria 3673
958 Ga0496115_0064682 3300048918 Bacteria 2953
959 Ga0496115_0146054 3300048918 Bacteria 1952
960 Ga0496116_0000026 3300048919 Bacteria 450803
961 Ga0496116_0051378 3300048919 Bacteria 2739
962 Ga0496116_0060520 3300048919 Bacteria 2456
963 Ga0496116_0076919 3300048919 Bacteria 2088
964 Ga0496116_0082859 3300048919 Bacteria 1982
965 Ga0496117_0000002 3300048920 Bacteria 2483758
966 Ga0496117_0028675 3300048920 Bacteria 4307
967 Ga0496117_0083200 3300048920 Bacteria 2093
968 Ga0496117_0110951 3300048920 Bacteria 1708
969 Ga0496117_0162863 3300048920 Bacteria 1304
970 Ga0496118_0002844 3300048921 Bacteria 22597
971 Ga0496118_0014526 3300048921 Bacteria 7364
972 Ga0496118_0016840 3300048921 Bacteria 6680
973 Ga0496118_0022202 3300048921 Bacteria 5558
974 Ga0496118_0048224 3300048921 Bacteria 3293
975 Ga0496119_0010067 3300048922 Bacteria 7995
976 Ga0496119_0014918 3300048922 Bacteria 6038
977 Ga0496119_0021542 3300048922 Bacteria 4654
978 Ga0496120_0000034 3300048923 Bacteria 215228
979 Ga0496120_0000455 3300048923 Bacteria 64606
980 Ga0496120_0025451 3300048923 Bacteria 3672
981 Ga0496120_0077220 3300048923 Bacteria 1813
982 Ga0496120_0152319 3300048923 Bacteria 1161
983 Ga0496121_0000220 3300048924 Bacteria 123930
984 Ga0496121_0071800 3300048924 Bacteria 2782
985 Ga0496121_0080858 3300048924 Bacteria 2574
986 Ga0496122_0000001 3300048925 Bacteria 1827766
987 Ga0496122_0035793 3300048925 Bacteria 4030
988 Ga0496122_0059858 3300048925 Bacteria 2809
989 Ga0496123_0000001 3300048926 Bacteria 1831497
990 Ga0496123_0014463 3300048926 Bacteria 6539
991 Ga0496123_0045453 3300048926 Bacteria 2991
992 Ga0496123_0142329 3300048926 Bacteria 1309
993 Ga0496124_0000083 3300048927 Bacteria 207798
994 Ga0496124_0002875 3300048927 Bacteria 21765
995 Ga0496124_0013228 3300048927 Bacteria 8070
996 Ga0496124_0102824 3300048927 Bacteria 2311
997 Ga0496125_0000001 3300048928 Bacteria 1766138
998 Ga0496125_0009589 3300048928 Bacteria 9907
999 Ga0496125_0029586 3300048928 Bacteria 4919
1000 Ga0496125_0064016 3300048928 Bacteria 2927
1001 Ga0496126_0000069 3300048929 Bacteria 246935
1002 Ga0496126_0007323 3300048929 Bacteria 12119
1003 Ga0496126_0057065 3300048929 Bacteria 3527
1004 Ga0496126_0188432 3300048929 Bacteria 1748
1005 Ga0496126_0262819 3300048929 Bacteria 1434
1006 Ga0496126_0378317 3300048929 Bacteria 1153
1007 Ga0495678_042185 3300049459 Bacteria 1820
1008 Ga0495682_0045915 3300049460 Bacteria 1596
1009 Ga0501031_0000006 3300049568 Bacteria 176019
1010 Ga0501032_0000016 3300049569 Bacteria 174688
1011 Ga0501032_0059787 3300049569 Bacteria 2557
1012 Ga0501033_0000101 3300049570 Bacteria 81870
1013 Ga0501033_0061814 3300049570 Bacteria 2759
1014 Ga0501034_0000168 3300049571 Bacteria 122667
1015 Ga0501034_0010519 3300049571 Bacteria 9635
1016 Ga0501034_0030869 3300049571 Bacteria 5446
1017 Ga0501034_0137323 3300049571 Bacteria 2425
1018 Ga0501036_0000019 3300049572 Bacteria 118632
1019 Ga0501036_0099560 3300049572 Bacteria 2458
1020 Ga0501037_0000013 3300049573 Bacteria 174688
1021 Ga0501037_0000895 3300049573 Bacteria 22218
1022 Ga0501037_0143061 3300049573 Bacteria 1711
1023 Ga0501038_0000012 3300049574 Bacteria 174688
1024 Ga0501038_0011999 3300049574 Bacteria 7912
1025 Ga0501038_0165827 3300049574 Bacteria 1792
1026 Ga0501039_0000019 3300049575 Bacteria 174688
1027 Ga0501039_0079324 3300049575 Bacteria 2554
1028 Ga0501040_0148787 3300049576 Bacteria 1651
1029 Ga0501042_0019008 3300049578 Bacteria 4768
1030 Ga0501043_0000045 3300049579 Bacteria 114003
1031 Ga0501043_0000209 3300049579 Bacteria 53858
1032 Ga0501043_0048636 3300049579 Bacteria 3334
1033 Ga0501043_0132686 3300049579 Bacteria 1952
1034 Ga0501047_0003738 3300049581 Bacteria 14331
1035 Ga0501047_0023848 3300049581 Bacteria 5875
1036 Ga0501047_0234199 3300049581 Bacteria 1688
1037 Ga0501069_0000007 3300049585 Bacteria 182820
1038 Ga0501070_0000758 3300049586 Bacteria 29461
1039 Ga0501070_0003344 3300049586 Bacteria 13925
1040 Ga0501070_0021164 3300049586 Bacteria 5458
1041 Ga0501070_0059883 3300049586 Bacteria 3156
1042 Ga0501070_0084105 3300049586 Bacteria 2634
1043 Ga0501070_0131515 3300049586 Bacteria 2067
1044 Ga0501071_0013377 3300049587 Bacteria 5590
1045 Ga0501071_0091102 3300049587 Bacteria 2240
1046 Ga0501072_0036236 3300049588 Bacteria 3867
1047 Ga0501074_0000047 3300049590 Bacteria 57039
1048 Ga0501074_0010115 3300049590 Bacteria 6849
1049 Ga0501074_0047884 3300049590 Bacteria 3089
1050 Ga0501076_0006762 3300049592 Bacteria 8322
1051 Ga0501080_0005487 3300049742 Bacteria 11319
1052 Ga0501080_0009780 3300049742 Bacteria 8760
1053 Ga0501080_0203467 3300049742 Bacteria 1817
1054 Ga0501083_0000029 3300049744 Bacteria 107507
1055 Ga0501280_002770 3300049776 Bacteria 2831
1056 Ga0501035_0000060 3300049822 Bacteria 132293
1057 Ga0501035_0000081 3300049822 Bacteria 117453
1058 Ga0501035_0004420 3300049822 Bacteria 13345
1059 Ga0501035_0029235 3300049822 Bacteria 5025
1060 Ga0501035_0044246 3300049822 Bacteria 4010
1061 Ga0501035_0092164 3300049822 Bacteria 2666
1062 Ga0501044_0000009 3300049823 Bacteria 270072
1063 Ga0501044_0000029 3300049823 Bacteria 176024
1064 Ga0501044_0052912 3300049823 Bacteria 4179
1065 Ga0501044_0252875 3300049823 Bacteria 1702
1066 Ga0501045_0006727 3300049824 Bacteria 7965
1067 nmdc:mga03683_1100_c1 3300050489 Bacteria 3363
1068 nmdc:mga03683_409_c1 3300050489 Bacteria 12382
1069 nmdc:mga03683_83526_c1 3300050489 Bacteria 1383
1070 nmdc:mga03n38_12016_c1 3300050490 Bacteria 3245
1071 nmdc:mga00v17_106281_c1 3300050491 Bacteria 1777
1072 nmdc:mga00v17_108403_c1 3300050491 Bacteria 1760
1073 nmdc:mga00v17_130499_c1 3300050491 Bacteria 1606
1074 nmdc:mga00v17_180316_c1 3300050491 Bacteria 1363
1075 nmdc:mga00v17_26_c1 3300050491 Bacteria 37082
1076 nmdc:mga00v17_30112_c1 3300050491 Bacteria 3191
1077 nmdc:mga00v17_47_c1 3300050491 Bacteria 77934
1078 nmdc:mga0yw44_11106_c1 3300050492 Bacteria 4630
1079 nmdc:mga0yw44_165685_c1 3300050492 Bacteria 1449
1080 nmdc:mga0yw44_18361_c1 3300050492 Bacteria 3828
1081 nmdc:mga0yw44_185747_c1 3300050492 Bacteria 1370
1082 nmdc:mga0yw44_31900_c1 3300050492 Bacteria 3067
1083 nmdc:mga0yw44_3820_c1 3300050492 Bacteria 6764
1084 nmdc:mga0yw44_3977_c1 3300050492 Bacteria 6679
1085 nmdc:mga0yw44_81306_c1 3300050492 Bacteria 2031
1086 nmdc:mga0yw44_831_c1 3300050492 Bacteria 11561
1087 nmdc:mga0yw44_8596_c1 3300050492 Bacteria 5098
1088 nmdc:mga0k408_143738_c1 3300050493 Bacteria 1420
1089 nmdc:mga0k408_40451_c1 3300050493 Bacteria 2682
1090 nmdc:mga0k408_7428_c1 3300050493 Bacteria 5851
1091 nmdc:mga0k408_9138_c1 3300050493 Bacteria 5339
1092 nmdc:mga06z11_114704_c1 3300050494 Bacteria 1496
1093 nmdc:mga06z11_16404_c1 3300050494 Bacteria 3336
1094 nmdc:mga06z11_176767_c1 3300050494 Bacteria 1229
1095 nmdc:mga06z11_18791_c1 3300050494 Bacteria 3165
1096 nmdc:mga06z11_3255_c1 3300050494 Bacteria 6275
1097 nmdc:mga06z11_91170_c1 3300050494 Bacteria 1655
1098 nmdc:mga06z11_92439_c1 3300050494 Bacteria 1645
1099 nmdc:mga04h51_23837_c1 3300050495 Bacteria 1868
1100 nmdc:mga04h51_32896_c1 3300050495 Bacteria 1648
1101 nmdc:mga04h51_4064_c1 3300050495 Bacteria 3606
1102 nmdc:mga07m45_108881_c1 3300050496 Bacteria 1595
1103 nmdc:mga07m45_23668_c2 3300050496 Bacteria 2490
1104 nmdc:mga07m45_30403_c1 3300050496 Bacteria 2992
1105 nmdc:mga07m45_3358_c1 3300050496 Bacteria 7713
1106 nmdc:mga07m45_36073_c1 3300050496 Bacteria 2753
1107 nmdc:mga07m45_50498_c1 3300050496 Bacteria 2344
1108 nmdc:mga07m45_61401_c1 3300050496 Bacteria 2129
1109 nmdc:mga07m45_64686_c1 3300050496 Bacteria 2076
1110 nmdc:mga07m45_91680_c1 3300050496 Bacteria 1741
1111 nmdc:mga05p37_41138_c1 3300050507 Bacteria 5675
1112 nmdc:mga05p37_83860_c1 3300050507 Bacteria 3926
1113 nmdc:mga05p37_94463_c1 3300050507 Bacteria 3684
1114 nmdc:mga09592_17221_c1 3300050508 Bacteria 5918
1115 nmdc:mga09592_76716_c1 3300050508 Bacteria 2842
1116 nmdc:mga0qj67_34351_c1 3300050509 Bacteria 3961
1117 nmdc:mga06r32_14671_c1 3300050510 Bacteria 7112
1118 nmdc:mga06r32_272496_c1 3300050510 Bacteria 1680
1119 nmdc:mga06r32_8869_c1 3300050510 Bacteria 9064
1120 nmdc:mga08y16_202134_c1 3300050511 Bacteria 2059
1121 nmdc:mga08y16_3032_c1 3300050511 Bacteria 17340
1122 nmdc:mga08y16_409700_c1 3300050511 Bacteria 1386
1123 nmdc:mga08y16_706_c1 3300050511 Bacteria 31784
1124 nmdc:mga0n895_151399_c1 3300050512 Bacteria 2350
1125 nmdc:mga0n895_2736_c1 3300050512 Bacteria 13917
1126 nmdc:mga0rr50_54810_c1 3300050513 Bacteria 2972
1127 nmdc:mga0a205_197_c1 3300050515 Bacteria 22634
1128 nmdc:mga0sz30_148_c1 3300050516 Bacteria 26288
1129 nmdc:mga0sz30_18723_c1 3300050516 Bacteria 2774
1130 nmdc:mga0sz30_57771_c1 3300050516 Bacteria 1654
1131 nmdc:mga0sz30_6454_c1 3300050516 Bacteria 4352
1132 Ga0495601_0013325 3300053077 Bacteria 4942
1133 Ga0495612_0003890 3300053078 Bacteria 6191
1134 Ga0500610_0025694 3300053079 Bacteria 2940
1135 Ga0500610_0072570 3300053079 Bacteria 1795
1136 Ga0495619_0001328 3300053085 Bacteria 16220
1137 Ga0495619_0013741 3300053085 Bacteria 5106
1138 Ga0500578_0060890 3300053086 Bacteria 2410
1139 Ga0500643_000015 3300053087 Bacteria 310312
1140 Ga0500643_012824 3300053087 Bacteria 2988
1141 Ga0500644_0040454 3300053088 Bacteria 1543
1142 Ga0500581_120407 3300053089 Bacteria 1268
1143 Ga0500566_0000082 3300053094 Bacteria 47150
1144 Ga0500641_0000376 3300053096 Bacteria 16585
1145 Ga0500641_0004622 3300053096 Bacteria 4866
1146 Ga0500641_0017367 3300053096 Bacteria 2690
1147 Ga0500641_0026306 3300053096 Bacteria 2258
1148 Ga0500650_0013072 3300053098 Bacteria 3471
1149 Ga0500556_0000002 3300053104 Bacteria 773626
1150 Ga0500557_000022 3300053105 Bacteria 88506
1151 Ga0500557_018021 3300053105 Bacteria 1962
1152 Ga0500562_032766 3300053108 Bacteria 1372
1153 Ga0500569_005635 3300053109 Bacteria 2700
1154 Ga0500569_029724 3300053109 Bacteria 1524
1155 Ga0500592_001501 3300053116 Bacteria 3780
1156 Ga0500594_0015572 3300053118 Bacteria 1835
1157 Ga0500642_0000016 3300053130 Bacteria 176560
1158 Ga0500642_0000166 3300053130 Bacteria 27296
1159 Ga0500658_0000625 3300053134 Bacteria 14656
1160 Ga0500659_0043180 3300053135 Bacteria 2446
1161 Ga0500559_0020582 3300053136 Bacteria 2790
1162 Ga0500568_0000035 3300053139 Bacteria 137912
1163 Ga0500568_0002154 3300053139 Bacteria 11868
1164 Ga0500568_0013231 3300053139 Bacteria 3764
1165 Ga0500568_0018845 3300053139 Bacteria 3010
1166 Ga0500577_0000373 3300053142 Bacteria 11382
1167 Ga0500577_0043761 3300053142 Bacteria 1647
1168 Ga0500588_0072814 3300053146 Bacteria 1131
1169 Ga0500604_0000742 3300053151 Bacteria 8922
1170 Ga0500604_0020569 3300053151 Bacteria 1859
1171 Ga0500616_0001686 3300053153 Bacteria 20346
1172 Ga0500616_0014259 3300053153 Bacteria 4573
1173 Ga0500622_0000668 3300053156 Bacteria 30285
1174 Ga0500622_0010502 3300053156 Bacteria 5080
1175 Ga0500624_001406 3300053157 Bacteria 3975
1176 Ga0500627_0035377 3300053158 Bacteria 2121
1177 Ga0500627_0039600 3300053158 Bacteria 2019
1178 Ga0500627_0052474 3300053158 Bacteria 1780
1179 Ga0500634_0004710 3300053161 Bacteria 6365
1180 Ga0500636_0000036 3300053177 Bacteria 71714
1181 Ga0500636_0003407 3300053177 Bacteria 8946
1182 Ga0500611_006845 3300053727 Bacteria 1683
1183 Ga0500625_006836 3300053729 Bacteria 4900
1184 Ga0500645_012516 3300053730 Bacteria 2739
1185 Ga0500645_028625 3300053730 Bacteria 1685
1186 Ga0500645_039163 3300053730 Bacteria 1405
1187 Ga0500609_003310 3300053731 Bacteria 2272
1188 Ga0500601_000258 3300053737 Bacteria 10116
1189 Ga0501084_0001734 3300054114 Bacteria 17311
1190 Ga0587090_004716 3300059510 Bacteria 1671
1191 Ga0501082_0000053 3300060353 Bacteria 82895
1192 Ga0501082_0007228 3300060353 Bacteria 9573
1193 Ga0501082_0360620 3300060353 Bacteria 1268
1194 Ga0530510_0041559 3300061734 Bacteria 3320
1195 2840769232 2840764183 Bacteria 6358399
1196 2503198329 2503198000 Bacteria 6884444
1197 2507508584 2507262055 Bacteria 8048963
1198 2508542656 2508501009 Bacteria 7784016
1199 2508691568 2508501042 Bacteria 8719808
1200 2509079577 2508501114 Bacteria 7082538
1201 2509111394 2508501122 Bacteria 6292184
1202 2509114447 2508501123 Bacteria 6283661
1203 2509368395 2509276018 Bacteria 6910194
1204 2509375667 2509276019 Bacteria 6802256
1205 2509447931 2509276033 Bacteria 7180565
1206 2510134869 2510065019 Bacteria 6903379
1207 2510303293 2510065057 Bacteria 6649661
1208 2510314677 2510065059 Bacteria 6847884
1209 2510896275 2510461076 Bacteria 8618824
1210 2511137054 2510917022 Bacteria 6504556
1211 2511174201 2510917026 Bacteria 7046020
1212 2511390399 2511231027 Bacteria 5013807
1213 2511401273 2511231028 Bacteria 8046582
1214 2511501969 2511231052 Bacteria 6974333
1215 2512533337 2512047086 Bacteria 6850303
1216 2512934195 2512875016 Bacteria 6529530
1217 2512962495 2512875024 Bacteria 7195110
1218 2512971094 2512875026 Bacteria 6861065
1219 2513572632 2513237084 Bacteria 7231967
1220 2513580137 2513237085 Bacteria 7695351
1221 2513582634 2513237086 Bacteria 7265287
1222 2513604549 2513237089 Bacteria 6553624
1223 2513609801 2513237090 Bacteria 7096802
1224 2513615464 2513237091 Bacteria 6900273
1225 2513623046 2513237092 Bacteria 8341956
1226 2513631293 2513237093 Bacteria 7545552
1227 2513640447 2513237094 Bacteria 8789602
1228 2513645841 2513237095 Bacteria 8976980
1229 2513710812 2513237103 Bacteria 7647401
1230 2513872767 2513237139 Bacteria 8737671
1231 2513881253 2513237140 Bacteria 7076289
1232 2513902384 2513237143 Bacteria 6664116
1233 2513984597 2513237156 Bacteria 6402557
1234 2513997068 2513237159 Bacteria 6810126
1235 2514007602 2513237160 Bacteria 6650282
1236 2514011853 2513237161 Bacteria 8871253
1237 2514022310 2513237162 Bacteria 7468464
1238 2514037866 2513237164 Bacteria 7563725
1239 2514587362 2513237351 Bacteria 6968952
1240 2515113952 2515075009 Bacteria 7288508
1241 2515608762 2515154107 Bacteria 6795637
1242 2515628365 2515154112 Bacteria 8294334
1243 2515636974 2515154113 Bacteria 7807172
1244 2515643003 2515154114 Bacteria 7848616
1245 2515656752 2515154116 Bacteria 7552979
1246 2515743691 2515154134 Bacteria 7220242
1247 2516209689 2516143018 Bacteria 6951533
1248 2516893265 2516653046 Bacteria 6989037
1249 2517037583 2516653077 Bacteria 7555578
1250 2517077870 2516653085 Bacteria 7346596
1251 2517096667 2517093000 Bacteria 7412387
1252 2517102527 2517093001 Bacteria 9002274
1253 2517106751 2517093001 Bacteria 9002274
1254 2517410381 2517287029 Bacteria 6905599
1255 2517570022 2517487022 Bacteria 7227575
1256 2520377947 2519899620 Bacteria 6499161
1257 2524443297 2524023205 Bacteria 8918781
1258 2524448835 2524023207 Bacteria 6813453
1259 2524460624 2524023209 Bacteria 6679728
1260 2528854928 2528768022 Bacteria 10457665
1261 2530646980 2529292951 Bacteria 6916614
1262 2535519405 2534681796 Bacteria 7146037
1263 2537877385 2537561587 Bacteria 5425293
1264 2551675157 2551306084 Bacteria 8942552
1265 2551680517 2551306084 Bacteria 8942552
1266 2551688050 2551306085 Bacteria 7347181
1267 2551691142 2551306086 Bacteria 6843938
1268 2551693968 2551306086 Bacteria 6843938
1269 2551713208 2551306089 Bacteria 7162724
1270 2551745077 2551306093 Bacteria 7064773
1271 2554246281 2554235003 Bacteria 5877155
1272 2558867983 2558860100 Bacteria 8458965
1273 2559293503 2558860242 Bacteria 5568029
1274 2585166129 2582581283 Bacteria 6030556
1275 2585202444 2582581294 Bacteria 6626667
1276 2585273236 2582581307 Bacteria 6597605
1277 2585278930 2582581308 Bacteria 7413247
1278 2585325455 2582581315 Bacteria 7318924
1279 2585393047 2582581866 Bacteria 6859583
1280 2585402245 2582581867 Bacteria 7184437
1281 2585529053 2585427526 Bacteria 7258840
1282 2585530727 2585427527 Bacteria 7273426
1283 2585540993 2585427528 Bacteria 6842387
1284 2585554907 2585427530 Bacteria 7383882
1285 2585559464 2585427531 Bacteria 6992870
1286 2585822455 2585427590 Bacteria 6824633
1287 2585839755 2585427593 Bacteria 7141551
1288 2585902135 2585427608 Bacteria 6544331
1289 2585905160 2585427609 Bacteria 6667127
1290 2585998486 2585427633 Bacteria 6413184
1291 2586003050 2585427634 Bacteria 6455027
1292 2587979725 2585428125 Bacteria 6662905
1293 2588520344 2588253730 Bacteria 6881675
1294 2597810534 2597489875 Bacteria 7010078
1295 2599331579 2599185156 Bacteria 5403036
1296 2599604385 2599185210 Bacteria 5624189
1297 2599935464 2599185301 Bacteria 6161860
1298 2600193092 2599185352 Bacteria 7228948
1299 2601609478 2600255279 Bacteria 5605316
1300 2601746253 2600255308 Bacteria 5611129
1301 2616295586 2615840624 Bacteria 6557588
1302 2616305797 2615840626 Bacteria 7921970
1303 2617349020 2617270735 Bacteria 9163226
1304 2643772430 2643221550 Bacteria 4619371
1305 2643803592 2643221557 Bacteria 7184309
1306 2643838345 2643221564 Bacteria 4193379
1307 2643857896 2643221568 Bacteria 5187270
1308 2643920662 2643221582 Bacteria 5804683
1309 2643983922 2643221595 Bacteria 6565519
1310 2644050739 2643221607 Bacteria 6314006
1311 2644067559 2643221610 Bacteria 7480339
1312 2644107705 2643221618 Bacteria 7717186
1313 2644133353 2643221623 Bacteria 5239945
1314 2644148624 2643221626 Bacteria 8069654
1315 2644156052 2643221627 Bacteria 6761570
1316 2644205213 2643221636 Bacteria 6583769
1317 2644210227 2643221637 Bacteria 5345260
1318 2644298042 2643221653 Bacteria 4569637
1319 2644309099 2643221655 Bacteria 7722067
1320 2644332927 2643221659 Bacteria 7890716
1321 2644375239 2643221668 Bacteria 7306521
1322 2644418612 2643221675 Bacteria 7473456
1323 2644451979 2643221680 Bacteria 7473610
1324 2644483657 2643221686 Bacteria 6310811
1325 2644491797 2643221688 Bacteria 5260751
1326 2644501345 2643221689 Bacteria 6042950
1327 2644519530 2643221693 Bacteria 5513853
1328 2644545901 2643221698 Bacteria 7756764
1329 2644615041 2643221712 Bacteria 7729434
1330 2644653779 2643221718 Bacteria 5345506
1331 2644656294 2643221719 Bacteria 4568197
1332 2644676578 2643221723 Bacteria 7095460
1333 2644690741 2643221726 Bacteria 7455827
1334 2657681192 2657244999 Bacteria 5946535
1335 2671115284 2667528174 Bacteria 6435400
1336 2688595651 2687453392 Bacteria 6880454
1337 2694628186 2693429783 Bacteria 7019804
1338 2694640957 2693429784 Bacteria 7241525
1339 2719387293 2718217927 Bacteria 6972593
1340 2720493355 2718218199 Bacteria 6740745
1341 2720614829 2718218232 Bacteria 6720332
1342 2720621602 2718218233 Bacteria 6662049
1343 2720632930 2718218235 Bacteria 6630699
1344 2720776654 2718218269 Bacteria 6906114
1345 2721400928 2718218423 Bacteria 6438183
1346 2723028242 2721755556 Bacteria 6745503
1347 2723561870 2721755684 Bacteria 6859907
1348 2723568502 2721755685 Bacteria 6704835
1349 2723572937 2721755686 Bacteria 7343952
1350 2723848000 2721755755 Bacteria 8322773
1351 2724039741 2721755809 Bacteria 6438790
1352 2724091261 2721755819 Bacteria 6906405
1353 2724105767 2721755822 Bacteria 6726041
1354 2724111593 2721755823 Bacteria 6752556
1355 2725945441 2724679232 Bacteria 7646494
1356 2730109178 2728369352 Bacteria 6745171
1357 2738800404 2738541293 Bacteria 7065685
1358 2738948748 2738541317 Bacteria 5340176
1359 2739035550 2738541333 Bacteria 7106503
1360 2739309537 2738543024 Bacteria 5603683
1361 2745076657 2744054633 Bacteria 8678936
1362 2756674264 2756170246 Bacteria 7451806
1363 2765469412 2765235802 Bacteria 5618596
1364 2766065296 2765235942 Bacteria 7445910
1365 2770200143 2767802442 Bacteria 5747986
1366 2774868707 2773857925 Bacteria 6472445
1367 2774871196 2773857925 Bacteria 6472445
1368 2776261404 2775506901 Bacteria 9631051
1369 2776264471 2775506901 Bacteria 9631051
1370 2776270195 2775506902 Bacteria 6208009
1371 2776285078 2775506904 Bacteria 5954060
1372 2776916135 2775507049 Bacteria 6284736
1373 2792581765 2791355082 Bacteria 5973319
1374 2792620165 2791355091 Bacteria 6135441
1375 2792626415 2791355092 Bacteria 6248105
1376 2792639364 2791355094 Bacteria 7011481
1377 2792746838 2791355123 Bacteria 8049106
1378 2793062393 2791355196 Bacteria 7323613
1379 2793293610 2791355256 Bacteria 6798008
1380 2793313050 2791355259 Bacteria 7254731
1381 2793327796 2791355261 Bacteria 6661293
1382 2793333405 2791355262 Bacteria 6774204
1383 2793353726 2791355265 Bacteria 6539969
1384 2793359676 2791355266 Bacteria 7116587
1385 2793369429 2791355267 Bacteria 7222458
1386 2802719517 2802428858 Bacteria 6636079
1387 2802726890 2802428859 Bacteria 6667919
1388 2802732251 2802428860 Bacteria 6525526
1389 2802739854 2802428861 Bacteria 6534206
1390 2802745360 2802428862 Bacteria 6633353
1391 2802752752 2802428863 Bacteria 6410669
1392 2804752392 2802429268 Bacteria 6094027
1393 2805915335 2802429603 Bacteria 8777136
1394 2805929431 2802429605 Bacteria 6875453
1395 2805935387 2802429606 Bacteria 6346811
1396 2806044536 2802429633 Bacteria 7341974
1397 2806052737 2802429634 Bacteria 7083200
1398 2806059037 2802429635 Bacteria 7650140
1399 2806068300 2802429636 Bacteria 7597525
1400 2806074420 2802429637 Bacteria 7067217
1401 2808986726 2808606387 Bacteria 5697198
1402 2818238887 2816332527 Bacteria 8933356
1403 2819244365 2818991272 Bacteria 4622173
1404 2819556800 2818991439 Bacteria 6907412
1405 2819612185 2818991448 Bacteria 6772224
1406 2819639226 2818991453 Bacteria 7181617
1407 2821123279 2821123053 Bacteria 7836056
1408 2824605745 2824600985 Bacteria 8488197
1409 2824614458 2824609381 Bacteria 8672835
1410 2824623239 2824617872 Bacteria 8814715
1411 2824633177 2824626560 Bacteria 8813858
1412 2824640014 2824635225 Bacteria 8785348
1413 2824649699 2824644064 Bacteria 8743947
1414 2824657749 2824653114 Bacteria 8493680
1415 2824667126 2824661429 Bacteria 9877870
1416 2824677394 2824671348 Bacteria 8369588
1417 2824685260 2824679649 Bacteria 8248951
1418 2824693056 2824687955 Bacteria 8360029
1419 2824700757 2824696289 Bacteria 8335049
1420 2824711336 2824704595 Bacteria 9667483
1421 2824722402 2824714736 Bacteria 8717648
1422 2824732061 2824723954 Bacteria 8758240
1423 2824758195 2824753945 Bacteria 9787441
1424 2824768176 2824763712 Bacteria 9792355
1425 2824779545 2824773399 Bacteria 8360218
1426 2835314675 2835312727 Bacteria 7413381
1427 2835315267 2835312727 Bacteria 7413381
1428 2837683087 2837678835 Bacteria 5252418
1429 2838019132 2838016132 Bacteria 6577831
1430 2838031451 2838029111 Bacteria 6603031
1431 2838051150 2838048938 Bacteria 6044578
1432 2838063873 2838061910 Bacteria 6794874
1433 2838073357 2838068647 Bacteria 6208656
1434 2838079594 2838074704 Bacteria 6785777
1435 2838123749 2838122688 Bacteria 8803140
1436 2838677535 2838675328 Bacteria 4909118
1437 2838684936 2838680041 Bacteria 6545511
1438 2838691295 2838686498 Bacteria 7807632
1439 2838699227 2838694306 Bacteria 6853137
1440 2838703709 2838701080 Bacteria 6669771
1441 2838712708 2838707686 Bacteria 6619912
1442 2838716424 2838714209 Bacteria 5525906
1443 2838719776 2838719591 Bacteria 5523910
1444 2838727175 2838724970 Bacteria 4908691
1445 2838735778 2838729681 Bacteria 7400765
1446 2838739698 2838736955 Bacteria 5760694
1447 2838748680 2838742623 Bacteria 7396178
1448 2839998355 2839993093 Bacteria 5512535
1449 2841736075 2841734538 Bacteria 6784580
1450 2841844178 2841840854 Bacteria 5761912
1451 2841846707 2841846520 Bacteria 5345850
1452 2841853885 2841851746 Bacteria 7532261
1453 2841860764 2841859092 Bacteria 5436171
1454 2841868146 2841864319 Bacteria 6742987
1455 2841948642 2841941048 Bacteria 8688029
1456 2841949850 2841949485 Bacteria 8680857
1457 2841958666 2841957949 Bacteria 8652217
1458 2841966268 2841966195 Bacteria 8673214
1459 2841975005 2841974524 Bacteria 8931498
1460 2841983427 2841983080 Bacteria 8395090
1461 2842039066 2842038055 Bacteria 8002051
1462 2842047987 2842045827 Bacteria 8006841
1463 2842082185 2842077413 Bacteria 6508645
1464 2842113410 2842110456 Bacteria 7656360
1465 2842123108 2842118031 Bacteria 7033875
1466 2842127264 2842124991 Bacteria 5346824
1467 2842132428 2842130223 Bacteria 4909145
1468 2842143899 2842140634 Bacteria 5759631
1469 2842151218 2842146304 Bacteria 5957337
1470 2842152403 2842152218 Bacteria 4908957
1471 2842162597 2842156927 Bacteria 6894975
1472 2842169975 2842163707 Bacteria 6916235
1473 2842172669 2842170452 Bacteria 5525737
1474 2842176022 2842175837 Bacteria 4908771
1475 2842185034 2842180545 Bacteria 6888678
1476 2842189531 2842187318 Bacteria 5524014
1477 2842198237 2842192696 Bacteria 6147454
1478 2842208330 2842205361 Bacteria 6340321
1479 2842213845 2842211629 Bacteria 5523832
1480 2842224537 2842224351 Bacteria 5524473
1481 2842235593 2842229732 Bacteria 7475766
1482 2842241990 2842237096 Bacteria 6620661
1483 2842249373 2842243621 Bacteria 7421798
1484 2842256274 2842250916 Bacteria 6579627
1485 2842263490 2842257432 Bacteria 7401195
1486 2842266633 2842264693 Bacteria 6472963
1487 2842275770 2842271015 Bacteria 7807131
1488 2842281661 2842278818 Bacteria 6340002
1489 2842296185 2842291075 Bacteria 7076806
1490 2842302428 2842298080 Bacteria 6123127
1491 2842308246 2842304105 Bacteria 7023636
1492 2842316473 2842311132 Bacteria 6616990
1493 2842321362 2842317721 Bacteria 6793725
1494 2842345029 2842341865 Bacteria 7003929
1495 2842360839 2842357229 Bacteria 6485165
1496 2842369148 2842363717 Bacteria 6844742
1497 2842375613 2842370503 Bacteria 7038661
1498 2842382585 2842377471 Bacteria 7140707
1499 2842389986 2842384541 Bacteria 7057858
1500 2842398485 2842395702 Bacteria 6780583
1501 2842426992 2842422224 Bacteria 6239196
1502 2842429952 2842428310 Bacteria 6767288
1503 2842436388 2842434925 Bacteria 6502746
1504 2842444091 2842441272 Bacteria 6769273
1505 2842451055 2842447887 Bacteria 6754142
1506 2842464373 2842462802 Bacteria 6588055
1507 2842470717 2842469257 Bacteria 6752936
1508 2842477954 2842475841 Bacteria 6603183
1509 2842493302 2842489311 Bacteria 6620893
1510 2842499128 2842495871 Bacteria 6820686
1511 2842504763 2842502639 Bacteria 6604161
1512 2842517549 2842515876 Bacteria 5436280
1513 2842522690 2842521101 Bacteria 6569494
1514 2842872368 2842871566 Bacteria 4827117
1515 2842923976 2842922631 Bacteria 5824079
1516 2844003818 2844002411 Bacteria 7168230
1517 2844010450 2844009547 Bacteria 6728125
1518 2844167582 2844163670 Bacteria 7266046
1519 2844319500 2844315083 Bacteria 8138177
1520 2844457469 2844454524 Bacteria 7952546
1521 2847673181 2847670302 Bacteria 6165597
1522 2847689695 2847686936 Bacteria 6278406
1523 2847936209 2847930680 Bacteria 9342022
1524 2847946565 2847939898 Bacteria 8606328
1525 2849079310 2849076700 Bacteria 7039503
1526 2850081157 2850079185 Bacteria 6848280
1527 2852389098 2852387548 Bacteria 8025568
1528 2854682063 2854681122 Bacteria 4548679
1529 2854900802 2854896431 Bacteria 5869725
1530 2854918831 2854916844 Bacteria 5725939
1531 2855825988 2855825444 Bacteria 6785811
1532 2855841333 2855839649 Bacteria 7135830
1533 2856319786 2856314179 Bacteria 6477897
1534 2856320892 2856320880 Bacteria 7263508
1535 2856332866 2856328259 Bacteria 6528202
1536 2856340247 2856334872 Bacteria 7037011
1537 2856342172 2856342000 Bacteria 7176905
1538 2856353700 2856349417 Bacteria 6230045
1539 2856363311 2856356410 Bacteria 6297484
1540 2856366157 2856364286 Bacteria 6939991
1541 2857352623 2857349434 Bacteria 7926032
1542 2857371115 2857367948 Bacteria 6965560
1543 2857518877 2857516855 Bacteria 7787325
1544 2857533769 2857531043 Bacteria 6754041
1545 2858802320 2858800743 Bacteria 6603254
1546 2869165868 2869162929 Bacteria 6399702
1547 2869171985 2869169390 Bacteria 6659796
1548 2869239355 2869234852 Bacteria 6654993
1549 2869249017 2869242130 Bacteria 6609239
1550 2869254940 2869249662 Bacteria 6868783
1551 2869260691 2869256925 Bacteria 6981691
1552 2869267204 2869264136 Bacteria 6880765
1553 2869275465 2869271264 Bacteria 6908218
1554 2869280138 2869278585 Bacteria 7077053
1555 2869290988 2869285874 Bacteria 6901219
1556 2871433270 2871429161 Bacteria 6547891
1557 2871441977 2871435913 Bacteria 6880295
1558 2871463507 2871459585 Bacteria 6866887
1559 2871468359 2871466892 Bacteria 6923287
1560 2871475039 2871474448 Bacteria 6806570
1561 2871488368 2871481445 Bacteria 6700002
1562 2871491170 2871488783 Bacteria 6929816
1563 2871498916 2871495908 Bacteria 6935695
1564 2874105934 2874102143 Bacteria 6342645
1565 2874120873 2874116593 Bacteria 6674494
1566 2874131425 2874123672 Bacteria 7238285
1567 2874132980 2874131515 Bacteria 6820270
1568 2874143309 2874139085 Bacteria 7021506
1569 2874148788 2874146452 Bacteria 7533118
1570 2874160834 2874155637 Bacteria 6724144
1571 2874164783 2874162495 Bacteria 6174670
1572 2874172064 2874168670 Bacteria 8062617
1573 2874598047 2874590934 Bacteria 8299676
1574 2874615408 2874612657 Bacteria 8252029
1575 2874627828 2874620515 Bacteria 8290088
1576 2874631855 2874628541 Bacteria 8630250
1577 2874647507 2874645413 Bacteria 8214782
1578 2876363543 2876363079 Bacteria 6544991
1579 2876373026 2876369609 Bacteria 6807521
1580 2876382929 2876377896 Bacteria 6565995
1581 2876391354 2876386047 Bacteria 6698674
1582 2876397340 2876392853 Bacteria 6660880
1583 2876403926 2876399893 Bacteria 6927900
1584 2876410068 2876406927 Bacteria 6191900
1585 2876418874 2876413966 Bacteria 6831344
1586 2876426048 2876420981 Bacteria 6687741
1587 2876766943 2876761206 Bacteria 10111113
1588 2876778475 2876771140 Bacteria 8287509
1589 2876820421 2876818435 Bacteria 8274608
1590 2878039739 2878035449 Bacteria 6555736
1591 2878733682 2878730984 Bacteria 6380721
1592 2878740624 2878738818 Bacteria 7136951
1593 2878750883 2878745973 Bacteria 6867388
1594 2878755579 2878753008 Bacteria 6922523
1595 2878763129 2878760144 Bacteria 6823465
1596 2878770104 2878767105 Bacteria 6898628
1597 2878780050 2878774303 Bacteria 6108671
1598 2878781873 2878781027 Bacteria 6834456
1599 2878795242 2878788777 Bacteria 6567085
1600 2879082269 2879074833 Bacteria 8279565
1601 2879083705 2879083081 Bacteria 8587928
1602 2879101241 2879099564 Bacteria 10442239
1603 2879135416 2879127579 Bacteria 8294491
1604 2879150624 2879142872 Bacteria 8267021
1605 2881147898 2881147464 Bacteria 7779814
1606 2881159071 2881155292 Bacteria 6461656
1607 2881164678 2881161766 Bacteria 7127907
1608 2881671171 2881665667 Bacteria 8175609
1609 2881847929 2881845957 Bacteria 6611900
1610 2881859601 2881853255 Bacteria 6698367
1611 2881867237 2881861095 Bacteria 7128710
1612 2882457510 2882456835 Bacteria 6863978
1613 2882457540 2882456835 Bacteria 6863978
1614 2882457711 2882456835 Bacteria 6863978
1615 2882634694 2882632389 Bacteria 8154593
1616 2882918198 2882912400 Bacteria 6801539
1617 2884300795 2884298095 Bacteria 3823049
1618 2885306520 2885305155 Bacteria 7348390
1619 2885314468 2885312484 Bacteria 6415165
1620 2885324216 2885318864 Bacteria 6729568
1621 2885333295 2885326080 Bacteria 7134805
1622 2885337006 2885334103 Bacteria 7216818
1623 2885352224 2885350715 Bacteria 6787678
1624 2885413692 2885409591 Bacteria 9235467
1625 2888342995 2888337043 Bacteria 6629336
1626 2888344044 2888343758 Bacteria 6611049
1627 2888352805 2888350351 Bacteria 7372807
1628 2888384063 2888378607 Bacteria 9652610
1629 2888393794 2888388044 Bacteria 7304136
1630 2888424475 2888419890 Bacteria 7857137
1631 2889014580 2889010040 Bacteria 6749192
1632 2889020438 2889016732 Bacteria 6700763
1633 2889919154 2889914905 Bacteria 5702301
1634 2894239106 2894232714 Bacteria 8834183
1635 2894655527 2894652903 Bacteria 4587256
1636 2896389937 2896384573 Bacteria 7700774
1637 2898798926 2898795034 Bacteria 4294459
1638 2899794409 2899792073 Bacteria 4926588
1639 2899808658 2899803654 Bacteria 5577784
1640 2899845792 2899845264 Bacteria 5672268
1641 2903454374 2903448605 Bacteria 7357801
1642 2903498946 2903492973 Bacteria 13473544
1643 2903501539 2903492973 Bacteria 13473544
1644 2903525493 2903521522 Bacteria 6525694
1645 2903531762 2903528002 Bacteria 6586099
1646 2903543715 2903540706 Bacteria 7062119
1647 2903734436 2903727486 Bacteria 8281579
1648 2904584140 2904578770 Bacteria 5302906
1649 2904664094 2904659560 Bacteria 6685615
1650 2904672852 2904666416 Bacteria 8226587
1651 2904714618 2904711408 Bacteria 9771557
1652 2906313808 2906308376 Bacteria 6841989
1653 2906326517 2906321335 Bacteria 6579571
1654 2906334889 2906328253 Bacteria 6585166
1655 2906354969 2906354277 Bacteria 6991324
1656 2906367875 2906363423 Bacteria 6856682
1657 2906375568 2906370794 Bacteria 6881062
1658 2906380841 2906378014 Bacteria 6911440
1659 2906398191 2906393657 Bacteria 6790866
1660 2906401483 2906401398 Bacteria 6693206
1661 2906411273 2906408224 Bacteria 6162342
1662 2906420562 2906414383 Bacteria 6580790
1663 2906432778 2906427513 Bacteria 6375796
1664 2906609232 2906602504 Bacteria 8295279
1665 2906633266 2906626472 Bacteria 8826946
1666 2906651447 2906643746 Bacteria 8722424
1667 2913300841 2913295892 Bacteria 6333755
1668 2913313844 2913308742 Bacteria 5350706
1669 2915981890 2915980308 Bacteria 6624279
1670 2915991341 2915986958 Bacteria 6739310
1671 2915994365 2915993759 Bacteria 7016183
1672 2916004386 2916000859 Bacteria 6865702
1673 2916008150 2916007675 Bacteria 6898660
1674 2916015089 2916014648 Bacteria 6946486
1675 2916024236 2916021584 Bacteria 6854472
1676 2916031768 2916028427 Bacteria 6748433
1677 2916041270 2916035215 Bacteria 6755766
1678 2916042536 2916041962 Bacteria 6820487
1679 2916052276 2916048683 Bacteria 6543552
1680 2916056437 2916055098 Bacteria 6758838
1681 2916067576 2916061851 Bacteria 6737736
1682 2916075702 2916068649 Bacteria 6943657
1683 2916080863 2916076590 Bacteria 6596108
1684 2919075731 2919073203 Bacteria 6531949
1685 2919116641 2919114240 Bacteria 5700270
1686 2919125020 2919119836 Bacteria 5208557
1687 2919168460 2919166419 Bacteria 4952238
1688 2919172424 2919171160 Bacteria 6499771
1689 2919409333 2919408235 Bacteria 6149349
1690 2919454316 2919450847 Bacteria 5631160
1691 2920766095 2920760137 Bacteria 7427611
1692 2920824721 2920822456 Bacteria 6897201
1693 2921201938 2921201388 Bacteria 6926299
1694 2921211204 2921208531 Bacteria 6745326
1695 2921240723 2921237296 Bacteria 6876710
1696 2921244634 2921244191 Bacteria 6568419
1697 2921251173 2921250672 Bacteria 6677771
1698 2921262468 2921257292 Bacteria 6808382
1699 2921265116 2921263974 Bacteria 6864552
1700 2921283767 2921282425 Bacteria 6826397
1701 2921296325 2921289301 Bacteria 7316391
1702 2921303773 2921296804 Bacteria 7176999
1703 2922135182 2922130491 Bacteria 7173936
1704 2922155086 2922151315 Bacteria 6902399
1705 2922165083 2922158528 Bacteria 6573167
1706 2922177911 2922172374 Bacteria 6167644
1707 2922184595 2922178524 Bacteria 6025201
1708 2922186354 2922185730 Bacteria 7113964
1709 2922374395
1710 2922396239 2922393267 Bacteria 8285685
1711 2923558760 2923556063 Bacteria 6793593
1712 2924147098 2924144063 Bacteria 6883928
1713 2924155258 2924150972 Bacteria 7169444
1714 2924160763 2924158325 Bacteria 7188855
1715 2924167341 2924165586 Bacteria 7260590
1716 2924178982 2924172951 Bacteria 6749356
1717 2924184070 2924179722 Bacteria 6843264
1718 2924189069 2924186466 Bacteria 6876637
1719 2924194796 2924193448 Bacteria 6955718
1720 2924203356 2924200457 Bacteria 6757188
1721 2924208830 2924207177 Bacteria 6917007
1722 2924217920 2924214083 Bacteria 7080103
1723 2924226508 2924221636 Bacteria 7113495
1724 2924229950 2924228884 Bacteria 6633132
1725 2924723133 2924718760 Bacteria 6331356
1726 2924728230 2924726620 Bacteria 6271473
1727 2924736665 2924733363 Bacteria 7574837
1728 2924741501 2924741084 Bacteria 6661321
1729 2924754607 2924748358 Bacteria 6154725
1730 2924764011 2924762789 Bacteria 6561353
1731 2924778225 2924776078 Bacteria 7492003
1732 2924785569 2924784321 Bacteria 7416538
1733 2926754650 2926754445 Bacteria 5964435
1734 2926761818 2926760298 Bacteria 5505990
1735 2928524268 2928521798 Bacteria 4960112
1736 2929142117 2929138655 Bacteria 5810547
1737 2929618065 2929615660 Bacteria 9193770
1738 2929627746 2929624759 Bacteria 9339455
1739 2932790355 2932784394 Bacteria 9704911
1740 2932810775 2932809354 Bacteria 9135765
1741 2932823894 2932818245 Bacteria 9955613
1742 2933007050 2933006813 Bacteria 4912075
1743 2933015360 2933011516 Bacteria 5439334
1744 2933574695 2933570622 Bacteria 7023390
1745 2933579993 2933577622 Bacteria 9116884
1746 2933589300 2933586486 Bacteria 7667493
1747 2933594252 2933594066 Bacteria 5594265
1748 2933603512 2933599457 Bacteria 5858799
1749 2935608885 2935608549 Bacteria 8203142
1750 2935623052 2935616580 Bacteria 9032984
1751 2935642416 2935638405 Bacteria 10015038
1752 2935650051 2935648319 Bacteria 8801166
1753 2935661797 2935656913 Bacteria 8965014
1754 2935668281 2935665750 Bacteria 9571747
1755 2935676312 2935675223 Bacteria 9928132
1756 2935692919 2935684952 Bacteria 9590419
1757 2935701078 2935694250 Bacteria 9291695
1758 2935706141 2935703347 Bacteria 10242284
1759 2935721356 2935713505 Bacteria 9608509
1760 2935730274 2935722832 Bacteria 9608746
1761 2935740287 2935732158 Bacteria 9706831
1762 2935749551 2935741537 Bacteria 9707219
1763 2935759136 2935750917 Bacteria 9590372
1764 2935762536 2935760218 Bacteria 9817913
1765 2935773297 2935769743 Bacteria 7878163
1766 2935778538 2935777560 Bacteria 8077691
1767 2935792749 2935785616 Bacteria 7962367
1768 2935800776 2935793552 Bacteria 8012592
1769 2935803140 2935801545 Bacteria 9301974
1770 2935814456 2935810662 Bacteria 9401221
1771 2935822045 2935819856 Bacteria 8261050
1772 2935831594 2935827899 Bacteria 10038562
1773 2935838454 2935837841 Bacteria 9454360
1774 2935847627 2935847175 Bacteria 8228321
1775 2935861300 2935855204 Bacteria 9035059
1776 2935865838 2935864058 Bacteria 9784707
1777 2935878339 2935873716 Bacteria 9632195
1778 2935899711 2935894831 Bacteria 6620579
1779 2935907530 2935901341 Bacteria 7341747
1780 2935909102 2935908558 Bacteria 8568796
1781 2935919823 2935916978 Bacteria 9113783
1782 2935926324 2935926038 Bacteria 8601059
1783 2935934774 2935934488 Bacteria 8602579
1784 2935943224 2935942939 Bacteria 8599779
1785 2935951662 2935951376 Bacteria 8602333
1786 2935967787 2935967501 Bacteria 8603075
1787 2935982671 2935975950 Bacteria 8347125
1788 2935988165 2935984226 Bacteria 8302647
1789 2935994652 2935992306 Bacteria 9802711
1790 2936007549 2936002035 Bacteria 9362176
1791 2936012465 2936011229 Bacteria 8801034
1792 2936021030 2936019824 Bacteria 8804134
1793 2936029758 2936028420 Bacteria 8965941
1794 2936040013 2936037263 Bacteria 9446081
1795 2936047223 2936046547 Bacteria 8903709
1796 2936057618 2936055302 Bacteria 8785755
1797 2936374846 2936367885 Bacteria 7324495
1798 2936380538 2936375103 Bacteria 6652732
1799 2936998124 2936996657 Bacteria 6298727
1800 2937005064 2937002841 Bacteria 6934057
1801 2937012208 2937009748 Bacteria 6746052
1802 2937018633 2937016420 Bacteria 6782579
1803 2937028972 2937023124 Bacteria 6815156
1804 2937031276 2937029754 Bacteria 6424026
1805 2937038583 2937036028 Bacteria 6846469
1806 2937045881 2937042894 Bacteria 6741576
1807 2937050950 2937049772 Bacteria 6757901
1808 2937061544 2937056579 Bacteria 7107896
1809 2937065229 2937063883 Bacteria 7199456
1810 2937073048 2937071275 Bacteria 6984483
1811 2937079798 2937078374 Bacteria 6610289
1812 2937085166 2937084907 Bacteria 6618516
1813 2937097588 2937091812 Bacteria 6979387
1814 2937099535 2937098957 Bacteria 7249374
1815 2937110009 2937106411 Bacteria 6947143
1816 2937116269 2937113482 Bacteria 6505872
1817 2937123079 2937119839 Bacteria 6597547
1818 2937128708 2937126314 Bacteria 6771275
1819 2937819887 2937813078 Bacteria 7783518
1820 2937826378 2937822353 Bacteria 7290551
1821 2937836691 2937836603 Bacteria 6811263
1822 2937847812 2937843397 Bacteria 5256375
1823 2937847813 2937843397 Bacteria 5256375
1824 2937854682 2937848649 Bacteria 6983481
1825 2937861906 2937861824 Bacteria 6660327
1826 2937878346 2937877337 Bacteria 7246526
1827 2937892192 2937891427 Bacteria 6357007
1828 2937980258 2937972304 Bacteria 7532020
1829 2937982872 2937980651 Bacteria 6517427
1830 2937997564 2937994558 Bacteria 7036190
1831 2938018158 2938014810 Bacteria 6700592
1832 2939672400 2939669807 Bacteria 5028511
1833 2940564859 2940556831 Bacteria 9590747
1834 2941504977 2941499720 Bacteria 7599444
1835 2941533285 2941531003 Bacteria 7653939
1836 2941538878 2941538514 Bacteria 9402094
1837 2954013218 2954011201 Bacteria 4762601
1838 2957384802 2957382221 Bacteria 6737050
1839 2957394844 2957388812 Bacteria 6778072
1840 2957398270 2957395598 Bacteria 6822399
1841 2957403206 2957402308 Bacteria 6741770
1842 2957411599 2957408893 Bacteria 6558585
1843 2957418323 2957415311 Bacteria 6991633
1844 2957423296 2957422303 Bacteria 7172205
1845 2957432799 2957430029 Bacteria 7022557
1846 2957441264 2957437181 Bacteria 6568994
1847 2957444988 2957443900 Bacteria 6869977
1848 2957455969 2957450854 Bacteria 6765715
1849 2957459920 2957457609 Bacteria 6967680
1850 2957465992 2957464669 Bacteria 6568877
1851 2957477087 2957471148 Bacteria 6797643
1852 2957479219 2957478035 Bacteria 6756658
1853 2957486256 2957484790 Bacteria 6703082
1854 2957492868 2957491536 Bacteria 6695180
1855 2957498692 2957498199 Bacteria 7126688
1856 2957507657 2957505466 Bacteria 7253085
1857 2958036004 2958034702 Bacteria 6989922
1858 2958045310 2958041894 Bacteria 13082850
1859 2958068017 2958064165 Bacteria 7158582
1860 2958076059 2958071322 Bacteria 6815895
1861 2958085462 2958084443 Bacteria 7312792
1862 2958098827 2958092219 Bacteria 6861151
1863 2958101736 2958100919 Bacteria 6800575
1864 2958108961 2958108152 Bacteria 6681128
1865 2958119418 2958115193 Bacteria 6923548
1866 2958127179 2958122699 Bacteria 7280457
1867 2958135388 2958130278 Bacteria 6897202
1868 2958139459 2958137437 Bacteria 6050276
1869 2958145512 2958144490 Bacteria 6677056
1870 2958161411 2958158011 Bacteria 6058449
1871 2958168037 2958165035 Bacteria 6906348
1872 2958178982 2958172287 Bacteria 6716688
1873 2958184417 2958179912 Bacteria 6874908
1874 2960584303 2960584000 Bacteria 6864594
1875 2960592717 2960591022 Bacteria 6622873
1876 2960602687 2960597568 Bacteria 6550735
1877 2960605934 2960603979 Bacteria 6898737
1878 2960612420 2960610863 Bacteria 6691244
1879 2960620014 2960617483 Bacteria 6727748
1880 2960629228 2960624210 Bacteria 6875384
1881 2960632834 2960631154 Bacteria 6732508
1882 2960639852 2960637947 Bacteria 7296468
1883 2960650504 2960645483 Bacteria 7211087
1884 2960660039 2960652885 Bacteria 7083688
1885 2960660850 2960660292 Bacteria 7041660
1886 2960670966 2960667422 Bacteria 6763020
1887 2960675913 2960674078 Bacteria 6609048
1888 2960681859 2960680706 Bacteria 6624464
1889 2960688014 2960687367 Bacteria 6535474
1890 2960694661 2960693952 Bacteria 6749742
1891 2961082472 2961077736 Bacteria 7079850
1892 2961118766 2961114664 Bacteria 6680456
1893 2961129736 2961127735 Bacteria 7196641
1894 2961166503 2961163497 Bacteria 6901077
1895 2961176477 2961170736 Bacteria 7072258
1896 2961190417 2961183825 Bacteria 6688536
1897 2963645003 2963644680 Bacteria 6530403
1898 2964611615 2964607997 Bacteria 7101408
1899 2964616576 2964615318 Bacteria 6809089
1900 2964622582 2964621998 Bacteria 6834995
1901 2964635803 2964628898 Bacteria 7083044
1902 2964640947 2964636051 Bacteria 7091832
1903 2964649473 2964643177 Bacteria 6820887
1904 2964651787 2964649959 Bacteria 6675118
1905 2964661011 2964656573 Bacteria 7100150
1906 2964667043 2964663802 Bacteria 7019362
1907 2964677501 2964670856 Bacteria 6851364
1908 2964684091 2964678106 Bacteria 6792020
1909 2964687675 2964685014 Bacteria 6839111
1910 2964692863 2964691889 Bacteria 6802758
1911 2964702322 2964698721 Bacteria 6765331
1912 2964711844 2964705432 Bacteria 7114648
1913 2964716771 2964712639 Bacteria 6695970
1914 2964723890 2964719344 Bacteria 7286602
1915 2965021323 2965018300 Bacteria 6883036
1916 2965030313 2965025482 Bacteria 6532201
1917 2965038417 2965032056 Bacteria 6887443
1918 2965046986 2965040258 Bacteria 6855979
1919 2965054068 2965047637 Bacteria 6623551
1920 2965066309 2965062239 Bacteria 7412989
1921 2965094312 2965089291 Bacteria 6866420
1922 2965107799 2965102966 Bacteria 6800987
1923 2965126747 2965119406 Bacteria 6956431
1924 2967665501 2967664464 Bacteria 6948836
1925 2967672560 2967671571 Bacteria 7021409
1926 2967681857 2967678726 Bacteria 7264382
1927 2967691700 2967686174 Bacteria 6678622
1928 2967695255 2967693043 Bacteria 6804451
1929 2967703245 2967699805 Bacteria 6854538
1930 2967707788 2967706974 Bacteria 7186053
1931 2967716661 2967714385 Bacteria 7000047
1932 2967721662 2967721400 Bacteria 7073753
1933 2967734983 2967728569 Bacteria 6641507
1934 2967736860 2967735183 Bacteria 6827012
1935 2967744128 2967742019 Bacteria 6794534
1936 2967755481 2967748971 Bacteria 6733771
1937 2967758749 2967755722 Bacteria 6814706
1938 2967765379 2967762386 Bacteria 6923502
1939 2967775657 2967769361 Bacteria 6587838
1940 2967782292 2967775926 Bacteria 6738189
1941 2968001506 2967996073 Bacteria 6787468
1942 2968007559 2968003550 Bacteria 6929263
1943 2968017258 2968016561 Bacteria 7022047
1944 2968088715 2968083720 Bacteria 7351627
1945 2968093852 2968091066 Bacteria 6052692
1946 2968097725 2968097103 Bacteria 6107094
1947 2968115233 2968110612 Bacteria 6814636
1948 2968121968 2968117919 Bacteria 6536078
1949 2968134129 2968128360 Bacteria 6270294
1950 2968142241 2968138860 Bacteria 6605449
1951 2968174907 2968171901 Bacteria 6894245
1952 2970026519 2970019648 Bacteria 7072033
1953 2970031011 2970026789 Bacteria 6785236
1954 2970039721 2970033650 Bacteria 7118744
1955 2970041328 2970040964 Bacteria 6731123
1956 2970054421 2970047711 Bacteria 7088379
1957 2970057812 2970054988 Bacteria 6611507
1958 2970066697 2970061556 Bacteria 7099761
1959 2970073000 2970068827 Bacteria 7123112
1960 2970077458 2970076120 Bacteria 6697332
1961 2970083746 2970082768 Bacteria 6183754
1962 2970091173 2970088815 Bacteria 6933825
1963 2970097288 2970095765 Bacteria 6936963
1964 2970107499 2970102677 Bacteria 6812532
1965 2970110866 2970109326 Bacteria 6863976
1966 2970122166 2970116247 Bacteria 6501857
1967 2970122980 2970122695 Bacteria 6625855
1968 2970131683 2970129317 Bacteria 6806560
1969 2970138581 2970136068 Bacteria 7207982
1970 2970144100 2970143518 Bacteria 6446480
1971 2970154256 2970149975 Bacteria 6779706
1972 2970160120 2970156795 Bacteria 7168044
1973 2970167122 2970164137 Bacteria 6861252
1974 2970173284 2970170962 Bacteria 6876229
1975 2970178377 2970177841 Bacteria 6768001
1976 2970187579 2970184632 Bacteria 7054431
1977 2970193336 2970191845 Bacteria 7032787
1978 2970470615 2970469710 Bacteria 6969209
1979 2970490168 2970489779 Bacteria 6517260
1980 2970509148 2970503327 Bacteria 7099517
1981 2970514787 2970510686 Bacteria 7006402
1982 2970525748 2970524798 Bacteria 6840927
1983 2970536594 2970532167 Bacteria 6553173
1984 2970544000 2970540015 Bacteria 6977556
1985 2970550468 2970547951 Bacteria 6931819
1986 2970557977 2970554993 Bacteria 6814252
1987 2970594735 2970593180 Bacteria 7073582
1988 2970623981 2970619444 Bacteria 6986144
1989 2977522403 2977516862 Bacteria 6940108
1990 2977529043 2977523885 Bacteria 6960446
1991 2977531669 2977530762 Bacteria 6951399
1992 2977540564 2977537788 Bacteria 6929320
1993 2977549084 2977544691 Bacteria 6875412
1994 2977554418 2977551784 Bacteria 7125765
1995 2977560182 2977558990 Bacteria 6863948
1996 2977572260 2977565890 Bacteria 6901543
1997 2977575289 2977572785 Bacteria 6763888
1998 2977580173 2977579622 Bacteria 6772100
1999 2977824719 2977821940 Bacteria 6906439
2000 2977835715 2977828996 Bacteria 7007971
2001 2977845485 2977843712 Bacteria 6753583
2002 2977857594 2977851361 Bacteria 6694324
2003 2977864368 2977858184 Bacteria 6215359
2004 2977866508 2977864932 Bacteria 7534097
2005 2977873694 2977872689 Bacteria 7270173
2006 2977905298 2977898635 Bacteria 6675551
2007 2977908976 2977907340 Bacteria 6577984
2008 2977918008 2977915119 Bacteria 6829656
2009 2977925870 2977922695 Bacteria 6956781
2010 2977939515 2977935797 Bacteria 6252826
2011 2977944147 2977942078 Bacteria 7570577
2012 2977951496 2977950692 Bacteria 6893264
2013 2977963420 2977957713 Bacteria 6877875
2014 2977978799 2977971508 Bacteria 7472917
2015 2977991602 2977986579 Bacteria 6581278
2016 2978971135 2978969890 Bacteria 5400756
2017 2979092916 2979089926 Bacteria 5670289
2018 2979099695 2979095461 Bacteria 5669583
2019 2979104885 2979100975 Bacteria 5423623
2020 2979712958 2979710463 Bacteria 6785254
2021 2979751194 2979742915 Bacteria 7301278
2022 2979771573 2979764755 Bacteria 6610066
2023 2979776490 2979772303 Bacteria 6618277
2024 2979782582 2979779861 Bacteria 6219781
2025 2979794707 2979793036 Bacteria 6808957
2026 2979813827 2979808191 Bacteria 7179355
2027 2984513314 2984509177 Bacteria 5274802
2028 2984520317 2984518228 Bacteria 5277463
2029 2984539615 2984537506 Bacteria 5277481
2030 2984588296 2984587000 Bacteria 5263363
2031 2984601841 2984601300 Bacteria 5455244
2032 2987641216 2987636660 Bacteria 8088555
2033 2987646125 2987645492 Bacteria 6117018
2034 2987656608 2987652177 Bacteria 6969023
2035 2987662513 2987659509 Bacteria 6966464
2036 2987667547 2987666974 Bacteria 6509233
2037 2987677285 2987673487 Bacteria 6884027
2038 2989354132 2989349275 Bacteria 6349068
2039 2989777012 2989776772 Bacteria 4843317
2040 2996311828 2996310559 Bacteria 6357320
2041 2996338547 2996336353 Bacteria 5511628
2042 2996346800 2996341866 Bacteria 6643098
2043 2996349945 2996348954 Bacteria 7239054
2044 2996391656 2996386984 Bacteria 6978667
2045 2996889227 2996887358 Bacteria 5795980
2046 2996894710 2996893221 Bacteria 5823108
2047 3000142582 3000135777 Bacteria 6891109
2048 3002145180 3002141150 Bacteria 5254435
2049 3003932697 3003930520 Bacteria 5667563
2050 3004172866 3004167301 Bacteria 8330599
2051 3004191563 3004188549 Bacteria 6952365
2052 3004198194 3004195979 Bacteria 6776956
2053 3004210023 3004203850 Bacteria 7307914
2054 3004216424 3004211236 Bacteria 7417683
2055 3004218635 3004218560 Bacteria 7421728
2056 3004239420 3004232784 Bacteria 6662140
2057 3004255195 3004248173 Bacteria 6563236
2058 3004272554 3004268573 Bacteria 7043476
2059 3004276647 3004275668 Bacteria 7114440
2060 3004293723 3004289098 Bacteria 6135450
2061 3004337751 3004334049 Bacteria 8449246
2062 3005417164 3005416602 Bacteria 7064308
2063 3005722735 3005718088 Bacteria 8283608
2064 637077346 637000159 Bacteria 7596297
2065 639650021 639633055 Bacteria 7751309
2066 643825975 643692032 Bacteria 6891900
2067 648739557 648276728 Bacteria 6968865
2068 649870218 649633066 Bacteria 6690028
2069 650738741 650716007 Bacteria 5573770
2070 8002287118 8002285264 Bacteria 6717907
2071 8003572287 8003570095 Bacteria 5747666
2072 8003993848 8003992118 Bacteria 7266902
2073 8004001393 8003999396 Bacteria 7063185
2074 8004301013 8004300914 Bacteria 6132239
2075 8004315020 8004312739 Bacteria 7444653
2076 8004363417 8004361976 Bacteria 6858373
2077 8004377158 8004374579 Bacteria 6898112
2078 8004393277 8004387939 Bacteria 7049250
2079 8004451485 8004445564 Bacteria 6322258
2080 8004637718 8004633249 Bacteria 6723080
2081 8004644241 8004640170 Bacteria 6723001
2082 8004697698 8004695233 Bacteria 6731676
2083 8004707002 8004703790 Bacteria 8006957
2084 8004720064 8004714634 Bacteria 6776161
2085 8004729718 8004727605 Bacteria 6643904
2086 8005247960 8005246636 Bacteria 4933972
2087 8005264195 8005258706 Bacteria 6184835
2088 8005282039 8005275841 Bacteria 6929066
2089 8005288486 8005282627 Bacteria 6675747
2090 8005294242 8005289223 Bacteria 6634003
2091 8005306653 8005301065 Bacteria 6614431
2092 8005309411 8005307578 Bacteria 7395396
2093 8005315225 8005314921 Bacteria 7072929
2094 8005323754 8005321885 Bacteria 5795980
2095 8005382762 8005376324 Bacteria 6590079
2096 8005383819 8005382845 Bacteria 6732062
2097 8005401145 8005395548 Bacteria 6806915
2098 8005434098 8005430974 Bacteria 6689030
2099 8005464639 8005460587 Bacteria 7157962
2100 8005485605 8005484373 Bacteria 6297373
2101 8005501689 8005497431 Bacteria 6477605
2102 8005547094 8005542996 Bacteria 7077758
2103 8005559142 8005556819 Bacteria 6908598
2104 8005566799 8005563573 Bacteria 7153261
2105 8005574923 8005570704 Bacteria 6957481
2106 8005623043 8005619151 Bacteria 7030230
2107 8005631653 8005626139 Bacteria 6534237
2108 8005648378 8005645114 Bacteria 6950293
2109 8005673111 8005668836 Bacteria 6953162
2110 8005684545 8005682033 Bacteria 6726518
2111 8005693651 8005688590 Bacteria 6610080
2112 8005700889 8005695170 Bacteria 6912330
2113 8016522331 8016511872 Bacteria 9921665
2114 8016529612 8016522445 Bacteria 8156687
2115 8016534829 8016530956 Bacteria 8155261
2116 8016548040 8016539877 Bacteria 8155419
2117 8016554087 8016548790 Bacteria 8155074
2118 8016562462 8016557553 Bacteria 8154380
2119 8016573177 8016566248 Bacteria 8158151
2120 8016577319 8016575299 Bacteria 8154085
2121 8016600257 8016595262 Bacteria 8149947
2122 8016614442 8016613128 Bacteria 8794220
2123 8016626554 8016622563 Bacteria 7999408
2124 8016640339 8016630954 Bacteria 9217207
2125 8017063228 8017057580 Bacteria 10023680
2126 8018133594 8018127388 Bacteria 7351159
2127 8018154626 8018150411 Bacteria 5549903
2128 8018170242 8018163183 Bacteria 7277977
2129 8018178441 8018176218 Bacteria 6896178
2130 8019534593 8019530166 Bacteria 8155624
2131 8019544879 8019538911 Bacteria 7872763
2132 8019553655 8019547302 Bacteria 7996444
2133 8019582654 8019576017 Bacteria 10049540
2134 8019600907 8019597564 Bacteria 10041141
2135 8019617643 8019608314 Bacteria 10042931
2136 8019634457 8019629233 Bacteria 8687553
2137 8019645272 8019638758 Bacteria 9062356
2138 8019662348 8019659431 Bacteria 8577854
2139 8019671849 8019668869 Bacteria 8791617
2140 8019690079 8019687851 Bacteria 8712826
2141 8023687524 8023680758 Bacteria 7729763
2142 8024481973 8024479707 Bacteria 6954785
2143 8024505914 8024501048 Bacteria 6427847
2144 8049294959 8049293176 Bacteria 6128433
2145 8054461050 8054460903 Bacteria 4872905
2146 8054562059 8054558443 Bacteria 5204801
2147 8055617561 8055617313 Bacteria 7548464
2148 8055746346 8055742211 Bacteria 9226248
2149 8056381606 8056375014 Bacteria 7006639
2150 8056387047 8056382006 Bacteria 6408074
2151 8056878716 8056875544 Bacteria 4355797
2152 8056878717 8056875544 Bacteria 4355797
2153 8056968040 8056967851 Bacteria 9038162
2154 8056968483 8056967851 Bacteria 9038162
2155 8057877014 8057874678 Bacteria 7494653
2156 JGI24741J21665_1007941
2157 JGI24746J21847_1000755
2158 JGI24740J21852_10006190
2159 JGI24740J21852_10007518
2160 JGI24739J22299_10000344
2161 JGI24739J22299_10043423
2162 JGI24737J22298_10001079
2163 JGI24750J21931_1000255
2164 JGI24745J21846_1000003
2165 JGI24035J26624_1000595
2166 JGI24033J26618_1000489
2167 JGI24034J26672_10000322
2168 JGI24742J22300_10002875
2169 JGI24751J29686_10004924
2170 JGI24751J29686_10010970
2171 JGI25156J39149_1004063
2172 JGI25162J39368_1001169
2173 JGI25158J39367_1000393
2174 JGI25157J39369_1000738
2175 JGI25152J39213_1003706
2176 JGI25159J45721_1000508
2177 JGI25151J46595_10000585
2178 JGI25151J46595_10001084
2179 JGI25151J46595_10036025
2180 JGI25165J46597_1000147
2181 JGI25165J46597_1000630
2182 JGI25153J46596_10000428
2183 JGI25153J46596_10001318
2184 JGI25153J46596_10004290
2185 JGI25153J46596_10017933
2186 JGI25153J46596_10026971
2187 JGI25160J50197_1000015
2188 JGI25160J50197_1000216
2189 JGI25160J50197_1000438
2190 JGI25160J50197_1000463
2191 JGI25160J50197_1001146
2192 JGI25160J50197_1001518
2193 JGI25160J50197_1002737
2194 JGI25160J50197_1005355
2195 JGI25161J50226_1000005
2196 JGI25161J50226_1000120
2197 JGI25161J50226_1000412
2198 JGI25161J50226_1005409
2199 Ga0055542_1000252
2200 Ga0055526_1000594
2201 Ga0055526_1001753
2202 Ga0055526_1002151
2203 Ga0055524_1011640
2204 Ga0055524_1019832
2205 Ga0055524_1021731
2206 Ga0055536_1002870
2207 Ga0055536_1013021
2208 Ga0055528_1000693
2209 Ga0055528_1001185
2210 Ga0055528_1005562
2211 Ga0055530_10011385
2212 Ga0055530_10012693
2213 Ga0055540_1001134
2214 Ga0055540_1002011
2215 Ga0055540_1002353
2216 Ga0055540_1014218
2217 Ga0055531_10002835
2218 Ga0055531_10007059
2219 Ga0055531_10007361
2220 Ga0058692_1000689
2221 Ga0055543_1000012
2222 Ga0055543_1000155
2223 Ga0055543_1000301
2224 Ga0055543_1000631
2225 Ga0055543_1002832
2226 Ga0065165_1000125
2227 Ga0065165_1000717
2228 Ga0065165_1000780
2229 Ga0065165_1000826
2230 Ga0065165_1001465
2231 Ga0065165_1003182
2232 Ga0065165_1013609
2233 Ga0065712_10003725
2234 Ga0065712_10070614
2235 Ga0065712_10111484
2236 Ga0065715_10093037
2237 Ga0070658_10205856
2238 Ga0070676_10000784
2239 Ga0070683_100000114
2240 Ga0070683_100057598
2241 Ga0070690_100000064
2242 Ga0070690_100022010
2243 Ga0070670_100002373
2244 Ga0070677_10000193
2245 Ga0070677_10022088
2246 Ga0068869_100000020
2247 Ga0068869_100006431
2248 Ga0070666_10030214
2249 Ga0070680_100000242
2250 Ga0070682_100000224
2251 Ga0068868_100001773
2252 Ga0068868_100009208
2253 Ga0068868_100186489
2254 Ga0070660_100000123
2255 Ga0070660_100084487
2256 Ga0070689_100000685
2257 Ga0070689_100076641
2258 Ga0070689_100153949
2259 Ga0070691_10013336
2260 Ga0070687_100000351
2261 Ga0070687_100039459
2262 Ga0070661_100026596
2263 Ga0070661_100046186
2264 Ga0070661_100111987
2265 Ga0070692_10000108
2266 Ga0070668_100003586
2267 Ga0070668_100021775
2268 Ga0070668_100180266
2269 Ga0070669_100000176
2270 Ga0070669_100062083
2271 Ga0070675_100000259
2272 Ga0070675_100099529
2273 Ga0070675_100193875
2274 Ga0070671_100004849
2275 Ga0070671_100006467
2276 Ga0070671_100098198
2277 Ga0070671_100129759
2278 Ga0070671_100153294
2279 Ga0070674_100000099
2280 Ga0070674_100026259
2281 Ga0070674_100184190
2282 Ga0070673_100000042
2283 Ga0070673_100084549
2284 Ga0070673_100112291
2285 Ga0070688_100000329
2286 Ga0070688_100074173
2287 Ga0070659_100000348
2288 Ga0070667_100001075
2289 Ga0070667_100019257
2290 Ga0070667_100042027
2291 Ga0070703_10000878
2292 Ga0070709_10032295
2293 Ga0070709_10129479
2294 Ga0070714_100152101
2295 Ga0070713_100030475
2296 Ga0070713_100183785
2297 Ga0070710_10024016
2298 Ga0070710_10083034
2299 Ga0070701_10000025
2300 Ga0070711_100032827
2301 Ga0070705_100003281
2302 Ga0070705_100170695
2303 Ga0070694_100003777
2304 Ga0070694_100100151
2305 Ga0070708_100257647
2306 Ga0070663_100000064
2307 Ga0070663_100113712
2308 Ga0070678_100002536
2309 Ga0070662_100073373
2310 Ga0070662_100303483
2311 Ga0070681_10000435
2312 Ga0070681_10182879
2313 Ga0070681_10236072
2314 Ga0068867_100005677
2315 Ga0068867_100024391
2316 Ga0068867_100027110
2317 Ga0068867_100067298
2318 Ga0068867_100190588
2319 Ga0070706_100197584
2320 Ga0070698_100011265
2321 Ga0070699_100202435
2322 Ga0070684_100001610
2323 Ga0070684_100027140
2324 Ga0070697_100094045
2325 Ga0068853_100002463
2326 Ga0068853_100039010
2327 Ga0068853_100195647
2328 Ga0068853_100323306
2329 Ga0070672_100000011
2330 Ga0070672_100118231
2331 Ga0070672_100134004
2332 Ga0070686_100000076
2333 Ga0070686_100087073
2334 Ga0070695_100053966
2335 Ga0070696_100052443
2336 Ga0070696_100056200
2337 Ga0070693_100004777
2338 Ga0070665_100002816
2339 Ga0070665_100003012
2340 Ga0070665_100016716
2341 Ga0070665_100037641
2342 Ga0070665_100289398
2343 Ga0070665_100424974
2344 Ga0068855_100049447
2345 Ga0068855_100061125
2346 Ga0068855_100110372
2347 Ga0070664_100000112
2348 Ga0068857_100000023
2349 Ga0068857_100024933
2350 Ga0068857_100031521
2351 Ga0068854_100066891
2352 Ga0068854_100178454
2353 Ga0068856_100000099
2354 Ga0068856_100006276
2355 Ga0068856_100014002
2356 Ga0068856_100095048
2357 Ga0068856_100118811
2358 Ga0070702_100000005
2359 Ga0068852_100002886
2360 Ga0068852_100014911
2361 Ga0068859_100000503
2362 Ga0068859_100128696
2363 Ga0068859_100425277
2364 Ga0068864_100000112
2365 Ga0068864_100006199
2366 Ga0068864_100029277
2367 Ga0068866_10000977
2368 Ga0068866_10201434
2369 Ga0068861_100002096
2370 Ga0068870_10000021
2371 Ga0068863_100000227
2372 Ga0068863_100100507
2373 Ga0068858_100001279
2374 Ga0068858_100004153
2375 Ga0068858_100032557
2376 Ga0068858_100367623
2377 Ga0068860_100315040
2378 Ga0068862_100001866
2379 Ga0068862_100108483
2380 Ga0081455_10004237
2381 Ga0081455_10057110
2382 Ga0081538_10019358
2383 Ga0081540_1056049
2384 Ga0081539_10001300
2385 Ga0081539_10029652
2386 Ga0081539_10046429
2387 Ga0070717_10102440
2388 Ga0070717_10130840
2389 Ga0075365_10001809
2390 Ga0075365_10002327
2391 Ga0075365_10005519
2392 Ga0075365_10008458
2393 Ga0075365_10016973
2394 Ga0075365_10018202
2395 Ga0075365_10043121
2396 Ga0075365_10054915
2397 Ga0075365_10067884
2398 Ga0075365_10086187
2399 Ga0075365_10097891
2400 Ga0075365_10137785
2401 Ga0075365_10198465
2402 Ga0075368_10000391
2403 Ga0075368_10001480
2404 Ga0075363_100004780
2405 Ga0075363_100011783
2406 Ga0075363_100026888
2407 Ga0075364_10000060
2408 Ga0075364_10016981
2409 Ga0075364_10022672
2410 Ga0070715_10014553
2411 Ga0070712_100231222
2412 Ga0075362_10003906
2413 Ga0075362_10058503
2414 Ga0075367_10014606
2415 Ga0075367_10021848
2416 Ga0075367_10031807
2417 Ga0075367_10079464
2418 Ga0075369_10000420
2419 Ga0075369_10009712
2420 Ga0075369_10024616
2421 Ga0075369_10037369
2422 Ga0075369_10109517
2423 Ga0075366_10005612
2424 Ga0075366_10030387
2425 Ga0075366_10031004
2426 Ga0075366_10044168
2427 Ga0075366_10084443
2428 Ga0075366_10142134
2429 Ga0097621_100000115
2430 Ga0097621_100031095
2431 Ga0097621_100052758
2432 Ga0075370_10019433
2433 Ga0075370_10020715
2434 Ga0075370_10049519
2435 Ga0075370_10055381
2436 Ga0075370_10058432
2437 Ga0075370_10062341
2438 Ga0075370_10072847
2439 Ga0068871_100000064
2440 Ga0068871_100031695
2441 Ga0068871_100082934
2442 Ga0068871_100183985
2443 Ga0075428_100001096
2444 Ga0075428_100019624
2445 Ga0075428_100140962
2446 Ga0075430_100016424
2447 Ga0075430_100328763
2448 Ga0075431_100002284
2449 Ga0075431_100006045
2450 Ga0075431_100057368
2451 Ga0075433_10286206
2452 Ga0075434_100011648
2453 Ga0075429_100016045
2454 Ga0075429_100040905
2455 Ga0068865_100000088
2456 Ga0068865_100107695
2457 Ga0068865_100141135
2458 Ga0097620_100000503
2459 Ga0097620_100128696
2460 Ga0097620_100168187
2461 Ga0097620_100425243
2462 Ga0099825_1026228
2463 Ga0099824_1015882
2464 Ga0099823_1016643
2465 Ga0079104_1005313
2466 Ga0079104_1029960
2467 Ga0099826_10001162
2468 Ga0099826_10055826
2469 Ga0075435_100018640
2470 Ga0105244_10027369
2471 Ga0105244_10041442
2472 Ga0105240_10000032
2473 Ga0105240_10087091
2474 Ga0111539_10000835
2475 Ga0111539_10001836
2476 Ga0111539_10002131
2477 Ga0111539_10043003
2478 Ga0111539_10240090
2479 Ga0111539_10344038
2480 Ga0105245_10000556
2481 Ga0105245_10001381
2482 Ga0105245_10042958
2483 Ga0105247_10000474
2484 Ga0105247_10008685
2485 Ga0105247_10010587
2486 Ga0105247_10036214
2487 Ga0105247_10140550
2488 Ga0114129_10005100
2489 Ga0114129_10023557
2490 Ga0114129_10041080
2491 Ga0114129_10116705
2492 Ga0114129_10135026
2493 Ga0105243_10002817
2494 Ga0105243_10003276
2495 Ga0105243_10059291
2496 Ga0105243_10111788
2497 Ga0105243_10129972
2498 Ga0105241_10013940
2499 Ga0105242_10006548
2500 Ga0105242_10010176
2501 Ga0105242_10136056
2502 Ga0105248_10000500
2503 Ga0105248_10000873
2504 Ga0105248_10005607
2505 Ga0105248_10053120
2506 Ga0105248_10064008
2507 Ga0105248_10376789
2508 Ga0105237_10000754
2509 Ga0105237_10012593
2510 Ga0105237_10053311
2511 Ga0105238_10063446
2512 Ga0105238_10076419
2513 Ga0105238_10079722
2514 Ga0105238_10095640
2515 Ga0105249_10002423
2516 Ga0123341_1003307
2517 Ga0123342_1012832
2518 Ga0123342_1023961
2519 Ga0099796_10029332
2520 Ga0105239_10003796
2521 Ga0105239_10295074
2522 Ga0105246_10000016
2523 Ga0105246_10000220
2524 Ga0105246_10058075
2525 Ga0157373_10001237
2526 Ga0157373_10042861
2527 Ga0157373_10132801
2528 Ga0157373_10168919
2529 Ga0157371_10000004
2530 Ga0157371_10015495
2531 Ga0157370_10003636
2532 Ga0157370_10234385
2533 Ga0157369_10073358
2534 Ga0157369_10102912
2535 Ga0171463_1003
2536 Ga0157374_10000092
2537 Ga0157374_10000524
2538 Ga0157374_10010385
2539 Ga0157374_10030091
2540 Ga0157374_10202455
2541 Ga0157378_10000591
2542 Ga0157378_10023177
2543 Ga0157378_10271419
2544 Ga0163162_10023568
2545 Ga0163162_10075105
2546 Ga0163162_10115386
2547 Ga0163162_10375085
2548 Ga0163162_10380472
2549 Ga0157372_10006371
2550 Ga0157372_10163959
2551 Ga0157372_10314045
2552 Ga0157372_10395714
2553 Ga0157375_10000124
2554 Ga0157375_10001668
2555 Ga0157375_10006444
2556 Ga0157375_10025162
2557 Ga0163163_10003404
2558 Ga0163163_10058876
2559 Ga0157380_10001027
2560 Ga0157380_10004466
2561 Ga0157380_10102839
2562 Ga0157380_10125337
2563 Ga0157380_10131629
2564 Ga0157380_10205409
2565 Ga0157380_10363411
2566 Ga0182008_10051736
2567 Ga0157377_10000121
2568 Ga0157379_10000422
2569 Ga0157379_10040122
2570 Ga0157379_10077910
2571 Ga0157376_10000034
2572 Ga0157376_10000285
2573 Ga0157376_10409954
2574 Ga0182006_1015445
2575 Ga0182007_10062860
2576 Ga0182005_1004008
2577 Ga0183363_1047
2578 Ga0163161_10000801
2579 Ga0163161_10107639
2580 Ga0214544_1001682
2581 Ga0214542_1001614
2582 Ga0214542_1028780
2583 Ga0214543_1000078
2584 Ga0214543_1001395
2585 Ga0228711_1000016
2586 Ga0228710_1000013
2587 Ga0209436_100041
2588 Ga0209436_101133
2589 Ga0209437_100075
2590 Ga0207425_1008603
2591 Ga0209026_1000050
2592 Ga0209148_1000032
2593 Ga0209148_1000289
2594 Ga0209759_1015261
2595 Ga0209129_1001627
2596 Ga0209129_1003249
2597 Ga0209129_1006654
2598 Ga0209233_1000034
2599 Ga0209233_1000056
2600 Ga0209233_1002652
2601 Ga0207666_1000004
2602 Ga0209455_1000190
2603 Ga0209455_1001308
2604 Ga0209673_1000060
2605 Ga0209673_1004110
2606 Ga0209673_1011460
2607 Ga0209673_1017145
2608 Ga0209130_1000018
2609 Ga0209130_1000029
2610 Ga0209130_1000030
2611 Ga0207673_1000326
2612 Ga0209676_1000100
2613 Ga0209676_1002997
2614 Ga0209676_1031133
2615 Ga0209676_1038379
2616 Ga0209025_1000060
2617 Ga0209025_1000959
2618 Ga0209025_1001184
2619 Ga0209025_1023046
2620 Ga0209564_1000278
2621 Ga0209564_1000281
2622 Ga0209564_1000937
2623 Ga0209564_1001052
2624 Ga0209564_1004532
2625 Ga0209564_1017395
2626 Ga0209564_1033434
2627 Ga0209758_1000160
2628 Ga0209758_1000219
2629 Ga0209758_1000383
2630 Ga0209758_1000637
2631 Ga0209758_1000677
2632 Ga0209758_1001377
2633 Ga0209758_1009047
2634 Ga0209758_1009123
2635 Ga0209758_1012378
2636 Ga0209050_1006153
2637 Ga0209050_1009722
2638 Ga0209050_1019463
2639 Ga0209256_1000042
2640 Ga0209256_1001295
2641 Ga0209256_1002288
2642 Ga0209256_1002941
2643 Ga0209256_1003739
2644 Ga0209256_1009106
2645 Ga0209256_1024299
2646 Ga0207426_1000044
2647 Ga0207426_1000047
2648 Ga0207426_1000074
2649 Ga0207426_1000268
2650 Ga0207426_1000379
2651 Ga0207426_1000465
2652 Ga0207426_1003500
2653 Ga0207426_1016971
2654 Ga0209051_1000236
2655 Ga0209051_1003666
2656 Ga0209051_1004392
2657 Ga0209051_1008481
2658 Ga0209051_1008829
2659 Ga0209051_1012789
2660 Ga0209257_1000650
2661 Ga0209257_1002011
2662 Ga0209257_1002210
2663 Ga0209257_1005286
2664 Ga0209257_1029619
2665 Ga0207653_10001908
2666 Ga0207682_10000016
2667 Ga0207692_10013299
2668 Ga0207642_10000976
2669 Ga0207642_10078028
2670 Ga0207710_10001396
2671 Ga0207710_10001528
2672 Ga0207710_10003942
2673 Ga0207710_10009728
2674 Ga0207710_10026449
2675 Ga0207688_10002050
2676 Ga0207688_10064625
2677 Ga0207680_10002179
2678 Ga0207680_10059119
2679 Ga0207680_10135217
2680 Ga0207680_10219750
2681 Ga0207647_10003692
2682 Ga0207647_10059232
2683 Ga0207685_10083900
2684 Ga0207645_10001535
2685 Ga0207643_10000075
2686 Ga0207643_10085289
2687 Ga0207684_10099451
2688 Ga0207654_10006201
2689 Ga0207707_10003863
2690 Ga0207707_10153787
2691 Ga0207695_10000024
2692 Ga0207695_10009034
2693 Ga0207695_10146083
2694 Ga0207695_10196807
2695 Ga0207671_10000718
2696 Ga0207671_10009593
2697 Ga0207671_10116073
2698 Ga0207693_10046639
2699 Ga0207663_10112324
2700 Ga0207660_10000023
2701 Ga0207660_10103923
2702 Ga0207662_10001681
2703 Ga0207662_10029205
2704 Ga0207657_10001755
2705 Ga0207657_10073027
2706 Ga0207657_10114168
2707 Ga0207657_10217966
2708 Ga0207649_10000122
2709 Ga0207649_10015177
2710 Ga0207652_10001146
2711 Ga0207681_10000240
2712 Ga0207681_10049729
2713 Ga0207681_10076472
2714 Ga0207681_10195542
2715 Ga0207694_10020011
2716 Ga0207650_10012941
2717 Ga0207650_10088443
2718 Ga0207659_10000017
2719 Ga0207659_10085461
2720 Ga0207659_10094800
2721 Ga0207659_10096989
2722 Ga0207687_10000077
2723 Ga0207687_10001492
2724 Ga0207687_10211238
2725 Ga0207700_10046442
2726 Ga0207700_10148027
2727 Ga0207664_10045678
2728 Ga0207644_10001298
2729 Ga0207644_10003716
2730 Ga0207644_10027349
2731 Ga0207644_10106786
2732 Ga0207644_10263806
2733 Ga0207644_10371701
2734 Ga0207690_10000151
2735 Ga0207706_10005479
2736 Ga0207706_10010327
2737 Ga0207706_10354838
2738 Ga0207706_10354839
2739 Ga0207686_10000294
2740 Ga0207686_10017811
2741 Ga0207686_10031259
2742 Ga0207709_10000126
2743 Ga0207709_10045603
2744 Ga0207709_10060946
2745 Ga0207709_10090300
2746 Ga0207709_10097350
2747 Ga0207709_10114962
2748 Ga0207670_10000086
2749 Ga0207670_10080693
2750 Ga0207669_10000188
2751 Ga0207669_10014695
2752 Ga0207669_10026710
2753 Ga0207669_10156474
2754 Ga0207669_10207167
2755 Ga0207704_10001793
2756 Ga0207665_10268951
2757 Ga0207691_10007063
2758 Ga0207691_10016974
2759 Ga0207691_10183906
2760 Ga0207711_10004478
2761 Ga0207711_10005965
2762 Ga0207711_10039484
2763 Ga0207711_10316023
2764 Ga0207689_10000140
2765 Ga0207689_10047161
2766 Ga0207689_10109566
2767 Ga0207661_10000074
2768 Ga0207661_10130409
2769 Ga0207679_10000031
2770 Ga0207679_10031984
2771 Ga0207679_10221628
2772 Ga0207667_10013359
2773 Ga0207667_10045333
2774 Ga0207667_10232803
2775 Ga0207651_10000044
2776 Ga0207651_10061639
2777 Ga0207712_10000279
2778 Ga0207712_10038823
2779 Ga0207668_10000687
2780 Ga0207668_10092184
2781 Ga0207640_10000105
2782 Ga0207640_10000216
2783 Ga0207658_10001907
2784 Ga0207658_10039014
2785 Ga0207677_10000318
2786 Ga0207703_10000418
2787 Ga0207703_10006276
2788 Ga0207703_10035176
2789 Ga0207703_10374259
2790 Ga0207639_10007495
2791 Ga0207639_10246028
2792 Ga0207639_10264405
2793 Ga0207639_10278625
2794 Ga0207678_10005986
2795 Ga0207678_10007246
2796 Ga0207678_10008184
2797 Ga0207678_10014870
2798 Ga0207678_10033040
2799 Ga0207678_10087729
2800 Ga0207708_10004013
2801 Ga0207702_10000753
2802 Ga0207702_10081034
2803 Ga0207702_10159139
2804 Ga0207641_10001634
2805 Ga0207641_10068519
2806 Ga0207641_10423619
2807 Ga0207648_10007377
2808 Ga0207648_10056668
2809 Ga0207648_10161442
2810 Ga0207676_10000133
2811 Ga0207676_10015457
2812 Ga0207676_10078003
2813 Ga0207674_10001514
2814 Ga0207674_10037910
2815 Ga0207674_10066374
2816 Ga0207674_10083784
2817 Ga0207674_10428761
2818 Ga0207675_100011837
2819 Ga0207675_100152444
2820 Ga0207675_100252407
2821 Ga0207683_10000004
2822 Ga0207683_10003094
2823 Ga0207683_10035832
2824 Ga0207698_10009206
2825 Ga0209281_1000043
2826 Ga0209281_1000221
2827 Ga0209281_1000453
2828 Ga0209389_1000008
2829 Ga0209389_1000081
2830 Ga0209371_1000009
2831 Ga0209371_1000732
2832 Ga0209371_1001249
2833 Ga0209371_1002043
2834 Ga0209589_1000091
2835 Ga0209489_100096
2836 Ga0209489_103917
2837 Ga0209700_100036
2838 Ga0209282_1000041
2839 Ga0209282_1000179
2840 Ga0209282_1070112
2841 Ga0209998_10000939
2842 Ga0209813_10001432
2843 Ga0209813_10006967
2844 Ga0209974_10005431
2845 Ga0207428_10000218
2846 Ga0207428_10002942
2847 Ga0268266_10001063
2848 Ga0268266_10005424
2849 Ga0268266_10120870
2850 Ga0268266_10122747
2851 Ga0268265_10000194
2852 Ga0268265_10168309
2853 Ga0268264_10000393
2854 Ga0268264_10089016
2855 Ga0307515_10000023
2856 Ga0268256_1000010
2857 Ga0268256_1000660
2858 Ga0268256_1012387
2859 Ga0265320_10001570
2860 Ga0265325_10020399
2861 Ga0265340_10018115
2862 Ga0265316_10226754
2863 Ga0307513_10003030
2864 Ga0307513_10117119
2865 Ga0307508_10000235
2866 Ga0265314_10015333
2867 Ga0265342_10019097
2868 Ga0316578_10012241
2869 Ga0307516_10076539
2870 Ga0307412_10004217
2871 Ga0307412_10051473
2872 Ga0307412_10096618
2873 Ga0315914_1000030
2874 Ga0307409_100079130
2875 Ga0307414_10335036
2876 Ga0307415_100162107
2877 Ga0307510_10051197
2878 Ga0307510_10166871
2879 Ga0315913_1000017
2880 Ga0315915_1000017
2881 Ga0373926_0044621
2882 Ga0373951_0006498
2883 Ga0373952_0005697
2884 Ga0373932_0006740
2885 Ga0373939_0001147
2886 Ga0373941_0004127
2887 Ga0373945_0023874
2888 Ga0373960_0002301
2889 Ga0373942_0004747
2890 Ga0373961_0006340
2891 Ga0373962_0006222
2892 Ga0316574_0000447
2893 Ga0373931_0000034
2894 Ga0373931_0106047
2895 Ga0373935_0044469
2896 Ga0373927_0198628
2897 Ga0373947_0080704
2898 Ga0373947_0094196
2899 Ga0373925_0078900
2900 Ga0395899_0005212
2901 Ga0395899_0014217
2902 Ga0395900_0006809
2903 Ga0395900_0009382
2904 Ga0395900_0028204
2905 Ga0395900_0061357
2906 Ga0395900_0064342
2907 Ga0395900_0119882
2908 Ga0395898_0031310
2909 Ga0395898_0079159
2910 Ga0395905_0012635
2911 Ga0395905_0044671
2912 Ga0395905_0185194
2913 Ga0395905_0245905
2914 Ga0395901_0014741
2915 Ga0395901_0019762
2916 Ga0395901_0034031
2917 Ga0395901_0048672
2918 Ga0395901_0107512
2919 Ga0395901_0244469
2920 Ga0436365_0226566
2921 Ga0436360_0428998
2922 Ga0439439_0029670
2923 Ga0439465_0010381
2924 Ga0451840_11510
2925 Ga0451846_53461
2926 Ga0451849_0343204
2927 Ga0451854_38034
2928 Ga0452268_28007
2929 Ga0466972_0000142
2930 Ga0466965_0041923
2931 Ga0466966_0000743
2932 Ga0466961_0000013
2933 Ga0451576_0000108
2934 Ga0466967_0223783
2935 Ga0495617_038070
2936 Ga0495592_0026735
2937 Ga0495592_0035379
2938 Ga0495629_0010621
2939 Ga0495638_0000398
2940 Ga0495638_0000984
2941 Ga0495651_0001455
2942 Ga0495651_0041355
2943 Ga0495653_0054937
2944 Ga0495580_0038736
2945 Ga0495605_0027289
2946 Ga0495605_0061921
2947 Ga0495639_0090084
2948 Ga0495662_0023492
2949 Ga0495584_0038495
2950 Ga0495584_0066931
2951 Ga0495585_0008429
2952 Ga0495594_0053341
2953 Ga0495594_0189411
2954 Ga0495596_0031129
2955 Ga0495607_0031344
2956 Ga0495607_0120054
2957 Ga0495583_0033212
2958 Ga0495583_0043839
2959 Ga0495608_0060068
2960 Ga0495608_0064835
2961 Ga0495610_0005846
2962 Ga0495610_0033707
2963 Ga0495616_0019931
2964 Ga0495618_0090406
2965 Ga0495620_0005040
2966 Ga0495620_0050099
2967 Ga0495628_0012367
2968 Ga0495628_0064312
2969 Ga0495631_0002044
2970 Ga0495632_0014778
2971 Ga0495632_0025306
2972 Ga0495643_0034038
2973 Ga0495648_0023485
2974 Ga0495654_0012329
2975 Ga0495654_0042125
2976 Ga0495665_0093167
2977 Ga0495640_0081289
2978 Ga0495587_0054702
2979 Ga0495598_0010805
2980 Ga0495609_0035152
2981 Ga0495597_0034925
2982 Ga0495645_0006446
2983 Ga0495667_0178930
2984 Ga0495668_0006092
2985 Ga0495668_0093064
2986 Ga0495668_0151443
2987 Ga0495625_0005382
2988 Ga0495625_0006283
2989 Ga0495625_0132238
2990 Ga0495635_0008179
2991 Ga0495659_0009205
2992 Ga0495661_0052588
2993 Ga0495588_0001146
2994 Ga0495588_0085757
2995 Ga0495657_0010464
2996 Ga0495599_0009888
2997 Ga0495623_0006513
2998 Ga0495646_0019580
2999 Ga0495646_0055602
3000 Ga0495647_0025057
3001 Ga0495669_0003796
3002 Ga0495624_0069333
3003 Ga0495670_0016624
3004 Ga0495649_0130167
3005 Ga0495600_0005780
3006 Ga0495660_0036980
3007 Ga0495660_0049199
3008 Ga0495660_0060603
3009 Ga0495581_0060439
3010 Ga0495604_0000939
3011 Ga0495604_0004637
3012 Ga0495604_0024899
3013 Ga0495636_0040488
3014 Ga0495636_0066614
3015 Ga0495674_0008253
3016 Ga0495674_0017976
3017 Ga0495672_0118403
3018 Ga0495676_0049415
3019 Ga0495676_0080633
3020 Ga0495680_0008716
3021 Ga0495683_0044834
3022 Ga0495683_0112830
3023 Ga0495687_022010
3024 Ga0495685_048100
3025 Ga0495681_0004119
3026 Ga0495681_0068694
3027 Ga0495684_0054666
3028 Ga0495684_0064339
3029 Ga0495686_0014003
3030 Ga0495686_0062679
3031 Ga0495602_0022141
3032 Ga0495602_0153059
3033 Ga0495615_0005003
3034 Ga0496100_0000050
3035 Ga0496100_0000310
3036 Ga0496100_0042930
3037 Ga0496101_0000121
3038 Ga0496101_0010077
3039 Ga0496101_0051291
3040 Ga0496101_0124102
3041 Ga0496102_0000679
3042 Ga0496102_0002728
3043 Ga0496102_0010100
3044 Ga0496102_0090375
3045 Ga0496102_0224187
3046 Ga0496102_0269753
3047 Ga0496102_0471420
3048 Ga0496103_0000175
3049 Ga0496103_0000777
3050 Ga0496103_0137749
3051 Ga0496104_0000500
3052 Ga0496104_0000588
3053 Ga0496104_0011318
3054 Ga0496104_0014050
3055 Ga0496104_0020089
3056 Ga0496104_0021190
3057 Ga0496104_0182554
3058 Ga0496105_0002408
3059 Ga0496105_0002551
3060 Ga0496105_0003077
3061 Ga0496105_0006243
3062 Ga0496105_0009375
3063 Ga0496105_0009884
3064 Ga0496105_0016466
3065 Ga0496105_0045775
3066 Ga0496106_0000133
3067 Ga0496106_0000323
3068 Ga0496106_0043242
3069 Ga0496106_0055832
3070 Ga0496106_0186856
3071 Ga0496107_0000237
3072 Ga0496107_0006942
3073 Ga0496107_0008677
3074 Ga0496107_0013131
3075 Ga0496107_0148941
3076 Ga0496107_0162931
3077 Ga0496108_0001888
3078 Ga0496108_0024837
3079 Ga0496108_0038602
3080 Ga0496108_0057474
3081 Ga0496109_0000493
3082 Ga0496109_0000952
3083 Ga0496109_0001602
3084 Ga0496109_0041234
3085 Ga0496109_0049410
3086 Ga0496109_0190810
3087 Ga0496109_0192867
3088 Ga0496110_0003720
3089 Ga0496110_0003830
3090 Ga0496110_0014142
3091 Ga0496110_0064390
3092 Ga0496110_0152174
3093 Ga0496111_0001343
3094 Ga0496111_0009718
3095 Ga0496111_0066787
3096 Ga0496111_0184353
3097 Ga0496112_0011990
3098 Ga0496112_0033461
3099 Ga0496112_0042530
3100 Ga0496112_0047993
3101 Ga0496113_0000869
3102 Ga0496113_0012388
3103 Ga0496113_0032115
3104 Ga0496113_0090154
3105 Ga0496113_0124584
3106 Ga0496114_0002721
3107 Ga0496114_0026653
3108 Ga0496114_0137983
3109 Ga0496115_0001322
3110 Ga0496115_0001562
3111 Ga0496115_0009975
3112 Ga0496115_0041219
3113 Ga0496115_0064682
3114 Ga0496115_0146054
3115 Ga0496116_0000026
3116 Ga0496116_0051378
3117 Ga0496116_0060520
3118 Ga0496116_0076919
3119 Ga0496116_0082859
3120 Ga0496117_0000002
3121 Ga0496117_0028675
3122 Ga0496117_0083200
3123 Ga0496117_0110951
3124 Ga0496117_0162863
3125 Ga0496118_0002844
3126 Ga0496118_0014526
3127 Ga0496118_0016840
3128 Ga0496118_0022202
3129 Ga0496118_0048224
3130 Ga0496119_0010067
3131 Ga0496119_0014918
3132 Ga0496119_0021542
3133 Ga0496120_0000034
3134 Ga0496120_0000455
3135 Ga0496120_0025451
3136 Ga0496120_0077220
3137 Ga0496120_0152319
3138 Ga0496121_0000220
3139 Ga0496121_0071800
3140 Ga0496121_0080858
3141 Ga0496122_0000001
3142 Ga0496122_0035793
3143 Ga0496122_0059858
3144 Ga0496123_0000001
3145 Ga0496123_0014463
3146 Ga0496123_0045453
3147 Ga0496123_0142329
3148 Ga0496124_0000083
3149 Ga0496124_0002875
3150 Ga0496124_0013228
3151 Ga0496124_0102824
3152 Ga0496125_0000001
3153 Ga0496125_0009589
3154 Ga0496125_0029586
3155 Ga0496125_0064016
3156 Ga0496126_0000069
3157 Ga0496126_0007323
3158 Ga0496126_0057065
3159 Ga0496126_0188432
3160 Ga0496126_0262819
3161 Ga0496126_0378317
3162 Ga0495678_042185
3163 Ga0495682_0045915
3164 Ga0501031_0000006
3165 Ga0501032_0000016
3166 Ga0501032_0059787
3167 Ga0501033_0000101
3168 Ga0501033_0061814
3169 Ga0501034_0000168
3170 Ga0501034_0010519
3171 Ga0501034_0030869
3172 Ga0501034_0137323
3173 Ga0501036_0000019
3174 Ga0501036_0099560
3175 Ga0501037_0000013
3176 Ga0501037_0000895
3177 Ga0501037_0143061
3178 Ga0501038_0000012
3179 Ga0501038_0011999
3180 Ga0501038_0165827
3181 Ga0501039_0000019
3182 Ga0501039_0079324
3183 Ga0501040_0148787
3184 Ga0501042_0019008
3185 Ga0501043_0000045
3186 Ga0501043_0000209
3187 Ga0501043_0048636
3188 Ga0501043_0132686
3189 Ga0501047_0003738
3190 Ga0501047_0023848
3191 Ga0501047_0234199
3192 Ga0501069_0000007
3193 Ga0501070_0000758
3194 Ga0501070_0003344
3195 Ga0501070_0021164
3196 Ga0501070_0059883
3197 Ga0501070_0084105
3198 Ga0501070_0131515
3199 Ga0501071_0013377
3200 Ga0501071_0091102
3201 Ga0501072_0036236
3202 Ga0501074_0000047
3203 Ga0501074_0010115
3204 Ga0501074_0047884
3205 Ga0501076_0006762
3206 Ga0501080_0005487
3207 Ga0501080_0009780
3208 Ga0501080_0203467
3209 Ga0501083_0000029
3210 Ga0501280_002770
3211 Ga0501035_0000060
3212 Ga0501035_0000081
3213 Ga0501035_0004420
3214 Ga0501035_0029235
3215 Ga0501035_0044246
3216 Ga0501035_0092164
3217 Ga0501044_0000009
3218 Ga0501044_0000029
3219 Ga0501044_0052912
3220 Ga0501044_0252875
3221 Ga0501045_0006727
3222 nmdc:mga03683_1100_c1
3223 nmdc:mga03683_409_c1
3224 nmdc:mga03683_83526_c1
3225 nmdc:mga03n38_12016_c1
3226 nmdc:mga00v17_106281_c1
3227 nmdc:mga00v17_108403_c1
3228 nmdc:mga00v17_130499_c1
3229 nmdc:mga00v17_180316_c1
3230 nmdc:mga00v17_26_c1
3231 nmdc:mga00v17_30112_c1
3232 nmdc:mga00v17_47_c1
3233 nmdc:mga0yw44_11106_c1
3234 nmdc:mga0yw44_165685_c1
3235 nmdc:mga0yw44_18361_c1
3236 nmdc:mga0yw44_185747_c1
3237 nmdc:mga0yw44_31900_c1
3238 nmdc:mga0yw44_3820_c1
3239 nmdc:mga0yw44_3977_c1
3240 nmdc:mga0yw44_81306_c1
3241 nmdc:mga0yw44_831_c1
3242 nmdc:mga0yw44_8596_c1
3243 nmdc:mga0k408_143738_c1
3244 nmdc:mga0k408_40451_c1
3245 nmdc:mga0k408_7428_c1
3246 nmdc:mga0k408_9138_c1
3247 nmdc:mga06z11_114704_c1
3248 nmdc:mga06z11_16404_c1
3249 nmdc:mga06z11_176767_c1
3250 nmdc:mga06z11_18791_c1
3251 nmdc:mga06z11_3255_c1
3252 nmdc:mga06z11_91170_c1
3253 nmdc:mga06z11_92439_c1
3254 nmdc:mga04h51_23837_c1
3255 nmdc:mga04h51_32896_c1
3256 nmdc:mga04h51_4064_c1
3257 nmdc:mga07m45_108881_c1
3258 nmdc:mga07m45_23668_c2
3259 nmdc:mga07m45_30403_c1
3260 nmdc:mga07m45_3358_c1
3261 nmdc:mga07m45_36073_c1
3262 nmdc:mga07m45_50498_c1
3263 nmdc:mga07m45_61401_c1
3264 nmdc:mga07m45_64686_c1
3265 nmdc:mga07m45_91680_c1
3266 nmdc:mga05p37_41138_c1
3267 nmdc:mga05p37_83860_c1
3268 nmdc:mga05p37_94463_c1
3269 nmdc:mga09592_17221_c1
3270 nmdc:mga09592_76716_c1
3271 nmdc:mga0qj67_34351_c1
3272 nmdc:mga06r32_14671_c1
3273 nmdc:mga06r32_272496_c1
3274 nmdc:mga06r32_8869_c1
3275 nmdc:mga08y16_202134_c1
3276 nmdc:mga08y16_3032_c1
3277 nmdc:mga08y16_409700_c1
3278 nmdc:mga08y16_706_c1
3279 nmdc:mga0n895_151399_c1
3280 nmdc:mga0n895_2736_c1
3281 nmdc:mga0rr50_54810_c1
3282 nmdc:mga0a205_197_c1
3283 nmdc:mga0sz30_148_c1
3284 nmdc:mga0sz30_18723_c1
3285 nmdc:mga0sz30_57771_c1
3286 nmdc:mga0sz30_6454_c1
3287 Ga0495601_0013325
3288 Ga0495612_0003890
3289 Ga0500610_0025694
3290 Ga0500610_0072570
3291 Ga0495619_0001328
3292 Ga0495619_0013741
3293 Ga0500578_0060890
3294 Ga0500643_000015
3295 Ga0500643_012824
3296 Ga0500644_0040454
3297 Ga0500581_120407
3298 Ga0500566_0000082
3299 Ga0500641_0000376
3300 Ga0500641_0004622
3301 Ga0500641_0017367
3302 Ga0500641_0026306
3303 Ga0500650_0013072
3304 Ga0500556_0000002
3305 Ga0500557_000022
3306 Ga0500557_018021
3307 Ga0500562_032766
3308 Ga0500569_005635
3309 Ga0500569_029724
3310 Ga0500592_001501
3311 Ga0500594_0015572
3312 Ga0500642_0000016
3313 Ga0500642_0000166
3314 Ga0500658_0000625
3315 Ga0500659_0043180
3316 Ga0500559_0020582
3317 Ga0500568_0000035
3318 Ga0500568_0002154
3319 Ga0500568_0013231
3320 Ga0500568_0018845
3321 Ga0500577_0000373
3322 Ga0500577_0043761
3323 Ga0500588_0072814
3324 Ga0500604_0000742
3325 Ga0500604_0020569
3326 Ga0500616_0001686
3327 Ga0500616_0014259
3328 Ga0500622_0000668
3329 Ga0500622_0010502
3330 Ga0500624_001406
3331 Ga0500627_0035377
3332 Ga0500627_0039600
3333 Ga0500627_0052474
3334 Ga0500634_0004710
3335 Ga0500636_0000036
3336 Ga0500636_0003407
3337 Ga0500611_006845
3338 Ga0500625_006836
3339 Ga0500645_012516
3340 Ga0500645_028625
3341 Ga0500645_039163
3342 Ga0500609_003310
3343 Ga0500601_000258
3344 Ga0501084_0001734
3345 Ga0587090_004716
3346 Ga0501082_0000053
3347 Ga0501082_0007228
3348 Ga0501082_0360620
3349 Ga0530510_0041559
3350 2840769232
3351 2503198329
3352 2507508584
3353 2508542656
3354 2508691568
3355 2509079577
3356 2509111394
3357 2509114447
3358 2509368395
3359 2509375667
3360 2509447931
3361 2510134869
3362 2510303293
3363 2510314677
3364 2510896275
3365 2511137054
3366 2511174201
3367 2511390399
3368 2511401273
3369 2511501969
3370 2512533337
3371 2512934195
3372 2512962495
3373 2512971094
3374 2513572632
3375 2513580137
3376 2513582634
3377 2513604549
3378 2513609801
3379 2513615464
3380 2513623046
3381 2513631293
3382 2513640447
3383 2513645841
3384 2513710812
3385 2513872767
3386 2513881253
3387 2513902384
3388 2513984597
3389 2513997068
3390 2514007602
3391 2514011853
3392 2514022310
3393 2514037866
3394 2514587362
3395 2515113952
3396 2515608762
3397 2515628365
3398 2515636974
3399 2515643003
3400 2515656752
3401 2515743691
3402 2516209689
3403 2516893265
3404 2517037583
3405 2517077870
3406 2517096667
3407 2517102527
3408 2517106751
3409 2517410381
3410 2517570022
3411 2520377947
3412 2524443297
3413 2524448835
3414 2524460624
3415 2528854928
3416 2530646980
3417 2535519405
3418 2537877385
3419 2551675157
3420 2551680517
3421 2551688050
3422 2551691142
3423 2551693968
3424 2551713208
3425 2551745077
3426 2554246281
3427 2558867983
3428 2559293503
3429 2585166129
3430 2585202444
3431 2585273236
3432 2585278930
3433 2585325455
3434 2585393047
3435 2585402245
3436 2585529053
3437 2585530727
3438 2585540993
3439 2585554907
3440 2585559464
3441 2585822455
3442 2585839755
3443 2585902135
3444 2585905160
3445 2585998486
3446 2586003050
3447 2587979725
3448 2588520344
3449 2597810534
3450 2599331579
3451 2599604385
3452 2599935464
3453 2600193092
3454 2601609478
3455 2601746253
3456 2616295586
3457 2616305797
3458 2617349020
3459 2643772430
3460 2643803592
3461 2643838345
3462 2643857896
3463 2643920662
3464 2643983922
3465 2644050739
3466 2644067559
3467 2644107705
3468 2644133353
3469 2644148624
3470 2644156052
3471 2644205213
3472 2644210227
3473 2644298042
3474 2644309099
3475 2644332927
3476 2644375239
3477 2644418612
3478 2644451979
3479 2644483657
3480 2644491797
3481 2644501345
3482 2644519530
3483 2644545901
3484 2644615041
3485 2644653779
3486 2644656294
3487 2644676578
3488 2644690741
3489 2657681192
3490 2671115284
3491 2688595651
3492 2694628186
3493 2694640957
3494 2719387293
3495 2720493355
3496 2720614829
3497 2720621602
3498 2720632930
3499 2720776654
3500 2721400928
3501 2723028242
3502 2723561870
3503 2723568502
3504 2723572937
3505 2723848000
3506 2724039741
3507 2724091261
3508 2724105767
3509 2724111593
3510 2725945441
3511 2730109178
3512 2738800404
3513 2738948748
3514 2739035550
3515 2739309537
3516 2745076657
3517 2756674264
3518 2765469412
3519 2766065296
3520 2770200143
3521 2774868707
3522 2774871196
3523 2776261404
3524 2776264471
3525 2776270195
3526 2776285078
3527 2776916135
3528 2792581765
3529 2792620165
3530 2792626415
3531 2792639364
3532 2792746838
3533 2793062393
3534 2793293610
3535 2793313050
3536 2793327796
3537 2793333405
3538 2793353726
3539 2793359676
3540 2793369429
3541 2802719517
3542 2802726890
3543 2802732251
3544 2802739854
3545 2802745360
3546 2802752752
3547 2804752392
3548 2805915335
3549 2805929431
3550 2805935387
3551 2806044536
3552 2806052737
3553 2806059037
3554 2806068300
3555 2806074420
3556 2808986726
3557 2818238887
3558 2819244365
3559 2819556800
3560 2819612185
3561 2819639226
3562 2821123279
3563 2824605745
3564 2824614458
3565 2824623239
3566 2824633177
3567 2824640014
3568 2824649699
3569 2824657749
3570 2824667126
3571 2824677394
3572 2824685260
3573 2824693056
3574 2824700757
3575 2824711336
3576 2824722402
3577 2824732061
3578 2824758195
3579 2824768176
3580 2824779545
3581 2835314675
3582 2835315267
3583 2837683087
3584 2838019132
3585 2838031451
3586 2838051150
3587 2838063873
3588 2838073357
3589 2838079594
3590 2838123749
3591 2838677535
3592 2838684936
3593 2838691295
3594 2838699227
3595 2838703709
3596 2838712708
3597 2838716424
3598 2838719776
3599 2838727175
3600 2838735778
3601 2838739698
3602 2838748680
3603 2839998355
3604 2841736075
3605 2841844178
3606 2841846707
3607 2841853885
3608 2841860764
3609 2841868146
3610 2841948642
3611 2841949850
3612 2841958666
3613 2841966268
3614 2841975005
3615 2841983427
3616 2842039066
3617 2842047987
3618 2842082185
3619 2842113410
3620 2842123108
3621 2842127264
3622 2842132428
3623 2842143899
3624 2842151218
3625 2842152403
3626 2842162597
3627 2842169975
3628 2842172669
3629 2842176022
3630 2842185034
3631 2842189531
3632 2842198237
3633 2842208330
3634 2842213845
3635 2842224537
3636 2842235593
3637 2842241990
3638 2842249373
3639 2842256274
3640 2842263490
3641 2842266633
3642 2842275770
3643 2842281661
3644 2842296185
3645 2842302428
3646 2842308246
3647 2842316473
3648 2842321362
3649 2842345029
3650 2842360839
3651 2842369148
3652 2842375613
3653 2842382585
3654 2842389986
3655 2842398485
3656 2842426992
3657 2842429952
3658 2842436388
3659 2842444091
3660 2842451055
3661 2842464373
3662 2842470717
3663 2842477954
3664 2842493302
3665 2842499128
3666 2842504763
3667 2842517549
3668 2842522690
3669 2842872368
3670 2842923976
3671 2844003818
3672 2844010450
3673 2844167582
3674 2844319500
3675 2844457469
3676 2847673181
3677 2847689695
3678 2847936209
3679 2847946565
3680 2849079310
3681 2850081157
3682 2852389098
3683 2854682063
3684 2854900802
3685 2854918831
3686 2855825988
3687 2855841333
3688 2856319786
3689 2856320892
3690 2856332866
3691 2856340247
3692 2856342172
3693 2856353700
3694 2856363311
3695 2856366157
3696 2857352623
3697 2857371115
3698 2857518877
3699 2857533769
3700 2858802320
3701 2869165868
3702 2869171985
3703 2869239355
3704 2869249017
3705 2869254940
3706 2869260691
3707 2869267204
3708 2869275465
3709 2869280138
3710 2869290988
3711 2871433270
3712 2871441977
3713 2871463507
3714 2871468359
3715 2871475039
3716 2871488368
3717 2871491170
3718 2871498916
3719 2874105934
3720 2874120873
3721 2874131425
3722 2874132980
3723 2874143309
3724 2874148788
3725 2874160834
3726 2874164783
3727 2874172064
3728 2874598047
3729 2874615408
3730 2874627828
3731 2874631855
3732 2874647507
3733 2876363543
3734 2876373026
3735 2876382929
3736 2876391354
3737 2876397340
3738 2876403926
3739 2876410068
3740 2876418874
3741 2876426048
3742 2876766943
3743 2876778475
3744 2876820421
3745 2878039739
3746 2878733682
3747 2878740624
3748 2878750883
3749 2878755579
3750 2878763129
3751 2878770104
3752 2878780050
3753 2878781873
3754 2878795242
3755 2879082269
3756 2879083705
3757 2879101241
3758 2879135416
3759 2879150624
3760 2881147898
3761 2881159071
3762 2881164678
3763 2881671171
3764 2881847929
3765 2881859601
3766 2881867237
3767 2882457510
3768 2882457540
3769 2882457711
3770 2882634694
3771 2882918198
3772 2884300795
3773 2885306520
3774 2885314468
3775 2885324216
3776 2885333295
3777 2885337006
3778 2885352224
3779 2885413692
3780 2888342995
3781 2888344044
3782 2888352805
3783 2888384063
3784 2888393794
3785 2888424475
3786 2889014580
3787 2889020438
3788 2889919154
3789 2894239106
3790 2894655527
3791 2896389937
3792 2898798926
3793 2899794409
3794 2899808658
3795 2899845792
3796 2903454374
3797 2903498946
3798 2903501539
3799 2903525493
3800 2903531762
3801 2903543715
3802 2903734436
3803 2904584140
3804 2904664094
3805 2904672852
3806 2904714618
3807 2906313808
3808 2906326517
3809 2906334889
3810 2906354969
3811 2906367875
3812 2906375568
3813 2906380841
3814 2906398191
3815 2906401483
3816 2906411273
3817 2906420562
3818 2906432778
3819 2906609232
3820 2906633266
3821 2906651447
3822 2913300841
3823 2913313844
3824 2915981890
3825 2915991341
3826 2915994365
3827 2916004386
3828 2916008150
3829 2916015089
3830 2916024236
3831 2916031768
3832 2916041270
3833 2916042536
3834 2916052276
3835 2916056437
3836 2916067576
3837 2916075702
3838 2916080863
3839 2919075731
3840 2919116641
3841 2919125020
3842 2919168460
3843 2919172424
3844 2919409333
3845 2919454316
3846 2920766095
3847 2920824721
3848 2921201938
3849 2921211204
3850 2921240723
3851 2921244634
3852 2921251173
3853 2921262468
3854 2921265116
3855 2921283767
3856 2921296325
3857 2921303773
3858 2922135182
3859 2922155086
3860 2922165083
3861 2922177911
3862 2922184595
3863 2922186354
3864 2922374395
3865 2922396239
3866 2923558760
3867 2924147098
3868 2924155258
3869 2924160763
3870 2924167341
3871 2924178982
3872 2924184070
3873 2924189069
3874 2924194796
3875 2924203356
3876 2924208830
3877 2924217920
3878 2924226508
3879 2924229950
3880 2924723133
3881 2924728230
3882 2924736665
3883 2924741501
3884 2924754607
3885 2924764011
3886 2924778225
3887 2924785569
3888 2926754650
3889 2926761818
3890 2928524268
3891 2929142117
3892 2929618065
3893 2929627746
3894 2932790355
3895 2932810775
3896 2932823894
3897 2933007050
3898 2933015360
3899 2933574695
3900 2933579993
3901 2933589300
3902 2933594252
3903 2933603512
3904 2935608885
3905 2935623052
3906 2935642416
3907 2935650051
3908 2935661797
3909 2935668281
3910 2935676312
3911 2935692919
3912 2935701078
3913 2935706141
3914 2935721356
3915 2935730274
3916 2935740287
3917 2935749551
3918 2935759136
3919 2935762536
3920 2935773297
3921 2935778538
3922 2935792749
3923 2935800776
3924 2935803140
3925 2935814456
3926 2935822045
3927 2935831594
3928 2935838454
3929 2935847627
3930 2935861300
3931 2935865838
3932 2935878339
3933 2935899711
3934 2935907530
3935 2935909102
3936 2935919823
3937 2935926324
3938 2935934774
3939 2935943224
3940 2935951662
3941 2935967787
3942 2935982671
3943 2935988165
3944 2935994652
3945 2936007549
3946 2936012465
3947 2936021030
3948 2936029758
3949 2936040013
3950 2936047223
3951 2936057618
3952 2936374846
3953 2936380538
3954 2936998124
3955 2937005064
3956 2937012208
3957 2937018633
3958 2937028972
3959 2937031276
3960 2937038583
3961 2937045881
3962 2937050950
3963 2937061544
3964 2937065229
3965 2937073048
3966 2937079798
3967 2937085166
3968 2937097588
3969 2937099535
3970 2937110009
3971 2937116269
3972 2937123079
3973 2937128708
3974 2937819887
3975 2937826378
3976 2937836691
3977 2937847812
3978 2937847813
3979 2937854682
3980 2937861906
3981 2937878346
3982 2937892192
3983 2937980258
3984 2937982872
3985 2937997564
3986 2938018158
3987 2939672400
3988 2940564859
3989 2941504977
3990 2941533285
3991 2941538878
3992 2954013218
3993 2957384802
3994 2957394844
3995 2957398270
3996 2957403206
3997 2957411599
3998 2957418323
3999 2957423296
4000 2957432799
4001 2957441264
4002 2957444988
4003 2957455969
4004 2957459920
4005 2957465992
4006 2957477087
4007 2957479219
4008 2957486256
4009 2957492868
4010 2957498692
4011 2957507657
4012 2958036004
4013 2958045310
4014 2958068017
4015 2958076059
4016 2958085462
4017 2958098827
4018 2958101736
4019 2958108961
4020 2958119418
4021 2958127179
4022 2958135388
4023 2958139459
4024 2958145512
4025 2958161411
4026 2958168037
4027 2958178982
4028 2958184417
4029 2960584303
4030 2960592717
4031 2960602687
4032 2960605934
4033 2960612420
4034 2960620014
4035 2960629228
4036 2960632834
4037 2960639852
4038 2960650504
4039 2960660039
4040 2960660850
4041 2960670966
4042 2960675913
4043 2960681859
4044 2960688014
4045 2960694661
4046 2961082472
4047 2961118766
4048 2961129736
4049 2961166503
4050 2961176477
4051 2961190417
4052 2963645003
4053 2964611615
4054 2964616576
4055 2964622582
4056 2964635803
4057 2964640947
4058 2964649473
4059 2964651787
4060 2964661011
4061 2964667043
4062 2964677501
4063 2964684091
4064 2964687675
4065 2964692863
4066 2964702322
4067 2964711844
4068 2964716771
4069 2964723890
4070 2965021323
4071 2965030313
4072 2965038417
4073 2965046986
4074 2965054068
4075 2965066309
4076 2965094312
4077 2965107799
4078 2965126747
4079 2967665501
4080 2967672560
4081 2967681857
4082 2967691700
4083 2967695255
4084 2967703245
4085 2967707788
4086 2967716661
4087 2967721662
4088 2967734983
4089 2967736860
4090 2967744128
4091 2967755481
4092 2967758749
4093 2967765379
4094 2967775657
4095 2967782292
4096 2968001506
4097 2968007559
4098 2968017258
4099 2968088715
4100 2968093852
4101 2968097725
4102 2968115233
4103 2968121968
4104 2968134129
4105 2968142241
4106 2968174907
4107 2970026519
4108 2970031011
4109 2970039721
4110 2970041328
4111 2970054421
4112 2970057812
4113 2970066697
4114 2970073000
4115 2970077458
4116 2970083746
4117 2970091173
4118 2970097288
4119 2970107499
4120 2970110866
4121 2970122166
4122 2970122980
4123 2970131683
4124 2970138581
4125 2970144100
4126 2970154256
4127 2970160120
4128 2970167122
4129 2970173284
4130 2970178377
4131 2970187579
4132 2970193336
4133 2970470615
4134 2970490168
4135 2970509148
4136 2970514787
4137 2970525748
4138 2970536594
4139 2970544000
4140 2970550468
4141 2970557977
4142 2970594735
4143 2970623981
4144 2977522403
4145 2977529043
4146 2977531669
4147 2977540564
4148 2977549084
4149 2977554418
4150 2977560182
4151 2977572260
4152 2977575289
4153 2977580173
4154 2977824719
4155 2977835715
4156 2977845485
4157 2977857594
4158 2977864368
4159 2977866508
4160 2977873694
4161 2977905298
4162 2977908976
4163 2977918008
4164 2977925870
4165 2977939515
4166 2977944147
4167 2977951496
4168 2977963420
4169 2977978799
4170 2977991602
4171 2978971135
4172 2979092916
4173 2979099695
4174 2979104885
4175 2979712958
4176 2979751194
4177 2979771573
4178 2979776490
4179 2979782582
4180 2979794707
4181 2979813827
4182 2984513314
4183 2984520317
4184 2984539615
4185 2984588296
4186 2984601841
4187 2987641216
4188 2987646125
4189 2987656608
4190 2987662513
4191 2987667547
4192 2987677285
4193 2989354132
4194 2989777012
4195 2996311828
4196 2996338547
4197 2996346800
4198 2996349945
4199 2996391656
4200 2996889227
4201 2996894710
4202 3000142582
4203 3002145180
4204 3003932697
4205 3004172866
4206 3004191563
4207 3004198194
4208 3004210023
4209 3004216424
4210 3004218635
4211 3004239420
4212 3004255195
4213 3004272554
4214 3004276647
4215 3004293723
4216 3004337751
4217 3005417164
4218 3005722735
4219 637077346
4220 639650021
4221 643825975
4222 648739557
4223 649870218
4224 650738741
4225 8002287118
4226 8003572287
4227 8003993848
4228 8004001393
4229 8004301013
4230 8004315020
4231 8004363417
4232 8004377158
4233 8004393277
4234 8004451485
4235 8004637718
4236 8004644241
4237 8004697698
4238 8004707002
4239 8004720064
4240 8004729718
4241 8005247960
4242 8005264195
4243 8005282039
4244 8005288486
4245 8005294242
4246 8005306653
4247 8005309411
4248 8005315225
4249 8005323754
4250 8005382762
4251 8005383819
4252 8005401145
4253 8005434098
4254 8005464639
4255 8005485605
4256 8005501689
4257 8005547094
4258 8005559142
4259 8005566799
4260 8005574923
4261 8005623043
4262 8005631653
4263 8005648378
4264 8005673111
4265 8005684545
4266 8005693651
4267 8005700889
4268 8016522331
4269 8016529612
4270 8016534829
4271 8016548040
4272 8016554087
4273 8016562462
4274 8016573177
4275 8016577319
4276 8016600257
4277 8016614442
4278 8016626554
4279 8016640339
4280 8017063228
4281 8018133594
4282 8018154626
4283 8018170242
4284 8018178441
4285 8019534593
4286 8019544879
4287 8019553655
4288 8019582654
4289 8019600907
4290 8019617643
4291 8019634457
4292 8019645272
4293 8019662348
4294 8019671849
4295 8019690079
4296 8023687524
4297 8024481973
4298 8024505914
4299 8049294959
4300 8054461050
4301 8054562059
4302 8055617561
4303 8055746346
4304 8056381606
4305 8056387047
4306 8056878716
4307 8056878717
4308 8056968040
4309 8056968483
4310 8057877014

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

111

398

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hzl-assembly1.cif.gz_A crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms 0.9906 23 352
4yzz-assembly1.cif.gz_A crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi-500035) mixed occupancy dimer, copurified calcium and picolinate bound active site versus apo site 0.9814 21 352
7ug8-assembly1.cif.gz_A crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium 0.9773 20 345
2hzl-assembly1.cif.gz_A crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms 0.9759 23 352
5cm6-assembly1.cif.gz_B crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate 0.9708 22 343
ID Description Score Start End Superfamily
2hzkC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9786 23 349 3.40.190.170
4yzzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9682 21 351 3.40.190.170
2hzkC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.965 23 349 3.40.190.170
4yicB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.956 145 313 3.40.190.10
4yzzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9551 21 351 3.40.190.170
ID Description Score Start End GO Terms
AF-A0A0D7EEV2-F1-model_v4 ABC transporter substrate-binding protein 0.9886 23 353 GO:0015849
GO:0031317
GO:0043177
GO:0046872
GO:0055085
AF-A0A3N5FTX4-F1-model_v4 ABC transporter substrate-binding protein 0.9886 41 347 GO:0055085
AF-A0A537VVV0-F1-model_v4 ABC transporter substrate-binding protein 0.9855 65 353 GO:0055085
AF-A0A0D7EEV2-F1-model_v4 ABC transporter substrate-binding protein 0.9827 23 353 GO:0015849
GO:0031317
GO:0043177
GO:0046872
GO:0055085
AF-A0A527HEM5-F1-model_v4 ABC transporter substrate-binding protein 0.9823 167 352 GO:0055085

Map