F496503

General Info

Members Datasets Scaffolds Average Seq Length
2171 665 4342 313

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10007622|JGI25151J46595_100076222
Length 380
Sequence MDGHACCRTGPRQPVPNQRQRALTNSRAALKTLGGHFXPALYRMIRXSSGTGLPVPHSPGCRVQANPIISIQQLSKTYASGFQALKSVSLDIRRGEILALLGPNGAGKTTLISIICGIVRPSSGTVTADGHDIVRDYRAARAKIGLVPQELSTDAFETVWSTVSFSRGLYGKAPNPAYIEKVLRDLSLWDKKDSKIMSLSGGMKRRVLIAKALSHEPTILFLDEPSAGVDVELRKGMWQMVRELQSSGVTIILTTHYIEEAEEMADRIGVINKGELILVEDKTVLMRKLGKKQLSLQLQTPLQSIPAALAGLPLELSGEGHTLVYTFDSQTEETGIAALLKRLAELGIDFKDLHSSESSLEDIFVSLVHADXPAAHKEAA

Samples

Sample ID Description Type Environment
1 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
15 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
16 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
17 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
18 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
19 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
20 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
21 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
23 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
24 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
25 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
26 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
27 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
28 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
29 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
30 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
31 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
32 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
35 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
36 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
37 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
38 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
43 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
44 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
45 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
46 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
47 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
50 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
51 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
52 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
53 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
54 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
55 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
56 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
57 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
58 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
59 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
60 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
61 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
62 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
63 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
64 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
65 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
70 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
71 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
72 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
73 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
74 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
75 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
76 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
77 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
78 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
79 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
80 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
81 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
82 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
83 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
84 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
85 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
86 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
87 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
88 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
89 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
92 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
93 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
94 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
95 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
96 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
106 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
107 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
108 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
111 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
114 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
115 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
116 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
117 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
118 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
119 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
120 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
121 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
122 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
123 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
124 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
125 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
126 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
127 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
128 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
129 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
130 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
131 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
132 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
133 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
134 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
135 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
136 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
137 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
138 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
139 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
141 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
142 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
144 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
145 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
146 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
147 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
148 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
149 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
150 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
151 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
152 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
153 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
154 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
155 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
156 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
157 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
158 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
159 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
160 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
161 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
162 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
163 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
164 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
165 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
166 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
167 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
168 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
169 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
170 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
171 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
172 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
173 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
175 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
177 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
179 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
180 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
181 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
182 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
183 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
189 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
190 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
192 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
193 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
194 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
197 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
198 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
199 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
203 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
206 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
207 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
208 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
210 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
211 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
276 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
280 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
281 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
282 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
283 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
285 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
286 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
287 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
288 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
289 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
290 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
291 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
295 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
296 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
297 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
298 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
299 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
300 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
301 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
303 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
304 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
305 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
306 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
307 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
308 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
309 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
310 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
311 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
312 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
313 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
314 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
315 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
316 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
317 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
318 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
319 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
320 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
321 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
322 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
323 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
324 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
325 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
326 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
327 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
328 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
329 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
330 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
331 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
332 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
333 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
334 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
335 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
336 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
337 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
338 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
339 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
340 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
341 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
342 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
343 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
344 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
345 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
346 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
347 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
348 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
349 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
350 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
351 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
352 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
353 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
354 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
355 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
356 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
357 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
358 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
359 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
360 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
361 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
362 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
363 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
364 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
365 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
366 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
367 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
368 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
369 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
370 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
371 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
372 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
373 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
374 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
375 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
376 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
377 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
378 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
379 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
380 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
381 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
382 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
383 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
384 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
385 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
386 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
387 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
388 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
389 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
390 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
391 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
392 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
393 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
394 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
395 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
396 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
397 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
398 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
399 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
400 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
401 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
402 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
403 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
404 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
405 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
406 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
407 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
408 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
409 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
410 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
411 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
412 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
413 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
414 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
415 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
416 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
417 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
418 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
419 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
420 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
421 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
422 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
423 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
424 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
425 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
426 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
427 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
428 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
429 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
430 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
431 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
432 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
433 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
434 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
435 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
436 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
437 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
438 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
439 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
440 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
441 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
442 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
443 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
444 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
445 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
446 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
447 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
448 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
449 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
450 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
451 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
452 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
453 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
454 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
455 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
456 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
457 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
458 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
459 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
460 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
461 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
462 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
463 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
464 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
465 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
466 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
467 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
468 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
469 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
470 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
471 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
472 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
473 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
474 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
475 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
476 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
477 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
478 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
479 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
480 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
481 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
482 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
483 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
484 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
485 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
486 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
487 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
488 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
489 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
490 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
491 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
492 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
493 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
494 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
495 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
496 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
497 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
498 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
499 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
500 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
501 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
502 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
503 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
504 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
505 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
506 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
507 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
508 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
509 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
510 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
511 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
512 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
513 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
514 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
515 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
516 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
517 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
518 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
519 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
520 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
521 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
522 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
523 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
524 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
525 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
526 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
527 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
528 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
529 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
530 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
531 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
532 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
533 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
534 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
535 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
536 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
537 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
538 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
539 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
540 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
541 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
542 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
543 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
544 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
545 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
546 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
547 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
548 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
549 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
550 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
551 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
552 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
553 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
554 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
555 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
556 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
557 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
558 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
559 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
560 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
561 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
562 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
563 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
564 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
565 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
566 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
567 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
568 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
569 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
570 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
571 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
572 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
573 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
574 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
575 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
576 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
577 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
578 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
579 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
580 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
581 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
582 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
583 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
584 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
585 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
586 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
587 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
588 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
589 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
590 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
591 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
592 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
593 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
594 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
595 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
596 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
597 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
598 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
599 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
600 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
601 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
602 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
603 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
604 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
605 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
606 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
607 2519103095 Burkholderia sp. KJ006 Isolate Nodule
608 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
609 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
610 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
611 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
612 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
613 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
614 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
615 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
616 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
617 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
618 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
619 2643221569 Achromobacter sp. Root565 Isolate Unclassified
620 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
621 2643221594 Achromobacter sp. Root170 Isolate Unclassified
622 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
623 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
624 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
625 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
626 2773857925 Microvirga vignae BR3299 Isolate Unclassified
627 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
628 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
629 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
630 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
631 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
632 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
633 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
634 2818991452 Burkholderia cepacia 561 Isolate Unclassified
635 2818991457 Xanthomonas translucens 569 Isolate Unclassified
636 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
637 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
638 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
639 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
640 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
641 2904564687 Burkholderia sp. 571 Isolate Unclassified
642 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
643 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
644 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
645 2928163908 Burkholderia sp. 567 Isolate Unclassified
646 2928170801 Burkholderia sp. 572 Isolate Unclassified
647 2928536128 Burkholderia sola 565 Isolate Unclassified
648 2928963466 Dyella japonica 1073 Isolate Unclassified
649 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
650 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
651 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
652 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
653 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
654 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
655 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
656 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
657 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
658 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
659 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
660 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
661 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
662 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
663 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
664 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
665 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.78
Metatranscriptomes 0.32
Isolates 2.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.75
Nodule 0.09
Rhizoplane 3.68
Rhizosphere 78.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10007622 3300003187 Bacteria 5284
2 SwRhRL2b_contig_719950 2162886007 Bacteria 4655
3 JGI24736J21556_1003706 3300001904 Bacteria 2638
4 JGI24736J21556_1018176 3300001904 Bacteria 1113
5 JGI24741J21665_1000800 3300001915 Bacteria 9447
6 JGI24741J21665_1000867 3300001915 Bacteria 9119
7 JGI24741J21665_1000873 3300001915 Bacteria 9094
8 JGI24741J21665_1002927 3300001915 Bacteria 4265
9 JGI24740J21852_10000833 3300001979 Bacteria 13603
10 JGI24740J21852_10002444 3300001979 Bacteria 8426
11 JGI24740J21852_10003279 3300001979 Bacteria 7138
12 JGI24740J21852_10011531 3300001979 Bacteria 3363
13 JGI24740J21852_10050988 3300001979 Bacteria 1187
14 JGI24739J22299_10003761 3300001989 Bacteria 5795
15 JGI24739J22299_10003964 3300001989 Bacteria 5663
16 JGI24737J22298_10004736 3300001990 Bacteria 4723
17 JGI24743J22301_10001171 3300001991 Bacteria 3531
18 JGI24735J21928_10001752 3300002067 Bacteria 7650
19 JGI24735J21928_10005070 3300002067 Bacteria 4385
20 JGI24738J21930_10002476 3300002075 Bacteria 4824
21 JGI24749J21850_1001805 3300002076 Bacteria 3029
22 JGI24033J26618_1001172 3300002155 Bacteria 2557
23 JGI24034J26672_10005980 3300002239 Bacteria 1752
24 JGI25155J39150_1000057 3300002704 Bacteria 72575
25 JGI25156J39149_1000073 3300002705 Bacteria 77465
26 JGI25156J39149_1000673 3300002705 Bacteria 18434
27 JGI25156J39149_1002242 3300002705 Bacteria 7137
28 JGI25162J39368_1000468 3300002737 Bacteria 31159
29 JGI25162J39368_1000971 3300002737 Bacteria 18268
30 JGI25162J39368_1001279 3300002737 Bacteria 14280
31 JGI25154J39366_1000097 3300002738 Bacteria 77399
32 JGI25154J39366_1001421 3300002738 Bacteria 8532
33 JGI25157J39369_1000075 3300002741 Bacteria 88169
34 JGI25157J39369_1000089 3300002741 Bacteria 77465
35 JGI25157J39369_1000469 3300002741 Bacteria 25434
36 JGI25157J39369_1000772 3300002741 Bacteria 16587
37 JGI25164J39214_1000193 3300002772 Bacteria 52696
38 JGI25164J39214_1000242 3300002772 Bacteria 41726
39 JGI25159J45721_1001136 3300002987 Bacteria 11378
40 JGI25159J45721_1005739 3300002987 Bacteria 3843
41 JGI25151J46595_10004543 3300003187 Bacteria 7320
42 JGI25151J46595_10029108 3300003187 Bacteria 2192
43 JGI25406J46586_10025745 3300003203 Bacteria 2279
44 JGI25165J46597_1000335 3300003214 Bacteria 55465
45 JGI25165J46597_1002530 3300003214 Bacteria 5737
46 JGI25160J50197_1000076 3300003354 Bacteria 102318
47 JGI26145J50221_1001413 3300003371 Bacteria 1901
48 JGI25161J50226_1000058 3300003374 Bacteria 102318
49 Ga0055539_1002563 3300003752 Bacteria 2728
50 Ga0055533_1000011 3300003756 Bacteria 467893
51 Ga0055533_1005444 3300003756 Bacteria 2041
52 Ga0055525_1000089 3300003759 Bacteria 142096
53 Ga0055525_1001594 3300003759 Bacteria 3649
54 Ga0055527_1000084 3300003760 Bacteria 74303
55 Ga0055527_1000206 3300003760 Bacteria 38636
56 Ga0055535_1000426 3300003761 Bacteria 39469
57 Ga0055535_1000639 3300003761 Bacteria 27945
58 Ga0055535_1000728 3300003761 Bacteria 24896
59 Ga0055542_1000057 3300003762 Bacteria 162955
60 Ga0055542_1000107 3300003762 Bacteria 111897
61 Ga0055542_1000195 3300003762 Bacteria 74303
62 Ga0055542_1000455 3300003762 Bacteria 38636
63 Ga0055529_1000460 3300003763 Bacteria 39464
64 Ga0055529_1000881 3300003763 Bacteria 17123
65 Ga0055526_1005666 3300003771 Bacteria 7092
66 Ga0055526_1005854 3300003771 Bacteria 6901
67 Ga0055537_1000730 3300003773 Bacteria 16851
68 Ga0055537_1014657 3300003773 Bacteria 1412
69 Ga0055524_1001067 3300003775 Bacteria 16851
70 Ga0055524_1003977 3300003775 Bacteria 6985
71 Ga0055536_1000621 3300003781 Bacteria 24132
72 Ga0055536_1001793 3300003781 Bacteria 12647
73 Ga0055536_1008264 3300003781 Bacteria 4505
74 Ga0055536_1008702 3300003781 Bacteria 4314
75 Ga0055534_1002014 3300003784 Bacteria 7386
76 Ga0055528_1006463 3300003790 Bacteria 5317
77 Ga0055530_10002477 3300003791 Bacteria 11838
78 Ga0055530_10006463 3300003791 Bacteria 5227
79 Ga0055530_10009456 3300003791 Bacteria 3744
80 Ga0055530_10014991 3300003791 Bacteria 2555
81 Ga0055540_1001926 3300003792 Bacteria 11591
82 Ga0055540_1005515 3300003792 Bacteria 5292
83 Ga0055531_10000450 3300003794 Bacteria 38240
84 Ga0055531_10002822 3300003794 Bacteria 11385
85 Ga0055531_10008906 3300003794 Bacteria 5208
86 Ga0055531_10010909 3300003794 Bacteria 4455
87 Ga0055531_10013622 3300003794 Bacteria 3732
88 Ga0055531_10040125 3300003794 Bacteria 1378
89 Ga0055531_10041520 3300003794 Bacteria 1330
90 Ga0058692_1000142 3300003856 Bacteria 45378
91 Ga0058692_1015531 3300003856 Bacteria 1713
92 Ga0055543_1002375 3300004625 Bacteria 6288
93 Ga0065165_1000949 3300005262 Bacteria 36709
94 Ga0065165_1004485 3300005262 Bacteria 8602
95 Ga0065165_1023570 3300005262 Bacteria 2083
96 Ga0065165_1037799 3300005262 Bacteria 1460
97 Ga0065165_1040512 3300005262 Bacteria 1389
98 Ga0065712_10084506 3300005290 Bacteria 2758
99 Ga0065715_10023686 3300005293 Bacteria 2211
100 Ga0065715_10118965 3300005293 Bacteria 2300
101 Ga0065715_10181169 3300005293 Bacteria 1475
102 Ga0065707_10118060 3300005295 Bacteria 2195
103 Ga0070658_10001353 3300005327 Bacteria 20935
104 Ga0070658_10003530 3300005327 Bacteria 12834
105 Ga0070658_10005606 3300005327 Bacteria 10181
106 Ga0070658_10011570 3300005327 Bacteria 7077
107 Ga0070658_10058004 3300005327 Bacteria 3150
108 Ga0070658_10070760 3300005327 Bacteria 2857
109 Ga0070658_10091592 3300005327 Bacteria 2505
110 Ga0070658_10117242 3300005327 Bacteria 2210
111 Ga0070658_10136788 3300005327 Bacteria 2045
112 Ga0070676_10015962 3300005328 Bacteria 4146
113 Ga0070676_10044461 3300005328 Bacteria 2585
114 Ga0070683_100007585 3300005329 Bacteria 9175
115 Ga0070683_100024660 3300005329 Bacteria 5390
116 Ga0070683_100037375 3300005329 Bacteria 4445
117 Ga0070683_100045251 3300005329 Bacteria 4062
118 Ga0070683_100064518 3300005329 Bacteria 3409
119 Ga0070690_100011275 3300005330 Bacteria 5225
120 Ga0070690_100015791 3300005330 Bacteria 4512
121 Ga0070690_100044508 3300005330 Bacteria 2818
122 Ga0070670_100000002 3300005331 Bacteria 568775
123 Ga0070670_100080375 3300005331 Bacteria 2802
124 Ga0070670_100101779 3300005331 Bacteria 2473
125 Ga0070670_100102372 3300005331 Bacteria 2466
126 Ga0070670_100102443 3300005331 Bacteria 2465
127 Ga0070670_100416273 3300005331 Bacteria 1188
128 Ga0070677_10008613 3300005333 Bacteria 3438
129 Ga0070677_10014193 3300005333 Bacteria 2799
130 Ga0068869_100025426 3300005334 Bacteria 4111
131 Ga0068869_100036648 3300005334 Bacteria 3483
132 Ga0068869_100049779 3300005334 Bacteria 3034
133 Ga0068869_100274068 3300005334 Bacteria 1355
134 Ga0070666_10122162 3300005335 Bacteria 1806
135 Ga0070680_100004287 3300005336 Bacteria 10716
136 Ga0070680_100008203 3300005336 Bacteria 7983
137 Ga0070680_100035878 3300005336 Bacteria 4004
138 Ga0070680_100055851 3300005336 Bacteria 3227
139 Ga0070680_100065166 3300005336 Bacteria 2986
140 Ga0070680_100128398 3300005336 Bacteria 2119
141 Ga0070680_100197564 3300005336 Bacteria 1696
142 Ga0070680_100204475 3300005336 Bacteria 1665
143 Ga0070680_100249745 3300005336 Bacteria 1500
144 Ga0070680_100286698 3300005336 Bacteria 1395
145 Ga0070682_100003586 3300005337 Bacteria 8594
146 Ga0070682_100057489 3300005337 Bacteria 2450
147 Ga0070682_100068347 3300005337 Bacteria 2266
148 Ga0070682_100080136 3300005337 Bacteria 2110
149 Ga0070682_100087362 3300005337 Bacteria 2032
150 Ga0070682_100221678 3300005337 Bacteria 1346
151 Ga0068868_100028093 3300005338 Bacteria 4297
152 Ga0068868_100062772 3300005338 Bacteria 2946
153 Ga0070660_100000006 3300005339 Bacteria 166714
154 Ga0070660_100000378 3300005339 Bacteria 29634
155 Ga0070660_100004561 3300005339 Bacteria 9577
156 Ga0070660_100005115 3300005339 Bacteria 9059
157 Ga0070660_100025856 3300005339 Bacteria 4366
158 Ga0070660_100031954 3300005339 Bacteria 3958
159 Ga0070660_100036722 3300005339 Bacteria 3712
160 Ga0070660_100046895 3300005339 Bacteria 3313
161 Ga0070660_100047116 3300005339 Bacteria 3306
162 Ga0070660_100048131 3300005339 Bacteria 3273
163 Ga0070689_100000001 3300005340 Bacteria 1334580
164 Ga0070689_100000908 3300005340 Bacteria 18492
165 Ga0070689_100034696 3300005340 Bacteria 3849
166 Ga0070689_100078629 3300005340 Bacteria 2586
167 Ga0070689_100349627 3300005340 Bacteria 1240
168 Ga0070691_10000225 3300005341 Bacteria 19202
169 Ga0070691_10037443 3300005341 Bacteria 2289
170 Ga0070687_100054025 3300005343 Bacteria 2091
171 Ga0070661_100000697 3300005344 Bacteria 24630
172 Ga0070661_100002483 3300005344 Bacteria 12641
173 Ga0070661_100006538 3300005344 Bacteria 8043
174 Ga0070661_100007312 3300005344 Bacteria 7616
175 Ga0070661_100007351 3300005344 Bacteria 7594
176 Ga0070661_100008194 3300005344 Bacteria 7209
177 Ga0070661_100017270 3300005344 Bacteria 5117
178 Ga0070661_100093035 3300005344 Bacteria 2234
179 Ga0070661_100094016 3300005344 Bacteria 2221
180 Ga0070661_100143156 3300005344 Bacteria 1803
181 Ga0070661_100163917 3300005344 Bacteria 1684
182 Ga0070661_100178757 3300005344 Bacteria 1614
183 Ga0070692_10022026 3300005345 Bacteria 3108
184 Ga0070692_10209677 3300005345 Bacteria 1146
185 Ga0070668_100020914 3300005347 Bacteria 4943
186 Ga0070668_100026755 3300005347 Bacteria 4379
187 Ga0070668_100101492 3300005347 Bacteria 2280
188 Ga0070669_100002974 3300005353 Bacteria 12215
189 Ga0070669_100025109 3300005353 Bacteria 4279
190 Ga0070669_100072519 3300005353 Bacteria 2549
191 Ga0070669_100110163 3300005353 Bacteria 2088
192 Ga0070669_100131910 3300005353 Bacteria 1918
193 Ga0070675_100027074 3300005354 Bacteria 4605
194 Ga0070675_100060456 3300005354 Bacteria 3128
195 Ga0070675_100152298 3300005354 Bacteria 1983
196 Ga0070675_100170806 3300005354 Bacteria 1875
197 Ga0070671_100000047 3300005355 Bacteria 84234
198 Ga0070671_100001263 3300005355 Bacteria 18957
199 Ga0070671_100018028 3300005355 Bacteria 5729
200 Ga0070671_100042151 3300005355 Bacteria 3794
201 Ga0070671_100092608 3300005355 Bacteria 2532
202 Ga0070671_100166376 3300005355 Bacteria 1864
203 Ga0070671_100304197 3300005355 Bacteria 1358
204 Ga0070671_100304496 3300005355 Bacteria 1357
205 Ga0070673_100001025 3300005364 Bacteria 15814
206 Ga0070673_100038215 3300005364 Bacteria 3664
207 Ga0070673_100133891 3300005364 Bacteria 2083
208 Ga0070673_100178224 3300005364 Bacteria 1818
209 Ga0070673_100240206 3300005364 Bacteria 1575
210 Ga0070688_100029825 3300005365 Bacteria 3269
211 Ga0070688_100126319 3300005365 Bacteria 1719
212 Ga0070688_100141474 3300005365 Bacteria 1635
213 Ga0070659_100000082 3300005366 Bacteria 71707
214 Ga0070659_100001873 3300005366 Bacteria 15080
215 Ga0070659_100003652 3300005366 Bacteria 10964
216 Ga0070659_100013172 3300005366 Bacteria 6151
217 Ga0070659_100026087 3300005366 Bacteria 4494
218 Ga0070659_100029716 3300005366 Bacteria 4224
219 Ga0070659_100044848 3300005366 Bacteria 3463
220 Ga0070659_100050838 3300005366 Bacteria 3258
221 Ga0070659_100082379 3300005366 Bacteria 2570
222 Ga0070659_100083949 3300005366 Bacteria 2546
223 Ga0070659_100209363 3300005366 Bacteria 1607
224 Ga0070659_100348957 3300005366 Bacteria 1241
225 Ga0070667_100000018 3300005367 Bacteria 226033
226 Ga0070667_100000136 3300005367 Bacteria 93545
227 Ga0070667_100001189 3300005367 Bacteria 23666
228 Ga0070667_100002630 3300005367 Bacteria 15546
229 Ga0070667_100152524 3300005367 Bacteria 2030
230 Ga0070667_100287926 3300005367 Bacteria 1476
231 Ga0070667_100332894 3300005367 Bacteria 1372
232 Ga0070709_10002390 3300005434 Bacteria 10167
233 Ga0070709_10011717 3300005434 Bacteria 4896
234 Ga0070714_100000079 3300005435 Bacteria 82899
235 Ga0070714_100001813 3300005435 Bacteria 15525
236 Ga0070714_100003909 3300005435 Bacteria 11196
237 Ga0070714_100005545 3300005435 Bacteria 9640
238 Ga0070714_100016187 3300005435 Bacteria 6016
239 Ga0070714_100032402 3300005435 Bacteria 4362
240 Ga0070714_100106704 3300005435 Bacteria 2475
241 Ga0070713_100027496 3300005436 Bacteria 4478
242 Ga0070713_100027807 3300005436 Bacteria 4458
243 Ga0070711_100022012 3300005439 Bacteria 4127
244 Ga0070711_100113121 3300005439 Bacteria 1996
245 Ga0070705_100008150 3300005440 Bacteria 5181
246 Ga0070705_100066153 3300005440 Bacteria 2167
247 Ga0070700_100009824 3300005441 Bacteria 5262
248 Ga0070700_100040823 3300005441 Bacteria 2842
249 Ga0070700_100050672 3300005441 Bacteria 2581
250 Ga0070708_100090787 3300005445 Bacteria 2781
251 Ga0070663_100000069 3300005455 Bacteria 44710
252 Ga0070663_100000204 3300005455 Bacteria 29549
253 Ga0070663_100002048 3300005455 Bacteria 11266
254 Ga0070663_100010569 3300005455 Bacteria 5757
255 Ga0070663_100011864 3300005455 Bacteria 5491
256 Ga0070663_100017483 3300005455 Bacteria 4681
257 Ga0070663_100056714 3300005455 Bacteria 2808
258 Ga0070663_100070594 3300005455 Bacteria 2540
259 Ga0070663_100087373 3300005455 Bacteria 2304
260 Ga0070663_100124726 3300005455 Bacteria 1949
261 Ga0070663_100156761 3300005455 Bacteria 1750
262 Ga0070663_100165351 3300005455 Bacteria 1706
263 Ga0070663_100206060 3300005455 Bacteria 1537
264 Ga0070663_100373390 3300005455 Bacteria 1160
265 Ga0070678_100004415 3300005456 Bacteria 7975
266 Ga0070678_100035451 3300005456 Bacteria 3483
267 Ga0070678_100072802 3300005456 Bacteria 2577
268 Ga0070678_100092613 3300005456 Bacteria 2322
269 Ga0070678_100294093 3300005456 Bacteria 1378
270 Ga0070662_100000546 3300005457 Bacteria 22896
271 Ga0070662_100038980 3300005457 Bacteria 3378
272 Ga0070662_100103515 3300005457 Bacteria 2159
273 Ga0070681_10000186 3300005458 Bacteria 47903
274 Ga0070681_10001722 3300005458 Bacteria 19584
275 Ga0070681_10001805 3300005458 Bacteria 19258
276 Ga0070681_10016914 3300005458 Bacteria 7286
277 Ga0070681_10028888 3300005458 Bacteria 5572
278 Ga0070681_10209235 3300005458 Bacteria 1867
279 Ga0070681_10313016 3300005458 Bacteria 1479
280 Ga0070685_10000011 3300005466 Bacteria 137723
281 Ga0070685_10005572 3300005466 Bacteria 6389
282 Ga0070685_10012813 3300005466 Bacteria 4410
283 Ga0070685_10037523 3300005466 Bacteria 2745
284 Ga0070685_10202572 3300005466 Bacteria 1291
285 Ga0070706_100075356 3300005467 Bacteria 3122
286 Ga0070698_100002222 3300005471 Bacteria 21479
287 Ga0070699_100006475 3300005518 Bacteria 10199
288 Ga0070699_100093465 3300005518 Bacteria 2631
289 Ga0070679_100000168 3300005530 Bacteria 52996
290 Ga0070679_100000209 3300005530 Bacteria 47903
291 Ga0070679_100006033 3300005530 Bacteria 11275
292 Ga0070679_100015243 3300005530 Bacteria 7385
293 Ga0070679_100017095 3300005530 Bacteria 7012
294 Ga0070679_100046964 3300005530 Bacteria 4305
295 Ga0070679_100098164 3300005530 Bacteria 2917
296 Ga0070679_100222455 3300005530 Bacteria 1848
297 Ga0070679_100245652 3300005530 Bacteria 1747
298 Ga0070679_100246614 3300005530 Bacteria 1743
299 Ga0070679_100321364 3300005530 Bacteria 1497
300 Ga0070684_100004281 3300005535 Bacteria 10823
301 Ga0070684_100013549 3300005535 Bacteria 6579
302 Ga0070684_100020604 3300005535 Bacteria 5468
303 Ga0070684_100051000 3300005535 Bacteria 3595
304 Ga0068853_100002701 3300005539 Bacteria 13378
305 Ga0068853_100008568 3300005539 Bacteria 8219
306 Ga0068853_100018661 3300005539 Bacteria 5743
307 Ga0068853_100025749 3300005539 Bacteria 4937
308 Ga0068853_100067167 3300005539 Bacteria 3114
309 Ga0068853_100116026 3300005539 Bacteria 2384
310 Ga0068853_100143380 3300005539 Bacteria 2145
311 Ga0068853_100156669 3300005539 Bacteria 2052
312 Ga0068853_100212350 3300005539 Bacteria 1764
313 Ga0068853_100295223 3300005539 Bacteria 1497
314 Ga0070672_100021972 3300005543 Bacteria 4678
315 Ga0070672_100043703 3300005543 Bacteria 3457
316 Ga0070672_100142343 3300005543 Bacteria 1979
317 Ga0070672_100297086 3300005543 Bacteria 1368
318 Ga0070686_100030021 3300005544 Bacteria 3313
319 Ga0070695_100008874 3300005545 Bacteria 5971
320 Ga0070696_100001072 3300005546 Bacteria 17656
321 Ga0070696_100003297 3300005546 Bacteria 10775
322 Ga0070696_100030889 3300005546 Bacteria 3669
323 Ga0070696_100055603 3300005546 Bacteria 2760
324 Ga0070696_100064029 3300005546 Bacteria 2576
325 Ga0070693_100034600 3300005547 Bacteria 2796
326 Ga0070693_100036637 3300005547 Bacteria 2729
327 Ga0070693_100082785 3300005547 Bacteria 1916
328 Ga0070665_100003964 3300005548 Bacteria 15604
329 Ga0070665_100007774 3300005548 Bacteria 10890
330 Ga0070665_100019771 3300005548 Bacteria 6760
331 Ga0070665_100025711 3300005548 Bacteria 5930
332 Ga0070665_100057362 3300005548 Bacteria 3903
333 Ga0068855_100000036 3300005563 Bacteria 162849
334 Ga0068855_100000480 3300005563 Bacteria 49187
335 Ga0068855_100001533 3300005563 Bacteria 29006
336 Ga0068855_100004530 3300005563 Bacteria 16970
337 Ga0068855_100007664 3300005563 Bacteria 13053
338 Ga0068855_100026190 3300005563 Bacteria 6976
339 Ga0068855_100026592 3300005563 Bacteria 6923
340 Ga0068855_100030225 3300005563 Bacteria 6480
341 Ga0068855_100050548 3300005563 Bacteria 4898
342 Ga0068855_100102087 3300005563 Bacteria 3301
343 Ga0068855_100109262 3300005563 Bacteria 3176
344 Ga0068855_100136938 3300005563 Bacteria 2793
345 Ga0068855_100171276 3300005563 Bacteria 2459
346 Ga0068855_100197425 3300005563 Bacteria 2267
347 Ga0068855_100399817 3300005563 Bacteria 1506
348 Ga0070664_100000152 3300005564 Bacteria 47795
349 Ga0070664_100002216 3300005564 Bacteria 15624
350 Ga0070664_100002766 3300005564 Bacteria 14158
351 Ga0070664_100004863 3300005564 Bacteria 10760
352 Ga0070664_100031462 3300005564 Bacteria 4434
353 Ga0070664_100037535 3300005564 Bacteria 4074
354 Ga0070664_100065976 3300005564 Bacteria 3090
355 Ga0070664_100192630 3300005564 Bacteria 1817
356 Ga0070664_100335752 3300005564 Bacteria 1372
357 Ga0068857_100011649 3300005577 Bacteria 7649
358 Ga0068857_100018647 3300005577 Bacteria 6090
359 Ga0068857_100020611 3300005577 Bacteria 5801
360 Ga0068857_100023989 3300005577 Bacteria 5369
361 Ga0068857_100080701 3300005577 Bacteria 2905
362 Ga0068857_100090959 3300005577 Bacteria 2731
363 Ga0068857_100125818 3300005577 Bacteria 2309
364 Ga0068857_100560876 3300005577 Bacteria 1077
365 Ga0068854_100000190 3300005578 Bacteria 41376
366 Ga0068854_100005665 3300005578 Bacteria 7892
367 Ga0068854_100007267 3300005578 Bacteria 7073
368 Ga0068854_100014610 3300005578 Bacteria 5180
369 Ga0068854_100014693 3300005578 Bacteria 5166
370 Ga0068854_100019713 3300005578 Bacteria 4550
371 Ga0068854_100089482 3300005578 Bacteria 2288
372 Ga0068854_100129743 3300005578 Bacteria 1924
373 Ga0068854_100132664 3300005578 Bacteria 1903
374 Ga0068856_100000409 3300005614 Bacteria 47269
375 Ga0068856_100000871 3300005614 Bacteria 32354
376 Ga0068856_100004156 3300005614 Bacteria 14466
377 Ga0068856_100004503 3300005614 Bacteria 13854
378 Ga0068856_100020224 3300005614 Bacteria 6465
379 Ga0068856_100062649 3300005614 Bacteria 3674
380 Ga0068856_100067352 3300005614 Bacteria 3538
381 Ga0068856_100077891 3300005614 Bacteria 3286
382 Ga0068856_100149033 3300005614 Bacteria 2348
383 Ga0068856_100282905 3300005614 Bacteria 1675
384 Ga0068856_100343183 3300005614 Bacteria 1512
385 Ga0068856_100375518 3300005614 Bacteria 1441
386 Ga0068856_100460519 3300005614 Bacteria 1292
387 Ga0070702_100026916 3300005615 Bacteria 3097
388 Ga0070702_100038356 3300005615 Bacteria 2667
389 Ga0070702_100207622 3300005615 Bacteria 1301
390 Ga0068852_100006255 3300005616 Bacteria 8589
391 Ga0068852_100012065 3300005616 Bacteria 6542
392 Ga0068852_100015026 3300005616 Bacteria 5985
393 Ga0068852_100023687 3300005616 Bacteria 4946
394 Ga0068852_100035141 3300005616 Bacteria 4176
395 Ga0068852_100048219 3300005616 Bacteria 3639
396 Ga0068852_100052885 3300005616 Bacteria 3493
397 Ga0068852_100122524 3300005616 Bacteria 2383
398 Ga0068852_100318374 3300005616 Bacteria 1510
399 Ga0068859_100003324 3300005617 Bacteria 16345
400 Ga0068859_100013908 3300005617 Bacteria 8073
401 Ga0068859_100018022 3300005617 Bacteria 7096
402 Ga0068859_100034393 3300005617 Bacteria 5086
403 Ga0068859_100091461 3300005617 Bacteria 3093
404 Ga0068864_100000003 3300005618 Bacteria 568775
405 Ga0068864_100015374 3300005618 Bacteria 6363
406 Ga0068864_100022493 3300005618 Bacteria 5286
407 Ga0068864_100029374 3300005618 Bacteria 4655
408 Ga0068864_100032138 3300005618 Bacteria 4457
409 Ga0068864_100038634 3300005618 Bacteria 4077
410 Ga0068864_100051693 3300005618 Bacteria 3541
411 Ga0068864_100065129 3300005618 Bacteria 3161
412 Ga0068864_100065381 3300005618 Bacteria 3155
413 Ga0068864_100072359 3300005618 Bacteria 3004
414 Ga0068864_100130939 3300005618 Bacteria 2253
415 Ga0068864_100139768 3300005618 Bacteria 2184
416 Ga0068864_100168939 3300005618 Bacteria 1993
417 Ga0068866_10004226 3300005718 Bacteria 5897
418 Ga0068861_100008881 3300005719 Bacteria 6926
419 Ga0068861_100022627 3300005719 Bacteria 4531
420 Ga0068861_100022771 3300005719 Bacteria 4517
421 Ga0068861_100069845 3300005719 Bacteria 2718
422 Ga0068851_10003350 3300005834 Bacteria 7127
423 Ga0068851_10010852 3300005834 Bacteria 4259
424 Ga0068851_10016754 3300005834 Bacteria 3510
425 Ga0068851_10025248 3300005834 Bacteria 2914
426 Ga0068851_10120751 3300005834 Bacteria 1408
427 Ga0068863_100000676 3300005841 Bacteria 34484
428 Ga0068863_100015016 3300005841 Bacteria 7439
429 Ga0068863_100018221 3300005841 Bacteria 6723
430 Ga0068863_100020554 3300005841 Bacteria 6311
431 Ga0068863_100043692 3300005841 Bacteria 4253
432 Ga0068863_100047277 3300005841 Bacteria 4082
433 Ga0068863_100089543 3300005841 Bacteria 2918
434 Ga0068863_100105072 3300005841 Bacteria 2686
435 Ga0068863_100177808 3300005841 Bacteria 2042
436 Ga0068858_100007507 3300005842 Bacteria 10537
437 Ga0068858_100183499 3300005842 Bacteria 1976
438 Ga0068860_100004338 3300005843 Bacteria 14500
439 Ga0068860_100005019 3300005843 Bacteria 13473
440 Ga0068860_100032807 3300005843 Bacteria 4988
441 Ga0068860_100034112 3300005843 Bacteria 4881
442 Ga0068860_100048959 3300005843 Bacteria 4028
443 Ga0068860_100074436 3300005843 Bacteria 3230
444 Ga0068862_100000550 3300005844 Bacteria 39321
445 Ga0068862_100001116 3300005844 Bacteria 25466
446 Ga0068862_100024262 3300005844 Bacteria 5088
447 Ga0068862_100028576 3300005844 Bacteria 4698
448 Ga0068862_100048865 3300005844 Bacteria 3613
449 Ga0068862_100531222 3300005844 Bacteria 1121
450 Ga0081455_10000066 3300005937 Bacteria 115221
451 Ga0081455_10001237 3300005937 Bacteria 31932
452 Ga0081539_10001910 3300005985 Bacteria 32284
453 Ga0070717_10002720 3300006028 Bacteria 12482
454 Ga0070717_10003857 3300006028 Bacteria 10783
455 Ga0070717_10048918 3300006028 Bacteria 3470
456 Ga0070717_10472666 3300006028 Bacteria 1131
457 Ga0075365_10060459 3300006038 Bacteria 2528
458 Ga0075363_100011681 3300006048 Bacteria 4213
459 Ga0075363_100147866 3300006048 Bacteria 1325
460 Ga0075364_10026765 3300006051 Bacteria 3682
461 Ga0070716_100073708 3300006173 Bacteria 2015
462 Ga0070716_100147098 3300006173 Bacteria 1510
463 Ga0075369_10052301 3300006186 Bacteria 1771
464 Ga0075366_10012523 3300006195 Bacteria 4812
465 Ga0075366_10099029 3300006195 Bacteria 1749
466 Ga0075366_10101296 3300006195 Bacteria 1728
467 Ga0097621_100005667 3300006237 Bacteria 8814
468 Ga0097621_100029431 3300006237 Bacteria 4337
469 Ga0097621_100038404 3300006237 Bacteria 3842
470 Ga0097621_100054938 3300006237 Bacteria 3250
471 Ga0097621_100213191 3300006237 Bacteria 1680
472 Ga0097621_100219439 3300006237 Bacteria 1656
473 Ga0097621_100490550 3300006237 Bacteria 1112
474 Ga0075370_10004592 3300006353 Bacteria 6734
475 Ga0075370_10008051 3300006353 Bacteria 5408
476 Ga0075370_10026557 3300006353 Bacteria 3208
477 Ga0075370_10090032 3300006353 Bacteria 1770
478 Ga0075370_10110310 3300006353 Bacteria 1597
479 Ga0068871_100000930 3300006358 Bacteria 19543
480 Ga0068871_100053826 3300006358 Bacteria 3263
481 Ga0068871_100054239 3300006358 Bacteria 3251
482 Ga0068871_100148555 3300006358 Bacteria 1997
483 Ga0068871_100169330 3300006358 Bacteria 1871
484 Ga0068871_100201616 3300006358 Bacteria 1718
485 Ga0075428_100317283 3300006844 Bacteria 1675
486 Ga0075430_100006474 3300006846 Bacteria 9869
487 Ga0075430_100028405 3300006846 Bacteria 4753
488 Ga0075430_100274356 3300006846 Bacteria 1395
489 Ga0075431_100019689 3300006847 Bacteria 6886
490 Ga0075431_100032826 3300006847 Bacteria 5350
491 Ga0075431_100057239 3300006847 Bacteria 4020
492 Ga0075433_10023918 3300006852 Bacteria 5149
493 Ga0075434_100438413 3300006871 Bacteria 1327
494 Ga0075429_100168055 3300006880 Bacteria 1921
495 Ga0068865_100038247 3300006881 Bacteria 3246
496 Ga0068865_100087868 3300006881 Bacteria 2247
497 Ga0075436_100038337 3300006914 Bacteria 3307
498 Ga0097620_100003324 3300006931 Bacteria 16345
499 Ga0097620_100013909 3300006931 Bacteria 8073
500 Ga0097620_100018020 3300006931 Bacteria 7096
501 Ga0097620_100034393 3300006931 Bacteria 5086
502 Ga0097620_100091464 3300006931 Bacteria 3093
503 Ga0079104_1016454 3300006946 Bacteria 2162
504 Ga0075435_100062520 3300007076 Bacteria 3021
505 Ga0075435_100240315 3300007076 Bacteria 1540
506 Ga0099794_10007575 3300007265 Bacteria 4466
507 Ga0099795_10000375 3300007788 Bacteria 8070
508 Ga0105240_10001797 3300009093 Bacteria 36111
509 Ga0105240_10004421 3300009093 Bacteria 21431
510 Ga0105240_10023500 3300009093 Bacteria 8149
511 Ga0105240_10028258 3300009093 Bacteria 7327
512 Ga0105240_10039469 3300009093 Bacteria 6046
513 Ga0105240_10068076 3300009093 Bacteria 4411
514 Ga0105240_10140267 3300009093 Bacteria 2890
515 Ga0105240_10195986 3300009093 Bacteria 2372
516 Ga0105240_10263066 3300009093 Bacteria 1989
517 Ga0105240_10306918 3300009093 Bacteria 1814
518 Ga0105240_10656185 3300009093 Bacteria 1149
519 Ga0111539_10057264 3300009094 Bacteria 4629
520 Ga0105245_10015709 3300009098 Bacteria 6601
521 Ga0105245_10272104 3300009098 Bacteria 1652
522 Ga0105247_10055366 3300009101 Bacteria 2448
523 Ga0114129_10010131 3300009147 Bacteria 13436
524 Ga0114129_10028488 3300009147 Bacteria 7914
525 Ga0114129_10110971 3300009147 Bacteria 3785
526 Ga0114129_10199985 3300009147 Bacteria 2707
527 Ga0114129_10596294 3300009147 Bacteria 1432
528 Ga0105243_10098111 3300009148 Bacteria 2426
529 Ga0105243_10142412 3300009148 Bacteria 2047
530 Ga0105241_10016286 3300009174 Bacteria 5448
531 Ga0105241_10023539 3300009174 Bacteria 4568
532 Ga0105241_10214386 3300009174 Bacteria 1615
533 Ga0105241_10290255 3300009174 Bacteria 1400
534 Ga0105242_10140285 3300009176 Bacteria 2096
535 Ga0105248_10001300 3300009177 Bacteria 27811
536 Ga0105248_10003092 3300009177 Bacteria 18448
537 Ga0105248_10011726 3300009177 Bacteria 9665
538 Ga0105248_10038844 3300009177 Bacteria 5329
539 Ga0105248_10075626 3300009177 Bacteria 3785
540 Ga0105248_10145097 3300009177 Bacteria 2678
541 Ga0105248_10224022 3300009177 Bacteria 2117
542 Ga0105248_10253051 3300009177 Bacteria 1982
543 Ga0105248_10295518 3300009177 Bacteria 1824
544 Ga0105248_10399827 3300009177 Bacteria 1547
545 Ga0105248_10436412 3300009177 Bacteria 1475
546 Ga0105237_10020873 3300009545 Bacteria 6744
547 Ga0105237_10046769 3300009545 Bacteria 4352
548 Ga0105237_10060291 3300009545 Bacteria 3796
549 Ga0105237_10061882 3300009545 Bacteria 3741
550 Ga0105237_10113145 3300009545 Bacteria 2706
551 Ga0105237_10248072 3300009545 Bacteria 1782
552 Ga0105237_10396390 3300009545 Bacteria 1385
553 Ga0105237_10422306 3300009545 Bacteria 1339
554 Ga0105238_10000864 3300009551 Bacteria 31302
555 Ga0105238_10003335 3300009551 Bacteria 16027
556 Ga0105238_10010092 3300009551 Bacteria 9469
557 Ga0105238_10057176 3300009551 Bacteria 3911
558 Ga0105238_10071848 3300009551 Bacteria 3457
559 Ga0105238_10078033 3300009551 Bacteria 3303
560 Ga0105238_10141550 3300009551 Bacteria 2382
561 Ga0105238_10141928 3300009551 Bacteria 2378
562 Ga0105238_10154215 3300009551 Bacteria 2272
563 Ga0105238_10161842 3300009551 Bacteria 2214
564 Ga0105238_10208849 3300009551 Bacteria 1928
565 Ga0105238_10239149 3300009551 Bacteria 1793
566 Ga0105238_10362978 3300009551 Bacteria 1438
567 Ga0105249_10000195 3300009553 Bacteria 69709
568 Ga0105249_10021588 3300009553 Bacteria 5764
569 Ga0105249_10028673 3300009553 Bacteria 5024
570 Ga0105249_10078976 3300009553 Bacteria 3054
571 Ga0099796_10000691 3300010159 Bacteria 5949
572 Ga0105239_10029266 3300010375 Bacteria 6057
573 Ga0105239_10048993 3300010375 Bacteria 4632
574 Ga0105239_10067091 3300010375 Bacteria 3941
575 Ga0105239_10082305 3300010375 Bacteria 3544
576 Ga0105239_10090653 3300010375 Bacteria 3373
577 Ga0105239_10096260 3300010375 Bacteria 3271
578 Ga0105239_10122764 3300010375 Bacteria 2886
579 Ga0105246_10043591 3300011119 Bacteria 3045
580 Ga0105246_10243297 3300011119 Bacteria 1424
581 Ga0157373_10011386 3300013100 Bacteria 6541
582 Ga0157373_10012292 3300013100 Bacteria 6294
583 Ga0157373_10022939 3300013100 Bacteria 4526
584 Ga0157373_10036718 3300013100 Bacteria 3514
585 Ga0157373_10062337 3300013100 Bacteria 2641
586 Ga0157373_10084911 3300013100 Bacteria 2231
587 Ga0157373_10113382 3300013100 Bacteria 1905
588 Ga0157373_10129460 3300013100 Bacteria 1775
589 Ga0157373_10158310 3300013100 Bacteria 1593
590 Ga0157371_10001396 3300013102 Bacteria 25235
591 Ga0157371_10083526 3300013102 Bacteria 2261
592 Ga0157371_10092881 3300013102 Bacteria 2138
593 Ga0157371_10093688 3300013102 Bacteria 2128
594 Ga0157371_10120715 3300013102 Bacteria 1863
595 Ga0157371_10125727 3300013102 Bacteria 1823
596 Ga0157370_10000793 3300013104 Bacteria 39742
597 Ga0157370_10006992 3300013104 Bacteria 12321
598 Ga0157370_10007658 3300013104 Bacteria 11722
599 Ga0157370_10017138 3300013104 Bacteria 7314
600 Ga0157370_10112349 3300013104 Bacteria 2546
601 Ga0157370_10128016 3300013104 Bacteria 2370
602 Ga0157370_10145186 3300013104 Bacteria 2210
603 Ga0157370_10179950 3300013104 Bacteria 1965
604 Ga0157370_10181923 3300013104 Bacteria 1953
605 Ga0157370_10285818 3300013104 Bacteria 1524
606 Ga0157370_10323000 3300013104 Bacteria 1423
607 Ga0157370_10383065 3300013104 Bacteria 1295
608 Ga0157369_10000185 3300013105 Bacteria 86285
609 Ga0157369_10004153 3300013105 Bacteria 17157
610 Ga0157369_10008454 3300013105 Bacteria 11806
611 Ga0157369_10040968 3300013105 Bacteria 5055
612 Ga0157369_10065759 3300013105 Bacteria 3902
613 Ga0157369_10135362 3300013105 Bacteria 2609
614 Ga0157369_10509066 3300013105 Bacteria 1245
615 Ga0157374_10019967 3300013296 Bacteria 5940
616 Ga0157374_10034227 3300013296 Bacteria 4638
617 Ga0157374_10080136 3300013296 Bacteria 3096
618 Ga0157374_10086107 3300013296 Bacteria 2989
619 Ga0157374_10090083 3300013296 Bacteria 2924
620 Ga0157374_10107629 3300013296 Bacteria 2679
621 Ga0157374_10137624 3300013296 Bacteria 2369
622 Ga0157374_10175451 3300013296 Bacteria 2092
623 Ga0157374_10401366 3300013296 Bacteria 1368
624 Ga0157378_10034473 3300013297 Bacteria 4476
625 Ga0157378_10214988 3300013297 Bacteria 1825
626 Ga0157378_10341662 3300013297 Bacteria 1460
627 Ga0163162_10000021 3300013306 Bacteria 214873
628 Ga0163162_10081285 3300013306 Bacteria 3311
629 Ga0163162_10815076 3300013306 Bacteria 1050
630 Ga0157372_10002671 3300013307 Bacteria 19288
631 Ga0157372_10024015 3300013307 Bacteria 6614
632 Ga0157372_10025492 3300013307 Bacteria 6430
633 Ga0157372_10026197 3300013307 Bacteria 6344
634 Ga0157372_10059284 3300013307 Bacteria 4281
635 Ga0157372_10101095 3300013307 Bacteria 3291
636 Ga0157372_10104398 3300013307 Bacteria 3239
637 Ga0157372_10120965 3300013307 Bacteria 3007
638 Ga0157372_10142936 3300013307 Bacteria 2759
639 Ga0157372_10193241 3300013307 Bacteria 2357
640 Ga0157372_10201177 3300013307 Bacteria 2307
641 Ga0157372_10232360 3300013307 Bacteria 2138
642 Ga0157372_10252443 3300013307 Bacteria 2047
643 Ga0157372_10280912 3300013307 Bacteria 1936
644 Ga0157372_10454398 3300013307 Bacteria 1493
645 Ga0157375_10002586 3300013308 Bacteria 15714
646 Ga0157375_10007788 3300013308 Bacteria 9371
647 Ga0157375_10019559 3300013308 Bacteria 6163
648 Ga0157375_10036322 3300013308 Bacteria 4713
649 Ga0157375_10054977 3300013308 Bacteria 3923
650 Ga0157375_10078869 3300013308 Bacteria 3327
651 Ga0157375_10173230 3300013308 Bacteria 2306
652 Ga0163163_10000132 3300014325 Bacteria 76574
653 Ga0163163_10001449 3300014325 Bacteria 20042
654 Ga0163163_10036340 3300014325 Bacteria 4784
655 Ga0163163_10130413 3300014325 Bacteria 2554
656 Ga0163163_10228447 3300014325 Bacteria 1910
657 Ga0163163_10400697 3300014325 Bacteria 1430
658 Ga0163163_10458181 3300014325 Bacteria 1335
659 Ga0157380_10000114 3300014326 Bacteria 44326
660 Ga0157380_10040570 3300014326 Bacteria 3626
661 Ga0182008_10008704 3300014497 Bacteria 5520
662 Ga0182008_10008890 3300014497 Bacteria 5449
663 Ga0157377_10057967 3300014745 Bacteria 2204
664 Ga0157379_10000505 3300014968 Bacteria 31681
665 Ga0157379_10009200 3300014968 Bacteria 8602
666 Ga0157379_10017855 3300014968 Bacteria 6250
667 Ga0157379_10224730 3300014968 Bacteria 1701
668 Ga0157376_10002600 3300014969 Bacteria 12261
669 Ga0157376_10030928 3300014969 Bacteria 4280
670 Ga0157376_10042383 3300014969 Bacteria 3731
671 Ga0157376_10100800 3300014969 Bacteria 2522
672 Ga0157376_10129041 3300014969 Bacteria 2253
673 Ga0157376_10240571 3300014969 Bacteria 1686
674 Ga0157376_10571598 3300014969 Bacteria 1121
675 Ga0182006_1000161 3300015261 Bacteria 71421
676 Ga0182006_1022511 3300015261 Bacteria 2619
677 Ga0182007_10009993 3300015262 Bacteria 3779
678 Ga0182007_10031769 3300015262 Bacteria 1796
679 Ga0182005_1004688 3300015265 Bacteria 4370
680 Ga0182005_1004909 3300015265 Bacteria 4240
681 Ga0183368_1003 3300015687 Bacteria 1276390
682 Ga0163161_10046242 3300017792 Bacteria 3140
683 Ga0163161_10131379 3300017792 Bacteria 1889
684 Ga0163161_10188067 3300017792 Bacteria 1586
685 Ga0206356_10235604 3300020070 Bacteria 4662
686 Ga0206351_10193420 3300020077 Bacteria 1538
687 Ga0206354_10341756 3300020081 Bacteria 6982
688 Ga0206353_10095998 3300020082 Bacteria 1425
689 Ga0154015_1244858 3300020610 Bacteria 5504
690 Ga0154015_1402022 3300020610 Bacteria 3567
691 Ga0213873_10024325 3300021358 Bacteria 1453
692 Ga0213874_10033033 3300021377 Bacteria 1506
693 Ga0213876_10011988 3300021384 Bacteria 4618
694 Ga0213876_10023781 3300021384 Bacteria 3235
695 Ga0209435_100008 3300025206 Bacteria 503644
696 Ga0209436_110535 3300025208 Bacteria 1685
697 Ga0209566_100231 3300025225 Bacteria 54215
698 Ga0209674_100003 3300025226 Bacteria 2196646
699 Ga0209674_100086 3300025226 Bacteria 187776
700 Ga0209674_100488 3300025226 Bacteria 16850
701 Ga0209674_100751 3300025226 Bacteria 10993
702 Ga0209672_100020 3300025228 Bacteria 429003
703 Ga0209672_100029 3300025228 Bacteria 339298
704 Ga0209672_100049 3300025228 Bacteria 238787
705 Ga0209672_100066 3300025228 Bacteria 189828
706 Ga0209147_100024 3300025229 Bacteria 429003
707 Ga0209147_100084 3300025229 Bacteria 189828
708 Ga0209563_100010 3300025230 Bacteria 1337457
709 Ga0209563_100051 3300025230 Bacteria 340545
710 Ga0207427_100117 3300025231 Bacteria 102251
711 Ga0207427_100178 3300025231 Bacteria 67956
712 Ga0207427_101735 3300025231 Bacteria 7170
713 Ga0207427_102934 3300025231 Bacteria 4003
714 Ga0209437_100240 3300025233 Bacteria 89740
715 Ga0209437_100304 3300025233 Bacteria 67955
716 Ga0209437_100482 3300025233 Bacteria 30012
717 Ga0209437_101084 3300025233 Bacteria 8725
718 Ga0209258_100053 3300025242 Bacteria 339233
719 Ga0209258_100084 3300025242 Bacteria 244783
720 Ga0209258_100087 3300025242 Bacteria 238787
721 Ga0209258_100117 3300025242 Bacteria 189828
722 Ga0209258_100144 3300025242 Bacteria 163814
723 Ga0209258_100647 3300025242 Bacteria 25954
724 Ga0209258_102270 3300025242 Bacteria 5161
725 Ga0207425_1010948 3300025245 Bacteria 2187
726 Ga0209646_1000029 3300025246 Bacteria 386414
727 Ga0209646_1000066 3300025246 Bacteria 244823
728 Ga0209026_1000016 3300025250 Bacteria 386457
729 Ga0209026_1000027 3300025250 Bacteria 351282
730 Ga0209026_1000074 3300025250 Bacteria 203820
731 Ga0209026_1000093 3300025250 Bacteria 170393
732 Ga0209026_1001064 3300025250 Bacteria 13335
733 Ga0209677_100044 3300025253 Bacteria 215799
734 Ga0209677_100128 3300025253 Bacteria 76547
735 Ga0209677_101339 3300025253 Bacteria 10829
736 Ga0209677_102377 3300025253 Bacteria 7181
737 Ga0209148_1000009 3300025254 Bacteria 1395625
738 Ga0209148_1000055 3300025254 Bacteria 367500
739 Ga0209148_1000096 3300025254 Bacteria 238787
740 Ga0209148_1000114 3300025254 Bacteria 192073
741 Ga0209148_1000141 3300025254 Bacteria 163821
742 Ga0209148_1000148 3300025254 Bacteria 159642
743 Ga0209148_1001683 3300025254 Bacteria 9898
744 Ga0209759_1000016 3300025256 Bacteria 386414
745 Ga0209759_1000110 3300025256 Bacteria 144917
746 Ga0209759_1000387 3300025256 Bacteria 55041
747 Ga0209759_1006844 3300025256 Bacteria 3771
748 Ga0209759_1008612 3300025256 Bacteria 3163
749 Ga0209129_1009361 3300025258 Bacteria 2593
750 Ga0209233_1000083 3300025261 Bacteria 336016
751 Ga0209233_1000287 3300025261 Bacteria 67956
752 Ga0209233_1000417 3300025261 Bacteria 32180
753 Ga0209565_1000041 3300025263 Bacteria 251081
754 Ga0209565_1000597 3300025263 Bacteria 24336
755 Ga0209565_1003353 3300025263 Bacteria 5227
756 Ga0209565_1008241 3300025263 Bacteria 2744
757 Ga0209455_1000060 3300025272 Bacteria 339298
758 Ga0209455_1000088 3300025272 Bacteria 238787
759 Ga0209455_1000110 3300025272 Bacteria 189828
760 Ga0209455_1003953 3300025272 Bacteria 5034
761 Ga0209673_1000057 3300025273 Bacteria 270150
762 Ga0209673_1001316 3300025273 Bacteria 25092
763 Ga0209673_1002473 3300025273 Bacteria 12777
764 Ga0209130_1000014 3300025284 Bacteria 412039
765 Ga0209130_1003456 3300025284 Bacteria 6687
766 Ga0209130_1005797 3300025284 Bacteria 4179
767 Ga0209675_1000783 3300025291 Bacteria 21160
768 Ga0209675_1010551 3300025291 Bacteria 3142
769 Ga0209675_1012756 3300025291 Bacteria 2682
770 Ga0209676_1000013 3300025292 Bacteria 816080
771 Ga0209676_1000153 3300025292 Bacteria 166393
772 Ga0209676_1000414 3300025292 Bacteria 76877
773 Ga0209676_1000928 3300025292 Bacteria 36206
774 Ga0209676_1000971 3300025292 Bacteria 34521
775 Ga0209676_1001166 3300025292 Bacteria 28483
776 Ga0209676_1002764 3300025292 Bacteria 11730
777 Ga0209676_1005511 3300025292 Bacteria 6581
778 Ga0209025_1000819 3300025294 Bacteria 49669
779 Ga0209025_1003991 3300025294 Bacteria 13248
780 Ga0209025_1013203 3300025294 Bacteria 5213
781 Ga0209564_1001403 3300025295 Bacteria 24959
782 Ga0209564_1002122 3300025295 Bacteria 16818
783 Ga0209564_1004135 3300025295 Bacteria 9106
784 Ga0209564_1005783 3300025295 Bacteria 6903
785 Ga0209564_1013128 3300025295 Bacteria 3545
786 Ga0209564_1017578 3300025295 Bacteria 2778
787 Ga0209758_1004353 3300025297 Bacteria 11861
788 Ga0209758_1004543 3300025297 Bacteria 11461
789 Ga0209758_1010044 3300025297 Bacteria 5742
790 Ga0209758_1032092 3300025297 Bacteria 2140
791 Ga0209050_1000008 3300025298 Bacteria 1144179
792 Ga0209050_1001001 3300025298 Bacteria 35419
793 Ga0209050_1001040 3300025298 Bacteria 34383
794 Ga0209050_1002812 3300025298 Bacteria 13901
795 Ga0209050_1005563 3300025298 Bacteria 7842
796 Ga0209050_1006477 3300025298 Bacteria 6914
797 Ga0209050_1012340 3300025298 Bacteria 3929
798 Ga0209050_1013887 3300025298 Bacteria 3528
799 Ga0209256_1000039 3300025299 Bacteria 372337
800 Ga0209256_1000670 3300025299 Bacteria 46303
801 Ga0209256_1001995 3300025299 Bacteria 18294
802 Ga0209256_1010505 3300025299 Bacteria 3862
803 Ga0209256_1010741 3300025299 Bacteria 3780
804 Ga0209256_1013905 3300025299 Bacteria 2948
805 Ga0207426_1000174 3300025302 Bacteria 160877
806 Ga0207426_1002190 3300025302 Bacteria 13181
807 Ga0209051_1000005 3300025303 Bacteria 1142353
808 Ga0209051_1000354 3300025303 Bacteria 68119
809 Ga0209051_1001411 3300025303 Bacteria 20636
810 Ga0209051_1011234 3300025303 Bacteria 4441
811 Ga0209051_1017460 3300025303 Bacteria 3205
812 Ga0209257_1000031 3300025304 Bacteria 688770
813 Ga0209257_1000184 3300025304 Bacteria 156438
814 Ga0209257_1000186 3300025304 Bacteria 154365
815 Ga0209257_1000616 3300025304 Bacteria 57900
816 Ga0209257_1000916 3300025304 Bacteria 41029
817 Ga0209257_1001656 3300025304 Bacteria 25301
818 Ga0209257_1002298 3300025304 Bacteria 19395
819 Ga0209257_1002620 3300025304 Bacteria 17370
820 Ga0209257_1008929 3300025304 Bacteria 5515
821 Ga0209257_1015048 3300025304 Bacteria 3258
822 Ga0207697_10000097 3300025315 Bacteria 39643
823 Ga0207697_10010256 3300025315 Bacteria 4012
824 Ga0207697_10028013 3300025315 Bacteria 2303
825 Ga0207656_10001616 3300025321 Bacteria 7495
826 Ga0207656_10020861 3300025321 Bacteria 2609
827 Ga0207656_10029893 3300025321 Bacteria 2247
828 Ga0207656_10089236 3300025321 Bacteria 1397
829 Ga0207682_10000606 3300025893 Bacteria 16672
830 Ga0207682_10009513 3300025893 Bacteria 3835
831 Ga0207688_10000116 3300025901 Bacteria 32495
832 Ga0207680_10017501 3300025903 Bacteria 3788
833 Ga0207647_10001462 3300025904 Bacteria 18164
834 Ga0207647_10001869 3300025904 Bacteria 16121
835 Ga0207647_10006674 3300025904 Bacteria 8386
836 Ga0207647_10008408 3300025904 Bacteria 7401
837 Ga0207647_10015485 3300025904 Bacteria 5225
838 Ga0207647_10050884 3300025904 Bacteria 2563
839 Ga0207647_10064672 3300025904 Bacteria 2222
840 Ga0207699_10007949 3300025906 Bacteria 5205
841 Ga0207645_10000751 3300025907 Bacteria 26990
842 Ga0207645_10049349 3300025907 Bacteria 2687
843 Ga0207643_10000178 3300025908 Bacteria 43423
844 Ga0207643_10073745 3300025908 Bacteria 1968
845 Ga0207705_10000003 3300025909 Bacteria 709270
846 Ga0207705_10000131 3300025909 Bacteria 81639
847 Ga0207705_10000146 3300025909 Bacteria 75353
848 Ga0207705_10003397 3300025909 Bacteria 12105
849 Ga0207705_10003406 3300025909 Bacteria 12091
850 Ga0207705_10003729 3300025909 Bacteria 11600
851 Ga0207705_10005607 3300025909 Bacteria 9379
852 Ga0207705_10007205 3300025909 Bacteria 8191
853 Ga0207705_10008024 3300025909 Bacteria 7740
854 Ga0207705_10008884 3300025909 Bacteria 7323
855 Ga0207705_10020214 3300025909 Bacteria 4763
856 Ga0207705_10033292 3300025909 Bacteria 3681
857 Ga0207705_10061477 3300025909 Bacteria 2713
858 Ga0207705_10075461 3300025909 Bacteria 2449
859 Ga0207705_10097427 3300025909 Bacteria 2160
860 Ga0207654_10012458 3300025911 Bacteria 4357
861 Ga0207654_10107726 3300025911 Bacteria 1728
862 Ga0207654_10192013 3300025911 Bacteria 1339
863 Ga0207707_10000168 3300025912 Bacteria 68834
864 Ga0207707_10000215 3300025912 Bacteria 61846
865 Ga0207707_10006842 3300025912 Bacteria 9942
866 Ga0207707_10006998 3300025912 Bacteria 9840
867 Ga0207707_10014027 3300025912 Bacteria 6986
868 Ga0207707_10014706 3300025912 Bacteria 6819
869 Ga0207707_10033686 3300025912 Bacteria 4482
870 Ga0207707_10036106 3300025912 Bacteria 4322
871 Ga0207707_10078805 3300025912 Bacteria 2877
872 Ga0207707_10110001 3300025912 Bacteria 2408
873 Ga0207707_10170473 3300025912 Bacteria 1902
874 Ga0207707_10238315 3300025912 Bacteria 1582
875 Ga0207695_10001113 3300025913 Bacteria 46732
876 Ga0207695_10001799 3300025913 Bacteria 33835
877 Ga0207695_10006878 3300025913 Bacteria 14637
878 Ga0207695_10015367 3300025913 Bacteria 9013
879 Ga0207695_10022510 3300025913 Bacteria 7151
880 Ga0207695_10027319 3300025913 Bacteria 6357
881 Ga0207695_10030192 3300025913 Bacteria 5971
882 Ga0207695_10035912 3300025913 Bacteria 5365
883 Ga0207695_10148734 3300025913 Bacteria 2283
884 Ga0207695_10159823 3300025913 Bacteria 2185
885 Ga0207695_10163005 3300025913 Bacteria 2160
886 Ga0207695_10165850 3300025913 Bacteria 2137
887 Ga0207695_10166453 3300025913 Bacteria 2132
888 Ga0207671_10021180 3300025914 Bacteria 4938
889 Ga0207671_10136168 3300025914 Bacteria 1888
890 Ga0207671_10213308 3300025914 Bacteria 1511
891 Ga0207671_10217718 3300025914 Bacteria 1495
892 Ga0207693_10067411 3300025915 Bacteria 2802
893 Ga0207693_10206708 3300025915 Bacteria 1543
894 Ga0207660_10000227 3300025917 Bacteria 36209
895 Ga0207660_10002134 3300025917 Bacteria 13125
896 Ga0207660_10003818 3300025917 Bacteria 9817
897 Ga0207660_10004969 3300025917 Bacteria 8668
898 Ga0207660_10005823 3300025917 Bacteria 7997
899 Ga0207660_10017556 3300025917 Bacteria 4756
900 Ga0207660_10083176 3300025917 Bacteria 2356
901 Ga0207660_10117507 3300025917 Bacteria 2010
902 Ga0207660_10139263 3300025917 Bacteria 1854
903 Ga0207662_10015909 3300025918 Bacteria 4238
904 Ga0207657_10000003 3300025919 Bacteria 263148
905 Ga0207657_10001611 3300025919 Bacteria 24269
906 Ga0207657_10001988 3300025919 Bacteria 22083
907 Ga0207657_10005362 3300025919 Bacteria 13431
908 Ga0207657_10006429 3300025919 Bacteria 12187
909 Ga0207657_10006601 3300025919 Bacteria 12014
910 Ga0207657_10007281 3300025919 Bacteria 11357
911 Ga0207657_10008053 3300025919 Bacteria 10745
912 Ga0207657_10009315 3300025919 Bacteria 9889
913 Ga0207657_10009409 3300025919 Bacteria 9822
914 Ga0207657_10011673 3300025919 Bacteria 8707
915 Ga0207657_10015108 3300025919 Bacteria 7499
916 Ga0207657_10043281 3300025919 Bacteria 3968
917 Ga0207657_10119040 3300025919 Bacteria 2174
918 Ga0207657_10169956 3300025919 Bacteria 1767
919 Ga0207657_10174880 3300025919 Bacteria 1738
920 Ga0207657_10182020 3300025919 Bacteria 1698
921 Ga0207657_10342971 3300025919 Bacteria 1179
922 Ga0207649_10000589 3300025920 Bacteria 24693
923 Ga0207649_10001798 3300025920 Bacteria 12268
924 Ga0207649_10003120 3300025920 Bacteria 9093
925 Ga0207649_10022398 3300025920 Bacteria 3649
926 Ga0207649_10029248 3300025920 Bacteria 3253
927 Ga0207649_10030793 3300025920 Bacteria 3182
928 Ga0207649_10054677 3300025920 Bacteria 2485
929 Ga0207649_10056667 3300025920 Bacteria 2448
930 Ga0207649_10060806 3300025920 Bacteria 2375
931 Ga0207649_10173575 3300025920 Bacteria 1503
932 Ga0207652_10000158 3300025921 Bacteria 73781
933 Ga0207652_10000282 3300025921 Bacteria 52954
934 Ga0207652_10000956 3300025921 Bacteria 27067
935 Ga0207652_10004584 3300025921 Bacteria 11210
936 Ga0207652_10005330 3300025921 Bacteria 10426
937 Ga0207652_10007449 3300025921 Bacteria 8819
938 Ga0207652_10012340 3300025921 Bacteria 6903
939 Ga0207652_10028196 3300025921 Bacteria 4683
940 Ga0207652_10061330 3300025921 Bacteria 3247
941 Ga0207652_10094510 3300025921 Bacteria 2632
942 Ga0207652_10129621 3300025921 Bacteria 2249
943 Ga0207652_10247259 3300025921 Bacteria 1608
944 Ga0207652_10277873 3300025921 Bacteria 1511
945 Ga0207681_10007817 3300025923 Bacteria 6550
946 Ga0207681_10022395 3300025923 Bacteria 4030
947 Ga0207681_10045690 3300025923 Bacteria 2942
948 Ga0207681_10050848 3300025923 Bacteria 2805
949 Ga0207681_10084941 3300025923 Bacteria 2245
950 Ga0207681_10136124 3300025923 Bacteria 1823
951 Ga0207681_10137195 3300025923 Bacteria 1817
952 Ga0207694_10002683 3300025924 Bacteria 14405
953 Ga0207694_10005613 3300025924 Bacteria 9616
954 Ga0207694_10008293 3300025924 Bacteria 7854
955 Ga0207694_10024724 3300025924 Bacteria 4563
956 Ga0207694_10062475 3300025924 Bacteria 2900
957 Ga0207694_10138033 3300025924 Bacteria 1959
958 Ga0207694_10175408 3300025924 Bacteria 1737
959 Ga0207694_10195737 3300025924 Bacteria 1643
960 Ga0207694_10203323 3300025924 Bacteria 1612
961 Ga0207650_10000003 3300025925 Bacteria 1123235
962 Ga0207650_10002909 3300025925 Bacteria 11821
963 Ga0207650_10008403 3300025925 Bacteria 7047
964 Ga0207650_10032987 3300025925 Bacteria 3748
965 Ga0207650_10033415 3300025925 Bacteria 3725
966 Ga0207650_10055555 3300025925 Bacteria 2939
967 Ga0207650_10105568 3300025925 Bacteria 2175
968 Ga0207650_10185133 3300025925 Bacteria 1661
969 Ga0207650_10318920 3300025925 Bacteria 1272
970 Ga0207650_10413278 3300025925 Bacteria 1118
971 Ga0207659_10004458 3300025926 Bacteria 8474
972 Ga0207659_10017662 3300025926 Bacteria 4662
973 Ga0207659_10202659 3300025926 Bacteria 1586
974 Ga0207687_10000298 3300025927 Bacteria 33998
975 Ga0207687_10061436 3300025927 Bacteria 2654
976 Ga0207700_10030366 3300025928 Bacteria 3827
977 Ga0207700_10033041 3300025928 Bacteria 3699
978 Ga0207700_10059559 3300025928 Bacteria 2888
979 Ga0207700_10154748 3300025928 Bacteria 1898
980 Ga0207700_10232598 3300025928 Bacteria 1568
981 Ga0207700_10499686 3300025928 Bacteria 1076
982 Ga0207664_10000036 3300025929 Bacteria 173396
983 Ga0207664_10001394 3300025929 Bacteria 15882
984 Ga0207664_10011395 3300025929 Bacteria 6318
985 Ga0207664_10015374 3300025929 Bacteria 5552
986 Ga0207664_10029328 3300025929 Bacteria 4190
987 Ga0207664_10051411 3300025929 Bacteria 3253
988 Ga0207664_10260182 3300025929 Bacteria 1517
989 Ga0207644_10000055 3300025931 Bacteria 84281
990 Ga0207644_10000272 3300025931 Bacteria 34285
991 Ga0207644_10003350 3300025931 Bacteria 10337
992 Ga0207644_10050006 3300025931 Bacteria 2995
993 Ga0207644_10081484 3300025931 Bacteria 2391
994 Ga0207644_10095215 3300025931 Bacteria 2226
995 Ga0207644_10117940 3300025931 Bacteria 2016
996 Ga0207644_10216232 3300025931 Bacteria 1517
997 Ga0207644_10233212 3300025931 Bacteria 1463
998 Ga0207690_10000007 3300025932 Bacteria 388533
999 Ga0207690_10000839 3300025932 Bacteria 19670
1000 Ga0207690_10000957 3300025932 Bacteria 18474
1001 Ga0207690_10001891 3300025932 Bacteria 12848
1002 Ga0207690_10002067 3300025932 Bacteria 12299
1003 Ga0207690_10002972 3300025932 Bacteria 10206
1004 Ga0207690_10004750 3300025932 Bacteria 8019
1005 Ga0207690_10016359 3300025932 Bacteria 4510
1006 Ga0207690_10041918 3300025932 Bacteria 3003
1007 Ga0207690_10121720 3300025932 Bacteria 1897
1008 Ga0207690_10197854 3300025932 Bacteria 1524
1009 Ga0207690_10372173 3300025932 Bacteria 1133
1010 Ga0207706_10000267 3300025933 Bacteria 56832
1011 Ga0207706_10004822 3300025933 Bacteria 12636
1012 Ga0207706_10007955 3300025933 Bacteria 9789
1013 Ga0207706_10022681 3300025933 Bacteria 5635
1014 Ga0207706_10117762 3300025933 Bacteria 2336
1015 Ga0207706_10267750 3300025933 Bacteria 1491
1016 Ga0207709_10002291 3300025935 Bacteria 12149
1017 Ga0207709_10101806 3300025935 Bacteria 1900
1018 Ga0207709_10372408 3300025935 Bacteria 1084
1019 Ga0207670_10000036 3300025936 Bacteria 106829
1020 Ga0207670_10017186 3300025936 Bacteria 4368
1021 Ga0207670_10028630 3300025936 Bacteria 3540
1022 Ga0207670_10033733 3300025936 Bacteria 3301
1023 Ga0207670_10037814 3300025936 Bacteria 3148
1024 Ga0207669_10061952 3300025937 Bacteria 2301
1025 Ga0207669_10083924 3300025937 Bacteria 2050
1026 Ga0207704_10125238 3300025938 Bacteria 1768
1027 Ga0207665_10056330 3300025939 Bacteria 2653
1028 Ga0207665_10073092 3300025939 Bacteria 2344
1029 Ga0207691_10010387 3300025940 Bacteria 8932
1030 Ga0207691_10011417 3300025940 Bacteria 8523
1031 Ga0207691_10013709 3300025940 Bacteria 7745
1032 Ga0207691_10019796 3300025940 Bacteria 6366
1033 Ga0207691_10020605 3300025940 Bacteria 6234
1034 Ga0207691_10045931 3300025940 Bacteria 4015
1035 Ga0207691_10052482 3300025940 Bacteria 3724
1036 Ga0207691_10131637 3300025940 Bacteria 2209
1037 Ga0207711_10000855 3300025941 Bacteria 29447
1038 Ga0207711_10000945 3300025941 Bacteria 27919
1039 Ga0207711_10013434 3300025941 Bacteria 6802
1040 Ga0207711_10013551 3300025941 Bacteria 6770
1041 Ga0207711_10022316 3300025941 Bacteria 5292
1042 Ga0207711_10070317 3300025941 Bacteria 3035
1043 Ga0207711_10287045 3300025941 Bacteria 1516
1044 Ga0207689_10000289 3300025942 Bacteria 45719
1045 Ga0207689_10046883 3300025942 Bacteria 3570
1046 Ga0207689_10118439 3300025942 Bacteria 2178
1047 Ga0207689_10265165 3300025942 Bacteria 1421
1048 Ga0207661_10009656 3300025944 Bacteria 6928
1049 Ga0207661_10030731 3300025944 Bacteria 4140
1050 Ga0207661_10143425 3300025944 Bacteria 2058
1051 Ga0207661_10313935 3300025944 Bacteria 1408
1052 Ga0207679_10000467 3300025945 Bacteria 28304
1053 Ga0207679_10004621 3300025945 Bacteria 8574
1054 Ga0207679_10007563 3300025945 Bacteria 6897
1055 Ga0207679_10023274 3300025945 Bacteria 4232
1056 Ga0207679_10034382 3300025945 Bacteria 3575
1057 Ga0207679_10043417 3300025945 Bacteria 3237
1058 Ga0207679_10088413 3300025945 Bacteria 2389
1059 Ga0207679_10182615 3300025945 Bacteria 1737
1060 Ga0207667_10000007 3300025949 Bacteria 630590
1061 Ga0207667_10000586 3300025949 Bacteria 47384
1062 Ga0207667_10001159 3300025949 Bacteria 33115
1063 Ga0207667_10001393 3300025949 Bacteria 30322
1064 Ga0207667_10003714 3300025949 Bacteria 18825
1065 Ga0207667_10005210 3300025949 Bacteria 15866
1066 Ga0207667_10014484 3300025949 Bacteria 8988
1067 Ga0207667_10016531 3300025949 Bacteria 8334
1068 Ga0207667_10020707 3300025949 Bacteria 7309
1069 Ga0207667_10022920 3300025949 Bacteria 6883
1070 Ga0207667_10023090 3300025949 Bacteria 6853
1071 Ga0207667_10032515 3300025949 Bacteria 5620
1072 Ga0207667_10058758 3300025949 Bacteria 4032
1073 Ga0207667_10091006 3300025949 Bacteria 3152
1074 Ga0207667_10099628 3300025949 Bacteria 2998
1075 Ga0207667_10104865 3300025949 Bacteria 2916
1076 Ga0207667_10114164 3300025949 Bacteria 2784
1077 Ga0207667_10118201 3300025949 Bacteria 2732
1078 Ga0207667_10288238 3300025949 Bacteria 1678
1079 Ga0207667_10350065 3300025949 Bacteria 1507
1080 Ga0207667_10408828 3300025949 Bacteria 1382
1081 Ga0207651_10001867 3300025960 Bacteria 9849
1082 Ga0207651_10031395 3300025960 Bacteria 3395
1083 Ga0207651_10039497 3300025960 Bacteria 3113
1084 Ga0207651_10056704 3300025960 Bacteria 2697
1085 Ga0207651_10087761 3300025960 Bacteria 2265
1086 Ga0207651_10090027 3300025960 Bacteria 2242
1087 Ga0207712_10003682 3300025961 Bacteria 9667
1088 Ga0207712_10074461 3300025961 Bacteria 2452
1089 Ga0207712_10096205 3300025961 Bacteria 2191
1090 Ga0207668_10039433 3300025972 Bacteria 3179
1091 Ga0207668_10059489 3300025972 Bacteria 2677
1092 Ga0207668_10240923 3300025972 Bacteria 1463
1093 Ga0207640_10000291 3300025981 Bacteria 33599
1094 Ga0207640_10002225 3300025981 Bacteria 10440
1095 Ga0207640_10003065 3300025981 Bacteria 9004
1096 Ga0207640_10004131 3300025981 Bacteria 7839
1097 Ga0207640_10004350 3300025981 Bacteria 7673
1098 Ga0207640_10006559 3300025981 Bacteria 6390
1099 Ga0207640_10006932 3300025981 Bacteria 6233
1100 Ga0207640_10017678 3300025981 Bacteria 4176
1101 Ga0207640_10101615 3300025981 Bacteria 2018
1102 Ga0207640_10132263 3300025981 Bacteria 1805
1103 Ga0207658_10000004 3300025986 Bacteria 569357
1104 Ga0207658_10000640 3300025986 Bacteria 30799
1105 Ga0207658_10002188 3300025986 Bacteria 14529
1106 Ga0207658_10025984 3300025986 Bacteria 4102
1107 Ga0207658_10190401 3300025986 Bacteria 1705
1108 Ga0207658_10192318 3300025986 Bacteria 1697
1109 Ga0207658_10276021 3300025986 Bacteria 1439
1110 Ga0207677_10053833 3300026023 Bacteria 2742
1111 Ga0207677_10070786 3300026023 Bacteria 2459
1112 Ga0207677_10120548 3300026023 Bacteria 1972
1113 Ga0207677_10177041 3300026023 Bacteria 1674
1114 Ga0207703_10131295 3300026035 Bacteria 2163
1115 Ga0207639_10003451 3300026041 Bacteria 10637
1116 Ga0207639_10003476 3300026041 Bacteria 10601
1117 Ga0207639_10009437 3300026041 Bacteria 6733
1118 Ga0207639_10030575 3300026041 Bacteria 3950
1119 Ga0207639_10065211 3300026041 Bacteria 2826
1120 Ga0207639_10070898 3300026041 Bacteria 2724
1121 Ga0207639_10074999 3300026041 Bacteria 2658
1122 Ga0207639_10171253 3300026041 Bacteria 1839
1123 Ga0207639_10171553 3300026041 Bacteria 1837
1124 Ga0207639_10181683 3300026041 Bacteria 1790
1125 Ga0207639_10246362 3300026041 Bacteria 1556
1126 Ga0207639_10301140 3300026041 Bacteria 1417
1127 Ga0207678_10000160 3300026067 Bacteria 55960
1128 Ga0207678_10001430 3300026067 Bacteria 21888
1129 Ga0207678_10001471 3300026067 Bacteria 21592
1130 Ga0207678_10001480 3300026067 Bacteria 21540
1131 Ga0207678_10001640 3300026067 Bacteria 20513
1132 Ga0207678_10001768 3300026067 Bacteria 19781
1133 Ga0207678_10004079 3300026067 Bacteria 13138
1134 Ga0207678_10005267 3300026067 Bacteria 11583
1135 Ga0207678_10006377 3300026067 Bacteria 10473
1136 Ga0207678_10007045 3300026067 Bacteria 9983
1137 Ga0207678_10027423 3300026067 Bacteria 4968
1138 Ga0207678_10048833 3300026067 Bacteria 3657
1139 Ga0207678_10092102 3300026067 Bacteria 2591
1140 Ga0207678_10149634 3300026067 Bacteria 1993
1141 Ga0207678_10232695 3300026067 Bacteria 1578
1142 Ga0207678_10238032 3300026067 Bacteria 1559
1143 Ga0207678_10353405 3300026067 Bacteria 1267
1144 Ga0207708_10000668 3300026075 Bacteria 26303
1145 Ga0207708_10017052 3300026075 Bacteria 5466
1146 Ga0207708_10041195 3300026075 Bacteria 3521
1147 Ga0207708_10119680 3300026075 Bacteria 2051
1148 Ga0207702_10000128 3300026078 Bacteria 89386
1149 Ga0207702_10000244 3300026078 Bacteria 63493
1150 Ga0207702_10000432 3300026078 Bacteria 47878
1151 Ga0207702_10001083 3300026078 Bacteria 27889
1152 Ga0207702_10001776 3300026078 Bacteria 21223
1153 Ga0207702_10002471 3300026078 Bacteria 17479
1154 Ga0207702_10002683 3300026078 Bacteria 16707
1155 Ga0207702_10004484 3300026078 Bacteria 12390
1156 Ga0207702_10008817 3300026078 Bacteria 8502
1157 Ga0207702_10020180 3300026078 Bacteria 5519
1158 Ga0207702_10026919 3300026078 Bacteria 4775
1159 Ga0207702_10142809 3300026078 Bacteria 2168
1160 Ga0207702_10144806 3300026078 Bacteria 2155
1161 Ga0207702_10290341 3300026078 Bacteria 1549
1162 Ga0207702_10311971 3300026078 Bacteria 1496
1163 Ga0207641_10012760 3300026088 Bacteria 6887
1164 Ga0207641_10025413 3300026088 Bacteria 4883
1165 Ga0207641_10029638 3300026088 Bacteria 4526
1166 Ga0207641_10041063 3300026088 Bacteria 3876
1167 Ga0207641_10052892 3300026088 Bacteria 3440
1168 Ga0207641_10055781 3300026088 Bacteria 3355
1169 Ga0207641_10077897 3300026088 Bacteria 2870
1170 Ga0207641_10118221 3300026088 Bacteria 2361
1171 Ga0207641_10134443 3300026088 Bacteria 2224
1172 Ga0207641_10203206 3300026088 Bacteria 1828
1173 Ga0207641_10347728 3300026088 Bacteria 1412
1174 Ga0207648_10002794 3300026089 Bacteria 18520
1175 Ga0207648_10028635 3300026089 Bacteria 4938
1176 Ga0207648_10040163 3300026089 Bacteria 4112
1177 Ga0207648_10083374 3300026089 Bacteria 2788
1178 Ga0207648_10202405 3300026089 Bacteria 1761
1179 Ga0207648_10244865 3300026089 Bacteria 1597
1180 Ga0207648_10312090 3300026089 Bacteria 1412
1181 Ga0207648_10378584 3300026089 Bacteria 1279
1182 Ga0207676_10000003 3300026095 Bacteria 1123235
1183 Ga0207676_10002722 3300026095 Bacteria 12578
1184 Ga0207676_10017485 3300026095 Bacteria 5197
1185 Ga0207676_10048100 3300026095 Bacteria 3309
1186 Ga0207676_10105712 3300026095 Bacteria 2344
1187 Ga0207676_10115176 3300026095 Bacteria 2256
1188 Ga0207676_10207077 3300026095 Bacteria 1737
1189 Ga0207676_10211234 3300026095 Bacteria 1722
1190 Ga0207676_10273043 3300026095 Bacteria 1532
1191 Ga0207674_10000039 3300026116 Bacteria 131096
1192 Ga0207674_10003404 3300026116 Bacteria 19500
1193 Ga0207674_10004794 3300026116 Bacteria 16214
1194 Ga0207674_10005001 3300026116 Bacteria 15848
1195 Ga0207674_10005506 3300026116 Bacteria 15034
1196 Ga0207674_10007751 3300026116 Bacteria 12493
1197 Ga0207674_10008565 3300026116 Bacteria 11793
1198 Ga0207674_10011756 3300026116 Bacteria 9821
1199 Ga0207674_10041750 3300026116 Bacteria 4742
1200 Ga0207674_10051162 3300026116 Bacteria 4216
1201 Ga0207674_10088975 3300026116 Bacteria 3080
1202 Ga0207674_10154524 3300026116 Bacteria 2250
1203 Ga0207675_100003529 3300026118 Bacteria 15257
1204 Ga0207675_100007814 3300026118 Bacteria 10092
1205 Ga0207675_100037403 3300026118 Bacteria 4527
1206 Ga0207675_100045722 3300026118 Bacteria 4090
1207 Ga0207675_100056446 3300026118 Bacteria 3663
1208 Ga0207675_100153901 3300026118 Bacteria 2190
1209 Ga0207675_100161405 3300026118 Bacteria 2138
1210 Ga0207675_100185942 3300026118 Bacteria 1991
1211 Ga0207675_100231854 3300026118 Bacteria 1781
1212 Ga0207683_10003397 3300026121 Bacteria 13869
1213 Ga0207683_10004053 3300026121 Bacteria 12661
1214 Ga0207683_10016296 3300026121 Bacteria 6325
1215 Ga0207683_10028344 3300026121 Bacteria 4842
1216 Ga0207683_10028751 3300026121 Bacteria 4808
1217 Ga0207683_10043033 3300026121 Bacteria 3944
1218 Ga0207683_10145620 3300026121 Bacteria 2136
1219 Ga0207683_10303500 3300026121 Bacteria 1461
1220 Ga0207683_10391103 3300026121 Bacteria 1278
1221 Ga0207698_10000511 3300026142 Bacteria 22568
1222 Ga0207698_10000772 3300026142 Bacteria 18637
1223 Ga0207698_10002291 3300026142 Bacteria 11337
1224 Ga0207698_10005977 3300026142 Bacteria 7563
1225 Ga0207698_10007308 3300026142 Bacteria 6923
1226 Ga0207698_10011617 3300026142 Bacteria 5719
1227 Ga0207698_10014360 3300026142 Bacteria 5262
1228 Ga0207698_10038140 3300026142 Bacteria 3547
1229 Ga0207698_10044515 3300026142 Bacteria 3336
1230 Ga0207698_10165669 3300026142 Bacteria 1939
1231 Ga0207698_10271249 3300026142 Bacteria 1564
1232 Ga0209371_1000402 3300027312 Bacteria 45205
1233 Ga0209969_1002467 3300027360 Bacteria 2558
1234 Ga0209969_1004138 3300027360 Bacteria 2030
1235 Ga0209984_1006643 3300027424 Bacteria 1423
1236 Ga0210000_1002839 3300027462 Bacteria 2473
1237 Ga0209179_1001067 3300027512 Bacteria 3176
1238 Ga0209968_1004405 3300027526 Bacteria 2113
1239 Ga0209999_1000831 3300027543 Bacteria 5109
1240 Ga0209999_1024095 3300027543 Bacteria 1122
1241 Ga0209982_1002696 3300027552 Bacteria 2499
1242 Ga0209970_1007495 3300027614 Bacteria 1789
1243 Ga0210002_1009435 3300027617 Bacteria 1489
1244 Ga0209983_1029795 3300027665 Bacteria 1161
1245 Ga0209588_1013741 3300027671 Bacteria 2473
1246 Ga0209971_1001096 3300027682 Bacteria 6876
1247 Ga0209971_1001702 3300027682 Bacteria 5417
1248 Ga0209971_1005689 3300027682 Bacteria 2956
1249 Ga0209966_1002408 3300027695 Bacteria 3120
1250 Ga0209974_10002606 3300027876 Bacteria 6548
1251 Ga0209974_10009957 3300027876 Bacteria 3215
1252 Ga0209974_10014357 3300027876 Bacteria 2636
1253 Ga0209974_10014761 3300027876 Bacteria 2595
1254 Ga0207428_10051032 3300027907 Bacteria 3307
1255 Ga0265354_1001901 3300028016 Bacteria 2777
1256 Ga0265356_1000958 3300028017 Bacteria 4619
1257 Ga0265357_1001777 3300028023 Bacteria 1651
1258 Ga0268266_10002350 3300028379 Bacteria 20457
1259 Ga0268266_10006760 3300028379 Bacteria 10456
1260 Ga0268266_10021331 3300028379 Bacteria 5519
1261 Ga0268266_10030898 3300028379 Bacteria 4548
1262 Ga0268266_10081031 3300028379 Bacteria 2829
1263 Ga0268266_10364862 3300028379 Bacteria 1360
1264 Ga0268265_10000166 3300028380 Bacteria 80256
1265 Ga0268265_10004150 3300028380 Bacteria 10158
1266 Ga0268265_10115159 3300028380 Bacteria 2203
1267 Ga0268264_10000016 3300028381 Bacteria 502537
1268 Ga0268264_10030656 3300028381 Bacteria 4408
1269 Ga0268264_10036457 3300028381 Bacteria 4052
1270 Ga0268264_10111651 3300028381 Bacteria 2395
1271 Ga0268264_10150826 3300028381 Bacteria 2084
1272 Ga0265334_10033440 3300028573 Bacteria 2047
1273 Ga0265336_10000008 3300028666 Bacteria 336082
1274 Ga0307517_10036337 3300028786 Bacteria 5544
1275 Ga0307517_10201167 3300028786 Bacteria 1245
1276 Ga0307515_10073692 3300028794 Bacteria 4583
1277 Ga0307515_10131399 3300028794 Bacteria 2755
1278 Ga0265338_10000147 3300028800 Bacteria 129297
1279 Ga0265338_10015253 3300028800 Bacteria 8463
1280 Ga0265338_10168423 3300028800 Bacteria 1683
1281 Ga0268256_1000749 3300030500 Bacteria 23804
1282 Ga0307511_10173324 3300030521 Bacteria 1180
1283 Ga0265760_10000671 3300031090 Bacteria 9729
1284 Ga0265340_10010905 3300031247 Bacteria 4848
1285 Ga0265327_10000546 3300031251 Bacteria 64262
1286 Ga0265327_10022058 3300031251 Bacteria 3822
1287 Ga0265316_10032066 3300031344 Bacteria 4292
1288 Ga0307513_10000013 3300031456 Bacteria 325682
1289 Ga0307513_10000037 3300031456 Bacteria 175364
1290 Ga0307513_10006109 3300031456 Bacteria 15809
1291 Ga0307513_10009214 3300031456 Bacteria 12495
1292 Ga0307513_10009485 3300031456 Bacteria 12308
1293 Ga0307513_10025641 3300031456 Bacteria 6823
1294 Ga0307513_10031639 3300031456 Bacteria 5988
1295 Ga0307513_10126660 3300031456 Bacteria 2508
1296 Ga0307513_10146530 3300031456 Bacteria 2278
1297 Ga0307509_10040026 3300031507 Bacteria 5100
1298 Ga0307509_10067018 3300031507 Bacteria 3763
1299 Ga0307509_10102599 3300031507 Bacteria 2892
1300 Ga0307509_10175361 3300031507 Bacteria 2017
1301 Ga0307408_100016400 3300031548 Bacteria 4944
1302 Ga0307408_100078785 3300031548 Bacteria 2457
1303 Ga0307408_100084695 3300031548 Bacteria 2378
1304 Ga0307408_100090577 3300031548 Bacteria 2308
1305 Ga0307408_100098516 3300031548 Bacteria 2222
1306 Ga0265313_10062816 3300031595 Bacteria 1734
1307 Ga0307508_10010305 3300031616 Bacteria 8551
1308 Ga0307508_10034874 3300031616 Bacteria 4534
1309 Ga0316575_10016265 3300031665 Bacteria 2813
1310 Ga0316575_10089516 3300031665 Bacteria 1246
1311 Ga0265342_10000896 3300031712 Bacteria 29642
1312 Ga0316576_10010553 3300031727 Bacteria 6008
1313 Ga0316576_10125990 3300031727 Bacteria 1925
1314 Ga0316576_10183694 3300031727 Bacteria 1577
1315 Ga0316578_10101146 3300031728 Bacteria 1728
1316 Ga0307516_10011653 3300031730 Bacteria 9540
1317 Ga0307405_10114597 3300031731 Bacteria 1832
1318 Ga0307405_10144803 3300031731 Bacteria 1662
1319 Ga0316577_10035089 3300031733 Bacteria 2803
1320 Ga0316577_10065256 3300031733 Bacteria 2032
1321 Ga0307413_10000338 3300031824 Bacteria 14792
1322 Ga0307413_10004322 3300031824 Bacteria 6165
1323 Ga0307413_10010229 3300031824 Bacteria 4536
1324 Ga0307413_10020874 3300031824 Bacteria 3494
1325 Ga0307413_10065277 3300031824 Bacteria 2266
1326 Ga0307413_10070999 3300031824 Bacteria 2192
1327 Ga0307413_10216233 3300031824 Bacteria 1396
1328 Ga0307410_10033725 3300031852 Bacteria 3307
1329 Ga0307410_10036495 3300031852 Bacteria 3201
1330 Ga0307410_10046331 3300031852 Bacteria 2900
1331 Ga0307410_10053878 3300031852 Bacteria 2724
1332 Ga0307410_10106896 3300031852 Bacteria 2017
1333 Ga0307410_10119677 3300031852 Bacteria 1918
1334 Ga0307410_10152060 3300031852 Bacteria 1724
1335 Ga0307406_10003967 3300031901 Bacteria 8043
1336 Ga0307406_10009035 3300031901 Bacteria 5573
1337 Ga0307406_10022167 3300031901 Bacteria 3766
1338 Ga0307406_10039119 3300031901 Bacteria 2940
1339 Ga0307406_10040688 3300031901 Bacteria 2891
1340 Ga0307406_10045880 3300031901 Bacteria 2747
1341 Ga0307406_10125922 3300031901 Bacteria 1790
1342 Ga0307407_10033693 3300031903 Bacteria 2797
1343 Ga0307407_10047631 3300031903 Bacteria 2434
1344 Ga0307412_10000445 3300031911 Bacteria 25038
1345 Ga0307412_10003289 3300031911 Bacteria 8965
1346 Ga0307412_10006797 3300031911 Bacteria 6488
1347 Ga0307412_10114727 3300031911 Bacteria 1929
1348 Ga0307412_10149165 3300031911 Bacteria 1723
1349 Ga0307412_10152871 3300031911 Bacteria 1705
1350 Ga0307412_10274744 3300031911 Bacteria 1320
1351 Ga0307412_10291024 3300031911 Bacteria 1286
1352 Ga0307409_100002862 3300031995 Bacteria 9137
1353 Ga0307409_100003524 3300031995 Bacteria 8531
1354 Ga0307409_100028252 3300031995 Bacteria 3992
1355 Ga0307409_100060791 3300031995 Bacteria 2948
1356 Ga0307409_100132612 3300031995 Bacteria 2132
1357 Ga0307409_100302238 3300031995 Bacteria 1489
1358 Ga0307416_100009355 3300032002 Bacteria 6410
1359 Ga0307416_100043067 3300032002 Bacteria 3531
1360 Ga0307416_100129481 3300032002 Bacteria 2268
1361 Ga0307416_100201961 3300032002 Bacteria 1887
1362 Ga0307416_100336778 3300032002 Bacteria 1519
1363 Ga0307416_100572901 3300032002 Bacteria 1205
1364 Ga0307414_10003324 3300032004 Bacteria 8582
1365 Ga0307414_10034680 3300032004 Bacteria 3349
1366 Ga0307414_10039804 3300032004 Bacteria 3169
1367 Ga0307414_10040002 3300032004 Bacteria 3163
1368 Ga0307414_10067337 3300032004 Bacteria 2565
1369 Ga0307414_10072543 3300032004 Bacteria 2487
1370 Ga0307414_10078692 3300032004 Bacteria 2404
1371 Ga0307414_10081381 3300032004 Bacteria 2371
1372 Ga0307414_10086675 3300032004 Bacteria 2311
1373 Ga0307414_10342435 3300032004 Bacteria 1280
1374 Ga0307414_10408430 3300032004 Bacteria 1181
1375 Ga0307411_10001485 3300032005 Bacteria 9629
1376 Ga0307411_10003060 3300032005 Bacteria 7641
1377 Ga0307411_10004620 3300032005 Bacteria 6628
1378 Ga0307411_10040251 3300032005 Bacteria 2963
1379 Ga0307411_10104301 3300032005 Bacteria 2013
1380 Ga0307415_100003431 3300032126 Bacteria 8062
1381 Ga0307415_100068728 3300032126 Bacteria 2481
1382 Ga0307415_100190061 3300032126 Bacteria 1619
1383 Ga0307415_100304614 3300032126 Bacteria 1321
1384 Ga0307415_100315497 3300032126 Bacteria 1301
1385 Ga0307415_100378283 3300032126 Bacteria 1201
1386 Ga0316583_10005720 3300032133 Bacteria 4469
1387 Ga0316585_10000970 3300032137 Bacteria 7377
1388 Ga0316585_10008103 3300032137 Bacteria 3042
1389 Ga0316580_10021814 3300032139 Bacteria 1976
1390 Ga0307507_10035501 3300033179 Bacteria 5121
1391 Ga0307507_10069877 3300033179 Bacteria 3191
1392 Ga0373934_0008204 3300035086 Bacteria 3889
1393 Ga0373934_0052308 3300035086 Bacteria 1619
1394 Ga0373944_0021727 3300035089 Bacteria 1860
1395 Ga0373923_0000056 3300035111 Bacteria 17507
1396 Ga0373936_0000074 3300035113 Bacteria 39201
1397 Ga0373936_0015945 3300035113 Bacteria 2883
1398 Ga0373939_0023803 3300035114 Bacteria 1700
1399 Ga0373953_0005940 3300035117 Bacteria 3995
1400 Ga0373953_0124420 3300035117 Bacteria 1097
1401 Ga0373954_0007256 3300035118 Bacteria 4842
1402 Ga0373954_0015620 3300035118 Bacteria 3395
1403 Ga0373954_0021985 3300035118 Bacteria 2891
1404 Ga0373956_0005453 3300035119 Bacteria 5094
1405 Ga0373956_0088997 3300035119 Bacteria 1423
1406 Ga0373957_0008067 3300035120 Bacteria 3397
1407 Ga0373957_0014212 3300035120 Bacteria 2718
1408 Ga0373957_0021645 3300035120 Bacteria 2284
1409 Ga0373957_0027152 3300035120 Bacteria 2077
1410 Ga0373946_0058209 3300035171 Bacteria 1636
1411 Ga0373955_0001249 3300035172 Bacteria 10804
1412 Ga0373955_0005370 3300035172 Bacteria 5753
1413 Ga0373955_0042797 3300035172 Bacteria 2433
1414 Ga0373955_0063169 3300035172 Bacteria 2050
1415 Ga0373961_0000126 3300035241 Bacteria 39091
1416 Ga0373962_0007891 3300035242 Bacteria 2612
1417 Ga0316574_0001239 3300035398 Bacteria 11904
1418 Ga0316574_0005525 3300035398 Bacteria 6750
1419 Ga0316574_0026641 3300035398 Bacteria 3478
1420 Ga0316574_0099027 3300035398 Bacteria 1865
1421 Ga0316574_0139144 3300035398 Bacteria 1564
1422 Ga0316574_0286433 3300035398 Bacteria 1049
1423 Ga0373924_0032456 3300035410 Bacteria 2104
1424 Ga0373931_0015899 3300035691 Bacteria 3696
1425 Ga0373935_0131967 3300035692 Bacteria 1679
1426 Ga0373935_0143274 3300035692 Bacteria 1616
1427 Ga0373927_0000615 3300035695 Bacteria 27027
1428 Ga0373927_0002114 3300035695 Bacteria 14645
1429 Ga0373927_0058213 3300035695 Bacteria 2499
1430 Ga0373933_0035998 3300035724 Bacteria 2894
1431 Ga0373933_0194331 3300035724 Bacteria 1297
1432 Ga0373947_0044769 3300035725 Bacteria 2647
1433 Ga0373947_0074317 3300035725 Bacteria 2091
1434 Ga0373937_0009412 3300036401 Bacteria 8492
1435 Ga0373937_0065983 3300036401 Bacteria 3332
1436 Ga0373937_0076730 3300036401 Bacteria 3087
1437 Ga0373937_0198343 3300036401 Bacteria 1886
1438 Ga0373937_0441480 3300036401 Bacteria 1235
1439 Ga0316582_0000277 3300036647 Bacteria 17504
1440 Ga0316582_0023018 3300036647 Bacteria 3707
1441 Ga0316582_0059868 3300036647 Bacteria 2440
1442 Ga0316582_0063495 3300036647 Bacteria 2373
1443 Ga0316584_0001500 3300036712 Bacteria 14048
1444 Ga0316584_0011002 3300036712 Bacteria 6342
1445 Ga0316584_0030295 3300036712 Bacteria 3997
1446 Ga0316584_0036370 3300036712 Bacteria 3653
1447 Ga0316584_0053546 3300036712 Bacteria 3020
1448 Ga0316584_0102259 3300036712 Bacteria 2146
1449 Ga0316584_0138468 3300036712 Bacteria 1816
1450 Ga0373925_0000278 3300037068 Bacteria 53402
1451 Ga0373925_0011317 3300037068 Bacteria 6474
1452 Ga0373925_0276282 3300037068 Bacteria 1352
1453 Ga0395899_0000261 3300037312 Bacteria 69173
1454 Ga0395899_0000309 3300037312 Bacteria 62448
1455 Ga0395899_0014151 3300037312 Bacteria 6088
1456 Ga0395899_0015844 3300037312 Bacteria 5747
1457 Ga0395899_0040051 3300037312 Bacteria 3505
1458 Ga0395899_0041062 3300037312 Bacteria 3457
1459 Ga0395899_0053950 3300037312 Bacteria 2975
1460 Ga0395899_0080294 3300037312 Bacteria 2374
1461 Ga0395899_0081700 3300037312 Bacteria 2351
1462 Ga0395899_0100636 3300037312 Bacteria 2087
1463 Ga0395899_0149996 3300037312 Bacteria 1653
1464 Ga0395899_0162039 3300037312 Bacteria 1579
1465 Ga0395899_0217919 3300037312 Bacteria 1323
1466 Ga0395900_0000036 3300037418 Bacteria 250619
1467 Ga0395900_0000421 3300037418 Bacteria 61155
1468 Ga0395900_0000463 3300037418 Bacteria 58345
1469 Ga0395900_0002071 3300037418 Bacteria 22508
1470 Ga0395900_0004593 3300037418 Bacteria 14573
1471 Ga0395900_0005687 3300037418 Bacteria 13035
1472 Ga0395900_0013849 3300037418 Bacteria 8230
1473 Ga0395900_0022152 3300037418 Bacteria 6499
1474 Ga0395900_0030670 3300037418 Bacteria 5521
1475 Ga0395900_0043088 3300037418 Bacteria 4650
1476 Ga0395900_0045251 3300037418 Bacteria 4533
1477 Ga0395900_0081366 3300037418 Bacteria 3327
1478 Ga0395900_0112961 3300037418 Bacteria 2789
1479 Ga0395900_0139380 3300037418 Bacteria 2484
1480 Ga0395900_0145385 3300037418 Bacteria 2424
1481 Ga0395900_0146395 3300037418 Bacteria 2415
1482 Ga0395900_0152379 3300037418 Bacteria 2361
1483 Ga0395900_0158473 3300037418 Bacteria 2310
1484 Ga0395900_0167565 3300037418 Bacteria 2238
1485 Ga0395900_0168010 3300037418 Bacteria 2234
1486 Ga0395900_0175775 3300037418 Bacteria 2178
1487 Ga0395900_0176108 3300037418 Bacteria 2175
1488 Ga0395900_0184034 3300037418 Bacteria 2121
1489 Ga0395900_0269389 3300037418 Bacteria 1698
1490 Ga0395900_0319660 3300037418 Bacteria 1533
1491 Ga0395900_0605659 3300037418 Bacteria 1036
1492 Ga0395898_0000305 3300037466 Bacteria 116565
1493 Ga0395898_0000485 3300037466 Bacteria 78871
1494 Ga0395898_0011241 3300037466 Bacteria 9315
1495 Ga0395898_0011477 3300037466 Bacteria 9200
1496 Ga0395898_0014192 3300037466 Bacteria 8192
1497 Ga0395898_0016672 3300037466 Bacteria 7510
1498 Ga0395898_0019437 3300037466 Bacteria 6913
1499 Ga0395898_0020422 3300037466 Bacteria 6726
1500 Ga0395898_0034473 3300037466 Bacteria 5044
1501 Ga0395898_0035939 3300037466 Bacteria 4923
1502 Ga0395898_0037985 3300037466 Bacteria 4774
1503 Ga0395898_0042918 3300037466 Bacteria 4460
1504 Ga0395898_0076987 3300037466 Bacteria 3220
1505 Ga0395898_0107552 3300037466 Bacteria 2674
1506 Ga0395898_0171768 3300037466 Bacteria 2072
1507 Ga0395898_0188804 3300037466 Bacteria 1969
1508 Ga0395898_0220915 3300037466 Bacteria 1807
1509 Ga0395898_0221856 3300037466 Bacteria 1803
1510 Ga0395898_0253128 3300037466 Bacteria 1679
1511 Ga0395905_0018294 3300037471 Bacteria 6651
1512 Ga0395905_0018671 3300037471 Bacteria 6577
1513 Ga0395905_0034234 3300037471 Bacteria 4769
1514 Ga0395905_0048902 3300037471 Bacteria 3962
1515 Ga0395905_0059563 3300037471 Bacteria 3569
1516 Ga0395905_0092636 3300037471 Bacteria 2834
1517 Ga0395905_0095282 3300037471 Bacteria 2793
1518 Ga0395905_0134658 3300037471 Bacteria 2324
1519 Ga0395905_0154853 3300037471 Bacteria 2155
1520 Ga0395905_0194649 3300037471 Bacteria 1901
1521 Ga0395905_0296101 3300037471 Bacteria 1505
1522 Ga0395905_0299238 3300037471 Bacteria 1496
1523 Ga0316581_0019015 3300037588 Bacteria 2000
1524 Ga0316581_0024562 3300037588 Bacteria 1788
1525 Ga0395901_0000036 3300038443 Bacteria 214274
1526 Ga0395901_0000188 3300038443 Bacteria 78908
1527 Ga0395901_0000604 3300038443 Bacteria 41808
1528 Ga0395901_0000913 3300038443 Bacteria 32275
1529 Ga0395901_0001198 3300038443 Bacteria 27598
1530 Ga0395901_0002697 3300038443 Bacteria 17888
1531 Ga0395901_0003975 3300038443 Bacteria 14871
1532 Ga0395901_0009119 3300038443 Bacteria 10047
1533 Ga0395901_0015319 3300038443 Bacteria 7803
1534 Ga0395901_0023104 3300038443 Bacteria 6373
1535 Ga0395901_0030354 3300038443 Bacteria 5568
1536 Ga0395901_0054449 3300038443 Bacteria 4158
1537 Ga0395901_0055205 3300038443 Bacteria 4130
1538 Ga0395901_0090263 3300038443 Bacteria 3207
1539 Ga0395901_0116576 3300038443 Bacteria 2805
1540 Ga0395901_0119581 3300038443 Bacteria 2768
1541 Ga0395901_0120156 3300038443 Bacteria 2761
1542 Ga0395901_0131771 3300038443 Bacteria 2627
1543 Ga0395901_0149284 3300038443 Bacteria 2456
1544 Ga0395901_0169395 3300038443 Bacteria 2291
1545 Ga0395901_0177660 3300038443 Bacteria 2232
1546 Ga0395901_0182239 3300038443 Bacteria 2203
1547 Ga0395901_0449665 3300038443 Bacteria 1318
1548 Ga0395901_0481965 3300038443 Bacteria 1265
1549 Ga0395901_0519707 3300038443 Bacteria 1209
1550 Ga0395901_0620186 3300038443 Bacteria 1088
1551 Ga0237819_00728 3300038705 Bacteria 10584
1552 Ga0237816_02003 3300039145 Bacteria 1604
1553 Ga0436365_0871778 3300039437 Bacteria 8451
1554 Ga0436360_0701846 3300039438 Bacteria 5048
1555 Ga0436360_1373761 3300039438 Bacteria 4302
1556 Ga0436361_1117061 3300039447 Bacteria 1170
1557 Ga0436361_1214005 3300039447 Bacteria 5642
1558 Ga0436363_1223925 3300039450 Bacteria 1002
1559 Ga0436363_1399761 3300039450 Bacteria 8237
1560 Ga0439436_0000023 3300041404 Bacteria 58899
1561 Ga0439436_0012204 3300041404 Bacteria 2607
1562 Ga0439436_0033111 3300041404 Bacteria 1497
1563 Ga0439439_0043679 3300041406 Bacteria 1166
1564 Ga0439465_0033940 3300041413 Bacteria 1632
1565 Ga0451787_571574 3300041441 Bacteria 1217
1566 Ga0451789_0461212 3300041443 Bacteria 1484
1567 Ga0451807_0322861 3300041486 Bacteria 8947
1568 Ga0451807_2136315 3300041486 Bacteria 4400
1569 Ga0451853_0162710 3300041512 Bacteria 8567
1570 Ga0439441_021491 3300042001 Bacteria 1192
1571 Ga0439443_006540 3300042003 Bacteria 1596
1572 Ga0439432_018244 3300042006 Bacteria 2346
1573 Ga0439432_044976 3300042006 Bacteria 1390
1574 Ga0439455_0003442 3300042012 Bacteria 3024
1575 Ga0439457_018740 3300042014 Bacteria 1538
1576 Ga0439462_0026691 3300042015 Bacteria 1523
1577 Ga0450911_000006 3300042115 Bacteria 222143
1578 Ga0450913_000424 3300042117 Bacteria 1752
1579 Ga0450898_006509 3300042134 Bacteria 1796
1580 Ga0450904_000100 3300042139 Bacteria 19264
1581 Ga0439446_0027405 3300042156 Bacteria 1635
1582 Ga0450908_000069 3300042184 Bacteria 20399
1583 Ga0451577_0000256 3300042876 Bacteria 104951
1584 Ga0466969_0000992 3300044656 Bacteria 15335
1585 Ga0466969_0016933 3300044656 Bacteria 3809
1586 Ga0466969_0055710 3300044656 Bacteria 1933
1587 Ga0466969_0105306 3300044656 Bacteria 1324
1588 Ga0466982_0000109 3300044672 Bacteria 20352
1589 Ga0453683_0002195 3300044673 Bacteria 15518
1590 Ga0453683_0067547 3300044673 Bacteria 2235
1591 Ga0466966_0000004 3300044684 Bacteria 223594
1592 Ga0466966_0002380 3300044684 Bacteria 12282
1593 Ga0466966_0066226 3300044684 Bacteria 2270
1594 Ga0466966_0077247 3300044684 Bacteria 2078
1595 Ga0466966_0104783 3300044684 Bacteria 1746
1596 Ga0466961_0000220 3300044693 Bacteria 38742
1597 Ga0466961_0000978 3300044693 Bacteria 17723
1598 Ga0466961_0004586 3300044693 Bacteria 8676
1599 Ga0466961_0132258 3300044693 Bacteria 1563
1600 Ga0466963_0001670 3300044694 Bacteria 12091
1601 Ga0466963_0025535 3300044694 Bacteria 3769
1602 Ga0466963_0034194 3300044694 Bacteria 3306
1603 Ga0466963_0106828 3300044694 Bacteria 1919
1604 Ga0466964_0012863 3300044706 Bacteria 3170
1605 Ga0453684_0000842 3300044712 Bacteria 103487
1606 Ga0453684_0005726 3300044712 Bacteria 24318
1607 Ga0453684_0229822 3300044712 Bacteria 2142
1608 Ga0466971_0002396 3300044719 Bacteria 7915
1609 Ga0466970_0001613 3300044765 Bacteria 10869
1610 Ga0466970_0001995 3300044765 Bacteria 9873
1611 Ga0466970_0021702 3300044765 Bacteria 3346
1612 Ga0466957_0018706 3300044842 Bacteria 4070
1613 Ga0466957_0029399 3300044842 Bacteria 3277
1614 Ga0466957_0082242 3300044842 Bacteria 2007
1615 Ga0466957_0140031 3300044842 Bacteria 1558
1616 Ga0466960_0063911 3300044901 Bacteria 1813
1617 Ga0466960_0224388 3300044901 Bacteria 1035
1618 Ga0466959_0000847 3300045049 Bacteria 18071
1619 Ga0466959_0000978 3300045049 Bacteria 16998
1620 Ga0466959_0009479 3300045049 Bacteria 6927
1621 Ga0466959_0141147 3300045049 Bacteria 1702
1622 Ga0466959_0248444 3300045049 Bacteria 1227
1623 Ga0466958_0004196 3300045836 Bacteria 7576
1624 Ga0466958_0082202 3300045836 Bacteria 1984
1625 Ga0466958_0114592 3300045836 Bacteria 1684
1626 Ga0466967_0016847 3300045976 Bacteria 5779
1627 Ga0466967_0023353 3300045976 Bacteria 5066
1628 Ga0466967_0043468 3300045976 Bacteria 3890
1629 Ga0466967_0316416 3300045976 Bacteria 1504
1630 Ga0495592_0004872 3300046454 Bacteria 9878
1631 Ga0495603_0000388 3300046455 Bacteria 24093
1632 Ga0495603_0040809 3300046455 Bacteria 2777
1633 Ga0495590_0001068 3300046457 Bacteria 12077
1634 Ga0495590_0006992 3300046457 Bacteria 4375
1635 Ga0495590_0019091 3300046457 Bacteria 2447
1636 Ga0495590_0093949 3300046457 Bacteria 1062
1637 Ga0495590_0113147 3300046457 Bacteria 969
1638 Ga0495591_002511 3300046458 Bacteria 10141
1639 Ga0495629_0003174 3300046459 Bacteria 12452
1640 Ga0495638_0000728 3300046460 Bacteria 35408
1641 Ga0495638_0001464 3300046460 Bacteria 21323
1642 Ga0495638_0005121 3300046460 Bacteria 9815
1643 Ga0495638_0007439 3300046460 Bacteria 7850
1644 Ga0495638_0040718 3300046460 Bacteria 2943
1645 Ga0495638_0102411 3300046460 Bacteria 1711
1646 Ga0495641_0008790 3300046461 Bacteria 6092
1647 Ga0495641_0026207 3300046461 Bacteria 2848
1648 Ga0495653_0004188 3300046463 Bacteria 11677
1649 Ga0495650_0000024 3300046471 Bacteria 496674
1650 Ga0495650_0077945 3300046471 Bacteria 1284
1651 Ga0495580_0016401 3300046472 Bacteria 5558
1652 Ga0495580_0041640 3300046472 Bacteria 3275
1653 Ga0495582_0001097 3300046473 Bacteria 15190
1654 Ga0495582_0013960 3300046473 Bacteria 4425
1655 Ga0495605_0000271 3300046474 Bacteria 58816
1656 Ga0495639_0008348 3300046475 Bacteria 4443
1657 Ga0495585_0000027 3300046492 Bacteria 147955
1658 Ga0495585_0085265 3300046492 Bacteria 1707
1659 Ga0495594_0000118 3300046499 Bacteria 37004
1660 Ga0495596_0000007 3300046500 Bacteria 151548
1661 Ga0495596_0045858 3300046500 Bacteria 1718
1662 Ga0495607_0015636 3300046501 Bacteria 4914
1663 Ga0495583_0000005 3300046506 Bacteria 636894
1664 Ga0495583_0000149 3300046506 Bacteria 117980
1665 Ga0495583_0000249 3300046506 Bacteria 89010
1666 Ga0495606_0002446 3300046507 Bacteria 21590
1667 Ga0495608_0107355 3300046511 Bacteria 1796
1668 Ga0495610_0000465 3300046512 Bacteria 41856
1669 Ga0495610_0001255 3300046512 Bacteria 22785
1670 Ga0495610_0001341 3300046512 Bacteria 21846
1671 Ga0495610_0011263 3300046512 Bacteria 5480
1672 Ga0495610_0033321 3300046512 Bacteria 2665
1673 Ga0495616_0016634 3300046513 Bacteria 4067
1674 Ga0495616_0019285 3300046513 Bacteria 3723
1675 Ga0495620_0016023 3300046515 Bacteria 3772
1676 Ga0495628_0013802 3300046516 Bacteria 6788
1677 Ga0495630_0012679 3300046517 Bacteria 6125
1678 Ga0495631_0012499 3300046518 Bacteria 4144
1679 Ga0495631_0014835 3300046518 Bacteria 3750
1680 Ga0495632_0004886 3300046519 Bacteria 8985
1681 Ga0495632_0019802 3300046519 Bacteria 3658
1682 Ga0495632_0065291 3300046519 Bacteria 1758
1683 Ga0495637_0008788 3300046520 Bacteria 4946
1684 Ga0495637_0099481 3300046520 Bacteria 1138
1685 Ga0495643_0015990 3300046522 Bacteria 4417
1686 Ga0495644_0111145 3300046523 Bacteria 1040
1687 Ga0495648_0000029 3300046524 Bacteria 223499
1688 Ga0495648_0100364 3300046524 Bacteria 1599
1689 Ga0495663_0000379 3300046525 Bacteria 16472
1690 Ga0495666_0006889 3300046526 Bacteria 5708
1691 Ga0495652_0103151 3300046529 Bacteria 2309
1692 Ga0495654_0000226 3300046530 Bacteria 52630
1693 Ga0495665_0044109 3300046531 Bacteria 2370
1694 Ga0495640_0006086 3300046533 Bacteria 9569
1695 Ga0495586_0117398 3300046535 Bacteria 1484
1696 Ga0495587_0014439 3300046536 Bacteria 4954
1697 Ga0495587_0191616 3300046536 Bacteria 1157
1698 Ga0495609_0000052 3300046538 Bacteria 150695
1699 Ga0495621_0013656 3300046539 Bacteria 2556
1700 Ga0495597_0017049 3300046542 Bacteria 3423
1701 Ga0495622_0004272 3300046557 Bacteria 6648
1702 Ga0495633_0000162 3300046558 Bacteria 87434
1703 Ga0495667_0008613 3300046559 Bacteria 6923
1704 Ga0495667_0020228 3300046559 Bacteria 4491
1705 Ga0495668_0000141 3300046616 Bacteria 108840
1706 Ga0495668_0007336 3300046616 Bacteria 7065
1707 Ga0495668_0011331 3300046616 Bacteria 5347
1708 Ga0495668_0058761 3300046616 Bacteria 2122
1709 Ga0495634_0002446 3300046642 Bacteria 15427
1710 Ga0495611_0000565 3300046648 Bacteria 21341
1711 Ga0495625_0000398 3300046660 Bacteria 66474
1712 Ga0495625_0010691 3300046660 Bacteria 7562
1713 Ga0495625_0015161 3300046660 Bacteria 6116
1714 Ga0495625_0036300 3300046660 Bacteria 3624
1715 Ga0495625_0042417 3300046660 Bacteria 3306
1716 Ga0495625_0111871 3300046660 Bacteria 1866
1717 Ga0495625_0116865 3300046660 Bacteria 1819
1718 Ga0495625_0130092 3300046660 Bacteria 1706
1719 Ga0495635_0025209 3300046663 Bacteria 4142
1720 Ga0495588_0057082 3300046674 Bacteria 2016
1721 Ga0495657_0022358 3300046675 Bacteria 4531
1722 Ga0495657_0089723 3300046675 Bacteria 1974
1723 Ga0495599_0018838 3300046678 Bacteria 4302
1724 Ga0495599_0023815 3300046678 Bacteria 3828
1725 Ga0495623_0039267 3300046679 Bacteria 3026
1726 Ga0495647_0000113 3300046681 Bacteria 20397
1727 Ga0495647_0007512 3300046681 Bacteria 3656
1728 Ga0495658_0002474 3300046683 Bacteria 9302
1729 Ga0495658_0013350 3300046683 Bacteria 4179
1730 Ga0495613_0008625 3300046689 Bacteria 7562
1731 Ga0495613_0029688 3300046689 Bacteria 4064
1732 Ga0495670_0001410 3300046691 Bacteria 11784
1733 Ga0495671_0011736 3300046692 Bacteria 4805
1734 Ga0495649_0000165 3300046694 Bacteria 57643
1735 Ga0495649_0000396 3300046694 Bacteria 37744
1736 Ga0495649_0010627 3300046694 Bacteria 5423
1737 Ga0495649_0021738 3300046694 Bacteria 3594
1738 Ga0495589_0024889 3300046794 Bacteria 3040
1739 Ga0495600_0009720 3300046809 Bacteria 5944
1740 Ga0495600_0025908 3300046809 Bacteria 3782
1741 Ga0495660_0005715 3300046810 Bacteria 7426
1742 Ga0495581_0090757 3300047315 Bacteria 1772
1743 Ga0495604_0003696 3300047317 Bacteria 12188
1744 Ga0495636_0002340 3300047318 Bacteria 7283
1745 Ga0495636_0018436 3300047318 Bacteria 2800
1746 Ga0495636_0035560 3300047318 Bacteria 2052
1747 Ga0495674_0065303 3300047319 Bacteria 3161
1748 Ga0495672_0011303 3300047320 Bacteria 6309
1749 Ga0495672_0128180 3300047320 Bacteria 1338
1750 Ga0495676_0170342 3300047321 Bacteria 1533
1751 Ga0495680_0042645 3300047322 Bacteria 3599
1752 Ga0495680_0087469 3300047322 Bacteria 2343
1753 Ga0495680_0361099 3300047322 Bacteria 1009
1754 Ga0495683_0000002 3300047323 Bacteria 638279
1755 Ga0495683_0077491 3300047323 Bacteria 1625
1756 Ga0495683_0142506 3300047323 Bacteria 1122
1757 Ga0495675_0090651 3300047444 Bacteria 1919
1758 Ga0495679_000035 3300047446 Bacteria 164777
1759 Ga0495679_000056 3300047446 Bacteria 111387
1760 Ga0495679_003586 3300047446 Bacteria 7410
1761 Ga0495685_046996 3300047447 Bacteria 1468
1762 Ga0495673_0000342 3300047469 Bacteria 58945
1763 Ga0495673_0002882 3300047469 Bacteria 11693
1764 Ga0495681_0079948 3300047470 Bacteria 1461
1765 Ga0495684_0078492 3300047471 Bacteria 2506
1766 Ga0495684_0094860 3300047471 Bacteria 2258
1767 Ga0495686_0001836 3300047472 Bacteria 21329
1768 Ga0495686_0001859 3300047472 Bacteria 21181
1769 Ga0495593_0000987 3300047673 Bacteria 16704
1770 Ga0495602_0014733 3300048088 Bacteria 7929
1771 Ga0495602_0044383 3300048088 Bacteria 4033
1772 Ga0495602_0374641 3300048088 Bacteria 1021
1773 Ga0495614_0042029 3300048089 Bacteria 1960
1774 Ga0496100_0102199 3300048903 Bacteria 1977
1775 Ga0496100_0216104 3300048903 Bacteria 1405
1776 Ga0496101_0015659 3300048904 Bacteria 5116
1777 Ga0496101_0017706 3300048904 Bacteria 4832
1778 Ga0496101_0022049 3300048904 Bacteria 4381
1779 Ga0496101_0024655 3300048904 Bacteria 4165
1780 Ga0496101_0279814 3300048904 Bacteria 1304
1781 Ga0496102_0039951 3300048905 Bacteria 4242
1782 Ga0496102_0047630 3300048905 Bacteria 3897
1783 Ga0496102_0083221 3300048905 Bacteria 2952
1784 Ga0496102_0250431 3300048905 Bacteria 1670
1785 Ga0496103_0040376 3300048906 Bacteria 2867
1786 Ga0496103_0079880 3300048906 Bacteria 2056
1787 Ga0496103_0129682 3300048906 Bacteria 1610
1788 Ga0496104_0032285 3300048907 Bacteria 4873
1789 Ga0496104_0034981 3300048907 Bacteria 4688
1790 Ga0496104_0055115 3300048907 Bacteria 3759
1791 Ga0496104_0097848 3300048907 Bacteria 2808
1792 Ga0496104_0186776 3300048907 Bacteria 1983
1793 Ga0496105_0009632 3300048908 Bacteria 7560
1794 Ga0496105_0019536 3300048908 Bacteria 5467
1795 Ga0496105_0292398 3300048908 Bacteria 1311
1796 Ga0496106_0047561 3300048909 Bacteria 3229
1797 Ga0496106_0063844 3300048909 Bacteria 2800
1798 Ga0496106_0271146 3300048909 Bacteria 1359
1799 Ga0496106_0287665 3300048909 Bacteria 1317
1800 Ga0496107_0000214 3300048910 Bacteria 30453
1801 Ga0496107_0019860 3300048910 Bacteria 4744
1802 Ga0496107_0077760 3300048910 Bacteria 2417
1803 Ga0496107_0183845 3300048910 Bacteria 1552
1804 Ga0496107_0186394 3300048910 Bacteria 1541
1805 Ga0496108_0003688 3300048911 Bacteria 12288
1806 Ga0496108_0016259 3300048911 Bacteria 6066
1807 Ga0496108_0027517 3300048911 Bacteria 4696
1808 Ga0496108_0126533 3300048911 Bacteria 2194
1809 Ga0496108_0185152 3300048911 Bacteria 1804
1810 Ga0496108_0384164 3300048911 Bacteria 1226
1811 Ga0496109_0001865 3300048912 Bacteria 17465
1812 Ga0496109_0048552 3300048912 Bacteria 3862
1813 Ga0496109_0087095 3300048912 Bacteria 2884
1814 Ga0496109_0091181 3300048912 Bacteria 2818
1815 Ga0496109_0186498 3300048912 Bacteria 1949
1816 Ga0496109_0188056 3300048912 Bacteria 1940
1817 Ga0496109_0206078 3300048912 Bacteria 1849
1818 Ga0496109_0212961 3300048912 Bacteria 1817
1819 Ga0496110_0012559 3300048913 Bacteria 6967
1820 Ga0496110_0074788 3300048913 Bacteria 3009
1821 Ga0496110_0077735 3300048913 Bacteria 2953
1822 Ga0496110_0150420 3300048913 Bacteria 2108
1823 Ga0496110_0156563 3300048913 Bacteria 2064
1824 Ga0496110_0457692 3300048913 Bacteria 1163
1825 Ga0496111_0011770 3300048914 Bacteria 5906
1826 Ga0496111_0022773 3300048914 Bacteria 4390
1827 Ga0496111_0239824 3300048914 Bacteria 1346
1828 Ga0496112_0003292 3300048915 Bacteria 13337
1829 Ga0496112_0027176 3300048915 Bacteria 5517
1830 Ga0496112_0072298 3300048915 Bacteria 3409
1831 Ga0496112_0175465 3300048915 Bacteria 2108
1832 Ga0496112_0190432 3300048915 Bacteria 2013
1833 Ga0496112_0453340 3300048915 Bacteria 1220
1834 Ga0496113_0424119 3300048916 Bacteria 1068
1835 Ga0496114_0006303 3300048917 Bacteria 9336
1836 Ga0496114_0098484 3300048917 Bacteria 2493
1837 Ga0496114_0136746 3300048917 Bacteria 2119
1838 Ga0496114_0160550 3300048917 Bacteria 1954
1839 Ga0496114_0221649 3300048917 Bacteria 1660
1840 Ga0496114_0352639 3300048917 Bacteria 1301
1841 Ga0496115_0006041 3300048918 Bacteria 8841
1842 Ga0496115_0169765 3300048918 Bacteria 1804
1843 Ga0496115_0197088 3300048918 Bacteria 1664
1844 Ga0496115_0271290 3300048918 Bacteria 1394
1845 Ga0496116_0028883 3300048919 Bacteria 4009
1846 Ga0496116_0038439 3300048919 Bacteria 3323
1847 Ga0496117_0016132 3300048920 Bacteria 6318
1848 Ga0496117_0040086 3300048920 Bacteria 3450
1849 Ga0496117_0054532 3300048920 Bacteria 2800
1850 Ga0496118_0001967 3300048921 Bacteria 29146
1851 Ga0496118_0003890 3300048921 Bacteria 18327
1852 Ga0496118_0029873 3300048921 Bacteria 4561
1853 Ga0496118_0119622 3300048921 Bacteria 1721
1854 Ga0496119_0000733 3300048922 Bacteria 44239
1855 Ga0496119_0005178 3300048922 Bacteria 12605
1856 Ga0496119_0011034 3300048922 Bacteria 7534
1857 Ga0496119_0012759 3300048922 Bacteria 6785
1858 Ga0496120_0000671 3300048923 Bacteria 50340
1859 Ga0496120_0015992 3300048923 Bacteria 4921
1860 Ga0496121_0000021 3300048924 Bacteria 478544
1861 Ga0496121_0000042 3300048924 Bacteria 342304
1862 Ga0496121_0000145 3300048924 Bacteria 156655
1863 Ga0496121_0033279 3300048924 Bacteria 4669
1864 Ga0496121_0099155 3300048924 Bacteria 2252
1865 Ga0496122_0000029 3300048925 Bacteria 336396
1866 Ga0496122_0000749 3300048925 Bacteria 63273
1867 Ga0496122_0013321 3300048925 Bacteria 8059
1868 Ga0496122_0098434 3300048925 Bacteria 1964
1869 Ga0496123_0000216 3300048926 Bacteria 117098
1870 Ga0496123_0000566 3300048926 Bacteria 63317
1871 Ga0496123_0000974 3300048926 Bacteria 44176
1872 Ga0496123_0006678 3300048926 Bacteria 11119
1873 Ga0496123_0041704 3300048926 Bacteria 3177
1874 Ga0496124_0000681 3300048927 Bacteria 55817
1875 Ga0496124_0088371 3300048927 Bacteria 2533
1876 Ga0496124_0147417 3300048927 Bacteria 1850
1877 Ga0496125_0001102 3300048928 Bacteria 41526
1878 Ga0496125_0001807 3300048928 Bacteria 29544
1879 Ga0496125_0018499 3300048928 Bacteria 6617
1880 Ga0496125_0029699 3300048928 Bacteria 4907
1881 Ga0496126_0021905 3300048929 Bacteria 6232
1882 Ga0496126_0073787 3300048929 Bacteria 3032
1883 Ga0496126_0305946 3300048929 Bacteria 1310
1884 Ga0495678_003651 3300049459 Bacteria 9339
1885 Ga0495682_0022008 3300049460 Bacteria 2387
1886 Ga0501031_0003304 3300049568 Bacteria 10348
1887 Ga0501031_0036277 3300049568 Bacteria 3216
1888 Ga0501032_0002277 3300049569 Bacteria 15078
1889 Ga0501033_0016780 3300049570 Bacteria 5538
1890 Ga0501033_0020882 3300049570 Bacteria 4943
1891 Ga0501033_0060379 3300049570 Bacteria 2797
1892 Ga0501033_0072968 3300049570 Bacteria 2520
1893 Ga0501034_0003528 3300049571 Bacteria 17767
1894 Ga0501034_0013919 3300049571 Bacteria 8282
1895 Ga0501034_0026913 3300049571 Bacteria 5851
1896 Ga0501034_0043094 3300049571 Bacteria 4568
1897 Ga0501034_0046443 3300049571 Bacteria 4388
1898 Ga0501034_0056312 3300049571 Bacteria 3956
1899 Ga0501034_0382079 3300049571 Bacteria 1333
1900 Ga0501036_0087742 3300049572 Bacteria 2629
1901 Ga0501036_0113245 3300049572 Bacteria 2293
1902 Ga0501036_0129900 3300049572 Bacteria 2127
1903 Ga0501036_0140941 3300049572 Bacteria 2035
1904 Ga0501037_0046554 3300049573 Bacteria 3180
1905 Ga0501038_0000654 3300049574 Bacteria 30791
1906 Ga0501038_0009310 3300049574 Bacteria 9010
1907 Ga0501038_0023889 3300049574 Bacteria 5459
1908 Ga0501038_0087373 3300049574 Bacteria 2618
1909 Ga0501039_0235261 3300049575 Bacteria 1440
1910 Ga0501039_0265879 3300049575 Bacteria 1348
1911 Ga0501040_0001815 3300049576 Bacteria 13724
1912 Ga0501041_0000192 3300049577 Bacteria 27903
1913 Ga0501042_0000054 3300049578 Bacteria 40211
1914 Ga0501042_0000271 3300049578 Bacteria 25300
1915 Ga0501042_0120352 3300049578 Bacteria 1890
1916 Ga0501043_0034251 3300049579 Bacteria 3995
1917 Ga0501043_0085298 3300049579 Bacteria 2481
1918 Ga0501043_0112989 3300049579 Bacteria 2133
1919 Ga0501046_0000108 3300049580 Bacteria 87513
1920 Ga0501046_0015253 3300049580 Bacteria 6462
1921 Ga0501047_0002839 3300049581 Bacteria 16426
1922 Ga0501047_0013253 3300049581 Bacteria 7808
1923 Ga0501047_0017768 3300049581 Bacteria 6814
1924 Ga0501047_0019890 3300049581 Bacteria 6444
1925 Ga0501047_0021564 3300049581 Bacteria 6187
1926 Ga0501047_0043063 3300049581 Bacteria 4362
1927 Ga0501047_0060215 3300049581 Bacteria 3665
1928 Ga0501047_0122096 3300049581 Bacteria 2486
1929 Ga0501047_0176192 3300049581 Bacteria 2005
1930 Ga0501047_0181887 3300049581 Bacteria 1969
1931 Ga0501048_0034331 3300049582 Bacteria 3660
1932 Ga0501067_0043101 3300049583 Bacteria 2506
1933 Ga0501067_0114492 3300049583 Bacteria 1500
1934 Ga0501069_0101362 3300049585 Bacteria 1634
1935 Ga0501069_0185100 3300049585 Bacteria 1204
1936 Ga0501069_0217959 3300049585 Bacteria 1108
1937 Ga0501070_0000102 3300049586 Bacteria 74839
1938 Ga0501070_0023819 3300049586 Bacteria 5131
1939 Ga0501070_0044639 3300049586 Bacteria 3686
1940 Ga0501070_0051997 3300049586 Bacteria 3400
1941 Ga0501070_0058239 3300049586 Bacteria 3202
1942 Ga0501070_0173712 3300049586 Bacteria 1774
1943 Ga0501070_0352055 3300049586 Bacteria 1195
1944 Ga0501070_0423843 3300049586 Bacteria 1074
1945 Ga0501071_0016296 3300049587 Bacteria 5110
1946 Ga0501071_0018432 3300049587 Bacteria 4832
1947 Ga0501071_0139032 3300049587 Bacteria 1808
1948 Ga0501072_0000655 3300049588 Bacteria 24933
1949 Ga0501073_0008965 3300049589 Bacteria 7389
1950 Ga0501073_0013754 3300049589 Bacteria 5886
1951 Ga0501073_0018310 3300049589 Bacteria 5061
1952 Ga0501073_0051133 3300049589 Bacteria 2895
1953 Ga0501074_0002305 3300049590 Bacteria 13281
1954 Ga0501074_0033737 3300049590 Bacteria 3710
1955 Ga0501074_0063087 3300049590 Bacteria 2669
1956 Ga0501075_0032811 3300049591 Bacteria 3860
1957 Ga0501075_0036165 3300049591 Bacteria 3686
1958 Ga0501075_0049268 3300049591 Bacteria 3166
1959 Ga0501076_0000057 3300049592 Bacteria 55044
1960 Ga0501076_0100931 3300049592 Bacteria 2325
1961 Ga0501077_0000637 3300049593 Bacteria 21303
1962 Ga0501077_0013351 3300049593 Bacteria 5151
1963 Ga0501239_000595 3300049672 Bacteria 2848
1964 Ga0501079_0000283 3300049741 Bacteria 31327
1965 Ga0501079_0041115 3300049741 Bacteria 3568
1966 Ga0501079_0145936 3300049741 Bacteria 1844
1967 Ga0501080_0000480 3300049742 Bacteria 31084
1968 Ga0501080_0015766 3300049742 Bacteria 6970
1969 Ga0501080_0016767 3300049742 Bacteria 6766
1970 Ga0501080_0022903 3300049742 Bacteria 5790
1971 Ga0501080_0029568 3300049742 Bacteria 5101
1972 Ga0501080_0034741 3300049742 Bacteria 4707
1973 Ga0501080_0051306 3300049742 Bacteria 3838
1974 Ga0501080_0132429 3300049742 Bacteria 2308
1975 Ga0501080_0207020 3300049742 Bacteria 1799
1976 Ga0501080_0364050 3300049742 Bacteria 1304
1977 Ga0501081_0000123 3300049743 Bacteria 33954
1978 Ga0501083_0014104 3300049744 Bacteria 5588
1979 Ga0501083_0020544 3300049744 Bacteria 4593
1980 Ga0501083_0044708 3300049744 Bacteria 2997
1981 Ga0501083_0069462 3300049744 Bacteria 2344
1982 Ga0501083_0149667 3300049744 Bacteria 1528
1983 Ga0501035_0003292 3300049822 Bacteria 15485
1984 Ga0501035_0003439 3300049822 Bacteria 15151
1985 Ga0501035_0019304 3300049822 Bacteria 6273
1986 Ga0501035_0057698 3300049822 Bacteria 3461
1987 Ga0501035_0059231 3300049822 Bacteria 3410
1988 Ga0501035_0069916 3300049822 Bacteria 3110
1989 Ga0501035_0078600 3300049822 Bacteria 2914
1990 Ga0501035_0090106 3300049822 Bacteria 2700
1991 Ga0501035_0099716 3300049822 Bacteria 2549
1992 Ga0501035_0269396 3300049822 Bacteria 1442
1993 Ga0501035_0383847 3300049822 Bacteria 1171
1994 Ga0501044_0002339 3300049823 Bacteria 21617
1995 Ga0501044_0024481 3300049823 Bacteria 6406
1996 Ga0501044_0045879 3300049823 Bacteria 4526
1997 Ga0501044_0053284 3300049823 Bacteria 4162
1998 Ga0501044_0085608 3300049823 Bacteria 3185
1999 Ga0501044_0092573 3300049823 Bacteria 3049
2000 Ga0501044_0094691 3300049823 Bacteria 3010
2001 Ga0501044_0189704 3300049823 Bacteria 2019
2002 Ga0501045_0002226 3300049824 Bacteria 13171
2003 Ga0501226_000012 3300049853 Bacteria 175419
2004 nmdc:mga03683_72905_c1 3300050489 Bacteria 1471
2005 nmdc:mga00v17_36848_c2 3300050491 Bacteria 1902
2006 nmdc:mga0yw44_222117_c1 3300050492 Bacteria 1252
2007 nmdc:mga0k408_259977_c1 3300050493 Bacteria 1037
2008 nmdc:mga0k408_34917_c1 3300050493 Bacteria 2881
2009 nmdc:mga0k408_45210_c1 3300050493 Bacteria 2540
2010 nmdc:mga07m45_119838_c1 3300050496 Bacteria 1519
2011 nmdc:mga07m45_85713_c1 3300050496 Bacteria 1801
2012 nmdc:mga05p37_155916_c1 3300050507 Bacteria 2791
2013 nmdc:mga05p37_52817_c1 3300050507 Bacteria 4997
2014 nmdc:mga05p37_716_c1 3300050507 Bacteria 36551
2015 nmdc:mga09592_39528_c1 3300050508 Bacteria 3963
2016 nmdc:mga0qj67_3310_c1 3300050509 Bacteria 11610
2017 nmdc:mga0qj67_36852_c1 3300050509 Bacteria 3829
2018 nmdc:mga0qj67_8357_c1 3300050509 Bacteria 7675
2019 nmdc:mga06r32_106735_c1 3300050510 Bacteria 2752
2020 nmdc:mga06r32_45534_c1 3300050510 Bacteria 4183
2021 nmdc:mga06r32_7880_c1 3300050510 Bacteria 9573
2022 nmdc:mga08y16_50166_c1 3300050511 Bacteria 4367
2023 nmdc:mga08y16_67396_c1 3300050511 Bacteria 3734
2024 nmdc:mga0n895_214105_c1 3300050512 Bacteria 1957
2025 nmdc:mga0rr50_222830_c1 3300050513 Bacteria 1558
2026 nmdc:mga0rr50_300447_c1 3300050513 Bacteria 1343
2027 nmdc:mga08x19_26318_c1 3300050514 Bacteria 3629
2028 nmdc:mga0a205_139417_c1 3300050515 Bacteria 2325
2029 nmdc:mga0a205_8602_c1 3300050515 Bacteria 9288
2030 Ga0495601_0002701 3300053077 Bacteria 10069
2031 Ga0495601_0051546 3300053077 Bacteria 2597
2032 Ga0495601_0169115 3300053077 Bacteria 1429
2033 Ga0495601_0260732 3300053077 Bacteria 1131
2034 Ga0495612_0025055 3300053078 Bacteria 2396
2035 Ga0500635_0000140 3300053080 Bacteria 41240
2036 Ga0500635_0043193 3300053080 Bacteria 1515
2037 Ga0495655_0000320 3300053083 Bacteria 8521
2038 Ga0495595_0007105 3300053084 Bacteria 4576
2039 Ga0495595_0008305 3300053084 Bacteria 4262
2040 Ga0495619_0002898 3300053085 Bacteria 11141
2041 Ga0495619_0015975 3300053085 Bacteria 4751
2042 Ga0495619_0077528 3300053085 Bacteria 2232
2043 Ga0500578_0000102 3300053086 Bacteria 99108
2044 Ga0500578_0213203 3300053086 Bacteria 1177
2045 Ga0500643_001069 3300053087 Bacteria 16551
2046 Ga0500643_001428 3300053087 Bacteria 13776
2047 Ga0500643_002015 3300053087 Bacteria 10931
2048 Ga0500643_037967 3300053087 Bacteria 1430
2049 Ga0500644_0000290 3300053088 Bacteria 27182
2050 Ga0500644_0006534 3300053088 Bacteria 2994
2051 Ga0500644_0073460 3300053088 Bacteria 1239
2052 Ga0500647_0003059 3300053091 Bacteria 6418
2053 Ga0500651_0000984 3300053093 Bacteria 14035
2054 Ga0500651_0013402 3300053093 Bacteria 4996
2055 Ga0500566_0004593 3300053094 Bacteria 8226
2056 Ga0500640_000515 3300053095 Bacteria 9693
2057 Ga0500555_006631 3300053103 Bacteria 3290
2058 Ga0500556_0000200 3300053104 Bacteria 49207
2059 Ga0500556_0001879 3300053104 Bacteria 7539
2060 Ga0500562_000497 3300053108 Bacteria 9556
2061 Ga0500572_000529 3300053111 Bacteria 12963
2062 Ga0500593_001627 3300053117 Bacteria 8090
2063 Ga0500594_0002267 3300053118 Bacteria 4165
2064 Ga0500597_000028 3300053120 Bacteria 31391
2065 Ga0500608_000158 3300053122 Bacteria 28168
2066 Ga0500614_004049 3300053123 Bacteria 3121
2067 Ga0500614_005413 3300053123 Bacteria 2679
2068 Ga0500618_000120 3300053125 Bacteria 64103
2069 Ga0500628_000537 3300053129 Bacteria 6931
2070 Ga0500642_0064213 3300053130 Bacteria 1657
2071 Ga0500642_0083140 3300053130 Bacteria 1473
2072 Ga0500658_0021557 3300053134 Bacteria 2442
2073 Ga0500559_0000403 3300053136 Bacteria 31068
2074 Ga0500559_0005605 3300053136 Bacteria 5755
2075 Ga0500559_0021028 3300053136 Bacteria 2762
2076 Ga0500559_0021554 3300053136 Bacteria 2731
2077 Ga0500564_000115 3300053138 Bacteria 20253
2078 Ga0500564_000291 3300053138 Bacteria 13918
2079 Ga0500568_0016301 3300053139 Bacteria 3307
2080 Ga0500568_0025658 3300053139 Bacteria 2483
2081 Ga0500573_0044788 3300053140 Bacteria 2551
2082 Ga0500616_0052065 3300053153 Bacteria 2154
2083 Ga0500622_0000674 3300053156 Bacteria 30184
2084 Ga0500622_0004041 3300053156 Bacteria 9441
2085 Ga0500622_0020591 3300053156 Bacteria 3502
2086 Ga0500622_0074155 3300053156 Bacteria 1715
2087 Ga0500624_000075 3300053157 Bacteria 56822
2088 Ga0500636_0000055 3300053177 Bacteria 54438
2089 Ga0500637_0000681 3300053178 Bacteria 13513
2090 Ga0500637_0053754 3300053178 Bacteria 2299
2091 Ga0500567_001143 3300053723 Bacteria 10405
2092 Ga0500625_000012 3300053729 Bacteria 127269
2093 Ga0500625_009792 3300053729 Bacteria 4287
2094 Ga0500645_000250 3300053730 Bacteria 40018
2095 Ga0500645_001003 3300053730 Bacteria 15923
2096 Ga0500645_008241 3300053730 Bacteria 3573
2097 Ga0500645_008698 3300053730 Bacteria 3446
2098 Ga0500609_001387 3300053731 Bacteria 3552
2099 Ga0500587_001238 3300053739 Bacteria 3556
2100 Ga0501084_0001450 3300054114 Bacteria 18818
2101 Ga0501084_0012475 3300054114 Bacteria 7041
2102 Ga0501082_0005168 3300060353 Bacteria 11354
2103 Ga0501082_0006095 3300060353 Bacteria 10465
2104 Ga0501082_0033315 3300060353 Bacteria 4445
2105 Ga0466962_0000555 3300061719 Bacteria 16376
2106 Ga0466962_0005147 3300061719 Bacteria 6290
2107 Ga0530510_0000267 3300061734 Bacteria 32744
2108 Ga0530510_0121791 3300061734 Bacteria 1915
2109 2501406879 2501025504 Bacteria 8008976
2110 2511097785 2510917014 Bacteria 8296963
2111 2511245969 2511231002 Bacteria 5042903
2112 2519460345 2519103095 Bacteria 6629912
2113 2525558312 2524614729 Bacteria 3091755
2114 2572255971 2571042365 Bacteria 3289345
2115 2585292648 2582581311 Bacteria 6763856
2116 2587759172 2585428062 Bacteria 6842168
2117 2595447692 2593339238 Bacteria 4182970
2118 2595450382 2593339239 Bacteria 4124669
2119 2599741329 2599185239 Bacteria 8686614
2120 2599747260 2599185240 Bacteria 7968121
2121 2599905713 2599185292 Bacteria 6290804
2122 2600209115 2599185355 Bacteria 7968906
2123 2630650300 2627854209 Bacteria 3093011
2124 2643860596 2643221569 Bacteria 6064337
2125 2643882244 2643221574 Bacteria 2789653
2126 2643981540 2643221594 Bacteria 5811388
2127 2644353395 2643221663 Bacteria 3425771
2128 2644549315 2643221699 Bacteria 5731501
2129 2644551440 2643221699 Bacteria 5731501
2130 2676745144 2675903129 Bacteria 7964495
2131 2729148598 2728369097 Bacteria 4333476
2132 2774871110 2773857925 Bacteria 6472445
2133 2808906743 2808606373 Bacteria 4423627
2134 2808973025 2808606384 Bacteria 8474373
2135 2809008147 2808606390 Bacteria 8476311
2136 2809014950 2808606391 Bacteria 8308166
2137 2809035447 2808606395 Bacteria 6020352
2138 2817257863 2816332253 Bacteria 6764532
2139 2817455998 2816332286 Bacteria 6853759
2140 2819635188 2818991452 Bacteria 8442785
2141 2819662386 2818991457 Bacteria 5323295
2142 2842922452 2842918807 Bacteria 4289178
2143 2852687898 2852684882 Bacteria 5463342
2144 2863427857 2863421361 Bacteria 7300805
2145 2870073562 2870068957 Bacteria 8925310
2146 2894512120 2894510363 Bacteria 5121143
2147 2904567559 2904564687 Bacteria 7609577
2148 2904574604 2904571731 Bacteria 7608790
2149 2919133032 2919130084 Bacteria 5301837
2150 2928158354 2928157003 Bacteria 7522202
2151 2928167442 2928163908 Bacteria 7561269
2152 2928177009 2928170801 Bacteria 8785406
2153 2928540281 2928536128 Bacteria 7657547
2154 2928966402 2928963466 Bacteria 5165703
2155 2929199329 2929195423 Bacteria 5325372
2156 2953996913 2953994433 Bacteria 4303959
2157 2981991815 2981990288 Bacteria 7590678
2158 642417434 641736154 Bacteria 7689995
2159 8001523336 8001522603 Bacteria 4726425
2160 8002394536 8002392321 Bacteria 4159911
2161 8003017602 8003014200 Bacteria 4059994
2162 8018850205 8018845410 Bacteria 8933938
2163 8020812240 8020807995 Bacteria 6801506
2164 8020941215 8020938398 Bacteria 7472757
2165 8020946740 8020945358 Bacteria 8467355
2166 8020958469 8020953355 Bacteria 7439080
2167 8021123866 8021120328 Bacteria 8782274
2168 8039100380 8039098773 Bacteria 6602928
2169 8040170759 8040167225 Bacteria 6542727
2170 8040176964 8040173305 Bacteria 6827067
2171 8045868635 8045864390 Bacteria 5043873
2172 JGI25151J46595_10007622
2173 SwRhRL2b_contig_719950
2174 JGI24736J21556_1003706
2175 JGI24736J21556_1018176
2176 JGI24741J21665_1000800
2177 JGI24741J21665_1000867
2178 JGI24741J21665_1000873
2179 JGI24741J21665_1002927
2180 JGI24740J21852_10000833
2181 JGI24740J21852_10002444
2182 JGI24740J21852_10003279
2183 JGI24740J21852_10011531
2184 JGI24740J21852_10050988
2185 JGI24739J22299_10003761
2186 JGI24739J22299_10003964
2187 JGI24737J22298_10004736
2188 JGI24743J22301_10001171
2189 JGI24735J21928_10001752
2190 JGI24735J21928_10005070
2191 JGI24738J21930_10002476
2192 JGI24749J21850_1001805
2193 JGI24033J26618_1001172
2194 JGI24034J26672_10005980
2195 JGI25155J39150_1000057
2196 JGI25156J39149_1000073
2197 JGI25156J39149_1000673
2198 JGI25156J39149_1002242
2199 JGI25162J39368_1000468
2200 JGI25162J39368_1000971
2201 JGI25162J39368_1001279
2202 JGI25154J39366_1000097
2203 JGI25154J39366_1001421
2204 JGI25157J39369_1000075
2205 JGI25157J39369_1000089
2206 JGI25157J39369_1000469
2207 JGI25157J39369_1000772
2208 JGI25164J39214_1000193
2209 JGI25164J39214_1000242
2210 JGI25159J45721_1001136
2211 JGI25159J45721_1005739
2212 JGI25151J46595_10004543
2213 JGI25151J46595_10029108
2214 JGI25406J46586_10025745
2215 JGI25165J46597_1000335
2216 JGI25165J46597_1002530
2217 JGI25160J50197_1000076
2218 JGI26145J50221_1001413
2219 JGI25161J50226_1000058
2220 Ga0055539_1002563
2221 Ga0055533_1000011
2222 Ga0055533_1005444
2223 Ga0055525_1000089
2224 Ga0055525_1001594
2225 Ga0055527_1000084
2226 Ga0055527_1000206
2227 Ga0055535_1000426
2228 Ga0055535_1000639
2229 Ga0055535_1000728
2230 Ga0055542_1000057
2231 Ga0055542_1000107
2232 Ga0055542_1000195
2233 Ga0055542_1000455
2234 Ga0055529_1000460
2235 Ga0055529_1000881
2236 Ga0055526_1005666
2237 Ga0055526_1005854
2238 Ga0055537_1000730
2239 Ga0055537_1014657
2240 Ga0055524_1001067
2241 Ga0055524_1003977
2242 Ga0055536_1000621
2243 Ga0055536_1001793
2244 Ga0055536_1008264
2245 Ga0055536_1008702
2246 Ga0055534_1002014
2247 Ga0055528_1006463
2248 Ga0055530_10002477
2249 Ga0055530_10006463
2250 Ga0055530_10009456
2251 Ga0055530_10014991
2252 Ga0055540_1001926
2253 Ga0055540_1005515
2254 Ga0055531_10000450
2255 Ga0055531_10002822
2256 Ga0055531_10008906
2257 Ga0055531_10010909
2258 Ga0055531_10013622
2259 Ga0055531_10040125
2260 Ga0055531_10041520
2261 Ga0058692_1000142
2262 Ga0058692_1015531
2263 Ga0055543_1002375
2264 Ga0065165_1000949
2265 Ga0065165_1004485
2266 Ga0065165_1023570
2267 Ga0065165_1037799
2268 Ga0065165_1040512
2269 Ga0065712_10084506
2270 Ga0065715_10023686
2271 Ga0065715_10118965
2272 Ga0065715_10181169
2273 Ga0065707_10118060
2274 Ga0070658_10001353
2275 Ga0070658_10003530
2276 Ga0070658_10005606
2277 Ga0070658_10011570
2278 Ga0070658_10058004
2279 Ga0070658_10070760
2280 Ga0070658_10091592
2281 Ga0070658_10117242
2282 Ga0070658_10136788
2283 Ga0070676_10015962
2284 Ga0070676_10044461
2285 Ga0070683_100007585
2286 Ga0070683_100024660
2287 Ga0070683_100037375
2288 Ga0070683_100045251
2289 Ga0070683_100064518
2290 Ga0070690_100011275
2291 Ga0070690_100015791
2292 Ga0070690_100044508
2293 Ga0070670_100000002
2294 Ga0070670_100080375
2295 Ga0070670_100101779
2296 Ga0070670_100102372
2297 Ga0070670_100102443
2298 Ga0070670_100416273
2299 Ga0070677_10008613
2300 Ga0070677_10014193
2301 Ga0068869_100025426
2302 Ga0068869_100036648
2303 Ga0068869_100049779
2304 Ga0068869_100274068
2305 Ga0070666_10122162
2306 Ga0070680_100004287
2307 Ga0070680_100008203
2308 Ga0070680_100035878
2309 Ga0070680_100055851
2310 Ga0070680_100065166
2311 Ga0070680_100128398
2312 Ga0070680_100197564
2313 Ga0070680_100204475
2314 Ga0070680_100249745
2315 Ga0070680_100286698
2316 Ga0070682_100003586
2317 Ga0070682_100057489
2318 Ga0070682_100068347
2319 Ga0070682_100080136
2320 Ga0070682_100087362
2321 Ga0070682_100221678
2322 Ga0068868_100028093
2323 Ga0068868_100062772
2324 Ga0070660_100000006
2325 Ga0070660_100000378
2326 Ga0070660_100004561
2327 Ga0070660_100005115
2328 Ga0070660_100025856
2329 Ga0070660_100031954
2330 Ga0070660_100036722
2331 Ga0070660_100046895
2332 Ga0070660_100047116
2333 Ga0070660_100048131
2334 Ga0070689_100000001
2335 Ga0070689_100000908
2336 Ga0070689_100034696
2337 Ga0070689_100078629
2338 Ga0070689_100349627
2339 Ga0070691_10000225
2340 Ga0070691_10037443
2341 Ga0070687_100054025
2342 Ga0070661_100000697
2343 Ga0070661_100002483
2344 Ga0070661_100006538
2345 Ga0070661_100007312
2346 Ga0070661_100007351
2347 Ga0070661_100008194
2348 Ga0070661_100017270
2349 Ga0070661_100093035
2350 Ga0070661_100094016
2351 Ga0070661_100143156
2352 Ga0070661_100163917
2353 Ga0070661_100178757
2354 Ga0070692_10022026
2355 Ga0070692_10209677
2356 Ga0070668_100020914
2357 Ga0070668_100026755
2358 Ga0070668_100101492
2359 Ga0070669_100002974
2360 Ga0070669_100025109
2361 Ga0070669_100072519
2362 Ga0070669_100110163
2363 Ga0070669_100131910
2364 Ga0070675_100027074
2365 Ga0070675_100060456
2366 Ga0070675_100152298
2367 Ga0070675_100170806
2368 Ga0070671_100000047
2369 Ga0070671_100001263
2370 Ga0070671_100018028
2371 Ga0070671_100042151
2372 Ga0070671_100092608
2373 Ga0070671_100166376
2374 Ga0070671_100304197
2375 Ga0070671_100304496
2376 Ga0070673_100001025
2377 Ga0070673_100038215
2378 Ga0070673_100133891
2379 Ga0070673_100178224
2380 Ga0070673_100240206
2381 Ga0070688_100029825
2382 Ga0070688_100126319
2383 Ga0070688_100141474
2384 Ga0070659_100000082
2385 Ga0070659_100001873
2386 Ga0070659_100003652
2387 Ga0070659_100013172
2388 Ga0070659_100026087
2389 Ga0070659_100029716
2390 Ga0070659_100044848
2391 Ga0070659_100050838
2392 Ga0070659_100082379
2393 Ga0070659_100083949
2394 Ga0070659_100209363
2395 Ga0070659_100348957
2396 Ga0070667_100000018
2397 Ga0070667_100000136
2398 Ga0070667_100001189
2399 Ga0070667_100002630
2400 Ga0070667_100152524
2401 Ga0070667_100287926
2402 Ga0070667_100332894
2403 Ga0070709_10002390
2404 Ga0070709_10011717
2405 Ga0070714_100000079
2406 Ga0070714_100001813
2407 Ga0070714_100003909
2408 Ga0070714_100005545
2409 Ga0070714_100016187
2410 Ga0070714_100032402
2411 Ga0070714_100106704
2412 Ga0070713_100027496
2413 Ga0070713_100027807
2414 Ga0070711_100022012
2415 Ga0070711_100113121
2416 Ga0070705_100008150
2417 Ga0070705_100066153
2418 Ga0070700_100009824
2419 Ga0070700_100040823
2420 Ga0070700_100050672
2421 Ga0070708_100090787
2422 Ga0070663_100000069
2423 Ga0070663_100000204
2424 Ga0070663_100002048
2425 Ga0070663_100010569
2426 Ga0070663_100011864
2427 Ga0070663_100017483
2428 Ga0070663_100056714
2429 Ga0070663_100070594
2430 Ga0070663_100087373
2431 Ga0070663_100124726
2432 Ga0070663_100156761
2433 Ga0070663_100165351
2434 Ga0070663_100206060
2435 Ga0070663_100373390
2436 Ga0070678_100004415
2437 Ga0070678_100035451
2438 Ga0070678_100072802
2439 Ga0070678_100092613
2440 Ga0070678_100294093
2441 Ga0070662_100000546
2442 Ga0070662_100038980
2443 Ga0070662_100103515
2444 Ga0070681_10000186
2445 Ga0070681_10001722
2446 Ga0070681_10001805
2447 Ga0070681_10016914
2448 Ga0070681_10028888
2449 Ga0070681_10209235
2450 Ga0070681_10313016
2451 Ga0070685_10000011
2452 Ga0070685_10005572
2453 Ga0070685_10012813
2454 Ga0070685_10037523
2455 Ga0070685_10202572
2456 Ga0070706_100075356
2457 Ga0070698_100002222
2458 Ga0070699_100006475
2459 Ga0070699_100093465
2460 Ga0070679_100000168
2461 Ga0070679_100000209
2462 Ga0070679_100006033
2463 Ga0070679_100015243
2464 Ga0070679_100017095
2465 Ga0070679_100046964
2466 Ga0070679_100098164
2467 Ga0070679_100222455
2468 Ga0070679_100245652
2469 Ga0070679_100246614
2470 Ga0070679_100321364
2471 Ga0070684_100004281
2472 Ga0070684_100013549
2473 Ga0070684_100020604
2474 Ga0070684_100051000
2475 Ga0068853_100002701
2476 Ga0068853_100008568
2477 Ga0068853_100018661
2478 Ga0068853_100025749
2479 Ga0068853_100067167
2480 Ga0068853_100116026
2481 Ga0068853_100143380
2482 Ga0068853_100156669
2483 Ga0068853_100212350
2484 Ga0068853_100295223
2485 Ga0070672_100021972
2486 Ga0070672_100043703
2487 Ga0070672_100142343
2488 Ga0070672_100297086
2489 Ga0070686_100030021
2490 Ga0070695_100008874
2491 Ga0070696_100001072
2492 Ga0070696_100003297
2493 Ga0070696_100030889
2494 Ga0070696_100055603
2495 Ga0070696_100064029
2496 Ga0070693_100034600
2497 Ga0070693_100036637
2498 Ga0070693_100082785
2499 Ga0070665_100003964
2500 Ga0070665_100007774
2501 Ga0070665_100019771
2502 Ga0070665_100025711
2503 Ga0070665_100057362
2504 Ga0068855_100000036
2505 Ga0068855_100000480
2506 Ga0068855_100001533
2507 Ga0068855_100004530
2508 Ga0068855_100007664
2509 Ga0068855_100026190
2510 Ga0068855_100026592
2511 Ga0068855_100030225
2512 Ga0068855_100050548
2513 Ga0068855_100102087
2514 Ga0068855_100109262
2515 Ga0068855_100136938
2516 Ga0068855_100171276
2517 Ga0068855_100197425
2518 Ga0068855_100399817
2519 Ga0070664_100000152
2520 Ga0070664_100002216
2521 Ga0070664_100002766
2522 Ga0070664_100004863
2523 Ga0070664_100031462
2524 Ga0070664_100037535
2525 Ga0070664_100065976
2526 Ga0070664_100192630
2527 Ga0070664_100335752
2528 Ga0068857_100011649
2529 Ga0068857_100018647
2530 Ga0068857_100020611
2531 Ga0068857_100023989
2532 Ga0068857_100080701
2533 Ga0068857_100090959
2534 Ga0068857_100125818
2535 Ga0068857_100560876
2536 Ga0068854_100000190
2537 Ga0068854_100005665
2538 Ga0068854_100007267
2539 Ga0068854_100014610
2540 Ga0068854_100014693
2541 Ga0068854_100019713
2542 Ga0068854_100089482
2543 Ga0068854_100129743
2544 Ga0068854_100132664
2545 Ga0068856_100000409
2546 Ga0068856_100000871
2547 Ga0068856_100004156
2548 Ga0068856_100004503
2549 Ga0068856_100020224
2550 Ga0068856_100062649
2551 Ga0068856_100067352
2552 Ga0068856_100077891
2553 Ga0068856_100149033
2554 Ga0068856_100282905
2555 Ga0068856_100343183
2556 Ga0068856_100375518
2557 Ga0068856_100460519
2558 Ga0070702_100026916
2559 Ga0070702_100038356
2560 Ga0070702_100207622
2561 Ga0068852_100006255
2562 Ga0068852_100012065
2563 Ga0068852_100015026
2564 Ga0068852_100023687
2565 Ga0068852_100035141
2566 Ga0068852_100048219
2567 Ga0068852_100052885
2568 Ga0068852_100122524
2569 Ga0068852_100318374
2570 Ga0068859_100003324
2571 Ga0068859_100013908
2572 Ga0068859_100018022
2573 Ga0068859_100034393
2574 Ga0068859_100091461
2575 Ga0068864_100000003
2576 Ga0068864_100015374
2577 Ga0068864_100022493
2578 Ga0068864_100029374
2579 Ga0068864_100032138
2580 Ga0068864_100038634
2581 Ga0068864_100051693
2582 Ga0068864_100065129
2583 Ga0068864_100065381
2584 Ga0068864_100072359
2585 Ga0068864_100130939
2586 Ga0068864_100139768
2587 Ga0068864_100168939
2588 Ga0068866_10004226
2589 Ga0068861_100008881
2590 Ga0068861_100022627
2591 Ga0068861_100022771
2592 Ga0068861_100069845
2593 Ga0068851_10003350
2594 Ga0068851_10010852
2595 Ga0068851_10016754
2596 Ga0068851_10025248
2597 Ga0068851_10120751
2598 Ga0068863_100000676
2599 Ga0068863_100015016
2600 Ga0068863_100018221
2601 Ga0068863_100020554
2602 Ga0068863_100043692
2603 Ga0068863_100047277
2604 Ga0068863_100089543
2605 Ga0068863_100105072
2606 Ga0068863_100177808
2607 Ga0068858_100007507
2608 Ga0068858_100183499
2609 Ga0068860_100004338
2610 Ga0068860_100005019
2611 Ga0068860_100032807
2612 Ga0068860_100034112
2613 Ga0068860_100048959
2614 Ga0068860_100074436
2615 Ga0068862_100000550
2616 Ga0068862_100001116
2617 Ga0068862_100024262
2618 Ga0068862_100028576
2619 Ga0068862_100048865
2620 Ga0068862_100531222
2621 Ga0081455_10000066
2622 Ga0081455_10001237
2623 Ga0081539_10001910
2624 Ga0070717_10002720
2625 Ga0070717_10003857
2626 Ga0070717_10048918
2627 Ga0070717_10472666
2628 Ga0075365_10060459
2629 Ga0075363_100011681
2630 Ga0075363_100147866
2631 Ga0075364_10026765
2632 Ga0070716_100073708
2633 Ga0070716_100147098
2634 Ga0075369_10052301
2635 Ga0075366_10012523
2636 Ga0075366_10099029
2637 Ga0075366_10101296
2638 Ga0097621_100005667
2639 Ga0097621_100029431
2640 Ga0097621_100038404
2641 Ga0097621_100054938
2642 Ga0097621_100213191
2643 Ga0097621_100219439
2644 Ga0097621_100490550
2645 Ga0075370_10004592
2646 Ga0075370_10008051
2647 Ga0075370_10026557
2648 Ga0075370_10090032
2649 Ga0075370_10110310
2650 Ga0068871_100000930
2651 Ga0068871_100053826
2652 Ga0068871_100054239
2653 Ga0068871_100148555
2654 Ga0068871_100169330
2655 Ga0068871_100201616
2656 Ga0075428_100317283
2657 Ga0075430_100006474
2658 Ga0075430_100028405
2659 Ga0075430_100274356
2660 Ga0075431_100019689
2661 Ga0075431_100032826
2662 Ga0075431_100057239
2663 Ga0075433_10023918
2664 Ga0075434_100438413
2665 Ga0075429_100168055
2666 Ga0068865_100038247
2667 Ga0068865_100087868
2668 Ga0075436_100038337
2669 Ga0097620_100003324
2670 Ga0097620_100013909
2671 Ga0097620_100018020
2672 Ga0097620_100034393
2673 Ga0097620_100091464
2674 Ga0079104_1016454
2675 Ga0075435_100062520
2676 Ga0075435_100240315
2677 Ga0099794_10007575
2678 Ga0099795_10000375
2679 Ga0105240_10001797
2680 Ga0105240_10004421
2681 Ga0105240_10023500
2682 Ga0105240_10028258
2683 Ga0105240_10039469
2684 Ga0105240_10068076
2685 Ga0105240_10140267
2686 Ga0105240_10195986
2687 Ga0105240_10263066
2688 Ga0105240_10306918
2689 Ga0105240_10656185
2690 Ga0111539_10057264
2691 Ga0105245_10015709
2692 Ga0105245_10272104
2693 Ga0105247_10055366
2694 Ga0114129_10010131
2695 Ga0114129_10028488
2696 Ga0114129_10110971
2697 Ga0114129_10199985
2698 Ga0114129_10596294
2699 Ga0105243_10098111
2700 Ga0105243_10142412
2701 Ga0105241_10016286
2702 Ga0105241_10023539
2703 Ga0105241_10214386
2704 Ga0105241_10290255
2705 Ga0105242_10140285
2706 Ga0105248_10001300
2707 Ga0105248_10003092
2708 Ga0105248_10011726
2709 Ga0105248_10038844
2710 Ga0105248_10075626
2711 Ga0105248_10145097
2712 Ga0105248_10224022
2713 Ga0105248_10253051
2714 Ga0105248_10295518
2715 Ga0105248_10399827
2716 Ga0105248_10436412
2717 Ga0105237_10020873
2718 Ga0105237_10046769
2719 Ga0105237_10060291
2720 Ga0105237_10061882
2721 Ga0105237_10113145
2722 Ga0105237_10248072
2723 Ga0105237_10396390
2724 Ga0105237_10422306
2725 Ga0105238_10000864
2726 Ga0105238_10003335
2727 Ga0105238_10010092
2728 Ga0105238_10057176
2729 Ga0105238_10071848
2730 Ga0105238_10078033
2731 Ga0105238_10141550
2732 Ga0105238_10141928
2733 Ga0105238_10154215
2734 Ga0105238_10161842
2735 Ga0105238_10208849
2736 Ga0105238_10239149
2737 Ga0105238_10362978
2738 Ga0105249_10000195
2739 Ga0105249_10021588
2740 Ga0105249_10028673
2741 Ga0105249_10078976
2742 Ga0099796_10000691
2743 Ga0105239_10029266
2744 Ga0105239_10048993
2745 Ga0105239_10067091
2746 Ga0105239_10082305
2747 Ga0105239_10090653
2748 Ga0105239_10096260
2749 Ga0105239_10122764
2750 Ga0105246_10043591
2751 Ga0105246_10243297
2752 Ga0157373_10011386
2753 Ga0157373_10012292
2754 Ga0157373_10022939
2755 Ga0157373_10036718
2756 Ga0157373_10062337
2757 Ga0157373_10084911
2758 Ga0157373_10113382
2759 Ga0157373_10129460
2760 Ga0157373_10158310
2761 Ga0157371_10001396
2762 Ga0157371_10083526
2763 Ga0157371_10092881
2764 Ga0157371_10093688
2765 Ga0157371_10120715
2766 Ga0157371_10125727
2767 Ga0157370_10000793
2768 Ga0157370_10006992
2769 Ga0157370_10007658
2770 Ga0157370_10017138
2771 Ga0157370_10112349
2772 Ga0157370_10128016
2773 Ga0157370_10145186
2774 Ga0157370_10179950
2775 Ga0157370_10181923
2776 Ga0157370_10285818
2777 Ga0157370_10323000
2778 Ga0157370_10383065
2779 Ga0157369_10000185
2780 Ga0157369_10004153
2781 Ga0157369_10008454
2782 Ga0157369_10040968
2783 Ga0157369_10065759
2784 Ga0157369_10135362
2785 Ga0157369_10509066
2786 Ga0157374_10019967
2787 Ga0157374_10034227
2788 Ga0157374_10080136
2789 Ga0157374_10086107
2790 Ga0157374_10090083
2791 Ga0157374_10107629
2792 Ga0157374_10137624
2793 Ga0157374_10175451
2794 Ga0157374_10401366
2795 Ga0157378_10034473
2796 Ga0157378_10214988
2797 Ga0157378_10341662
2798 Ga0163162_10000021
2799 Ga0163162_10081285
2800 Ga0163162_10815076
2801 Ga0157372_10002671
2802 Ga0157372_10024015
2803 Ga0157372_10025492
2804 Ga0157372_10026197
2805 Ga0157372_10059284
2806 Ga0157372_10101095
2807 Ga0157372_10104398
2808 Ga0157372_10120965
2809 Ga0157372_10142936
2810 Ga0157372_10193241
2811 Ga0157372_10201177
2812 Ga0157372_10232360
2813 Ga0157372_10252443
2814 Ga0157372_10280912
2815 Ga0157372_10454398
2816 Ga0157375_10002586
2817 Ga0157375_10007788
2818 Ga0157375_10019559
2819 Ga0157375_10036322
2820 Ga0157375_10054977
2821 Ga0157375_10078869
2822 Ga0157375_10173230
2823 Ga0163163_10000132
2824 Ga0163163_10001449
2825 Ga0163163_10036340
2826 Ga0163163_10130413
2827 Ga0163163_10228447
2828 Ga0163163_10400697
2829 Ga0163163_10458181
2830 Ga0157380_10000114
2831 Ga0157380_10040570
2832 Ga0182008_10008704
2833 Ga0182008_10008890
2834 Ga0157377_10057967
2835 Ga0157379_10000505
2836 Ga0157379_10009200
2837 Ga0157379_10017855
2838 Ga0157379_10224730
2839 Ga0157376_10002600
2840 Ga0157376_10030928
2841 Ga0157376_10042383
2842 Ga0157376_10100800
2843 Ga0157376_10129041
2844 Ga0157376_10240571
2845 Ga0157376_10571598
2846 Ga0182006_1000161
2847 Ga0182006_1022511
2848 Ga0182007_10009993
2849 Ga0182007_10031769
2850 Ga0182005_1004688
2851 Ga0182005_1004909
2852 Ga0183368_1003
2853 Ga0163161_10046242
2854 Ga0163161_10131379
2855 Ga0163161_10188067
2856 Ga0206356_10235604
2857 Ga0206351_10193420
2858 Ga0206354_10341756
2859 Ga0206353_10095998
2860 Ga0154015_1244858
2861 Ga0154015_1402022
2862 Ga0213873_10024325
2863 Ga0213874_10033033
2864 Ga0213876_10011988
2865 Ga0213876_10023781
2866 Ga0209435_100008
2867 Ga0209436_110535
2868 Ga0209566_100231
2869 Ga0209674_100003
2870 Ga0209674_100086
2871 Ga0209674_100488
2872 Ga0209674_100751
2873 Ga0209672_100020
2874 Ga0209672_100029
2875 Ga0209672_100049
2876 Ga0209672_100066
2877 Ga0209147_100024
2878 Ga0209147_100084
2879 Ga0209563_100010
2880 Ga0209563_100051
2881 Ga0207427_100117
2882 Ga0207427_100178
2883 Ga0207427_101735
2884 Ga0207427_102934
2885 Ga0209437_100240
2886 Ga0209437_100304
2887 Ga0209437_100482
2888 Ga0209437_101084
2889 Ga0209258_100053
2890 Ga0209258_100084
2891 Ga0209258_100087
2892 Ga0209258_100117
2893 Ga0209258_100144
2894 Ga0209258_100647
2895 Ga0209258_102270
2896 Ga0207425_1010948
2897 Ga0209646_1000029
2898 Ga0209646_1000066
2899 Ga0209026_1000016
2900 Ga0209026_1000027
2901 Ga0209026_1000074
2902 Ga0209026_1000093
2903 Ga0209026_1001064
2904 Ga0209677_100044
2905 Ga0209677_100128
2906 Ga0209677_101339
2907 Ga0209677_102377
2908 Ga0209148_1000009
2909 Ga0209148_1000055
2910 Ga0209148_1000096
2911 Ga0209148_1000114
2912 Ga0209148_1000141
2913 Ga0209148_1000148
2914 Ga0209148_1001683
2915 Ga0209759_1000016
2916 Ga0209759_1000110
2917 Ga0209759_1000387
2918 Ga0209759_1006844
2919 Ga0209759_1008612
2920 Ga0209129_1009361
2921 Ga0209233_1000083
2922 Ga0209233_1000287
2923 Ga0209233_1000417
2924 Ga0209565_1000041
2925 Ga0209565_1000597
2926 Ga0209565_1003353
2927 Ga0209565_1008241
2928 Ga0209455_1000060
2929 Ga0209455_1000088
2930 Ga0209455_1000110
2931 Ga0209455_1003953
2932 Ga0209673_1000057
2933 Ga0209673_1001316
2934 Ga0209673_1002473
2935 Ga0209130_1000014
2936 Ga0209130_1003456
2937 Ga0209130_1005797
2938 Ga0209675_1000783
2939 Ga0209675_1010551
2940 Ga0209675_1012756
2941 Ga0209676_1000013
2942 Ga0209676_1000153
2943 Ga0209676_1000414
2944 Ga0209676_1000928
2945 Ga0209676_1000971
2946 Ga0209676_1001166
2947 Ga0209676_1002764
2948 Ga0209676_1005511
2949 Ga0209025_1000819
2950 Ga0209025_1003991
2951 Ga0209025_1013203
2952 Ga0209564_1001403
2953 Ga0209564_1002122
2954 Ga0209564_1004135
2955 Ga0209564_1005783
2956 Ga0209564_1013128
2957 Ga0209564_1017578
2958 Ga0209758_1004353
2959 Ga0209758_1004543
2960 Ga0209758_1010044
2961 Ga0209758_1032092
2962 Ga0209050_1000008
2963 Ga0209050_1001001
2964 Ga0209050_1001040
2965 Ga0209050_1002812
2966 Ga0209050_1005563
2967 Ga0209050_1006477
2968 Ga0209050_1012340
2969 Ga0209050_1013887
2970 Ga0209256_1000039
2971 Ga0209256_1000670
2972 Ga0209256_1001995
2973 Ga0209256_1010505
2974 Ga0209256_1010741
2975 Ga0209256_1013905
2976 Ga0207426_1000174
2977 Ga0207426_1002190
2978 Ga0209051_1000005
2979 Ga0209051_1000354
2980 Ga0209051_1001411
2981 Ga0209051_1011234
2982 Ga0209051_1017460
2983 Ga0209257_1000031
2984 Ga0209257_1000184
2985 Ga0209257_1000186
2986 Ga0209257_1000616
2987 Ga0209257_1000916
2988 Ga0209257_1001656
2989 Ga0209257_1002298
2990 Ga0209257_1002620
2991 Ga0209257_1008929
2992 Ga0209257_1015048
2993 Ga0207697_10000097
2994 Ga0207697_10010256
2995 Ga0207697_10028013
2996 Ga0207656_10001616
2997 Ga0207656_10020861
2998 Ga0207656_10029893
2999 Ga0207656_10089236
3000 Ga0207682_10000606
3001 Ga0207682_10009513
3002 Ga0207688_10000116
3003 Ga0207680_10017501
3004 Ga0207647_10001462
3005 Ga0207647_10001869
3006 Ga0207647_10006674
3007 Ga0207647_10008408
3008 Ga0207647_10015485
3009 Ga0207647_10050884
3010 Ga0207647_10064672
3011 Ga0207699_10007949
3012 Ga0207645_10000751
3013 Ga0207645_10049349
3014 Ga0207643_10000178
3015 Ga0207643_10073745
3016 Ga0207705_10000003
3017 Ga0207705_10000131
3018 Ga0207705_10000146
3019 Ga0207705_10003397
3020 Ga0207705_10003406
3021 Ga0207705_10003729
3022 Ga0207705_10005607
3023 Ga0207705_10007205
3024 Ga0207705_10008024
3025 Ga0207705_10008884
3026 Ga0207705_10020214
3027 Ga0207705_10033292
3028 Ga0207705_10061477
3029 Ga0207705_10075461
3030 Ga0207705_10097427
3031 Ga0207654_10012458
3032 Ga0207654_10107726
3033 Ga0207654_10192013
3034 Ga0207707_10000168
3035 Ga0207707_10000215
3036 Ga0207707_10006842
3037 Ga0207707_10006998
3038 Ga0207707_10014027
3039 Ga0207707_10014706
3040 Ga0207707_10033686
3041 Ga0207707_10036106
3042 Ga0207707_10078805
3043 Ga0207707_10110001
3044 Ga0207707_10170473
3045 Ga0207707_10238315
3046 Ga0207695_10001113
3047 Ga0207695_10001799
3048 Ga0207695_10006878
3049 Ga0207695_10015367
3050 Ga0207695_10022510
3051 Ga0207695_10027319
3052 Ga0207695_10030192
3053 Ga0207695_10035912
3054 Ga0207695_10148734
3055 Ga0207695_10159823
3056 Ga0207695_10163005
3057 Ga0207695_10165850
3058 Ga0207695_10166453
3059 Ga0207671_10021180
3060 Ga0207671_10136168
3061 Ga0207671_10213308
3062 Ga0207671_10217718
3063 Ga0207693_10067411
3064 Ga0207693_10206708
3065 Ga0207660_10000227
3066 Ga0207660_10002134
3067 Ga0207660_10003818
3068 Ga0207660_10004969
3069 Ga0207660_10005823
3070 Ga0207660_10017556
3071 Ga0207660_10083176
3072 Ga0207660_10117507
3073 Ga0207660_10139263
3074 Ga0207662_10015909
3075 Ga0207657_10000003
3076 Ga0207657_10001611
3077 Ga0207657_10001988
3078 Ga0207657_10005362
3079 Ga0207657_10006429
3080 Ga0207657_10006601
3081 Ga0207657_10007281
3082 Ga0207657_10008053
3083 Ga0207657_10009315
3084 Ga0207657_10009409
3085 Ga0207657_10011673
3086 Ga0207657_10015108
3087 Ga0207657_10043281
3088 Ga0207657_10119040
3089 Ga0207657_10169956
3090 Ga0207657_10174880
3091 Ga0207657_10182020
3092 Ga0207657_10342971
3093 Ga0207649_10000589
3094 Ga0207649_10001798
3095 Ga0207649_10003120
3096 Ga0207649_10022398
3097 Ga0207649_10029248
3098 Ga0207649_10030793
3099 Ga0207649_10054677
3100 Ga0207649_10056667
3101 Ga0207649_10060806
3102 Ga0207649_10173575
3103 Ga0207652_10000158
3104 Ga0207652_10000282
3105 Ga0207652_10000956
3106 Ga0207652_10004584
3107 Ga0207652_10005330
3108 Ga0207652_10007449
3109 Ga0207652_10012340
3110 Ga0207652_10028196
3111 Ga0207652_10061330
3112 Ga0207652_10094510
3113 Ga0207652_10129621
3114 Ga0207652_10247259
3115 Ga0207652_10277873
3116 Ga0207681_10007817
3117 Ga0207681_10022395
3118 Ga0207681_10045690
3119 Ga0207681_10050848
3120 Ga0207681_10084941
3121 Ga0207681_10136124
3122 Ga0207681_10137195
3123 Ga0207694_10002683
3124 Ga0207694_10005613
3125 Ga0207694_10008293
3126 Ga0207694_10024724
3127 Ga0207694_10062475
3128 Ga0207694_10138033
3129 Ga0207694_10175408
3130 Ga0207694_10195737
3131 Ga0207694_10203323
3132 Ga0207650_10000003
3133 Ga0207650_10002909
3134 Ga0207650_10008403
3135 Ga0207650_10032987
3136 Ga0207650_10033415
3137 Ga0207650_10055555
3138 Ga0207650_10105568
3139 Ga0207650_10185133
3140 Ga0207650_10318920
3141 Ga0207650_10413278
3142 Ga0207659_10004458
3143 Ga0207659_10017662
3144 Ga0207659_10202659
3145 Ga0207687_10000298
3146 Ga0207687_10061436
3147 Ga0207700_10030366
3148 Ga0207700_10033041
3149 Ga0207700_10059559
3150 Ga0207700_10154748
3151 Ga0207700_10232598
3152 Ga0207700_10499686
3153 Ga0207664_10000036
3154 Ga0207664_10001394
3155 Ga0207664_10011395
3156 Ga0207664_10015374
3157 Ga0207664_10029328
3158 Ga0207664_10051411
3159 Ga0207664_10260182
3160 Ga0207644_10000055
3161 Ga0207644_10000272
3162 Ga0207644_10003350
3163 Ga0207644_10050006
3164 Ga0207644_10081484
3165 Ga0207644_10095215
3166 Ga0207644_10117940
3167 Ga0207644_10216232
3168 Ga0207644_10233212
3169 Ga0207690_10000007
3170 Ga0207690_10000839
3171 Ga0207690_10000957
3172 Ga0207690_10001891
3173 Ga0207690_10002067
3174 Ga0207690_10002972
3175 Ga0207690_10004750
3176 Ga0207690_10016359
3177 Ga0207690_10041918
3178 Ga0207690_10121720
3179 Ga0207690_10197854
3180 Ga0207690_10372173
3181 Ga0207706_10000267
3182 Ga0207706_10004822
3183 Ga0207706_10007955
3184 Ga0207706_10022681
3185 Ga0207706_10117762
3186 Ga0207706_10267750
3187 Ga0207709_10002291
3188 Ga0207709_10101806
3189 Ga0207709_10372408
3190 Ga0207670_10000036
3191 Ga0207670_10017186
3192 Ga0207670_10028630
3193 Ga0207670_10033733
3194 Ga0207670_10037814
3195 Ga0207669_10061952
3196 Ga0207669_10083924
3197 Ga0207704_10125238
3198 Ga0207665_10056330
3199 Ga0207665_10073092
3200 Ga0207691_10010387
3201 Ga0207691_10011417
3202 Ga0207691_10013709
3203 Ga0207691_10019796
3204 Ga0207691_10020605
3205 Ga0207691_10045931
3206 Ga0207691_10052482
3207 Ga0207691_10131637
3208 Ga0207711_10000855
3209 Ga0207711_10000945
3210 Ga0207711_10013434
3211 Ga0207711_10013551
3212 Ga0207711_10022316
3213 Ga0207711_10070317
3214 Ga0207711_10287045
3215 Ga0207689_10000289
3216 Ga0207689_10046883
3217 Ga0207689_10118439
3218 Ga0207689_10265165
3219 Ga0207661_10009656
3220 Ga0207661_10030731
3221 Ga0207661_10143425
3222 Ga0207661_10313935
3223 Ga0207679_10000467
3224 Ga0207679_10004621
3225 Ga0207679_10007563
3226 Ga0207679_10023274
3227 Ga0207679_10034382
3228 Ga0207679_10043417
3229 Ga0207679_10088413
3230 Ga0207679_10182615
3231 Ga0207667_10000007
3232 Ga0207667_10000586
3233 Ga0207667_10001159
3234 Ga0207667_10001393
3235 Ga0207667_10003714
3236 Ga0207667_10005210
3237 Ga0207667_10014484
3238 Ga0207667_10016531
3239 Ga0207667_10020707
3240 Ga0207667_10022920
3241 Ga0207667_10023090
3242 Ga0207667_10032515
3243 Ga0207667_10058758
3244 Ga0207667_10091006
3245 Ga0207667_10099628
3246 Ga0207667_10104865
3247 Ga0207667_10114164
3248 Ga0207667_10118201
3249 Ga0207667_10288238
3250 Ga0207667_10350065
3251 Ga0207667_10408828
3252 Ga0207651_10001867
3253 Ga0207651_10031395
3254 Ga0207651_10039497
3255 Ga0207651_10056704
3256 Ga0207651_10087761
3257 Ga0207651_10090027
3258 Ga0207712_10003682
3259 Ga0207712_10074461
3260 Ga0207712_10096205
3261 Ga0207668_10039433
3262 Ga0207668_10059489
3263 Ga0207668_10240923
3264 Ga0207640_10000291
3265 Ga0207640_10002225
3266 Ga0207640_10003065
3267 Ga0207640_10004131
3268 Ga0207640_10004350
3269 Ga0207640_10006559
3270 Ga0207640_10006932
3271 Ga0207640_10017678
3272 Ga0207640_10101615
3273 Ga0207640_10132263
3274 Ga0207658_10000004
3275 Ga0207658_10000640
3276 Ga0207658_10002188
3277 Ga0207658_10025984
3278 Ga0207658_10190401
3279 Ga0207658_10192318
3280 Ga0207658_10276021
3281 Ga0207677_10053833
3282 Ga0207677_10070786
3283 Ga0207677_10120548
3284 Ga0207677_10177041
3285 Ga0207703_10131295
3286 Ga0207639_10003451
3287 Ga0207639_10003476
3288 Ga0207639_10009437
3289 Ga0207639_10030575
3290 Ga0207639_10065211
3291 Ga0207639_10070898
3292 Ga0207639_10074999
3293 Ga0207639_10171253
3294 Ga0207639_10171553
3295 Ga0207639_10181683
3296 Ga0207639_10246362
3297 Ga0207639_10301140
3298 Ga0207678_10000160
3299 Ga0207678_10001430
3300 Ga0207678_10001471
3301 Ga0207678_10001480
3302 Ga0207678_10001640
3303 Ga0207678_10001768
3304 Ga0207678_10004079
3305 Ga0207678_10005267
3306 Ga0207678_10006377
3307 Ga0207678_10007045
3308 Ga0207678_10027423
3309 Ga0207678_10048833
3310 Ga0207678_10092102
3311 Ga0207678_10149634
3312 Ga0207678_10232695
3313 Ga0207678_10238032
3314 Ga0207678_10353405
3315 Ga0207708_10000668
3316 Ga0207708_10017052
3317 Ga0207708_10041195
3318 Ga0207708_10119680
3319 Ga0207702_10000128
3320 Ga0207702_10000244
3321 Ga0207702_10000432
3322 Ga0207702_10001083
3323 Ga0207702_10001776
3324 Ga0207702_10002471
3325 Ga0207702_10002683
3326 Ga0207702_10004484
3327 Ga0207702_10008817
3328 Ga0207702_10020180
3329 Ga0207702_10026919
3330 Ga0207702_10142809
3331 Ga0207702_10144806
3332 Ga0207702_10290341
3333 Ga0207702_10311971
3334 Ga0207641_10012760
3335 Ga0207641_10025413
3336 Ga0207641_10029638
3337 Ga0207641_10041063
3338 Ga0207641_10052892
3339 Ga0207641_10055781
3340 Ga0207641_10077897
3341 Ga0207641_10118221
3342 Ga0207641_10134443
3343 Ga0207641_10203206
3344 Ga0207641_10347728
3345 Ga0207648_10002794
3346 Ga0207648_10028635
3347 Ga0207648_10040163
3348 Ga0207648_10083374
3349 Ga0207648_10202405
3350 Ga0207648_10244865
3351 Ga0207648_10312090
3352 Ga0207648_10378584
3353 Ga0207676_10000003
3354 Ga0207676_10002722
3355 Ga0207676_10017485
3356 Ga0207676_10048100
3357 Ga0207676_10105712
3358 Ga0207676_10115176
3359 Ga0207676_10207077
3360 Ga0207676_10211234
3361 Ga0207676_10273043
3362 Ga0207674_10000039
3363 Ga0207674_10003404
3364 Ga0207674_10004794
3365 Ga0207674_10005001
3366 Ga0207674_10005506
3367 Ga0207674_10007751
3368 Ga0207674_10008565
3369 Ga0207674_10011756
3370 Ga0207674_10041750
3371 Ga0207674_10051162
3372 Ga0207674_10088975
3373 Ga0207674_10154524
3374 Ga0207675_100003529
3375 Ga0207675_100007814
3376 Ga0207675_100037403
3377 Ga0207675_100045722
3378 Ga0207675_100056446
3379 Ga0207675_100153901
3380 Ga0207675_100161405
3381 Ga0207675_100185942
3382 Ga0207675_100231854
3383 Ga0207683_10003397
3384 Ga0207683_10004053
3385 Ga0207683_10016296
3386 Ga0207683_10028344
3387 Ga0207683_10028751
3388 Ga0207683_10043033
3389 Ga0207683_10145620
3390 Ga0207683_10303500
3391 Ga0207683_10391103
3392 Ga0207698_10000511
3393 Ga0207698_10000772
3394 Ga0207698_10002291
3395 Ga0207698_10005977
3396 Ga0207698_10007308
3397 Ga0207698_10011617
3398 Ga0207698_10014360
3399 Ga0207698_10038140
3400 Ga0207698_10044515
3401 Ga0207698_10165669
3402 Ga0207698_10271249
3403 Ga0209371_1000402
3404 Ga0209969_1002467
3405 Ga0209969_1004138
3406 Ga0209984_1006643
3407 Ga0210000_1002839
3408 Ga0209179_1001067
3409 Ga0209968_1004405
3410 Ga0209999_1000831
3411 Ga0209999_1024095
3412 Ga0209982_1002696
3413 Ga0209970_1007495
3414 Ga0210002_1009435
3415 Ga0209983_1029795
3416 Ga0209588_1013741
3417 Ga0209971_1001096
3418 Ga0209971_1001702
3419 Ga0209971_1005689
3420 Ga0209966_1002408
3421 Ga0209974_10002606
3422 Ga0209974_10009957
3423 Ga0209974_10014357
3424 Ga0209974_10014761
3425 Ga0207428_10051032
3426 Ga0265354_1001901
3427 Ga0265356_1000958
3428 Ga0265357_1001777
3429 Ga0268266_10002350
3430 Ga0268266_10006760
3431 Ga0268266_10021331
3432 Ga0268266_10030898
3433 Ga0268266_10081031
3434 Ga0268266_10364862
3435 Ga0268265_10000166
3436 Ga0268265_10004150
3437 Ga0268265_10115159
3438 Ga0268264_10000016
3439 Ga0268264_10030656
3440 Ga0268264_10036457
3441 Ga0268264_10111651
3442 Ga0268264_10150826
3443 Ga0265334_10033440
3444 Ga0265336_10000008
3445 Ga0307517_10036337
3446 Ga0307517_10201167
3447 Ga0307515_10073692
3448 Ga0307515_10131399
3449 Ga0265338_10000147
3450 Ga0265338_10015253
3451 Ga0265338_10168423
3452 Ga0268256_1000749
3453 Ga0307511_10173324
3454 Ga0265760_10000671
3455 Ga0265340_10010905
3456 Ga0265327_10000546
3457 Ga0265327_10022058
3458 Ga0265316_10032066
3459 Ga0307513_10000013
3460 Ga0307513_10000037
3461 Ga0307513_10006109
3462 Ga0307513_10009214
3463 Ga0307513_10009485
3464 Ga0307513_10025641
3465 Ga0307513_10031639
3466 Ga0307513_10126660
3467 Ga0307513_10146530
3468 Ga0307509_10040026
3469 Ga0307509_10067018
3470 Ga0307509_10102599
3471 Ga0307509_10175361
3472 Ga0307408_100016400
3473 Ga0307408_100078785
3474 Ga0307408_100084695
3475 Ga0307408_100090577
3476 Ga0307408_100098516
3477 Ga0265313_10062816
3478 Ga0307508_10010305
3479 Ga0307508_10034874
3480 Ga0316575_10016265
3481 Ga0316575_10089516
3482 Ga0265342_10000896
3483 Ga0316576_10010553
3484 Ga0316576_10125990
3485 Ga0316576_10183694
3486 Ga0316578_10101146
3487 Ga0307516_10011653
3488 Ga0307405_10114597
3489 Ga0307405_10144803
3490 Ga0316577_10035089
3491 Ga0316577_10065256
3492 Ga0307413_10000338
3493 Ga0307413_10004322
3494 Ga0307413_10010229
3495 Ga0307413_10020874
3496 Ga0307413_10065277
3497 Ga0307413_10070999
3498 Ga0307413_10216233
3499 Ga0307410_10033725
3500 Ga0307410_10036495
3501 Ga0307410_10046331
3502 Ga0307410_10053878
3503 Ga0307410_10106896
3504 Ga0307410_10119677
3505 Ga0307410_10152060
3506 Ga0307406_10003967
3507 Ga0307406_10009035
3508 Ga0307406_10022167
3509 Ga0307406_10039119
3510 Ga0307406_10040688
3511 Ga0307406_10045880
3512 Ga0307406_10125922
3513 Ga0307407_10033693
3514 Ga0307407_10047631
3515 Ga0307412_10000445
3516 Ga0307412_10003289
3517 Ga0307412_10006797
3518 Ga0307412_10114727
3519 Ga0307412_10149165
3520 Ga0307412_10152871
3521 Ga0307412_10274744
3522 Ga0307412_10291024
3523 Ga0307409_100002862
3524 Ga0307409_100003524
3525 Ga0307409_100028252
3526 Ga0307409_100060791
3527 Ga0307409_100132612
3528 Ga0307409_100302238
3529 Ga0307416_100009355
3530 Ga0307416_100043067
3531 Ga0307416_100129481
3532 Ga0307416_100201961
3533 Ga0307416_100336778
3534 Ga0307416_100572901
3535 Ga0307414_10003324
3536 Ga0307414_10034680
3537 Ga0307414_10039804
3538 Ga0307414_10040002
3539 Ga0307414_10067337
3540 Ga0307414_10072543
3541 Ga0307414_10078692
3542 Ga0307414_10081381
3543 Ga0307414_10086675
3544 Ga0307414_10342435
3545 Ga0307414_10408430
3546 Ga0307411_10001485
3547 Ga0307411_10003060
3548 Ga0307411_10004620
3549 Ga0307411_10040251
3550 Ga0307411_10104301
3551 Ga0307415_100003431
3552 Ga0307415_100068728
3553 Ga0307415_100190061
3554 Ga0307415_100304614
3555 Ga0307415_100315497
3556 Ga0307415_100378283
3557 Ga0316583_10005720
3558 Ga0316585_10000970
3559 Ga0316585_10008103
3560 Ga0316580_10021814
3561 Ga0307507_10035501
3562 Ga0307507_10069877
3563 Ga0373934_0008204
3564 Ga0373934_0052308
3565 Ga0373944_0021727
3566 Ga0373923_0000056
3567 Ga0373936_0000074
3568 Ga0373936_0015945
3569 Ga0373939_0023803
3570 Ga0373953_0005940
3571 Ga0373953_0124420
3572 Ga0373954_0007256
3573 Ga0373954_0015620
3574 Ga0373954_0021985
3575 Ga0373956_0005453
3576 Ga0373956_0088997
3577 Ga0373957_0008067
3578 Ga0373957_0014212
3579 Ga0373957_0021645
3580 Ga0373957_0027152
3581 Ga0373946_0058209
3582 Ga0373955_0001249
3583 Ga0373955_0005370
3584 Ga0373955_0042797
3585 Ga0373955_0063169
3586 Ga0373961_0000126
3587 Ga0373962_0007891
3588 Ga0316574_0001239
3589 Ga0316574_0005525
3590 Ga0316574_0026641
3591 Ga0316574_0099027
3592 Ga0316574_0139144
3593 Ga0316574_0286433
3594 Ga0373924_0032456
3595 Ga0373931_0015899
3596 Ga0373935_0131967
3597 Ga0373935_0143274
3598 Ga0373927_0000615
3599 Ga0373927_0002114
3600 Ga0373927_0058213
3601 Ga0373933_0035998
3602 Ga0373933_0194331
3603 Ga0373947_0044769
3604 Ga0373947_0074317
3605 Ga0373937_0009412
3606 Ga0373937_0065983
3607 Ga0373937_0076730
3608 Ga0373937_0198343
3609 Ga0373937_0441480
3610 Ga0316582_0000277
3611 Ga0316582_0023018
3612 Ga0316582_0059868
3613 Ga0316582_0063495
3614 Ga0316584_0001500
3615 Ga0316584_0011002
3616 Ga0316584_0030295
3617 Ga0316584_0036370
3618 Ga0316584_0053546
3619 Ga0316584_0102259
3620 Ga0316584_0138468
3621 Ga0373925_0000278
3622 Ga0373925_0011317
3623 Ga0373925_0276282
3624 Ga0395899_0000261
3625 Ga0395899_0000309
3626 Ga0395899_0014151
3627 Ga0395899_0015844
3628 Ga0395899_0040051
3629 Ga0395899_0041062
3630 Ga0395899_0053950
3631 Ga0395899_0080294
3632 Ga0395899_0081700
3633 Ga0395899_0100636
3634 Ga0395899_0149996
3635 Ga0395899_0162039
3636 Ga0395899_0217919
3637 Ga0395900_0000036
3638 Ga0395900_0000421
3639 Ga0395900_0000463
3640 Ga0395900_0002071
3641 Ga0395900_0004593
3642 Ga0395900_0005687
3643 Ga0395900_0013849
3644 Ga0395900_0022152
3645 Ga0395900_0030670
3646 Ga0395900_0043088
3647 Ga0395900_0045251
3648 Ga0395900_0081366
3649 Ga0395900_0112961
3650 Ga0395900_0139380
3651 Ga0395900_0145385
3652 Ga0395900_0146395
3653 Ga0395900_0152379
3654 Ga0395900_0158473
3655 Ga0395900_0167565
3656 Ga0395900_0168010
3657 Ga0395900_0175775
3658 Ga0395900_0176108
3659 Ga0395900_0184034
3660 Ga0395900_0269389
3661 Ga0395900_0319660
3662 Ga0395900_0605659
3663 Ga0395898_0000305
3664 Ga0395898_0000485
3665 Ga0395898_0011241
3666 Ga0395898_0011477
3667 Ga0395898_0014192
3668 Ga0395898_0016672
3669 Ga0395898_0019437
3670 Ga0395898_0020422
3671 Ga0395898_0034473
3672 Ga0395898_0035939
3673 Ga0395898_0037985
3674 Ga0395898_0042918
3675 Ga0395898_0076987
3676 Ga0395898_0107552
3677 Ga0395898_0171768
3678 Ga0395898_0188804
3679 Ga0395898_0220915
3680 Ga0395898_0221856
3681 Ga0395898_0253128
3682 Ga0395905_0018294
3683 Ga0395905_0018671
3684 Ga0395905_0034234
3685 Ga0395905_0048902
3686 Ga0395905_0059563
3687 Ga0395905_0092636
3688 Ga0395905_0095282
3689 Ga0395905_0134658
3690 Ga0395905_0154853
3691 Ga0395905_0194649
3692 Ga0395905_0296101
3693 Ga0395905_0299238
3694 Ga0316581_0019015
3695 Ga0316581_0024562
3696 Ga0395901_0000036
3697 Ga0395901_0000188
3698 Ga0395901_0000604
3699 Ga0395901_0000913
3700 Ga0395901_0001198
3701 Ga0395901_0002697
3702 Ga0395901_0003975
3703 Ga0395901_0009119
3704 Ga0395901_0015319
3705 Ga0395901_0023104
3706 Ga0395901_0030354
3707 Ga0395901_0054449
3708 Ga0395901_0055205
3709 Ga0395901_0090263
3710 Ga0395901_0116576
3711 Ga0395901_0119581
3712 Ga0395901_0120156
3713 Ga0395901_0131771
3714 Ga0395901_0149284
3715 Ga0395901_0169395
3716 Ga0395901_0177660
3717 Ga0395901_0182239
3718 Ga0395901_0449665
3719 Ga0395901_0481965
3720 Ga0395901_0519707
3721 Ga0395901_0620186
3722 Ga0237819_00728
3723 Ga0237816_02003
3724 Ga0436365_0871778
3725 Ga0436360_0701846
3726 Ga0436360_1373761
3727 Ga0436361_1117061
3728 Ga0436361_1214005
3729 Ga0436363_1223925
3730 Ga0436363_1399761
3731 Ga0439436_0000023
3732 Ga0439436_0012204
3733 Ga0439436_0033111
3734 Ga0439439_0043679
3735 Ga0439465_0033940
3736 Ga0451787_571574
3737 Ga0451789_0461212
3738 Ga0451807_0322861
3739 Ga0451807_2136315
3740 Ga0451853_0162710
3741 Ga0439441_021491
3742 Ga0439443_006540
3743 Ga0439432_018244
3744 Ga0439432_044976
3745 Ga0439455_0003442
3746 Ga0439457_018740
3747 Ga0439462_0026691
3748 Ga0450911_000006
3749 Ga0450913_000424
3750 Ga0450898_006509
3751 Ga0450904_000100
3752 Ga0439446_0027405
3753 Ga0450908_000069
3754 Ga0451577_0000256
3755 Ga0466969_0000992
3756 Ga0466969_0016933
3757 Ga0466969_0055710
3758 Ga0466969_0105306
3759 Ga0466982_0000109
3760 Ga0453683_0002195
3761 Ga0453683_0067547
3762 Ga0466966_0000004
3763 Ga0466966_0002380
3764 Ga0466966_0066226
3765 Ga0466966_0077247
3766 Ga0466966_0104783
3767 Ga0466961_0000220
3768 Ga0466961_0000978
3769 Ga0466961_0004586
3770 Ga0466961_0132258
3771 Ga0466963_0001670
3772 Ga0466963_0025535
3773 Ga0466963_0034194
3774 Ga0466963_0106828
3775 Ga0466964_0012863
3776 Ga0453684_0000842
3777 Ga0453684_0005726
3778 Ga0453684_0229822
3779 Ga0466971_0002396
3780 Ga0466970_0001613
3781 Ga0466970_0001995
3782 Ga0466970_0021702
3783 Ga0466957_0018706
3784 Ga0466957_0029399
3785 Ga0466957_0082242
3786 Ga0466957_0140031
3787 Ga0466960_0063911
3788 Ga0466960_0224388
3789 Ga0466959_0000847
3790 Ga0466959_0000978
3791 Ga0466959_0009479
3792 Ga0466959_0141147
3793 Ga0466959_0248444
3794 Ga0466958_0004196
3795 Ga0466958_0082202
3796 Ga0466958_0114592
3797 Ga0466967_0016847
3798 Ga0466967_0023353
3799 Ga0466967_0043468
3800 Ga0466967_0316416
3801 Ga0495592_0004872
3802 Ga0495603_0000388
3803 Ga0495603_0040809
3804 Ga0495590_0001068
3805 Ga0495590_0006992
3806 Ga0495590_0019091
3807 Ga0495590_0093949
3808 Ga0495590_0113147
3809 Ga0495591_002511
3810 Ga0495629_0003174
3811 Ga0495638_0000728
3812 Ga0495638_0001464
3813 Ga0495638_0005121
3814 Ga0495638_0007439
3815 Ga0495638_0040718
3816 Ga0495638_0102411
3817 Ga0495641_0008790
3818 Ga0495641_0026207
3819 Ga0495653_0004188
3820 Ga0495650_0000024
3821 Ga0495650_0077945
3822 Ga0495580_0016401
3823 Ga0495580_0041640
3824 Ga0495582_0001097
3825 Ga0495582_0013960
3826 Ga0495605_0000271
3827 Ga0495639_0008348
3828 Ga0495585_0000027
3829 Ga0495585_0085265
3830 Ga0495594_0000118
3831 Ga0495596_0000007
3832 Ga0495596_0045858
3833 Ga0495607_0015636
3834 Ga0495583_0000005
3835 Ga0495583_0000149
3836 Ga0495583_0000249
3837 Ga0495606_0002446
3838 Ga0495608_0107355
3839 Ga0495610_0000465
3840 Ga0495610_0001255
3841 Ga0495610_0001341
3842 Ga0495610_0011263
3843 Ga0495610_0033321
3844 Ga0495616_0016634
3845 Ga0495616_0019285
3846 Ga0495620_0016023
3847 Ga0495628_0013802
3848 Ga0495630_0012679
3849 Ga0495631_0012499
3850 Ga0495631_0014835
3851 Ga0495632_0004886
3852 Ga0495632_0019802
3853 Ga0495632_0065291
3854 Ga0495637_0008788
3855 Ga0495637_0099481
3856 Ga0495643_0015990
3857 Ga0495644_0111145
3858 Ga0495648_0000029
3859 Ga0495648_0100364
3860 Ga0495663_0000379
3861 Ga0495666_0006889
3862 Ga0495652_0103151
3863 Ga0495654_0000226
3864 Ga0495665_0044109
3865 Ga0495640_0006086
3866 Ga0495586_0117398
3867 Ga0495587_0014439
3868 Ga0495587_0191616
3869 Ga0495609_0000052
3870 Ga0495621_0013656
3871 Ga0495597_0017049
3872 Ga0495622_0004272
3873 Ga0495633_0000162
3874 Ga0495667_0008613
3875 Ga0495667_0020228
3876 Ga0495668_0000141
3877 Ga0495668_0007336
3878 Ga0495668_0011331
3879 Ga0495668_0058761
3880 Ga0495634_0002446
3881 Ga0495611_0000565
3882 Ga0495625_0000398
3883 Ga0495625_0010691
3884 Ga0495625_0015161
3885 Ga0495625_0036300
3886 Ga0495625_0042417
3887 Ga0495625_0111871
3888 Ga0495625_0116865
3889 Ga0495625_0130092
3890 Ga0495635_0025209
3891 Ga0495588_0057082
3892 Ga0495657_0022358
3893 Ga0495657_0089723
3894 Ga0495599_0018838
3895 Ga0495599_0023815
3896 Ga0495623_0039267
3897 Ga0495647_0000113
3898 Ga0495647_0007512
3899 Ga0495658_0002474
3900 Ga0495658_0013350
3901 Ga0495613_0008625
3902 Ga0495613_0029688
3903 Ga0495670_0001410
3904 Ga0495671_0011736
3905 Ga0495649_0000165
3906 Ga0495649_0000396
3907 Ga0495649_0010627
3908 Ga0495649_0021738
3909 Ga0495589_0024889
3910 Ga0495600_0009720
3911 Ga0495600_0025908
3912 Ga0495660_0005715
3913 Ga0495581_0090757
3914 Ga0495604_0003696
3915 Ga0495636_0002340
3916 Ga0495636_0018436
3917 Ga0495636_0035560
3918 Ga0495674_0065303
3919 Ga0495672_0011303
3920 Ga0495672_0128180
3921 Ga0495676_0170342
3922 Ga0495680_0042645
3923 Ga0495680_0087469
3924 Ga0495680_0361099
3925 Ga0495683_0000002
3926 Ga0495683_0077491
3927 Ga0495683_0142506
3928 Ga0495675_0090651
3929 Ga0495679_000035
3930 Ga0495679_000056
3931 Ga0495679_003586
3932 Ga0495685_046996
3933 Ga0495673_0000342
3934 Ga0495673_0002882
3935 Ga0495681_0079948
3936 Ga0495684_0078492
3937 Ga0495684_0094860
3938 Ga0495686_0001836
3939 Ga0495686_0001859
3940 Ga0495593_0000987
3941 Ga0495602_0014733
3942 Ga0495602_0044383
3943 Ga0495602_0374641
3944 Ga0495614_0042029
3945 Ga0496100_0102199
3946 Ga0496100_0216104
3947 Ga0496101_0015659
3948 Ga0496101_0017706
3949 Ga0496101_0022049
3950 Ga0496101_0024655
3951 Ga0496101_0279814
3952 Ga0496102_0039951
3953 Ga0496102_0047630
3954 Ga0496102_0083221
3955 Ga0496102_0250431
3956 Ga0496103_0040376
3957 Ga0496103_0079880
3958 Ga0496103_0129682
3959 Ga0496104_0032285
3960 Ga0496104_0034981
3961 Ga0496104_0055115
3962 Ga0496104_0097848
3963 Ga0496104_0186776
3964 Ga0496105_0009632
3965 Ga0496105_0019536
3966 Ga0496105_0292398
3967 Ga0496106_0047561
3968 Ga0496106_0063844
3969 Ga0496106_0271146
3970 Ga0496106_0287665
3971 Ga0496107_0000214
3972 Ga0496107_0019860
3973 Ga0496107_0077760
3974 Ga0496107_0183845
3975 Ga0496107_0186394
3976 Ga0496108_0003688
3977 Ga0496108_0016259
3978 Ga0496108_0027517
3979 Ga0496108_0126533
3980 Ga0496108_0185152
3981 Ga0496108_0384164
3982 Ga0496109_0001865
3983 Ga0496109_0048552
3984 Ga0496109_0087095
3985 Ga0496109_0091181
3986 Ga0496109_0186498
3987 Ga0496109_0188056
3988 Ga0496109_0206078
3989 Ga0496109_0212961
3990 Ga0496110_0012559
3991 Ga0496110_0074788
3992 Ga0496110_0077735
3993 Ga0496110_0150420
3994 Ga0496110_0156563
3995 Ga0496110_0457692
3996 Ga0496111_0011770
3997 Ga0496111_0022773
3998 Ga0496111_0239824
3999 Ga0496112_0003292
4000 Ga0496112_0027176
4001 Ga0496112_0072298
4002 Ga0496112_0175465
4003 Ga0496112_0190432
4004 Ga0496112_0453340
4005 Ga0496113_0424119
4006 Ga0496114_0006303
4007 Ga0496114_0098484
4008 Ga0496114_0136746
4009 Ga0496114_0160550
4010 Ga0496114_0221649
4011 Ga0496114_0352639
4012 Ga0496115_0006041
4013 Ga0496115_0169765
4014 Ga0496115_0197088
4015 Ga0496115_0271290
4016 Ga0496116_0028883
4017 Ga0496116_0038439
4018 Ga0496117_0016132
4019 Ga0496117_0040086
4020 Ga0496117_0054532
4021 Ga0496118_0001967
4022 Ga0496118_0003890
4023 Ga0496118_0029873
4024 Ga0496118_0119622
4025 Ga0496119_0000733
4026 Ga0496119_0005178
4027 Ga0496119_0011034
4028 Ga0496119_0012759
4029 Ga0496120_0000671
4030 Ga0496120_0015992
4031 Ga0496121_0000021
4032 Ga0496121_0000042
4033 Ga0496121_0000145
4034 Ga0496121_0033279
4035 Ga0496121_0099155
4036 Ga0496122_0000029
4037 Ga0496122_0000749
4038 Ga0496122_0013321
4039 Ga0496122_0098434
4040 Ga0496123_0000216
4041 Ga0496123_0000566
4042 Ga0496123_0000974
4043 Ga0496123_0006678
4044 Ga0496123_0041704
4045 Ga0496124_0000681
4046 Ga0496124_0088371
4047 Ga0496124_0147417
4048 Ga0496125_0001102
4049 Ga0496125_0001807
4050 Ga0496125_0018499
4051 Ga0496125_0029699
4052 Ga0496126_0021905
4053 Ga0496126_0073787
4054 Ga0496126_0305946
4055 Ga0495678_003651
4056 Ga0495682_0022008
4057 Ga0501031_0003304
4058 Ga0501031_0036277
4059 Ga0501032_0002277
4060 Ga0501033_0016780
4061 Ga0501033_0020882
4062 Ga0501033_0060379
4063 Ga0501033_0072968
4064 Ga0501034_0003528
4065 Ga0501034_0013919
4066 Ga0501034_0026913
4067 Ga0501034_0043094
4068 Ga0501034_0046443
4069 Ga0501034_0056312
4070 Ga0501034_0382079
4071 Ga0501036_0087742
4072 Ga0501036_0113245
4073 Ga0501036_0129900
4074 Ga0501036_0140941
4075 Ga0501037_0046554
4076 Ga0501038_0000654
4077 Ga0501038_0009310
4078 Ga0501038_0023889
4079 Ga0501038_0087373
4080 Ga0501039_0235261
4081 Ga0501039_0265879
4082 Ga0501040_0001815
4083 Ga0501041_0000192
4084 Ga0501042_0000054
4085 Ga0501042_0000271
4086 Ga0501042_0120352
4087 Ga0501043_0034251
4088 Ga0501043_0085298
4089 Ga0501043_0112989
4090 Ga0501046_0000108
4091 Ga0501046_0015253
4092 Ga0501047_0002839
4093 Ga0501047_0013253
4094 Ga0501047_0017768
4095 Ga0501047_0019890
4096 Ga0501047_0021564
4097 Ga0501047_0043063
4098 Ga0501047_0060215
4099 Ga0501047_0122096
4100 Ga0501047_0176192
4101 Ga0501047_0181887
4102 Ga0501048_0034331
4103 Ga0501067_0043101
4104 Ga0501067_0114492
4105 Ga0501069_0101362
4106 Ga0501069_0185100
4107 Ga0501069_0217959
4108 Ga0501070_0000102
4109 Ga0501070_0023819
4110 Ga0501070_0044639
4111 Ga0501070_0051997
4112 Ga0501070_0058239
4113 Ga0501070_0173712
4114 Ga0501070_0352055
4115 Ga0501070_0423843
4116 Ga0501071_0016296
4117 Ga0501071_0018432
4118 Ga0501071_0139032
4119 Ga0501072_0000655
4120 Ga0501073_0008965
4121 Ga0501073_0013754
4122 Ga0501073_0018310
4123 Ga0501073_0051133
4124 Ga0501074_0002305
4125 Ga0501074_0033737
4126 Ga0501074_0063087
4127 Ga0501075_0032811
4128 Ga0501075_0036165
4129 Ga0501075_0049268
4130 Ga0501076_0000057
4131 Ga0501076_0100931
4132 Ga0501077_0000637
4133 Ga0501077_0013351
4134 Ga0501239_000595
4135 Ga0501079_0000283
4136 Ga0501079_0041115
4137 Ga0501079_0145936
4138 Ga0501080_0000480
4139 Ga0501080_0015766
4140 Ga0501080_0016767
4141 Ga0501080_0022903
4142 Ga0501080_0029568
4143 Ga0501080_0034741
4144 Ga0501080_0051306
4145 Ga0501080_0132429
4146 Ga0501080_0207020
4147 Ga0501080_0364050
4148 Ga0501081_0000123
4149 Ga0501083_0014104
4150 Ga0501083_0020544
4151 Ga0501083_0044708
4152 Ga0501083_0069462
4153 Ga0501083_0149667
4154 Ga0501035_0003292
4155 Ga0501035_0003439
4156 Ga0501035_0019304
4157 Ga0501035_0057698
4158 Ga0501035_0059231
4159 Ga0501035_0069916
4160 Ga0501035_0078600
4161 Ga0501035_0090106
4162 Ga0501035_0099716
4163 Ga0501035_0269396
4164 Ga0501035_0383847
4165 Ga0501044_0002339
4166 Ga0501044_0024481
4167 Ga0501044_0045879
4168 Ga0501044_0053284
4169 Ga0501044_0085608
4170 Ga0501044_0092573
4171 Ga0501044_0094691
4172 Ga0501044_0189704
4173 Ga0501045_0002226
4174 Ga0501226_000012
4175 nmdc:mga03683_72905_c1
4176 nmdc:mga00v17_36848_c2
4177 nmdc:mga0yw44_222117_c1
4178 nmdc:mga0k408_259977_c1
4179 nmdc:mga0k408_34917_c1
4180 nmdc:mga0k408_45210_c1
4181 nmdc:mga07m45_119838_c1
4182 nmdc:mga07m45_85713_c1
4183 nmdc:mga05p37_155916_c1
4184 nmdc:mga05p37_52817_c1
4185 nmdc:mga05p37_716_c1
4186 nmdc:mga09592_39528_c1
4187 nmdc:mga0qj67_3310_c1
4188 nmdc:mga0qj67_36852_c1
4189 nmdc:mga0qj67_8357_c1
4190 nmdc:mga06r32_106735_c1
4191 nmdc:mga06r32_45534_c1
4192 nmdc:mga06r32_7880_c1
4193 nmdc:mga08y16_50166_c1
4194 nmdc:mga08y16_67396_c1
4195 nmdc:mga0n895_214105_c1
4196 nmdc:mga0rr50_222830_c1
4197 nmdc:mga0rr50_300447_c1
4198 nmdc:mga08x19_26318_c1
4199 nmdc:mga0a205_139417_c1
4200 nmdc:mga0a205_8602_c1
4201 Ga0495601_0002701
4202 Ga0495601_0051546
4203 Ga0495601_0169115
4204 Ga0495601_0260732
4205 Ga0495612_0025055
4206 Ga0500635_0000140
4207 Ga0500635_0043193
4208 Ga0495655_0000320
4209 Ga0495595_0007105
4210 Ga0495595_0008305
4211 Ga0495619_0002898
4212 Ga0495619_0015975
4213 Ga0495619_0077528
4214 Ga0500578_0000102
4215 Ga0500578_0213203
4216 Ga0500643_001069
4217 Ga0500643_001428
4218 Ga0500643_002015
4219 Ga0500643_037967
4220 Ga0500644_0000290
4221 Ga0500644_0006534
4222 Ga0500644_0073460
4223 Ga0500647_0003059
4224 Ga0500651_0000984
4225 Ga0500651_0013402
4226 Ga0500566_0004593
4227 Ga0500640_000515
4228 Ga0500555_006631
4229 Ga0500556_0000200
4230 Ga0500556_0001879
4231 Ga0500562_000497
4232 Ga0500572_000529
4233 Ga0500593_001627
4234 Ga0500594_0002267
4235 Ga0500597_000028
4236 Ga0500608_000158
4237 Ga0500614_004049
4238 Ga0500614_005413
4239 Ga0500618_000120
4240 Ga0500628_000537
4241 Ga0500642_0064213
4242 Ga0500642_0083140
4243 Ga0500658_0021557
4244 Ga0500559_0000403
4245 Ga0500559_0005605
4246 Ga0500559_0021028
4247 Ga0500559_0021554
4248 Ga0500564_000115
4249 Ga0500564_000291
4250 Ga0500568_0016301
4251 Ga0500568_0025658
4252 Ga0500573_0044788
4253 Ga0500616_0052065
4254 Ga0500622_0000674
4255 Ga0500622_0004041
4256 Ga0500622_0020591
4257 Ga0500622_0074155
4258 Ga0500624_000075
4259 Ga0500636_0000055
4260 Ga0500637_0000681
4261 Ga0500637_0053754
4262 Ga0500567_001143
4263 Ga0500625_000012
4264 Ga0500625_009792
4265 Ga0500645_000250
4266 Ga0500645_001003
4267 Ga0500645_008241
4268 Ga0500645_008698
4269 Ga0500609_001387
4270 Ga0500587_001238
4271 Ga0501084_0001450
4272 Ga0501084_0012475
4273 Ga0501082_0005168
4274 Ga0501082_0006095
4275 Ga0501082_0033315
4276 Ga0466962_0000555
4277 Ga0466962_0005147
4278 Ga0530510_0000267
4279 Ga0530510_0121791
4280 2501406879
4281 2511097785
4282 2511245969
4283 2519460345
4284 2525558312
4285 2572255971
4286 2585292648
4287 2587759172
4288 2595447692
4289 2595450382
4290 2599741329
4291 2599747260
4292 2599905713
4293 2600209115
4294 2630650300
4295 2643860596
4296 2643882244
4297 2643981540
4298 2644353395
4299 2644549315
4300 2644551440
4301 2676745144
4302 2729148598
4303 2774871110
4304 2808906743
4305 2808973025
4306 2809008147
4307 2809014950
4308 2809035447
4309 2817257863
4310 2817455998
4311 2819635188
4312 2819662386
4313 2842922452
4314 2852687898
4315 2863427857
4316 2870073562
4317 2894512120
4318 2904567559
4319 2904574604
4320 2919133032
4321 2928158354
4322 2928167442
4323 2928177009
4324 2928540281
4325 2928966402
4326 2929199329
4327 2953996913
4328 2981991815
4329 642417434
4330 8001523336
4331 8002394536
4332 8003017602
4333 8018850205
4334 8020812240
4335 8020941215
4336 8020946740
4337 8020958469
4338 8021123866
4339 8039100380
4340 8040170759
4341 8040176964
4342 8045868635

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

85

227

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5x41-assembly1.cif.gz_B 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9414 1 222
5x41-assembly2.cif.gz_D 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9413 1 225
7ahc-assembly1.cif.gz_C opua apo inward-facing 0.939 5 216
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9365 3 218
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9332 2 221
ID Description Score Start End Superfamily
af_Q2G1L8_1_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9475 3 219 3.40.50.300
af_P0AAF6_1_241_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9467 5 222 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9445 5 221 3.40.50.300
af_Q1RS86_918_1157_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9434 1 208 3.40.50.300
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.942 2 226 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7Y4ZA76-F1-model_v4 ABC transporter ATP-binding protein 0.9695 3 216 GO:0005524
GO:0016887
AF-A0A348B4H2-F1-model_v4 ABC transporter domain-containing protein 0.9684 34 222 GO:0005524
GO:0016887
AF-A0A0U3H3Q4-F1-model_v4 ABC transporter ATP-binding protein 0.9653 3 222 GO:0005524
GO:0016887
AF-A0A7C6CAI4-F1-model_v4 ABC transporter ATP-binding protein 0.9637 3 225 GO:0005524
GO:0016887
AF-A0A842N7Y0-F1-model_v4 ABC transporter ATP-binding protein 0.9629 37 219 GO:0005524
GO:0016887

Map