F496503
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2171 | 665 | 4342 | 313 |
Family's Representative Sequence
| Representative Sequence | 3300003187|JGI25151J46595_10007622|JGI25151J46595_100076222 |
| Length | 380 |
| Sequence | MDGHACCRTGPRQPVPNQRQRALTNSRAALKTLGGHFXPALYRMIRXSSGTGLPVPHSPGCRVQANPIISIQQLSKTYASGFQALKSVSLDIRRGEILALLGPNGAGKTTLISIICGIVRPSSGTVTADGHDIVRDYRAARAKIGLVPQELSTDAFETVWSTVSFSRGLYGKAPNPAYIEKVLRDLSLWDKKDSKIMSLSGGMKRRVLIAKALSHEPTILFLDEPSAGVDVELRKGMWQMVRELQSSGVTIILTTHYIEEAEEMADRIGVINKGELILVEDKTVLMRKLGKKQLSLQLQTPLQSIPAALAGLPLELSGEGHTLVYTFDSQTEETGIAALLKRLAELGIDFKDLHSSESSLEDIFVSLVHADXPAAHKEAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 12 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 13 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 14 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 15 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 16 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 17 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 18 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 19 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 20 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 21 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 22 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 23 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 24 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 25 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 26 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 35 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 37 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 38 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 39 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 41 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 43 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 44 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 45 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 46 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 47 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 48 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 55 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 59 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 71 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 84 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 89 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 91 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 98 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 100 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 101 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 102 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 104 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 105 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 106 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 107 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 108 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 109 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 110 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 111 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 112 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 113 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 114 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 115 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 117 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 118 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 119 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 120 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 121 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 122 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 124 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 125 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 126 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 127 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 128 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 129 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 130 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 131 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 132 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 133 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 135 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 136 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 137 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 138 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 151 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 165 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 169 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 170 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 171 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 172 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 174 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 175 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 176 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 177 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 179 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 180 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 181 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 182 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 192 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 193 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 194 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 197 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 198 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 202 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 204 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 207 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 210 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 288 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 289 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 290 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 291 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 295 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 296 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 297 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 298 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 299 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 300 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 301 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 303 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 304 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 305 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 306 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 307 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 308 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 309 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 310 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 311 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 312 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 313 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 314 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 315 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 316 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 317 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 318 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 319 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 320 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 321 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 322 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 323 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 324 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 325 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 326 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 327 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 328 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 329 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 330 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 331 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 332 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 333 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 334 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 335 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 336 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 337 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 338 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 339 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 340 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 341 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 342 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 343 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 344 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 345 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 346 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 347 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 348 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 349 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 350 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 351 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 352 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 353 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 354 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 355 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 356 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 357 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 358 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 359 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 360 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 361 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 362 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 363 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 364 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 365 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 366 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 367 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 368 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 369 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 370 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 371 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 372 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 373 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 374 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 375 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 376 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 377 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 378 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 379 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 380 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 381 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 382 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 383 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 384 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 385 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 386 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 387 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 388 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 389 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 390 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 391 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 392 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 393 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 394 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 395 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 396 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 397 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 398 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 399 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 400 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 401 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 402 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 484 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 485 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 486 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 487 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 488 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 489 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 490 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 491 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 492 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 493 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 494 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 495 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 496 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 497 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 498 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 499 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 500 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 501 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 502 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 503 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 504 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 505 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 506 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 507 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 508 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 509 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 510 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 513 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 514 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 515 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 516 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 517 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 518 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 519 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 520 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 521 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 522 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 523 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 524 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 525 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 526 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 527 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 528 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 529 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 530 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 531 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 532 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 533 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 534 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 535 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 536 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 537 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 538 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 539 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 540 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 541 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 542 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 543 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 544 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 545 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 546 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 547 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 548 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 549 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 550 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 551 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 552 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 553 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 554 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 555 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 556 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 557 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 558 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 559 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 560 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 563 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 567 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 568 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 569 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 570 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 571 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 572 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 573 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 574 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 575 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 576 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 577 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 578 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 579 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 580 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 581 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 582 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 583 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 584 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 585 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 586 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 587 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 588 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 589 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 590 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 591 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 592 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 593 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 594 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 595 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 596 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 597 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 598 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 599 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 600 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 601 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 602 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 603 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 604 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 605 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 606 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 607 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 608 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 609 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 610 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 611 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 612 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 613 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 614 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 615 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 616 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 617 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 618 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 619 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 620 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 621 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 622 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 623 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 624 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 625 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 626 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 627 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 628 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 629 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 630 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 631 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 632 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 633 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 634 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 635 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 636 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 637 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 638 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 639 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 640 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 641 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 642 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 643 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 644 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 645 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 646 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 647 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 648 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 649 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 650 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 651 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 652 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 653 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
| 654 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 655 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 656 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 657 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 658 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 659 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 660 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 661 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 662 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 663 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 664 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 665 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.78 |
| Metatranscriptomes | 0.32 |
| Isolates | 2.9 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.75 |
| Nodule | 0.09 |
| Rhizoplane | 3.68 |
| Rhizosphere | 78.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10007622 | 3300003187 | Bacteria | 5284 |
| 2 | SwRhRL2b_contig_719950 | 2162886007 | Bacteria | 4655 |
| 3 | JGI24736J21556_1003706 | 3300001904 | Bacteria | 2638 |
| 4 | JGI24736J21556_1018176 | 3300001904 | Bacteria | 1113 |
| 5 | JGI24741J21665_1000800 | 3300001915 | Bacteria | 9447 |
| 6 | JGI24741J21665_1000867 | 3300001915 | Bacteria | 9119 |
| 7 | JGI24741J21665_1000873 | 3300001915 | Bacteria | 9094 |
| 8 | JGI24741J21665_1002927 | 3300001915 | Bacteria | 4265 |
| 9 | JGI24740J21852_10000833 | 3300001979 | Bacteria | 13603 |
| 10 | JGI24740J21852_10002444 | 3300001979 | Bacteria | 8426 |
| 11 | JGI24740J21852_10003279 | 3300001979 | Bacteria | 7138 |
| 12 | JGI24740J21852_10011531 | 3300001979 | Bacteria | 3363 |
| 13 | JGI24740J21852_10050988 | 3300001979 | Bacteria | 1187 |
| 14 | JGI24739J22299_10003761 | 3300001989 | Bacteria | 5795 |
| 15 | JGI24739J22299_10003964 | 3300001989 | Bacteria | 5663 |
| 16 | JGI24737J22298_10004736 | 3300001990 | Bacteria | 4723 |
| 17 | JGI24743J22301_10001171 | 3300001991 | Bacteria | 3531 |
| 18 | JGI24735J21928_10001752 | 3300002067 | Bacteria | 7650 |
| 19 | JGI24735J21928_10005070 | 3300002067 | Bacteria | 4385 |
| 20 | JGI24738J21930_10002476 | 3300002075 | Bacteria | 4824 |
| 21 | JGI24749J21850_1001805 | 3300002076 | Bacteria | 3029 |
| 22 | JGI24033J26618_1001172 | 3300002155 | Bacteria | 2557 |
| 23 | JGI24034J26672_10005980 | 3300002239 | Bacteria | 1752 |
| 24 | JGI25155J39150_1000057 | 3300002704 | Bacteria | 72575 |
| 25 | JGI25156J39149_1000073 | 3300002705 | Bacteria | 77465 |
| 26 | JGI25156J39149_1000673 | 3300002705 | Bacteria | 18434 |
| 27 | JGI25156J39149_1002242 | 3300002705 | Bacteria | 7137 |
| 28 | JGI25162J39368_1000468 | 3300002737 | Bacteria | 31159 |
| 29 | JGI25162J39368_1000971 | 3300002737 | Bacteria | 18268 |
| 30 | JGI25162J39368_1001279 | 3300002737 | Bacteria | 14280 |
| 31 | JGI25154J39366_1000097 | 3300002738 | Bacteria | 77399 |
| 32 | JGI25154J39366_1001421 | 3300002738 | Bacteria | 8532 |
| 33 | JGI25157J39369_1000075 | 3300002741 | Bacteria | 88169 |
| 34 | JGI25157J39369_1000089 | 3300002741 | Bacteria | 77465 |
| 35 | JGI25157J39369_1000469 | 3300002741 | Bacteria | 25434 |
| 36 | JGI25157J39369_1000772 | 3300002741 | Bacteria | 16587 |
| 37 | JGI25164J39214_1000193 | 3300002772 | Bacteria | 52696 |
| 38 | JGI25164J39214_1000242 | 3300002772 | Bacteria | 41726 |
| 39 | JGI25159J45721_1001136 | 3300002987 | Bacteria | 11378 |
| 40 | JGI25159J45721_1005739 | 3300002987 | Bacteria | 3843 |
| 41 | JGI25151J46595_10004543 | 3300003187 | Bacteria | 7320 |
| 42 | JGI25151J46595_10029108 | 3300003187 | Bacteria | 2192 |
| 43 | JGI25406J46586_10025745 | 3300003203 | Bacteria | 2279 |
| 44 | JGI25165J46597_1000335 | 3300003214 | Bacteria | 55465 |
| 45 | JGI25165J46597_1002530 | 3300003214 | Bacteria | 5737 |
| 46 | JGI25160J50197_1000076 | 3300003354 | Bacteria | 102318 |
| 47 | JGI26145J50221_1001413 | 3300003371 | Bacteria | 1901 |
| 48 | JGI25161J50226_1000058 | 3300003374 | Bacteria | 102318 |
| 49 | Ga0055539_1002563 | 3300003752 | Bacteria | 2728 |
| 50 | Ga0055533_1000011 | 3300003756 | Bacteria | 467893 |
| 51 | Ga0055533_1005444 | 3300003756 | Bacteria | 2041 |
| 52 | Ga0055525_1000089 | 3300003759 | Bacteria | 142096 |
| 53 | Ga0055525_1001594 | 3300003759 | Bacteria | 3649 |
| 54 | Ga0055527_1000084 | 3300003760 | Bacteria | 74303 |
| 55 | Ga0055527_1000206 | 3300003760 | Bacteria | 38636 |
| 56 | Ga0055535_1000426 | 3300003761 | Bacteria | 39469 |
| 57 | Ga0055535_1000639 | 3300003761 | Bacteria | 27945 |
| 58 | Ga0055535_1000728 | 3300003761 | Bacteria | 24896 |
| 59 | Ga0055542_1000057 | 3300003762 | Bacteria | 162955 |
| 60 | Ga0055542_1000107 | 3300003762 | Bacteria | 111897 |
| 61 | Ga0055542_1000195 | 3300003762 | Bacteria | 74303 |
| 62 | Ga0055542_1000455 | 3300003762 | Bacteria | 38636 |
| 63 | Ga0055529_1000460 | 3300003763 | Bacteria | 39464 |
| 64 | Ga0055529_1000881 | 3300003763 | Bacteria | 17123 |
| 65 | Ga0055526_1005666 | 3300003771 | Bacteria | 7092 |
| 66 | Ga0055526_1005854 | 3300003771 | Bacteria | 6901 |
| 67 | Ga0055537_1000730 | 3300003773 | Bacteria | 16851 |
| 68 | Ga0055537_1014657 | 3300003773 | Bacteria | 1412 |
| 69 | Ga0055524_1001067 | 3300003775 | Bacteria | 16851 |
| 70 | Ga0055524_1003977 | 3300003775 | Bacteria | 6985 |
| 71 | Ga0055536_1000621 | 3300003781 | Bacteria | 24132 |
| 72 | Ga0055536_1001793 | 3300003781 | Bacteria | 12647 |
| 73 | Ga0055536_1008264 | 3300003781 | Bacteria | 4505 |
| 74 | Ga0055536_1008702 | 3300003781 | Bacteria | 4314 |
| 75 | Ga0055534_1002014 | 3300003784 | Bacteria | 7386 |
| 76 | Ga0055528_1006463 | 3300003790 | Bacteria | 5317 |
| 77 | Ga0055530_10002477 | 3300003791 | Bacteria | 11838 |
| 78 | Ga0055530_10006463 | 3300003791 | Bacteria | 5227 |
| 79 | Ga0055530_10009456 | 3300003791 | Bacteria | 3744 |
| 80 | Ga0055530_10014991 | 3300003791 | Bacteria | 2555 |
| 81 | Ga0055540_1001926 | 3300003792 | Bacteria | 11591 |
| 82 | Ga0055540_1005515 | 3300003792 | Bacteria | 5292 |
| 83 | Ga0055531_10000450 | 3300003794 | Bacteria | 38240 |
| 84 | Ga0055531_10002822 | 3300003794 | Bacteria | 11385 |
| 85 | Ga0055531_10008906 | 3300003794 | Bacteria | 5208 |
| 86 | Ga0055531_10010909 | 3300003794 | Bacteria | 4455 |
| 87 | Ga0055531_10013622 | 3300003794 | Bacteria | 3732 |
| 88 | Ga0055531_10040125 | 3300003794 | Bacteria | 1378 |
| 89 | Ga0055531_10041520 | 3300003794 | Bacteria | 1330 |
| 90 | Ga0058692_1000142 | 3300003856 | Bacteria | 45378 |
| 91 | Ga0058692_1015531 | 3300003856 | Bacteria | 1713 |
| 92 | Ga0055543_1002375 | 3300004625 | Bacteria | 6288 |
| 93 | Ga0065165_1000949 | 3300005262 | Bacteria | 36709 |
| 94 | Ga0065165_1004485 | 3300005262 | Bacteria | 8602 |
| 95 | Ga0065165_1023570 | 3300005262 | Bacteria | 2083 |
| 96 | Ga0065165_1037799 | 3300005262 | Bacteria | 1460 |
| 97 | Ga0065165_1040512 | 3300005262 | Bacteria | 1389 |
| 98 | Ga0065712_10084506 | 3300005290 | Bacteria | 2758 |
| 99 | Ga0065715_10023686 | 3300005293 | Bacteria | 2211 |
| 100 | Ga0065715_10118965 | 3300005293 | Bacteria | 2300 |
| 101 | Ga0065715_10181169 | 3300005293 | Bacteria | 1475 |
| 102 | Ga0065707_10118060 | 3300005295 | Bacteria | 2195 |
| 103 | Ga0070658_10001353 | 3300005327 | Bacteria | 20935 |
| 104 | Ga0070658_10003530 | 3300005327 | Bacteria | 12834 |
| 105 | Ga0070658_10005606 | 3300005327 | Bacteria | 10181 |
| 106 | Ga0070658_10011570 | 3300005327 | Bacteria | 7077 |
| 107 | Ga0070658_10058004 | 3300005327 | Bacteria | 3150 |
| 108 | Ga0070658_10070760 | 3300005327 | Bacteria | 2857 |
| 109 | Ga0070658_10091592 | 3300005327 | Bacteria | 2505 |
| 110 | Ga0070658_10117242 | 3300005327 | Bacteria | 2210 |
| 111 | Ga0070658_10136788 | 3300005327 | Bacteria | 2045 |
| 112 | Ga0070676_10015962 | 3300005328 | Bacteria | 4146 |
| 113 | Ga0070676_10044461 | 3300005328 | Bacteria | 2585 |
| 114 | Ga0070683_100007585 | 3300005329 | Bacteria | 9175 |
| 115 | Ga0070683_100024660 | 3300005329 | Bacteria | 5390 |
| 116 | Ga0070683_100037375 | 3300005329 | Bacteria | 4445 |
| 117 | Ga0070683_100045251 | 3300005329 | Bacteria | 4062 |
| 118 | Ga0070683_100064518 | 3300005329 | Bacteria | 3409 |
| 119 | Ga0070690_100011275 | 3300005330 | Bacteria | 5225 |
| 120 | Ga0070690_100015791 | 3300005330 | Bacteria | 4512 |
| 121 | Ga0070690_100044508 | 3300005330 | Bacteria | 2818 |
| 122 | Ga0070670_100000002 | 3300005331 | Bacteria | 568775 |
| 123 | Ga0070670_100080375 | 3300005331 | Bacteria | 2802 |
| 124 | Ga0070670_100101779 | 3300005331 | Bacteria | 2473 |
| 125 | Ga0070670_100102372 | 3300005331 | Bacteria | 2466 |
| 126 | Ga0070670_100102443 | 3300005331 | Bacteria | 2465 |
| 127 | Ga0070670_100416273 | 3300005331 | Bacteria | 1188 |
| 128 | Ga0070677_10008613 | 3300005333 | Bacteria | 3438 |
| 129 | Ga0070677_10014193 | 3300005333 | Bacteria | 2799 |
| 130 | Ga0068869_100025426 | 3300005334 | Bacteria | 4111 |
| 131 | Ga0068869_100036648 | 3300005334 | Bacteria | 3483 |
| 132 | Ga0068869_100049779 | 3300005334 | Bacteria | 3034 |
| 133 | Ga0068869_100274068 | 3300005334 | Bacteria | 1355 |
| 134 | Ga0070666_10122162 | 3300005335 | Bacteria | 1806 |
| 135 | Ga0070680_100004287 | 3300005336 | Bacteria | 10716 |
| 136 | Ga0070680_100008203 | 3300005336 | Bacteria | 7983 |
| 137 | Ga0070680_100035878 | 3300005336 | Bacteria | 4004 |
| 138 | Ga0070680_100055851 | 3300005336 | Bacteria | 3227 |
| 139 | Ga0070680_100065166 | 3300005336 | Bacteria | 2986 |
| 140 | Ga0070680_100128398 | 3300005336 | Bacteria | 2119 |
| 141 | Ga0070680_100197564 | 3300005336 | Bacteria | 1696 |
| 142 | Ga0070680_100204475 | 3300005336 | Bacteria | 1665 |
| 143 | Ga0070680_100249745 | 3300005336 | Bacteria | 1500 |
| 144 | Ga0070680_100286698 | 3300005336 | Bacteria | 1395 |
| 145 | Ga0070682_100003586 | 3300005337 | Bacteria | 8594 |
| 146 | Ga0070682_100057489 | 3300005337 | Bacteria | 2450 |
| 147 | Ga0070682_100068347 | 3300005337 | Bacteria | 2266 |
| 148 | Ga0070682_100080136 | 3300005337 | Bacteria | 2110 |
| 149 | Ga0070682_100087362 | 3300005337 | Bacteria | 2032 |
| 150 | Ga0070682_100221678 | 3300005337 | Bacteria | 1346 |
| 151 | Ga0068868_100028093 | 3300005338 | Bacteria | 4297 |
| 152 | Ga0068868_100062772 | 3300005338 | Bacteria | 2946 |
| 153 | Ga0070660_100000006 | 3300005339 | Bacteria | 166714 |
| 154 | Ga0070660_100000378 | 3300005339 | Bacteria | 29634 |
| 155 | Ga0070660_100004561 | 3300005339 | Bacteria | 9577 |
| 156 | Ga0070660_100005115 | 3300005339 | Bacteria | 9059 |
| 157 | Ga0070660_100025856 | 3300005339 | Bacteria | 4366 |
| 158 | Ga0070660_100031954 | 3300005339 | Bacteria | 3958 |
| 159 | Ga0070660_100036722 | 3300005339 | Bacteria | 3712 |
| 160 | Ga0070660_100046895 | 3300005339 | Bacteria | 3313 |
| 161 | Ga0070660_100047116 | 3300005339 | Bacteria | 3306 |
| 162 | Ga0070660_100048131 | 3300005339 | Bacteria | 3273 |
| 163 | Ga0070689_100000001 | 3300005340 | Bacteria | 1334580 |
| 164 | Ga0070689_100000908 | 3300005340 | Bacteria | 18492 |
| 165 | Ga0070689_100034696 | 3300005340 | Bacteria | 3849 |
| 166 | Ga0070689_100078629 | 3300005340 | Bacteria | 2586 |
| 167 | Ga0070689_100349627 | 3300005340 | Bacteria | 1240 |
| 168 | Ga0070691_10000225 | 3300005341 | Bacteria | 19202 |
| 169 | Ga0070691_10037443 | 3300005341 | Bacteria | 2289 |
| 170 | Ga0070687_100054025 | 3300005343 | Bacteria | 2091 |
| 171 | Ga0070661_100000697 | 3300005344 | Bacteria | 24630 |
| 172 | Ga0070661_100002483 | 3300005344 | Bacteria | 12641 |
| 173 | Ga0070661_100006538 | 3300005344 | Bacteria | 8043 |
| 174 | Ga0070661_100007312 | 3300005344 | Bacteria | 7616 |
| 175 | Ga0070661_100007351 | 3300005344 | Bacteria | 7594 |
| 176 | Ga0070661_100008194 | 3300005344 | Bacteria | 7209 |
| 177 | Ga0070661_100017270 | 3300005344 | Bacteria | 5117 |
| 178 | Ga0070661_100093035 | 3300005344 | Bacteria | 2234 |
| 179 | Ga0070661_100094016 | 3300005344 | Bacteria | 2221 |
| 180 | Ga0070661_100143156 | 3300005344 | Bacteria | 1803 |
| 181 | Ga0070661_100163917 | 3300005344 | Bacteria | 1684 |
| 182 | Ga0070661_100178757 | 3300005344 | Bacteria | 1614 |
| 183 | Ga0070692_10022026 | 3300005345 | Bacteria | 3108 |
| 184 | Ga0070692_10209677 | 3300005345 | Bacteria | 1146 |
| 185 | Ga0070668_100020914 | 3300005347 | Bacteria | 4943 |
| 186 | Ga0070668_100026755 | 3300005347 | Bacteria | 4379 |
| 187 | Ga0070668_100101492 | 3300005347 | Bacteria | 2280 |
| 188 | Ga0070669_100002974 | 3300005353 | Bacteria | 12215 |
| 189 | Ga0070669_100025109 | 3300005353 | Bacteria | 4279 |
| 190 | Ga0070669_100072519 | 3300005353 | Bacteria | 2549 |
| 191 | Ga0070669_100110163 | 3300005353 | Bacteria | 2088 |
| 192 | Ga0070669_100131910 | 3300005353 | Bacteria | 1918 |
| 193 | Ga0070675_100027074 | 3300005354 | Bacteria | 4605 |
| 194 | Ga0070675_100060456 | 3300005354 | Bacteria | 3128 |
| 195 | Ga0070675_100152298 | 3300005354 | Bacteria | 1983 |
| 196 | Ga0070675_100170806 | 3300005354 | Bacteria | 1875 |
| 197 | Ga0070671_100000047 | 3300005355 | Bacteria | 84234 |
| 198 | Ga0070671_100001263 | 3300005355 | Bacteria | 18957 |
| 199 | Ga0070671_100018028 | 3300005355 | Bacteria | 5729 |
| 200 | Ga0070671_100042151 | 3300005355 | Bacteria | 3794 |
| 201 | Ga0070671_100092608 | 3300005355 | Bacteria | 2532 |
| 202 | Ga0070671_100166376 | 3300005355 | Bacteria | 1864 |
| 203 | Ga0070671_100304197 | 3300005355 | Bacteria | 1358 |
| 204 | Ga0070671_100304496 | 3300005355 | Bacteria | 1357 |
| 205 | Ga0070673_100001025 | 3300005364 | Bacteria | 15814 |
| 206 | Ga0070673_100038215 | 3300005364 | Bacteria | 3664 |
| 207 | Ga0070673_100133891 | 3300005364 | Bacteria | 2083 |
| 208 | Ga0070673_100178224 | 3300005364 | Bacteria | 1818 |
| 209 | Ga0070673_100240206 | 3300005364 | Bacteria | 1575 |
| 210 | Ga0070688_100029825 | 3300005365 | Bacteria | 3269 |
| 211 | Ga0070688_100126319 | 3300005365 | Bacteria | 1719 |
| 212 | Ga0070688_100141474 | 3300005365 | Bacteria | 1635 |
| 213 | Ga0070659_100000082 | 3300005366 | Bacteria | 71707 |
| 214 | Ga0070659_100001873 | 3300005366 | Bacteria | 15080 |
| 215 | Ga0070659_100003652 | 3300005366 | Bacteria | 10964 |
| 216 | Ga0070659_100013172 | 3300005366 | Bacteria | 6151 |
| 217 | Ga0070659_100026087 | 3300005366 | Bacteria | 4494 |
| 218 | Ga0070659_100029716 | 3300005366 | Bacteria | 4224 |
| 219 | Ga0070659_100044848 | 3300005366 | Bacteria | 3463 |
| 220 | Ga0070659_100050838 | 3300005366 | Bacteria | 3258 |
| 221 | Ga0070659_100082379 | 3300005366 | Bacteria | 2570 |
| 222 | Ga0070659_100083949 | 3300005366 | Bacteria | 2546 |
| 223 | Ga0070659_100209363 | 3300005366 | Bacteria | 1607 |
| 224 | Ga0070659_100348957 | 3300005366 | Bacteria | 1241 |
| 225 | Ga0070667_100000018 | 3300005367 | Bacteria | 226033 |
| 226 | Ga0070667_100000136 | 3300005367 | Bacteria | 93545 |
| 227 | Ga0070667_100001189 | 3300005367 | Bacteria | 23666 |
| 228 | Ga0070667_100002630 | 3300005367 | Bacteria | 15546 |
| 229 | Ga0070667_100152524 | 3300005367 | Bacteria | 2030 |
| 230 | Ga0070667_100287926 | 3300005367 | Bacteria | 1476 |
| 231 | Ga0070667_100332894 | 3300005367 | Bacteria | 1372 |
| 232 | Ga0070709_10002390 | 3300005434 | Bacteria | 10167 |
| 233 | Ga0070709_10011717 | 3300005434 | Bacteria | 4896 |
| 234 | Ga0070714_100000079 | 3300005435 | Bacteria | 82899 |
| 235 | Ga0070714_100001813 | 3300005435 | Bacteria | 15525 |
| 236 | Ga0070714_100003909 | 3300005435 | Bacteria | 11196 |
| 237 | Ga0070714_100005545 | 3300005435 | Bacteria | 9640 |
| 238 | Ga0070714_100016187 | 3300005435 | Bacteria | 6016 |
| 239 | Ga0070714_100032402 | 3300005435 | Bacteria | 4362 |
| 240 | Ga0070714_100106704 | 3300005435 | Bacteria | 2475 |
| 241 | Ga0070713_100027496 | 3300005436 | Bacteria | 4478 |
| 242 | Ga0070713_100027807 | 3300005436 | Bacteria | 4458 |
| 243 | Ga0070711_100022012 | 3300005439 | Bacteria | 4127 |
| 244 | Ga0070711_100113121 | 3300005439 | Bacteria | 1996 |
| 245 | Ga0070705_100008150 | 3300005440 | Bacteria | 5181 |
| 246 | Ga0070705_100066153 | 3300005440 | Bacteria | 2167 |
| 247 | Ga0070700_100009824 | 3300005441 | Bacteria | 5262 |
| 248 | Ga0070700_100040823 | 3300005441 | Bacteria | 2842 |
| 249 | Ga0070700_100050672 | 3300005441 | Bacteria | 2581 |
| 250 | Ga0070708_100090787 | 3300005445 | Bacteria | 2781 |
| 251 | Ga0070663_100000069 | 3300005455 | Bacteria | 44710 |
| 252 | Ga0070663_100000204 | 3300005455 | Bacteria | 29549 |
| 253 | Ga0070663_100002048 | 3300005455 | Bacteria | 11266 |
| 254 | Ga0070663_100010569 | 3300005455 | Bacteria | 5757 |
| 255 | Ga0070663_100011864 | 3300005455 | Bacteria | 5491 |
| 256 | Ga0070663_100017483 | 3300005455 | Bacteria | 4681 |
| 257 | Ga0070663_100056714 | 3300005455 | Bacteria | 2808 |
| 258 | Ga0070663_100070594 | 3300005455 | Bacteria | 2540 |
| 259 | Ga0070663_100087373 | 3300005455 | Bacteria | 2304 |
| 260 | Ga0070663_100124726 | 3300005455 | Bacteria | 1949 |
| 261 | Ga0070663_100156761 | 3300005455 | Bacteria | 1750 |
| 262 | Ga0070663_100165351 | 3300005455 | Bacteria | 1706 |
| 263 | Ga0070663_100206060 | 3300005455 | Bacteria | 1537 |
| 264 | Ga0070663_100373390 | 3300005455 | Bacteria | 1160 |
| 265 | Ga0070678_100004415 | 3300005456 | Bacteria | 7975 |
| 266 | Ga0070678_100035451 | 3300005456 | Bacteria | 3483 |
| 267 | Ga0070678_100072802 | 3300005456 | Bacteria | 2577 |
| 268 | Ga0070678_100092613 | 3300005456 | Bacteria | 2322 |
| 269 | Ga0070678_100294093 | 3300005456 | Bacteria | 1378 |
| 270 | Ga0070662_100000546 | 3300005457 | Bacteria | 22896 |
| 271 | Ga0070662_100038980 | 3300005457 | Bacteria | 3378 |
| 272 | Ga0070662_100103515 | 3300005457 | Bacteria | 2159 |
| 273 | Ga0070681_10000186 | 3300005458 | Bacteria | 47903 |
| 274 | Ga0070681_10001722 | 3300005458 | Bacteria | 19584 |
| 275 | Ga0070681_10001805 | 3300005458 | Bacteria | 19258 |
| 276 | Ga0070681_10016914 | 3300005458 | Bacteria | 7286 |
| 277 | Ga0070681_10028888 | 3300005458 | Bacteria | 5572 |
| 278 | Ga0070681_10209235 | 3300005458 | Bacteria | 1867 |
| 279 | Ga0070681_10313016 | 3300005458 | Bacteria | 1479 |
| 280 | Ga0070685_10000011 | 3300005466 | Bacteria | 137723 |
| 281 | Ga0070685_10005572 | 3300005466 | Bacteria | 6389 |
| 282 | Ga0070685_10012813 | 3300005466 | Bacteria | 4410 |
| 283 | Ga0070685_10037523 | 3300005466 | Bacteria | 2745 |
| 284 | Ga0070685_10202572 | 3300005466 | Bacteria | 1291 |
| 285 | Ga0070706_100075356 | 3300005467 | Bacteria | 3122 |
| 286 | Ga0070698_100002222 | 3300005471 | Bacteria | 21479 |
| 287 | Ga0070699_100006475 | 3300005518 | Bacteria | 10199 |
| 288 | Ga0070699_100093465 | 3300005518 | Bacteria | 2631 |
| 289 | Ga0070679_100000168 | 3300005530 | Bacteria | 52996 |
| 290 | Ga0070679_100000209 | 3300005530 | Bacteria | 47903 |
| 291 | Ga0070679_100006033 | 3300005530 | Bacteria | 11275 |
| 292 | Ga0070679_100015243 | 3300005530 | Bacteria | 7385 |
| 293 | Ga0070679_100017095 | 3300005530 | Bacteria | 7012 |
| 294 | Ga0070679_100046964 | 3300005530 | Bacteria | 4305 |
| 295 | Ga0070679_100098164 | 3300005530 | Bacteria | 2917 |
| 296 | Ga0070679_100222455 | 3300005530 | Bacteria | 1848 |
| 297 | Ga0070679_100245652 | 3300005530 | Bacteria | 1747 |
| 298 | Ga0070679_100246614 | 3300005530 | Bacteria | 1743 |
| 299 | Ga0070679_100321364 | 3300005530 | Bacteria | 1497 |
| 300 | Ga0070684_100004281 | 3300005535 | Bacteria | 10823 |
| 301 | Ga0070684_100013549 | 3300005535 | Bacteria | 6579 |
| 302 | Ga0070684_100020604 | 3300005535 | Bacteria | 5468 |
| 303 | Ga0070684_100051000 | 3300005535 | Bacteria | 3595 |
| 304 | Ga0068853_100002701 | 3300005539 | Bacteria | 13378 |
| 305 | Ga0068853_100008568 | 3300005539 | Bacteria | 8219 |
| 306 | Ga0068853_100018661 | 3300005539 | Bacteria | 5743 |
| 307 | Ga0068853_100025749 | 3300005539 | Bacteria | 4937 |
| 308 | Ga0068853_100067167 | 3300005539 | Bacteria | 3114 |
| 309 | Ga0068853_100116026 | 3300005539 | Bacteria | 2384 |
| 310 | Ga0068853_100143380 | 3300005539 | Bacteria | 2145 |
| 311 | Ga0068853_100156669 | 3300005539 | Bacteria | 2052 |
| 312 | Ga0068853_100212350 | 3300005539 | Bacteria | 1764 |
| 313 | Ga0068853_100295223 | 3300005539 | Bacteria | 1497 |
| 314 | Ga0070672_100021972 | 3300005543 | Bacteria | 4678 |
| 315 | Ga0070672_100043703 | 3300005543 | Bacteria | 3457 |
| 316 | Ga0070672_100142343 | 3300005543 | Bacteria | 1979 |
| 317 | Ga0070672_100297086 | 3300005543 | Bacteria | 1368 |
| 318 | Ga0070686_100030021 | 3300005544 | Bacteria | 3313 |
| 319 | Ga0070695_100008874 | 3300005545 | Bacteria | 5971 |
| 320 | Ga0070696_100001072 | 3300005546 | Bacteria | 17656 |
| 321 | Ga0070696_100003297 | 3300005546 | Bacteria | 10775 |
| 322 | Ga0070696_100030889 | 3300005546 | Bacteria | 3669 |
| 323 | Ga0070696_100055603 | 3300005546 | Bacteria | 2760 |
| 324 | Ga0070696_100064029 | 3300005546 | Bacteria | 2576 |
| 325 | Ga0070693_100034600 | 3300005547 | Bacteria | 2796 |
| 326 | Ga0070693_100036637 | 3300005547 | Bacteria | 2729 |
| 327 | Ga0070693_100082785 | 3300005547 | Bacteria | 1916 |
| 328 | Ga0070665_100003964 | 3300005548 | Bacteria | 15604 |
| 329 | Ga0070665_100007774 | 3300005548 | Bacteria | 10890 |
| 330 | Ga0070665_100019771 | 3300005548 | Bacteria | 6760 |
| 331 | Ga0070665_100025711 | 3300005548 | Bacteria | 5930 |
| 332 | Ga0070665_100057362 | 3300005548 | Bacteria | 3903 |
| 333 | Ga0068855_100000036 | 3300005563 | Bacteria | 162849 |
| 334 | Ga0068855_100000480 | 3300005563 | Bacteria | 49187 |
| 335 | Ga0068855_100001533 | 3300005563 | Bacteria | 29006 |
| 336 | Ga0068855_100004530 | 3300005563 | Bacteria | 16970 |
| 337 | Ga0068855_100007664 | 3300005563 | Bacteria | 13053 |
| 338 | Ga0068855_100026190 | 3300005563 | Bacteria | 6976 |
| 339 | Ga0068855_100026592 | 3300005563 | Bacteria | 6923 |
| 340 | Ga0068855_100030225 | 3300005563 | Bacteria | 6480 |
| 341 | Ga0068855_100050548 | 3300005563 | Bacteria | 4898 |
| 342 | Ga0068855_100102087 | 3300005563 | Bacteria | 3301 |
| 343 | Ga0068855_100109262 | 3300005563 | Bacteria | 3176 |
| 344 | Ga0068855_100136938 | 3300005563 | Bacteria | 2793 |
| 345 | Ga0068855_100171276 | 3300005563 | Bacteria | 2459 |
| 346 | Ga0068855_100197425 | 3300005563 | Bacteria | 2267 |
| 347 | Ga0068855_100399817 | 3300005563 | Bacteria | 1506 |
| 348 | Ga0070664_100000152 | 3300005564 | Bacteria | 47795 |
| 349 | Ga0070664_100002216 | 3300005564 | Bacteria | 15624 |
| 350 | Ga0070664_100002766 | 3300005564 | Bacteria | 14158 |
| 351 | Ga0070664_100004863 | 3300005564 | Bacteria | 10760 |
| 352 | Ga0070664_100031462 | 3300005564 | Bacteria | 4434 |
| 353 | Ga0070664_100037535 | 3300005564 | Bacteria | 4074 |
| 354 | Ga0070664_100065976 | 3300005564 | Bacteria | 3090 |
| 355 | Ga0070664_100192630 | 3300005564 | Bacteria | 1817 |
| 356 | Ga0070664_100335752 | 3300005564 | Bacteria | 1372 |
| 357 | Ga0068857_100011649 | 3300005577 | Bacteria | 7649 |
| 358 | Ga0068857_100018647 | 3300005577 | Bacteria | 6090 |
| 359 | Ga0068857_100020611 | 3300005577 | Bacteria | 5801 |
| 360 | Ga0068857_100023989 | 3300005577 | Bacteria | 5369 |
| 361 | Ga0068857_100080701 | 3300005577 | Bacteria | 2905 |
| 362 | Ga0068857_100090959 | 3300005577 | Bacteria | 2731 |
| 363 | Ga0068857_100125818 | 3300005577 | Bacteria | 2309 |
| 364 | Ga0068857_100560876 | 3300005577 | Bacteria | 1077 |
| 365 | Ga0068854_100000190 | 3300005578 | Bacteria | 41376 |
| 366 | Ga0068854_100005665 | 3300005578 | Bacteria | 7892 |
| 367 | Ga0068854_100007267 | 3300005578 | Bacteria | 7073 |
| 368 | Ga0068854_100014610 | 3300005578 | Bacteria | 5180 |
| 369 | Ga0068854_100014693 | 3300005578 | Bacteria | 5166 |
| 370 | Ga0068854_100019713 | 3300005578 | Bacteria | 4550 |
| 371 | Ga0068854_100089482 | 3300005578 | Bacteria | 2288 |
| 372 | Ga0068854_100129743 | 3300005578 | Bacteria | 1924 |
| 373 | Ga0068854_100132664 | 3300005578 | Bacteria | 1903 |
| 374 | Ga0068856_100000409 | 3300005614 | Bacteria | 47269 |
| 375 | Ga0068856_100000871 | 3300005614 | Bacteria | 32354 |
| 376 | Ga0068856_100004156 | 3300005614 | Bacteria | 14466 |
| 377 | Ga0068856_100004503 | 3300005614 | Bacteria | 13854 |
| 378 | Ga0068856_100020224 | 3300005614 | Bacteria | 6465 |
| 379 | Ga0068856_100062649 | 3300005614 | Bacteria | 3674 |
| 380 | Ga0068856_100067352 | 3300005614 | Bacteria | 3538 |
| 381 | Ga0068856_100077891 | 3300005614 | Bacteria | 3286 |
| 382 | Ga0068856_100149033 | 3300005614 | Bacteria | 2348 |
| 383 | Ga0068856_100282905 | 3300005614 | Bacteria | 1675 |
| 384 | Ga0068856_100343183 | 3300005614 | Bacteria | 1512 |
| 385 | Ga0068856_100375518 | 3300005614 | Bacteria | 1441 |
| 386 | Ga0068856_100460519 | 3300005614 | Bacteria | 1292 |
| 387 | Ga0070702_100026916 | 3300005615 | Bacteria | 3097 |
| 388 | Ga0070702_100038356 | 3300005615 | Bacteria | 2667 |
| 389 | Ga0070702_100207622 | 3300005615 | Bacteria | 1301 |
| 390 | Ga0068852_100006255 | 3300005616 | Bacteria | 8589 |
| 391 | Ga0068852_100012065 | 3300005616 | Bacteria | 6542 |
| 392 | Ga0068852_100015026 | 3300005616 | Bacteria | 5985 |
| 393 | Ga0068852_100023687 | 3300005616 | Bacteria | 4946 |
| 394 | Ga0068852_100035141 | 3300005616 | Bacteria | 4176 |
| 395 | Ga0068852_100048219 | 3300005616 | Bacteria | 3639 |
| 396 | Ga0068852_100052885 | 3300005616 | Bacteria | 3493 |
| 397 | Ga0068852_100122524 | 3300005616 | Bacteria | 2383 |
| 398 | Ga0068852_100318374 | 3300005616 | Bacteria | 1510 |
| 399 | Ga0068859_100003324 | 3300005617 | Bacteria | 16345 |
| 400 | Ga0068859_100013908 | 3300005617 | Bacteria | 8073 |
| 401 | Ga0068859_100018022 | 3300005617 | Bacteria | 7096 |
| 402 | Ga0068859_100034393 | 3300005617 | Bacteria | 5086 |
| 403 | Ga0068859_100091461 | 3300005617 | Bacteria | 3093 |
| 404 | Ga0068864_100000003 | 3300005618 | Bacteria | 568775 |
| 405 | Ga0068864_100015374 | 3300005618 | Bacteria | 6363 |
| 406 | Ga0068864_100022493 | 3300005618 | Bacteria | 5286 |
| 407 | Ga0068864_100029374 | 3300005618 | Bacteria | 4655 |
| 408 | Ga0068864_100032138 | 3300005618 | Bacteria | 4457 |
| 409 | Ga0068864_100038634 | 3300005618 | Bacteria | 4077 |
| 410 | Ga0068864_100051693 | 3300005618 | Bacteria | 3541 |
| 411 | Ga0068864_100065129 | 3300005618 | Bacteria | 3161 |
| 412 | Ga0068864_100065381 | 3300005618 | Bacteria | 3155 |
| 413 | Ga0068864_100072359 | 3300005618 | Bacteria | 3004 |
| 414 | Ga0068864_100130939 | 3300005618 | Bacteria | 2253 |
| 415 | Ga0068864_100139768 | 3300005618 | Bacteria | 2184 |
| 416 | Ga0068864_100168939 | 3300005618 | Bacteria | 1993 |
| 417 | Ga0068866_10004226 | 3300005718 | Bacteria | 5897 |
| 418 | Ga0068861_100008881 | 3300005719 | Bacteria | 6926 |
| 419 | Ga0068861_100022627 | 3300005719 | Bacteria | 4531 |
| 420 | Ga0068861_100022771 | 3300005719 | Bacteria | 4517 |
| 421 | Ga0068861_100069845 | 3300005719 | Bacteria | 2718 |
| 422 | Ga0068851_10003350 | 3300005834 | Bacteria | 7127 |
| 423 | Ga0068851_10010852 | 3300005834 | Bacteria | 4259 |
| 424 | Ga0068851_10016754 | 3300005834 | Bacteria | 3510 |
| 425 | Ga0068851_10025248 | 3300005834 | Bacteria | 2914 |
| 426 | Ga0068851_10120751 | 3300005834 | Bacteria | 1408 |
| 427 | Ga0068863_100000676 | 3300005841 | Bacteria | 34484 |
| 428 | Ga0068863_100015016 | 3300005841 | Bacteria | 7439 |
| 429 | Ga0068863_100018221 | 3300005841 | Bacteria | 6723 |
| 430 | Ga0068863_100020554 | 3300005841 | Bacteria | 6311 |
| 431 | Ga0068863_100043692 | 3300005841 | Bacteria | 4253 |
| 432 | Ga0068863_100047277 | 3300005841 | Bacteria | 4082 |
| 433 | Ga0068863_100089543 | 3300005841 | Bacteria | 2918 |
| 434 | Ga0068863_100105072 | 3300005841 | Bacteria | 2686 |
| 435 | Ga0068863_100177808 | 3300005841 | Bacteria | 2042 |
| 436 | Ga0068858_100007507 | 3300005842 | Bacteria | 10537 |
| 437 | Ga0068858_100183499 | 3300005842 | Bacteria | 1976 |
| 438 | Ga0068860_100004338 | 3300005843 | Bacteria | 14500 |
| 439 | Ga0068860_100005019 | 3300005843 | Bacteria | 13473 |
| 440 | Ga0068860_100032807 | 3300005843 | Bacteria | 4988 |
| 441 | Ga0068860_100034112 | 3300005843 | Bacteria | 4881 |
| 442 | Ga0068860_100048959 | 3300005843 | Bacteria | 4028 |
| 443 | Ga0068860_100074436 | 3300005843 | Bacteria | 3230 |
| 444 | Ga0068862_100000550 | 3300005844 | Bacteria | 39321 |
| 445 | Ga0068862_100001116 | 3300005844 | Bacteria | 25466 |
| 446 | Ga0068862_100024262 | 3300005844 | Bacteria | 5088 |
| 447 | Ga0068862_100028576 | 3300005844 | Bacteria | 4698 |
| 448 | Ga0068862_100048865 | 3300005844 | Bacteria | 3613 |
| 449 | Ga0068862_100531222 | 3300005844 | Bacteria | 1121 |
| 450 | Ga0081455_10000066 | 3300005937 | Bacteria | 115221 |
| 451 | Ga0081455_10001237 | 3300005937 | Bacteria | 31932 |
| 452 | Ga0081539_10001910 | 3300005985 | Bacteria | 32284 |
| 453 | Ga0070717_10002720 | 3300006028 | Bacteria | 12482 |
| 454 | Ga0070717_10003857 | 3300006028 | Bacteria | 10783 |
| 455 | Ga0070717_10048918 | 3300006028 | Bacteria | 3470 |
| 456 | Ga0070717_10472666 | 3300006028 | Bacteria | 1131 |
| 457 | Ga0075365_10060459 | 3300006038 | Bacteria | 2528 |
| 458 | Ga0075363_100011681 | 3300006048 | Bacteria | 4213 |
| 459 | Ga0075363_100147866 | 3300006048 | Bacteria | 1325 |
| 460 | Ga0075364_10026765 | 3300006051 | Bacteria | 3682 |
| 461 | Ga0070716_100073708 | 3300006173 | Bacteria | 2015 |
| 462 | Ga0070716_100147098 | 3300006173 | Bacteria | 1510 |
| 463 | Ga0075369_10052301 | 3300006186 | Bacteria | 1771 |
| 464 | Ga0075366_10012523 | 3300006195 | Bacteria | 4812 |
| 465 | Ga0075366_10099029 | 3300006195 | Bacteria | 1749 |
| 466 | Ga0075366_10101296 | 3300006195 | Bacteria | 1728 |
| 467 | Ga0097621_100005667 | 3300006237 | Bacteria | 8814 |
| 468 | Ga0097621_100029431 | 3300006237 | Bacteria | 4337 |
| 469 | Ga0097621_100038404 | 3300006237 | Bacteria | 3842 |
| 470 | Ga0097621_100054938 | 3300006237 | Bacteria | 3250 |
| 471 | Ga0097621_100213191 | 3300006237 | Bacteria | 1680 |
| 472 | Ga0097621_100219439 | 3300006237 | Bacteria | 1656 |
| 473 | Ga0097621_100490550 | 3300006237 | Bacteria | 1112 |
| 474 | Ga0075370_10004592 | 3300006353 | Bacteria | 6734 |
| 475 | Ga0075370_10008051 | 3300006353 | Bacteria | 5408 |
| 476 | Ga0075370_10026557 | 3300006353 | Bacteria | 3208 |
| 477 | Ga0075370_10090032 | 3300006353 | Bacteria | 1770 |
| 478 | Ga0075370_10110310 | 3300006353 | Bacteria | 1597 |
| 479 | Ga0068871_100000930 | 3300006358 | Bacteria | 19543 |
| 480 | Ga0068871_100053826 | 3300006358 | Bacteria | 3263 |
| 481 | Ga0068871_100054239 | 3300006358 | Bacteria | 3251 |
| 482 | Ga0068871_100148555 | 3300006358 | Bacteria | 1997 |
| 483 | Ga0068871_100169330 | 3300006358 | Bacteria | 1871 |
| 484 | Ga0068871_100201616 | 3300006358 | Bacteria | 1718 |
| 485 | Ga0075428_100317283 | 3300006844 | Bacteria | 1675 |
| 486 | Ga0075430_100006474 | 3300006846 | Bacteria | 9869 |
| 487 | Ga0075430_100028405 | 3300006846 | Bacteria | 4753 |
| 488 | Ga0075430_100274356 | 3300006846 | Bacteria | 1395 |
| 489 | Ga0075431_100019689 | 3300006847 | Bacteria | 6886 |
| 490 | Ga0075431_100032826 | 3300006847 | Bacteria | 5350 |
| 491 | Ga0075431_100057239 | 3300006847 | Bacteria | 4020 |
| 492 | Ga0075433_10023918 | 3300006852 | Bacteria | 5149 |
| 493 | Ga0075434_100438413 | 3300006871 | Bacteria | 1327 |
| 494 | Ga0075429_100168055 | 3300006880 | Bacteria | 1921 |
| 495 | Ga0068865_100038247 | 3300006881 | Bacteria | 3246 |
| 496 | Ga0068865_100087868 | 3300006881 | Bacteria | 2247 |
| 497 | Ga0075436_100038337 | 3300006914 | Bacteria | 3307 |
| 498 | Ga0097620_100003324 | 3300006931 | Bacteria | 16345 |
| 499 | Ga0097620_100013909 | 3300006931 | Bacteria | 8073 |
| 500 | Ga0097620_100018020 | 3300006931 | Bacteria | 7096 |
| 501 | Ga0097620_100034393 | 3300006931 | Bacteria | 5086 |
| 502 | Ga0097620_100091464 | 3300006931 | Bacteria | 3093 |
| 503 | Ga0079104_1016454 | 3300006946 | Bacteria | 2162 |
| 504 | Ga0075435_100062520 | 3300007076 | Bacteria | 3021 |
| 505 | Ga0075435_100240315 | 3300007076 | Bacteria | 1540 |
| 506 | Ga0099794_10007575 | 3300007265 | Bacteria | 4466 |
| 507 | Ga0099795_10000375 | 3300007788 | Bacteria | 8070 |
| 508 | Ga0105240_10001797 | 3300009093 | Bacteria | 36111 |
| 509 | Ga0105240_10004421 | 3300009093 | Bacteria | 21431 |
| 510 | Ga0105240_10023500 | 3300009093 | Bacteria | 8149 |
| 511 | Ga0105240_10028258 | 3300009093 | Bacteria | 7327 |
| 512 | Ga0105240_10039469 | 3300009093 | Bacteria | 6046 |
| 513 | Ga0105240_10068076 | 3300009093 | Bacteria | 4411 |
| 514 | Ga0105240_10140267 | 3300009093 | Bacteria | 2890 |
| 515 | Ga0105240_10195986 | 3300009093 | Bacteria | 2372 |
| 516 | Ga0105240_10263066 | 3300009093 | Bacteria | 1989 |
| 517 | Ga0105240_10306918 | 3300009093 | Bacteria | 1814 |
| 518 | Ga0105240_10656185 | 3300009093 | Bacteria | 1149 |
| 519 | Ga0111539_10057264 | 3300009094 | Bacteria | 4629 |
| 520 | Ga0105245_10015709 | 3300009098 | Bacteria | 6601 |
| 521 | Ga0105245_10272104 | 3300009098 | Bacteria | 1652 |
| 522 | Ga0105247_10055366 | 3300009101 | Bacteria | 2448 |
| 523 | Ga0114129_10010131 | 3300009147 | Bacteria | 13436 |
| 524 | Ga0114129_10028488 | 3300009147 | Bacteria | 7914 |
| 525 | Ga0114129_10110971 | 3300009147 | Bacteria | 3785 |
| 526 | Ga0114129_10199985 | 3300009147 | Bacteria | 2707 |
| 527 | Ga0114129_10596294 | 3300009147 | Bacteria | 1432 |
| 528 | Ga0105243_10098111 | 3300009148 | Bacteria | 2426 |
| 529 | Ga0105243_10142412 | 3300009148 | Bacteria | 2047 |
| 530 | Ga0105241_10016286 | 3300009174 | Bacteria | 5448 |
| 531 | Ga0105241_10023539 | 3300009174 | Bacteria | 4568 |
| 532 | Ga0105241_10214386 | 3300009174 | Bacteria | 1615 |
| 533 | Ga0105241_10290255 | 3300009174 | Bacteria | 1400 |
| 534 | Ga0105242_10140285 | 3300009176 | Bacteria | 2096 |
| 535 | Ga0105248_10001300 | 3300009177 | Bacteria | 27811 |
| 536 | Ga0105248_10003092 | 3300009177 | Bacteria | 18448 |
| 537 | Ga0105248_10011726 | 3300009177 | Bacteria | 9665 |
| 538 | Ga0105248_10038844 | 3300009177 | Bacteria | 5329 |
| 539 | Ga0105248_10075626 | 3300009177 | Bacteria | 3785 |
| 540 | Ga0105248_10145097 | 3300009177 | Bacteria | 2678 |
| 541 | Ga0105248_10224022 | 3300009177 | Bacteria | 2117 |
| 542 | Ga0105248_10253051 | 3300009177 | Bacteria | 1982 |
| 543 | Ga0105248_10295518 | 3300009177 | Bacteria | 1824 |
| 544 | Ga0105248_10399827 | 3300009177 | Bacteria | 1547 |
| 545 | Ga0105248_10436412 | 3300009177 | Bacteria | 1475 |
| 546 | Ga0105237_10020873 | 3300009545 | Bacteria | 6744 |
| 547 | Ga0105237_10046769 | 3300009545 | Bacteria | 4352 |
| 548 | Ga0105237_10060291 | 3300009545 | Bacteria | 3796 |
| 549 | Ga0105237_10061882 | 3300009545 | Bacteria | 3741 |
| 550 | Ga0105237_10113145 | 3300009545 | Bacteria | 2706 |
| 551 | Ga0105237_10248072 | 3300009545 | Bacteria | 1782 |
| 552 | Ga0105237_10396390 | 3300009545 | Bacteria | 1385 |
| 553 | Ga0105237_10422306 | 3300009545 | Bacteria | 1339 |
| 554 | Ga0105238_10000864 | 3300009551 | Bacteria | 31302 |
| 555 | Ga0105238_10003335 | 3300009551 | Bacteria | 16027 |
| 556 | Ga0105238_10010092 | 3300009551 | Bacteria | 9469 |
| 557 | Ga0105238_10057176 | 3300009551 | Bacteria | 3911 |
| 558 | Ga0105238_10071848 | 3300009551 | Bacteria | 3457 |
| 559 | Ga0105238_10078033 | 3300009551 | Bacteria | 3303 |
| 560 | Ga0105238_10141550 | 3300009551 | Bacteria | 2382 |
| 561 | Ga0105238_10141928 | 3300009551 | Bacteria | 2378 |
| 562 | Ga0105238_10154215 | 3300009551 | Bacteria | 2272 |
| 563 | Ga0105238_10161842 | 3300009551 | Bacteria | 2214 |
| 564 | Ga0105238_10208849 | 3300009551 | Bacteria | 1928 |
| 565 | Ga0105238_10239149 | 3300009551 | Bacteria | 1793 |
| 566 | Ga0105238_10362978 | 3300009551 | Bacteria | 1438 |
| 567 | Ga0105249_10000195 | 3300009553 | Bacteria | 69709 |
| 568 | Ga0105249_10021588 | 3300009553 | Bacteria | 5764 |
| 569 | Ga0105249_10028673 | 3300009553 | Bacteria | 5024 |
| 570 | Ga0105249_10078976 | 3300009553 | Bacteria | 3054 |
| 571 | Ga0099796_10000691 | 3300010159 | Bacteria | 5949 |
| 572 | Ga0105239_10029266 | 3300010375 | Bacteria | 6057 |
| 573 | Ga0105239_10048993 | 3300010375 | Bacteria | 4632 |
| 574 | Ga0105239_10067091 | 3300010375 | Bacteria | 3941 |
| 575 | Ga0105239_10082305 | 3300010375 | Bacteria | 3544 |
| 576 | Ga0105239_10090653 | 3300010375 | Bacteria | 3373 |
| 577 | Ga0105239_10096260 | 3300010375 | Bacteria | 3271 |
| 578 | Ga0105239_10122764 | 3300010375 | Bacteria | 2886 |
| 579 | Ga0105246_10043591 | 3300011119 | Bacteria | 3045 |
| 580 | Ga0105246_10243297 | 3300011119 | Bacteria | 1424 |
| 581 | Ga0157373_10011386 | 3300013100 | Bacteria | 6541 |
| 582 | Ga0157373_10012292 | 3300013100 | Bacteria | 6294 |
| 583 | Ga0157373_10022939 | 3300013100 | Bacteria | 4526 |
| 584 | Ga0157373_10036718 | 3300013100 | Bacteria | 3514 |
| 585 | Ga0157373_10062337 | 3300013100 | Bacteria | 2641 |
| 586 | Ga0157373_10084911 | 3300013100 | Bacteria | 2231 |
| 587 | Ga0157373_10113382 | 3300013100 | Bacteria | 1905 |
| 588 | Ga0157373_10129460 | 3300013100 | Bacteria | 1775 |
| 589 | Ga0157373_10158310 | 3300013100 | Bacteria | 1593 |
| 590 | Ga0157371_10001396 | 3300013102 | Bacteria | 25235 |
| 591 | Ga0157371_10083526 | 3300013102 | Bacteria | 2261 |
| 592 | Ga0157371_10092881 | 3300013102 | Bacteria | 2138 |
| 593 | Ga0157371_10093688 | 3300013102 | Bacteria | 2128 |
| 594 | Ga0157371_10120715 | 3300013102 | Bacteria | 1863 |
| 595 | Ga0157371_10125727 | 3300013102 | Bacteria | 1823 |
| 596 | Ga0157370_10000793 | 3300013104 | Bacteria | 39742 |
| 597 | Ga0157370_10006992 | 3300013104 | Bacteria | 12321 |
| 598 | Ga0157370_10007658 | 3300013104 | Bacteria | 11722 |
| 599 | Ga0157370_10017138 | 3300013104 | Bacteria | 7314 |
| 600 | Ga0157370_10112349 | 3300013104 | Bacteria | 2546 |
| 601 | Ga0157370_10128016 | 3300013104 | Bacteria | 2370 |
| 602 | Ga0157370_10145186 | 3300013104 | Bacteria | 2210 |
| 603 | Ga0157370_10179950 | 3300013104 | Bacteria | 1965 |
| 604 | Ga0157370_10181923 | 3300013104 | Bacteria | 1953 |
| 605 | Ga0157370_10285818 | 3300013104 | Bacteria | 1524 |
| 606 | Ga0157370_10323000 | 3300013104 | Bacteria | 1423 |
| 607 | Ga0157370_10383065 | 3300013104 | Bacteria | 1295 |
| 608 | Ga0157369_10000185 | 3300013105 | Bacteria | 86285 |
| 609 | Ga0157369_10004153 | 3300013105 | Bacteria | 17157 |
| 610 | Ga0157369_10008454 | 3300013105 | Bacteria | 11806 |
| 611 | Ga0157369_10040968 | 3300013105 | Bacteria | 5055 |
| 612 | Ga0157369_10065759 | 3300013105 | Bacteria | 3902 |
| 613 | Ga0157369_10135362 | 3300013105 | Bacteria | 2609 |
| 614 | Ga0157369_10509066 | 3300013105 | Bacteria | 1245 |
| 615 | Ga0157374_10019967 | 3300013296 | Bacteria | 5940 |
| 616 | Ga0157374_10034227 | 3300013296 | Bacteria | 4638 |
| 617 | Ga0157374_10080136 | 3300013296 | Bacteria | 3096 |
| 618 | Ga0157374_10086107 | 3300013296 | Bacteria | 2989 |
| 619 | Ga0157374_10090083 | 3300013296 | Bacteria | 2924 |
| 620 | Ga0157374_10107629 | 3300013296 | Bacteria | 2679 |
| 621 | Ga0157374_10137624 | 3300013296 | Bacteria | 2369 |
| 622 | Ga0157374_10175451 | 3300013296 | Bacteria | 2092 |
| 623 | Ga0157374_10401366 | 3300013296 | Bacteria | 1368 |
| 624 | Ga0157378_10034473 | 3300013297 | Bacteria | 4476 |
| 625 | Ga0157378_10214988 | 3300013297 | Bacteria | 1825 |
| 626 | Ga0157378_10341662 | 3300013297 | Bacteria | 1460 |
| 627 | Ga0163162_10000021 | 3300013306 | Bacteria | 214873 |
| 628 | Ga0163162_10081285 | 3300013306 | Bacteria | 3311 |
| 629 | Ga0163162_10815076 | 3300013306 | Bacteria | 1050 |
| 630 | Ga0157372_10002671 | 3300013307 | Bacteria | 19288 |
| 631 | Ga0157372_10024015 | 3300013307 | Bacteria | 6614 |
| 632 | Ga0157372_10025492 | 3300013307 | Bacteria | 6430 |
| 633 | Ga0157372_10026197 | 3300013307 | Bacteria | 6344 |
| 634 | Ga0157372_10059284 | 3300013307 | Bacteria | 4281 |
| 635 | Ga0157372_10101095 | 3300013307 | Bacteria | 3291 |
| 636 | Ga0157372_10104398 | 3300013307 | Bacteria | 3239 |
| 637 | Ga0157372_10120965 | 3300013307 | Bacteria | 3007 |
| 638 | Ga0157372_10142936 | 3300013307 | Bacteria | 2759 |
| 639 | Ga0157372_10193241 | 3300013307 | Bacteria | 2357 |
| 640 | Ga0157372_10201177 | 3300013307 | Bacteria | 2307 |
| 641 | Ga0157372_10232360 | 3300013307 | Bacteria | 2138 |
| 642 | Ga0157372_10252443 | 3300013307 | Bacteria | 2047 |
| 643 | Ga0157372_10280912 | 3300013307 | Bacteria | 1936 |
| 644 | Ga0157372_10454398 | 3300013307 | Bacteria | 1493 |
| 645 | Ga0157375_10002586 | 3300013308 | Bacteria | 15714 |
| 646 | Ga0157375_10007788 | 3300013308 | Bacteria | 9371 |
| 647 | Ga0157375_10019559 | 3300013308 | Bacteria | 6163 |
| 648 | Ga0157375_10036322 | 3300013308 | Bacteria | 4713 |
| 649 | Ga0157375_10054977 | 3300013308 | Bacteria | 3923 |
| 650 | Ga0157375_10078869 | 3300013308 | Bacteria | 3327 |
| 651 | Ga0157375_10173230 | 3300013308 | Bacteria | 2306 |
| 652 | Ga0163163_10000132 | 3300014325 | Bacteria | 76574 |
| 653 | Ga0163163_10001449 | 3300014325 | Bacteria | 20042 |
| 654 | Ga0163163_10036340 | 3300014325 | Bacteria | 4784 |
| 655 | Ga0163163_10130413 | 3300014325 | Bacteria | 2554 |
| 656 | Ga0163163_10228447 | 3300014325 | Bacteria | 1910 |
| 657 | Ga0163163_10400697 | 3300014325 | Bacteria | 1430 |
| 658 | Ga0163163_10458181 | 3300014325 | Bacteria | 1335 |
| 659 | Ga0157380_10000114 | 3300014326 | Bacteria | 44326 |
| 660 | Ga0157380_10040570 | 3300014326 | Bacteria | 3626 |
| 661 | Ga0182008_10008704 | 3300014497 | Bacteria | 5520 |
| 662 | Ga0182008_10008890 | 3300014497 | Bacteria | 5449 |
| 663 | Ga0157377_10057967 | 3300014745 | Bacteria | 2204 |
| 664 | Ga0157379_10000505 | 3300014968 | Bacteria | 31681 |
| 665 | Ga0157379_10009200 | 3300014968 | Bacteria | 8602 |
| 666 | Ga0157379_10017855 | 3300014968 | Bacteria | 6250 |
| 667 | Ga0157379_10224730 | 3300014968 | Bacteria | 1701 |
| 668 | Ga0157376_10002600 | 3300014969 | Bacteria | 12261 |
| 669 | Ga0157376_10030928 | 3300014969 | Bacteria | 4280 |
| 670 | Ga0157376_10042383 | 3300014969 | Bacteria | 3731 |
| 671 | Ga0157376_10100800 | 3300014969 | Bacteria | 2522 |
| 672 | Ga0157376_10129041 | 3300014969 | Bacteria | 2253 |
| 673 | Ga0157376_10240571 | 3300014969 | Bacteria | 1686 |
| 674 | Ga0157376_10571598 | 3300014969 | Bacteria | 1121 |
| 675 | Ga0182006_1000161 | 3300015261 | Bacteria | 71421 |
| 676 | Ga0182006_1022511 | 3300015261 | Bacteria | 2619 |
| 677 | Ga0182007_10009993 | 3300015262 | Bacteria | 3779 |
| 678 | Ga0182007_10031769 | 3300015262 | Bacteria | 1796 |
| 679 | Ga0182005_1004688 | 3300015265 | Bacteria | 4370 |
| 680 | Ga0182005_1004909 | 3300015265 | Bacteria | 4240 |
| 681 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 682 | Ga0163161_10046242 | 3300017792 | Bacteria | 3140 |
| 683 | Ga0163161_10131379 | 3300017792 | Bacteria | 1889 |
| 684 | Ga0163161_10188067 | 3300017792 | Bacteria | 1586 |
| 685 | Ga0206356_10235604 | 3300020070 | Bacteria | 4662 |
| 686 | Ga0206351_10193420 | 3300020077 | Bacteria | 1538 |
| 687 | Ga0206354_10341756 | 3300020081 | Bacteria | 6982 |
| 688 | Ga0206353_10095998 | 3300020082 | Bacteria | 1425 |
| 689 | Ga0154015_1244858 | 3300020610 | Bacteria | 5504 |
| 690 | Ga0154015_1402022 | 3300020610 | Bacteria | 3567 |
| 691 | Ga0213873_10024325 | 3300021358 | Bacteria | 1453 |
| 692 | Ga0213874_10033033 | 3300021377 | Bacteria | 1506 |
| 693 | Ga0213876_10011988 | 3300021384 | Bacteria | 4618 |
| 694 | Ga0213876_10023781 | 3300021384 | Bacteria | 3235 |
| 695 | Ga0209435_100008 | 3300025206 | Bacteria | 503644 |
| 696 | Ga0209436_110535 | 3300025208 | Bacteria | 1685 |
| 697 | Ga0209566_100231 | 3300025225 | Bacteria | 54215 |
| 698 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 699 | Ga0209674_100086 | 3300025226 | Bacteria | 187776 |
| 700 | Ga0209674_100488 | 3300025226 | Bacteria | 16850 |
| 701 | Ga0209674_100751 | 3300025226 | Bacteria | 10993 |
| 702 | Ga0209672_100020 | 3300025228 | Bacteria | 429003 |
| 703 | Ga0209672_100029 | 3300025228 | Bacteria | 339298 |
| 704 | Ga0209672_100049 | 3300025228 | Bacteria | 238787 |
| 705 | Ga0209672_100066 | 3300025228 | Bacteria | 189828 |
| 706 | Ga0209147_100024 | 3300025229 | Bacteria | 429003 |
| 707 | Ga0209147_100084 | 3300025229 | Bacteria | 189828 |
| 708 | Ga0209563_100010 | 3300025230 | Bacteria | 1337457 |
| 709 | Ga0209563_100051 | 3300025230 | Bacteria | 340545 |
| 710 | Ga0207427_100117 | 3300025231 | Bacteria | 102251 |
| 711 | Ga0207427_100178 | 3300025231 | Bacteria | 67956 |
| 712 | Ga0207427_101735 | 3300025231 | Bacteria | 7170 |
| 713 | Ga0207427_102934 | 3300025231 | Bacteria | 4003 |
| 714 | Ga0209437_100240 | 3300025233 | Bacteria | 89740 |
| 715 | Ga0209437_100304 | 3300025233 | Bacteria | 67955 |
| 716 | Ga0209437_100482 | 3300025233 | Bacteria | 30012 |
| 717 | Ga0209437_101084 | 3300025233 | Bacteria | 8725 |
| 718 | Ga0209258_100053 | 3300025242 | Bacteria | 339233 |
| 719 | Ga0209258_100084 | 3300025242 | Bacteria | 244783 |
| 720 | Ga0209258_100087 | 3300025242 | Bacteria | 238787 |
| 721 | Ga0209258_100117 | 3300025242 | Bacteria | 189828 |
| 722 | Ga0209258_100144 | 3300025242 | Bacteria | 163814 |
| 723 | Ga0209258_100647 | 3300025242 | Bacteria | 25954 |
| 724 | Ga0209258_102270 | 3300025242 | Bacteria | 5161 |
| 725 | Ga0207425_1010948 | 3300025245 | Bacteria | 2187 |
| 726 | Ga0209646_1000029 | 3300025246 | Bacteria | 386414 |
| 727 | Ga0209646_1000066 | 3300025246 | Bacteria | 244823 |
| 728 | Ga0209026_1000016 | 3300025250 | Bacteria | 386457 |
| 729 | Ga0209026_1000027 | 3300025250 | Bacteria | 351282 |
| 730 | Ga0209026_1000074 | 3300025250 | Bacteria | 203820 |
| 731 | Ga0209026_1000093 | 3300025250 | Bacteria | 170393 |
| 732 | Ga0209026_1001064 | 3300025250 | Bacteria | 13335 |
| 733 | Ga0209677_100044 | 3300025253 | Bacteria | 215799 |
| 734 | Ga0209677_100128 | 3300025253 | Bacteria | 76547 |
| 735 | Ga0209677_101339 | 3300025253 | Bacteria | 10829 |
| 736 | Ga0209677_102377 | 3300025253 | Bacteria | 7181 |
| 737 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 738 | Ga0209148_1000055 | 3300025254 | Bacteria | 367500 |
| 739 | Ga0209148_1000096 | 3300025254 | Bacteria | 238787 |
| 740 | Ga0209148_1000114 | 3300025254 | Bacteria | 192073 |
| 741 | Ga0209148_1000141 | 3300025254 | Bacteria | 163821 |
| 742 | Ga0209148_1000148 | 3300025254 | Bacteria | 159642 |
| 743 | Ga0209148_1001683 | 3300025254 | Bacteria | 9898 |
| 744 | Ga0209759_1000016 | 3300025256 | Bacteria | 386414 |
| 745 | Ga0209759_1000110 | 3300025256 | Bacteria | 144917 |
| 746 | Ga0209759_1000387 | 3300025256 | Bacteria | 55041 |
| 747 | Ga0209759_1006844 | 3300025256 | Bacteria | 3771 |
| 748 | Ga0209759_1008612 | 3300025256 | Bacteria | 3163 |
| 749 | Ga0209129_1009361 | 3300025258 | Bacteria | 2593 |
| 750 | Ga0209233_1000083 | 3300025261 | Bacteria | 336016 |
| 751 | Ga0209233_1000287 | 3300025261 | Bacteria | 67956 |
| 752 | Ga0209233_1000417 | 3300025261 | Bacteria | 32180 |
| 753 | Ga0209565_1000041 | 3300025263 | Bacteria | 251081 |
| 754 | Ga0209565_1000597 | 3300025263 | Bacteria | 24336 |
| 755 | Ga0209565_1003353 | 3300025263 | Bacteria | 5227 |
| 756 | Ga0209565_1008241 | 3300025263 | Bacteria | 2744 |
| 757 | Ga0209455_1000060 | 3300025272 | Bacteria | 339298 |
| 758 | Ga0209455_1000088 | 3300025272 | Bacteria | 238787 |
| 759 | Ga0209455_1000110 | 3300025272 | Bacteria | 189828 |
| 760 | Ga0209455_1003953 | 3300025272 | Bacteria | 5034 |
| 761 | Ga0209673_1000057 | 3300025273 | Bacteria | 270150 |
| 762 | Ga0209673_1001316 | 3300025273 | Bacteria | 25092 |
| 763 | Ga0209673_1002473 | 3300025273 | Bacteria | 12777 |
| 764 | Ga0209130_1000014 | 3300025284 | Bacteria | 412039 |
| 765 | Ga0209130_1003456 | 3300025284 | Bacteria | 6687 |
| 766 | Ga0209130_1005797 | 3300025284 | Bacteria | 4179 |
| 767 | Ga0209675_1000783 | 3300025291 | Bacteria | 21160 |
| 768 | Ga0209675_1010551 | 3300025291 | Bacteria | 3142 |
| 769 | Ga0209675_1012756 | 3300025291 | Bacteria | 2682 |
| 770 | Ga0209676_1000013 | 3300025292 | Bacteria | 816080 |
| 771 | Ga0209676_1000153 | 3300025292 | Bacteria | 166393 |
| 772 | Ga0209676_1000414 | 3300025292 | Bacteria | 76877 |
| 773 | Ga0209676_1000928 | 3300025292 | Bacteria | 36206 |
| 774 | Ga0209676_1000971 | 3300025292 | Bacteria | 34521 |
| 775 | Ga0209676_1001166 | 3300025292 | Bacteria | 28483 |
| 776 | Ga0209676_1002764 | 3300025292 | Bacteria | 11730 |
| 777 | Ga0209676_1005511 | 3300025292 | Bacteria | 6581 |
| 778 | Ga0209025_1000819 | 3300025294 | Bacteria | 49669 |
| 779 | Ga0209025_1003991 | 3300025294 | Bacteria | 13248 |
| 780 | Ga0209025_1013203 | 3300025294 | Bacteria | 5213 |
| 781 | Ga0209564_1001403 | 3300025295 | Bacteria | 24959 |
| 782 | Ga0209564_1002122 | 3300025295 | Bacteria | 16818 |
| 783 | Ga0209564_1004135 | 3300025295 | Bacteria | 9106 |
| 784 | Ga0209564_1005783 | 3300025295 | Bacteria | 6903 |
| 785 | Ga0209564_1013128 | 3300025295 | Bacteria | 3545 |
| 786 | Ga0209564_1017578 | 3300025295 | Bacteria | 2778 |
| 787 | Ga0209758_1004353 | 3300025297 | Bacteria | 11861 |
| 788 | Ga0209758_1004543 | 3300025297 | Bacteria | 11461 |
| 789 | Ga0209758_1010044 | 3300025297 | Bacteria | 5742 |
| 790 | Ga0209758_1032092 | 3300025297 | Bacteria | 2140 |
| 791 | Ga0209050_1000008 | 3300025298 | Bacteria | 1144179 |
| 792 | Ga0209050_1001001 | 3300025298 | Bacteria | 35419 |
| 793 | Ga0209050_1001040 | 3300025298 | Bacteria | 34383 |
| 794 | Ga0209050_1002812 | 3300025298 | Bacteria | 13901 |
| 795 | Ga0209050_1005563 | 3300025298 | Bacteria | 7842 |
| 796 | Ga0209050_1006477 | 3300025298 | Bacteria | 6914 |
| 797 | Ga0209050_1012340 | 3300025298 | Bacteria | 3929 |
| 798 | Ga0209050_1013887 | 3300025298 | Bacteria | 3528 |
| 799 | Ga0209256_1000039 | 3300025299 | Bacteria | 372337 |
| 800 | Ga0209256_1000670 | 3300025299 | Bacteria | 46303 |
| 801 | Ga0209256_1001995 | 3300025299 | Bacteria | 18294 |
| 802 | Ga0209256_1010505 | 3300025299 | Bacteria | 3862 |
| 803 | Ga0209256_1010741 | 3300025299 | Bacteria | 3780 |
| 804 | Ga0209256_1013905 | 3300025299 | Bacteria | 2948 |
| 805 | Ga0207426_1000174 | 3300025302 | Bacteria | 160877 |
| 806 | Ga0207426_1002190 | 3300025302 | Bacteria | 13181 |
| 807 | Ga0209051_1000005 | 3300025303 | Bacteria | 1142353 |
| 808 | Ga0209051_1000354 | 3300025303 | Bacteria | 68119 |
| 809 | Ga0209051_1001411 | 3300025303 | Bacteria | 20636 |
| 810 | Ga0209051_1011234 | 3300025303 | Bacteria | 4441 |
| 811 | Ga0209051_1017460 | 3300025303 | Bacteria | 3205 |
| 812 | Ga0209257_1000031 | 3300025304 | Bacteria | 688770 |
| 813 | Ga0209257_1000184 | 3300025304 | Bacteria | 156438 |
| 814 | Ga0209257_1000186 | 3300025304 | Bacteria | 154365 |
| 815 | Ga0209257_1000616 | 3300025304 | Bacteria | 57900 |
| 816 | Ga0209257_1000916 | 3300025304 | Bacteria | 41029 |
| 817 | Ga0209257_1001656 | 3300025304 | Bacteria | 25301 |
| 818 | Ga0209257_1002298 | 3300025304 | Bacteria | 19395 |
| 819 | Ga0209257_1002620 | 3300025304 | Bacteria | 17370 |
| 820 | Ga0209257_1008929 | 3300025304 | Bacteria | 5515 |
| 821 | Ga0209257_1015048 | 3300025304 | Bacteria | 3258 |
| 822 | Ga0207697_10000097 | 3300025315 | Bacteria | 39643 |
| 823 | Ga0207697_10010256 | 3300025315 | Bacteria | 4012 |
| 824 | Ga0207697_10028013 | 3300025315 | Bacteria | 2303 |
| 825 | Ga0207656_10001616 | 3300025321 | Bacteria | 7495 |
| 826 | Ga0207656_10020861 | 3300025321 | Bacteria | 2609 |
| 827 | Ga0207656_10029893 | 3300025321 | Bacteria | 2247 |
| 828 | Ga0207656_10089236 | 3300025321 | Bacteria | 1397 |
| 829 | Ga0207682_10000606 | 3300025893 | Bacteria | 16672 |
| 830 | Ga0207682_10009513 | 3300025893 | Bacteria | 3835 |
| 831 | Ga0207688_10000116 | 3300025901 | Bacteria | 32495 |
| 832 | Ga0207680_10017501 | 3300025903 | Bacteria | 3788 |
| 833 | Ga0207647_10001462 | 3300025904 | Bacteria | 18164 |
| 834 | Ga0207647_10001869 | 3300025904 | Bacteria | 16121 |
| 835 | Ga0207647_10006674 | 3300025904 | Bacteria | 8386 |
| 836 | Ga0207647_10008408 | 3300025904 | Bacteria | 7401 |
| 837 | Ga0207647_10015485 | 3300025904 | Bacteria | 5225 |
| 838 | Ga0207647_10050884 | 3300025904 | Bacteria | 2563 |
| 839 | Ga0207647_10064672 | 3300025904 | Bacteria | 2222 |
| 840 | Ga0207699_10007949 | 3300025906 | Bacteria | 5205 |
| 841 | Ga0207645_10000751 | 3300025907 | Bacteria | 26990 |
| 842 | Ga0207645_10049349 | 3300025907 | Bacteria | 2687 |
| 843 | Ga0207643_10000178 | 3300025908 | Bacteria | 43423 |
| 844 | Ga0207643_10073745 | 3300025908 | Bacteria | 1968 |
| 845 | Ga0207705_10000003 | 3300025909 | Bacteria | 709270 |
| 846 | Ga0207705_10000131 | 3300025909 | Bacteria | 81639 |
| 847 | Ga0207705_10000146 | 3300025909 | Bacteria | 75353 |
| 848 | Ga0207705_10003397 | 3300025909 | Bacteria | 12105 |
| 849 | Ga0207705_10003406 | 3300025909 | Bacteria | 12091 |
| 850 | Ga0207705_10003729 | 3300025909 | Bacteria | 11600 |
| 851 | Ga0207705_10005607 | 3300025909 | Bacteria | 9379 |
| 852 | Ga0207705_10007205 | 3300025909 | Bacteria | 8191 |
| 853 | Ga0207705_10008024 | 3300025909 | Bacteria | 7740 |
| 854 | Ga0207705_10008884 | 3300025909 | Bacteria | 7323 |
| 855 | Ga0207705_10020214 | 3300025909 | Bacteria | 4763 |
| 856 | Ga0207705_10033292 | 3300025909 | Bacteria | 3681 |
| 857 | Ga0207705_10061477 | 3300025909 | Bacteria | 2713 |
| 858 | Ga0207705_10075461 | 3300025909 | Bacteria | 2449 |
| 859 | Ga0207705_10097427 | 3300025909 | Bacteria | 2160 |
| 860 | Ga0207654_10012458 | 3300025911 | Bacteria | 4357 |
| 861 | Ga0207654_10107726 | 3300025911 | Bacteria | 1728 |
| 862 | Ga0207654_10192013 | 3300025911 | Bacteria | 1339 |
| 863 | Ga0207707_10000168 | 3300025912 | Bacteria | 68834 |
| 864 | Ga0207707_10000215 | 3300025912 | Bacteria | 61846 |
| 865 | Ga0207707_10006842 | 3300025912 | Bacteria | 9942 |
| 866 | Ga0207707_10006998 | 3300025912 | Bacteria | 9840 |
| 867 | Ga0207707_10014027 | 3300025912 | Bacteria | 6986 |
| 868 | Ga0207707_10014706 | 3300025912 | Bacteria | 6819 |
| 869 | Ga0207707_10033686 | 3300025912 | Bacteria | 4482 |
| 870 | Ga0207707_10036106 | 3300025912 | Bacteria | 4322 |
| 871 | Ga0207707_10078805 | 3300025912 | Bacteria | 2877 |
| 872 | Ga0207707_10110001 | 3300025912 | Bacteria | 2408 |
| 873 | Ga0207707_10170473 | 3300025912 | Bacteria | 1902 |
| 874 | Ga0207707_10238315 | 3300025912 | Bacteria | 1582 |
| 875 | Ga0207695_10001113 | 3300025913 | Bacteria | 46732 |
| 876 | Ga0207695_10001799 | 3300025913 | Bacteria | 33835 |
| 877 | Ga0207695_10006878 | 3300025913 | Bacteria | 14637 |
| 878 | Ga0207695_10015367 | 3300025913 | Bacteria | 9013 |
| 879 | Ga0207695_10022510 | 3300025913 | Bacteria | 7151 |
| 880 | Ga0207695_10027319 | 3300025913 | Bacteria | 6357 |
| 881 | Ga0207695_10030192 | 3300025913 | Bacteria | 5971 |
| 882 | Ga0207695_10035912 | 3300025913 | Bacteria | 5365 |
| 883 | Ga0207695_10148734 | 3300025913 | Bacteria | 2283 |
| 884 | Ga0207695_10159823 | 3300025913 | Bacteria | 2185 |
| 885 | Ga0207695_10163005 | 3300025913 | Bacteria | 2160 |
| 886 | Ga0207695_10165850 | 3300025913 | Bacteria | 2137 |
| 887 | Ga0207695_10166453 | 3300025913 | Bacteria | 2132 |
| 888 | Ga0207671_10021180 | 3300025914 | Bacteria | 4938 |
| 889 | Ga0207671_10136168 | 3300025914 | Bacteria | 1888 |
| 890 | Ga0207671_10213308 | 3300025914 | Bacteria | 1511 |
| 891 | Ga0207671_10217718 | 3300025914 | Bacteria | 1495 |
| 892 | Ga0207693_10067411 | 3300025915 | Bacteria | 2802 |
| 893 | Ga0207693_10206708 | 3300025915 | Bacteria | 1543 |
| 894 | Ga0207660_10000227 | 3300025917 | Bacteria | 36209 |
| 895 | Ga0207660_10002134 | 3300025917 | Bacteria | 13125 |
| 896 | Ga0207660_10003818 | 3300025917 | Bacteria | 9817 |
| 897 | Ga0207660_10004969 | 3300025917 | Bacteria | 8668 |
| 898 | Ga0207660_10005823 | 3300025917 | Bacteria | 7997 |
| 899 | Ga0207660_10017556 | 3300025917 | Bacteria | 4756 |
| 900 | Ga0207660_10083176 | 3300025917 | Bacteria | 2356 |
| 901 | Ga0207660_10117507 | 3300025917 | Bacteria | 2010 |
| 902 | Ga0207660_10139263 | 3300025917 | Bacteria | 1854 |
| 903 | Ga0207662_10015909 | 3300025918 | Bacteria | 4238 |
| 904 | Ga0207657_10000003 | 3300025919 | Bacteria | 263148 |
| 905 | Ga0207657_10001611 | 3300025919 | Bacteria | 24269 |
| 906 | Ga0207657_10001988 | 3300025919 | Bacteria | 22083 |
| 907 | Ga0207657_10005362 | 3300025919 | Bacteria | 13431 |
| 908 | Ga0207657_10006429 | 3300025919 | Bacteria | 12187 |
| 909 | Ga0207657_10006601 | 3300025919 | Bacteria | 12014 |
| 910 | Ga0207657_10007281 | 3300025919 | Bacteria | 11357 |
| 911 | Ga0207657_10008053 | 3300025919 | Bacteria | 10745 |
| 912 | Ga0207657_10009315 | 3300025919 | Bacteria | 9889 |
| 913 | Ga0207657_10009409 | 3300025919 | Bacteria | 9822 |
| 914 | Ga0207657_10011673 | 3300025919 | Bacteria | 8707 |
| 915 | Ga0207657_10015108 | 3300025919 | Bacteria | 7499 |
| 916 | Ga0207657_10043281 | 3300025919 | Bacteria | 3968 |
| 917 | Ga0207657_10119040 | 3300025919 | Bacteria | 2174 |
| 918 | Ga0207657_10169956 | 3300025919 | Bacteria | 1767 |
| 919 | Ga0207657_10174880 | 3300025919 | Bacteria | 1738 |
| 920 | Ga0207657_10182020 | 3300025919 | Bacteria | 1698 |
| 921 | Ga0207657_10342971 | 3300025919 | Bacteria | 1179 |
| 922 | Ga0207649_10000589 | 3300025920 | Bacteria | 24693 |
| 923 | Ga0207649_10001798 | 3300025920 | Bacteria | 12268 |
| 924 | Ga0207649_10003120 | 3300025920 | Bacteria | 9093 |
| 925 | Ga0207649_10022398 | 3300025920 | Bacteria | 3649 |
| 926 | Ga0207649_10029248 | 3300025920 | Bacteria | 3253 |
| 927 | Ga0207649_10030793 | 3300025920 | Bacteria | 3182 |
| 928 | Ga0207649_10054677 | 3300025920 | Bacteria | 2485 |
| 929 | Ga0207649_10056667 | 3300025920 | Bacteria | 2448 |
| 930 | Ga0207649_10060806 | 3300025920 | Bacteria | 2375 |
| 931 | Ga0207649_10173575 | 3300025920 | Bacteria | 1503 |
| 932 | Ga0207652_10000158 | 3300025921 | Bacteria | 73781 |
| 933 | Ga0207652_10000282 | 3300025921 | Bacteria | 52954 |
| 934 | Ga0207652_10000956 | 3300025921 | Bacteria | 27067 |
| 935 | Ga0207652_10004584 | 3300025921 | Bacteria | 11210 |
| 936 | Ga0207652_10005330 | 3300025921 | Bacteria | 10426 |
| 937 | Ga0207652_10007449 | 3300025921 | Bacteria | 8819 |
| 938 | Ga0207652_10012340 | 3300025921 | Bacteria | 6903 |
| 939 | Ga0207652_10028196 | 3300025921 | Bacteria | 4683 |
| 940 | Ga0207652_10061330 | 3300025921 | Bacteria | 3247 |
| 941 | Ga0207652_10094510 | 3300025921 | Bacteria | 2632 |
| 942 | Ga0207652_10129621 | 3300025921 | Bacteria | 2249 |
| 943 | Ga0207652_10247259 | 3300025921 | Bacteria | 1608 |
| 944 | Ga0207652_10277873 | 3300025921 | Bacteria | 1511 |
| 945 | Ga0207681_10007817 | 3300025923 | Bacteria | 6550 |
| 946 | Ga0207681_10022395 | 3300025923 | Bacteria | 4030 |
| 947 | Ga0207681_10045690 | 3300025923 | Bacteria | 2942 |
| 948 | Ga0207681_10050848 | 3300025923 | Bacteria | 2805 |
| 949 | Ga0207681_10084941 | 3300025923 | Bacteria | 2245 |
| 950 | Ga0207681_10136124 | 3300025923 | Bacteria | 1823 |
| 951 | Ga0207681_10137195 | 3300025923 | Bacteria | 1817 |
| 952 | Ga0207694_10002683 | 3300025924 | Bacteria | 14405 |
| 953 | Ga0207694_10005613 | 3300025924 | Bacteria | 9616 |
| 954 | Ga0207694_10008293 | 3300025924 | Bacteria | 7854 |
| 955 | Ga0207694_10024724 | 3300025924 | Bacteria | 4563 |
| 956 | Ga0207694_10062475 | 3300025924 | Bacteria | 2900 |
| 957 | Ga0207694_10138033 | 3300025924 | Bacteria | 1959 |
| 958 | Ga0207694_10175408 | 3300025924 | Bacteria | 1737 |
| 959 | Ga0207694_10195737 | 3300025924 | Bacteria | 1643 |
| 960 | Ga0207694_10203323 | 3300025924 | Bacteria | 1612 |
| 961 | Ga0207650_10000003 | 3300025925 | Bacteria | 1123235 |
| 962 | Ga0207650_10002909 | 3300025925 | Bacteria | 11821 |
| 963 | Ga0207650_10008403 | 3300025925 | Bacteria | 7047 |
| 964 | Ga0207650_10032987 | 3300025925 | Bacteria | 3748 |
| 965 | Ga0207650_10033415 | 3300025925 | Bacteria | 3725 |
| 966 | Ga0207650_10055555 | 3300025925 | Bacteria | 2939 |
| 967 | Ga0207650_10105568 | 3300025925 | Bacteria | 2175 |
| 968 | Ga0207650_10185133 | 3300025925 | Bacteria | 1661 |
| 969 | Ga0207650_10318920 | 3300025925 | Bacteria | 1272 |
| 970 | Ga0207650_10413278 | 3300025925 | Bacteria | 1118 |
| 971 | Ga0207659_10004458 | 3300025926 | Bacteria | 8474 |
| 972 | Ga0207659_10017662 | 3300025926 | Bacteria | 4662 |
| 973 | Ga0207659_10202659 | 3300025926 | Bacteria | 1586 |
| 974 | Ga0207687_10000298 | 3300025927 | Bacteria | 33998 |
| 975 | Ga0207687_10061436 | 3300025927 | Bacteria | 2654 |
| 976 | Ga0207700_10030366 | 3300025928 | Bacteria | 3827 |
| 977 | Ga0207700_10033041 | 3300025928 | Bacteria | 3699 |
| 978 | Ga0207700_10059559 | 3300025928 | Bacteria | 2888 |
| 979 | Ga0207700_10154748 | 3300025928 | Bacteria | 1898 |
| 980 | Ga0207700_10232598 | 3300025928 | Bacteria | 1568 |
| 981 | Ga0207700_10499686 | 3300025928 | Bacteria | 1076 |
| 982 | Ga0207664_10000036 | 3300025929 | Bacteria | 173396 |
| 983 | Ga0207664_10001394 | 3300025929 | Bacteria | 15882 |
| 984 | Ga0207664_10011395 | 3300025929 | Bacteria | 6318 |
| 985 | Ga0207664_10015374 | 3300025929 | Bacteria | 5552 |
| 986 | Ga0207664_10029328 | 3300025929 | Bacteria | 4190 |
| 987 | Ga0207664_10051411 | 3300025929 | Bacteria | 3253 |
| 988 | Ga0207664_10260182 | 3300025929 | Bacteria | 1517 |
| 989 | Ga0207644_10000055 | 3300025931 | Bacteria | 84281 |
| 990 | Ga0207644_10000272 | 3300025931 | Bacteria | 34285 |
| 991 | Ga0207644_10003350 | 3300025931 | Bacteria | 10337 |
| 992 | Ga0207644_10050006 | 3300025931 | Bacteria | 2995 |
| 993 | Ga0207644_10081484 | 3300025931 | Bacteria | 2391 |
| 994 | Ga0207644_10095215 | 3300025931 | Bacteria | 2226 |
| 995 | Ga0207644_10117940 | 3300025931 | Bacteria | 2016 |
| 996 | Ga0207644_10216232 | 3300025931 | Bacteria | 1517 |
| 997 | Ga0207644_10233212 | 3300025931 | Bacteria | 1463 |
| 998 | Ga0207690_10000007 | 3300025932 | Bacteria | 388533 |
| 999 | Ga0207690_10000839 | 3300025932 | Bacteria | 19670 |
| 1000 | Ga0207690_10000957 | 3300025932 | Bacteria | 18474 |
| 1001 | Ga0207690_10001891 | 3300025932 | Bacteria | 12848 |
| 1002 | Ga0207690_10002067 | 3300025932 | Bacteria | 12299 |
| 1003 | Ga0207690_10002972 | 3300025932 | Bacteria | 10206 |
| 1004 | Ga0207690_10004750 | 3300025932 | Bacteria | 8019 |
| 1005 | Ga0207690_10016359 | 3300025932 | Bacteria | 4510 |
| 1006 | Ga0207690_10041918 | 3300025932 | Bacteria | 3003 |
| 1007 | Ga0207690_10121720 | 3300025932 | Bacteria | 1897 |
| 1008 | Ga0207690_10197854 | 3300025932 | Bacteria | 1524 |
| 1009 | Ga0207690_10372173 | 3300025932 | Bacteria | 1133 |
| 1010 | Ga0207706_10000267 | 3300025933 | Bacteria | 56832 |
| 1011 | Ga0207706_10004822 | 3300025933 | Bacteria | 12636 |
| 1012 | Ga0207706_10007955 | 3300025933 | Bacteria | 9789 |
| 1013 | Ga0207706_10022681 | 3300025933 | Bacteria | 5635 |
| 1014 | Ga0207706_10117762 | 3300025933 | Bacteria | 2336 |
| 1015 | Ga0207706_10267750 | 3300025933 | Bacteria | 1491 |
| 1016 | Ga0207709_10002291 | 3300025935 | Bacteria | 12149 |
| 1017 | Ga0207709_10101806 | 3300025935 | Bacteria | 1900 |
| 1018 | Ga0207709_10372408 | 3300025935 | Bacteria | 1084 |
| 1019 | Ga0207670_10000036 | 3300025936 | Bacteria | 106829 |
| 1020 | Ga0207670_10017186 | 3300025936 | Bacteria | 4368 |
| 1021 | Ga0207670_10028630 | 3300025936 | Bacteria | 3540 |
| 1022 | Ga0207670_10033733 | 3300025936 | Bacteria | 3301 |
| 1023 | Ga0207670_10037814 | 3300025936 | Bacteria | 3148 |
| 1024 | Ga0207669_10061952 | 3300025937 | Bacteria | 2301 |
| 1025 | Ga0207669_10083924 | 3300025937 | Bacteria | 2050 |
| 1026 | Ga0207704_10125238 | 3300025938 | Bacteria | 1768 |
| 1027 | Ga0207665_10056330 | 3300025939 | Bacteria | 2653 |
| 1028 | Ga0207665_10073092 | 3300025939 | Bacteria | 2344 |
| 1029 | Ga0207691_10010387 | 3300025940 | Bacteria | 8932 |
| 1030 | Ga0207691_10011417 | 3300025940 | Bacteria | 8523 |
| 1031 | Ga0207691_10013709 | 3300025940 | Bacteria | 7745 |
| 1032 | Ga0207691_10019796 | 3300025940 | Bacteria | 6366 |
| 1033 | Ga0207691_10020605 | 3300025940 | Bacteria | 6234 |
| 1034 | Ga0207691_10045931 | 3300025940 | Bacteria | 4015 |
| 1035 | Ga0207691_10052482 | 3300025940 | Bacteria | 3724 |
| 1036 | Ga0207691_10131637 | 3300025940 | Bacteria | 2209 |
| 1037 | Ga0207711_10000855 | 3300025941 | Bacteria | 29447 |
| 1038 | Ga0207711_10000945 | 3300025941 | Bacteria | 27919 |
| 1039 | Ga0207711_10013434 | 3300025941 | Bacteria | 6802 |
| 1040 | Ga0207711_10013551 | 3300025941 | Bacteria | 6770 |
| 1041 | Ga0207711_10022316 | 3300025941 | Bacteria | 5292 |
| 1042 | Ga0207711_10070317 | 3300025941 | Bacteria | 3035 |
| 1043 | Ga0207711_10287045 | 3300025941 | Bacteria | 1516 |
| 1044 | Ga0207689_10000289 | 3300025942 | Bacteria | 45719 |
| 1045 | Ga0207689_10046883 | 3300025942 | Bacteria | 3570 |
| 1046 | Ga0207689_10118439 | 3300025942 | Bacteria | 2178 |
| 1047 | Ga0207689_10265165 | 3300025942 | Bacteria | 1421 |
| 1048 | Ga0207661_10009656 | 3300025944 | Bacteria | 6928 |
| 1049 | Ga0207661_10030731 | 3300025944 | Bacteria | 4140 |
| 1050 | Ga0207661_10143425 | 3300025944 | Bacteria | 2058 |
| 1051 | Ga0207661_10313935 | 3300025944 | Bacteria | 1408 |
| 1052 | Ga0207679_10000467 | 3300025945 | Bacteria | 28304 |
| 1053 | Ga0207679_10004621 | 3300025945 | Bacteria | 8574 |
| 1054 | Ga0207679_10007563 | 3300025945 | Bacteria | 6897 |
| 1055 | Ga0207679_10023274 | 3300025945 | Bacteria | 4232 |
| 1056 | Ga0207679_10034382 | 3300025945 | Bacteria | 3575 |
| 1057 | Ga0207679_10043417 | 3300025945 | Bacteria | 3237 |
| 1058 | Ga0207679_10088413 | 3300025945 | Bacteria | 2389 |
| 1059 | Ga0207679_10182615 | 3300025945 | Bacteria | 1737 |
| 1060 | Ga0207667_10000007 | 3300025949 | Bacteria | 630590 |
| 1061 | Ga0207667_10000586 | 3300025949 | Bacteria | 47384 |
| 1062 | Ga0207667_10001159 | 3300025949 | Bacteria | 33115 |
| 1063 | Ga0207667_10001393 | 3300025949 | Bacteria | 30322 |
| 1064 | Ga0207667_10003714 | 3300025949 | Bacteria | 18825 |
| 1065 | Ga0207667_10005210 | 3300025949 | Bacteria | 15866 |
| 1066 | Ga0207667_10014484 | 3300025949 | Bacteria | 8988 |
| 1067 | Ga0207667_10016531 | 3300025949 | Bacteria | 8334 |
| 1068 | Ga0207667_10020707 | 3300025949 | Bacteria | 7309 |
| 1069 | Ga0207667_10022920 | 3300025949 | Bacteria | 6883 |
| 1070 | Ga0207667_10023090 | 3300025949 | Bacteria | 6853 |
| 1071 | Ga0207667_10032515 | 3300025949 | Bacteria | 5620 |
| 1072 | Ga0207667_10058758 | 3300025949 | Bacteria | 4032 |
| 1073 | Ga0207667_10091006 | 3300025949 | Bacteria | 3152 |
| 1074 | Ga0207667_10099628 | 3300025949 | Bacteria | 2998 |
| 1075 | Ga0207667_10104865 | 3300025949 | Bacteria | 2916 |
| 1076 | Ga0207667_10114164 | 3300025949 | Bacteria | 2784 |
| 1077 | Ga0207667_10118201 | 3300025949 | Bacteria | 2732 |
| 1078 | Ga0207667_10288238 | 3300025949 | Bacteria | 1678 |
| 1079 | Ga0207667_10350065 | 3300025949 | Bacteria | 1507 |
| 1080 | Ga0207667_10408828 | 3300025949 | Bacteria | 1382 |
| 1081 | Ga0207651_10001867 | 3300025960 | Bacteria | 9849 |
| 1082 | Ga0207651_10031395 | 3300025960 | Bacteria | 3395 |
| 1083 | Ga0207651_10039497 | 3300025960 | Bacteria | 3113 |
| 1084 | Ga0207651_10056704 | 3300025960 | Bacteria | 2697 |
| 1085 | Ga0207651_10087761 | 3300025960 | Bacteria | 2265 |
| 1086 | Ga0207651_10090027 | 3300025960 | Bacteria | 2242 |
| 1087 | Ga0207712_10003682 | 3300025961 | Bacteria | 9667 |
| 1088 | Ga0207712_10074461 | 3300025961 | Bacteria | 2452 |
| 1089 | Ga0207712_10096205 | 3300025961 | Bacteria | 2191 |
| 1090 | Ga0207668_10039433 | 3300025972 | Bacteria | 3179 |
| 1091 | Ga0207668_10059489 | 3300025972 | Bacteria | 2677 |
| 1092 | Ga0207668_10240923 | 3300025972 | Bacteria | 1463 |
| 1093 | Ga0207640_10000291 | 3300025981 | Bacteria | 33599 |
| 1094 | Ga0207640_10002225 | 3300025981 | Bacteria | 10440 |
| 1095 | Ga0207640_10003065 | 3300025981 | Bacteria | 9004 |
| 1096 | Ga0207640_10004131 | 3300025981 | Bacteria | 7839 |
| 1097 | Ga0207640_10004350 | 3300025981 | Bacteria | 7673 |
| 1098 | Ga0207640_10006559 | 3300025981 | Bacteria | 6390 |
| 1099 | Ga0207640_10006932 | 3300025981 | Bacteria | 6233 |
| 1100 | Ga0207640_10017678 | 3300025981 | Bacteria | 4176 |
| 1101 | Ga0207640_10101615 | 3300025981 | Bacteria | 2018 |
| 1102 | Ga0207640_10132263 | 3300025981 | Bacteria | 1805 |
| 1103 | Ga0207658_10000004 | 3300025986 | Bacteria | 569357 |
| 1104 | Ga0207658_10000640 | 3300025986 | Bacteria | 30799 |
| 1105 | Ga0207658_10002188 | 3300025986 | Bacteria | 14529 |
| 1106 | Ga0207658_10025984 | 3300025986 | Bacteria | 4102 |
| 1107 | Ga0207658_10190401 | 3300025986 | Bacteria | 1705 |
| 1108 | Ga0207658_10192318 | 3300025986 | Bacteria | 1697 |
| 1109 | Ga0207658_10276021 | 3300025986 | Bacteria | 1439 |
| 1110 | Ga0207677_10053833 | 3300026023 | Bacteria | 2742 |
| 1111 | Ga0207677_10070786 | 3300026023 | Bacteria | 2459 |
| 1112 | Ga0207677_10120548 | 3300026023 | Bacteria | 1972 |
| 1113 | Ga0207677_10177041 | 3300026023 | Bacteria | 1674 |
| 1114 | Ga0207703_10131295 | 3300026035 | Bacteria | 2163 |
| 1115 | Ga0207639_10003451 | 3300026041 | Bacteria | 10637 |
| 1116 | Ga0207639_10003476 | 3300026041 | Bacteria | 10601 |
| 1117 | Ga0207639_10009437 | 3300026041 | Bacteria | 6733 |
| 1118 | Ga0207639_10030575 | 3300026041 | Bacteria | 3950 |
| 1119 | Ga0207639_10065211 | 3300026041 | Bacteria | 2826 |
| 1120 | Ga0207639_10070898 | 3300026041 | Bacteria | 2724 |
| 1121 | Ga0207639_10074999 | 3300026041 | Bacteria | 2658 |
| 1122 | Ga0207639_10171253 | 3300026041 | Bacteria | 1839 |
| 1123 | Ga0207639_10171553 | 3300026041 | Bacteria | 1837 |
| 1124 | Ga0207639_10181683 | 3300026041 | Bacteria | 1790 |
| 1125 | Ga0207639_10246362 | 3300026041 | Bacteria | 1556 |
| 1126 | Ga0207639_10301140 | 3300026041 | Bacteria | 1417 |
| 1127 | Ga0207678_10000160 | 3300026067 | Bacteria | 55960 |
| 1128 | Ga0207678_10001430 | 3300026067 | Bacteria | 21888 |
| 1129 | Ga0207678_10001471 | 3300026067 | Bacteria | 21592 |
| 1130 | Ga0207678_10001480 | 3300026067 | Bacteria | 21540 |
| 1131 | Ga0207678_10001640 | 3300026067 | Bacteria | 20513 |
| 1132 | Ga0207678_10001768 | 3300026067 | Bacteria | 19781 |
| 1133 | Ga0207678_10004079 | 3300026067 | Bacteria | 13138 |
| 1134 | Ga0207678_10005267 | 3300026067 | Bacteria | 11583 |
| 1135 | Ga0207678_10006377 | 3300026067 | Bacteria | 10473 |
| 1136 | Ga0207678_10007045 | 3300026067 | Bacteria | 9983 |
| 1137 | Ga0207678_10027423 | 3300026067 | Bacteria | 4968 |
| 1138 | Ga0207678_10048833 | 3300026067 | Bacteria | 3657 |
| 1139 | Ga0207678_10092102 | 3300026067 | Bacteria | 2591 |
| 1140 | Ga0207678_10149634 | 3300026067 | Bacteria | 1993 |
| 1141 | Ga0207678_10232695 | 3300026067 | Bacteria | 1578 |
| 1142 | Ga0207678_10238032 | 3300026067 | Bacteria | 1559 |
| 1143 | Ga0207678_10353405 | 3300026067 | Bacteria | 1267 |
| 1144 | Ga0207708_10000668 | 3300026075 | Bacteria | 26303 |
| 1145 | Ga0207708_10017052 | 3300026075 | Bacteria | 5466 |
| 1146 | Ga0207708_10041195 | 3300026075 | Bacteria | 3521 |
| 1147 | Ga0207708_10119680 | 3300026075 | Bacteria | 2051 |
| 1148 | Ga0207702_10000128 | 3300026078 | Bacteria | 89386 |
| 1149 | Ga0207702_10000244 | 3300026078 | Bacteria | 63493 |
| 1150 | Ga0207702_10000432 | 3300026078 | Bacteria | 47878 |
| 1151 | Ga0207702_10001083 | 3300026078 | Bacteria | 27889 |
| 1152 | Ga0207702_10001776 | 3300026078 | Bacteria | 21223 |
| 1153 | Ga0207702_10002471 | 3300026078 | Bacteria | 17479 |
| 1154 | Ga0207702_10002683 | 3300026078 | Bacteria | 16707 |
| 1155 | Ga0207702_10004484 | 3300026078 | Bacteria | 12390 |
| 1156 | Ga0207702_10008817 | 3300026078 | Bacteria | 8502 |
| 1157 | Ga0207702_10020180 | 3300026078 | Bacteria | 5519 |
| 1158 | Ga0207702_10026919 | 3300026078 | Bacteria | 4775 |
| 1159 | Ga0207702_10142809 | 3300026078 | Bacteria | 2168 |
| 1160 | Ga0207702_10144806 | 3300026078 | Bacteria | 2155 |
| 1161 | Ga0207702_10290341 | 3300026078 | Bacteria | 1549 |
| 1162 | Ga0207702_10311971 | 3300026078 | Bacteria | 1496 |
| 1163 | Ga0207641_10012760 | 3300026088 | Bacteria | 6887 |
| 1164 | Ga0207641_10025413 | 3300026088 | Bacteria | 4883 |
| 1165 | Ga0207641_10029638 | 3300026088 | Bacteria | 4526 |
| 1166 | Ga0207641_10041063 | 3300026088 | Bacteria | 3876 |
| 1167 | Ga0207641_10052892 | 3300026088 | Bacteria | 3440 |
| 1168 | Ga0207641_10055781 | 3300026088 | Bacteria | 3355 |
| 1169 | Ga0207641_10077897 | 3300026088 | Bacteria | 2870 |
| 1170 | Ga0207641_10118221 | 3300026088 | Bacteria | 2361 |
| 1171 | Ga0207641_10134443 | 3300026088 | Bacteria | 2224 |
| 1172 | Ga0207641_10203206 | 3300026088 | Bacteria | 1828 |
| 1173 | Ga0207641_10347728 | 3300026088 | Bacteria | 1412 |
| 1174 | Ga0207648_10002794 | 3300026089 | Bacteria | 18520 |
| 1175 | Ga0207648_10028635 | 3300026089 | Bacteria | 4938 |
| 1176 | Ga0207648_10040163 | 3300026089 | Bacteria | 4112 |
| 1177 | Ga0207648_10083374 | 3300026089 | Bacteria | 2788 |
| 1178 | Ga0207648_10202405 | 3300026089 | Bacteria | 1761 |
| 1179 | Ga0207648_10244865 | 3300026089 | Bacteria | 1597 |
| 1180 | Ga0207648_10312090 | 3300026089 | Bacteria | 1412 |
| 1181 | Ga0207648_10378584 | 3300026089 | Bacteria | 1279 |
| 1182 | Ga0207676_10000003 | 3300026095 | Bacteria | 1123235 |
| 1183 | Ga0207676_10002722 | 3300026095 | Bacteria | 12578 |
| 1184 | Ga0207676_10017485 | 3300026095 | Bacteria | 5197 |
| 1185 | Ga0207676_10048100 | 3300026095 | Bacteria | 3309 |
| 1186 | Ga0207676_10105712 | 3300026095 | Bacteria | 2344 |
| 1187 | Ga0207676_10115176 | 3300026095 | Bacteria | 2256 |
| 1188 | Ga0207676_10207077 | 3300026095 | Bacteria | 1737 |
| 1189 | Ga0207676_10211234 | 3300026095 | Bacteria | 1722 |
| 1190 | Ga0207676_10273043 | 3300026095 | Bacteria | 1532 |
| 1191 | Ga0207674_10000039 | 3300026116 | Bacteria | 131096 |
| 1192 | Ga0207674_10003404 | 3300026116 | Bacteria | 19500 |
| 1193 | Ga0207674_10004794 | 3300026116 | Bacteria | 16214 |
| 1194 | Ga0207674_10005001 | 3300026116 | Bacteria | 15848 |
| 1195 | Ga0207674_10005506 | 3300026116 | Bacteria | 15034 |
| 1196 | Ga0207674_10007751 | 3300026116 | Bacteria | 12493 |
| 1197 | Ga0207674_10008565 | 3300026116 | Bacteria | 11793 |
| 1198 | Ga0207674_10011756 | 3300026116 | Bacteria | 9821 |
| 1199 | Ga0207674_10041750 | 3300026116 | Bacteria | 4742 |
| 1200 | Ga0207674_10051162 | 3300026116 | Bacteria | 4216 |
| 1201 | Ga0207674_10088975 | 3300026116 | Bacteria | 3080 |
| 1202 | Ga0207674_10154524 | 3300026116 | Bacteria | 2250 |
| 1203 | Ga0207675_100003529 | 3300026118 | Bacteria | 15257 |
| 1204 | Ga0207675_100007814 | 3300026118 | Bacteria | 10092 |
| 1205 | Ga0207675_100037403 | 3300026118 | Bacteria | 4527 |
| 1206 | Ga0207675_100045722 | 3300026118 | Bacteria | 4090 |
| 1207 | Ga0207675_100056446 | 3300026118 | Bacteria | 3663 |
| 1208 | Ga0207675_100153901 | 3300026118 | Bacteria | 2190 |
| 1209 | Ga0207675_100161405 | 3300026118 | Bacteria | 2138 |
| 1210 | Ga0207675_100185942 | 3300026118 | Bacteria | 1991 |
| 1211 | Ga0207675_100231854 | 3300026118 | Bacteria | 1781 |
| 1212 | Ga0207683_10003397 | 3300026121 | Bacteria | 13869 |
| 1213 | Ga0207683_10004053 | 3300026121 | Bacteria | 12661 |
| 1214 | Ga0207683_10016296 | 3300026121 | Bacteria | 6325 |
| 1215 | Ga0207683_10028344 | 3300026121 | Bacteria | 4842 |
| 1216 | Ga0207683_10028751 | 3300026121 | Bacteria | 4808 |
| 1217 | Ga0207683_10043033 | 3300026121 | Bacteria | 3944 |
| 1218 | Ga0207683_10145620 | 3300026121 | Bacteria | 2136 |
| 1219 | Ga0207683_10303500 | 3300026121 | Bacteria | 1461 |
| 1220 | Ga0207683_10391103 | 3300026121 | Bacteria | 1278 |
| 1221 | Ga0207698_10000511 | 3300026142 | Bacteria | 22568 |
| 1222 | Ga0207698_10000772 | 3300026142 | Bacteria | 18637 |
| 1223 | Ga0207698_10002291 | 3300026142 | Bacteria | 11337 |
| 1224 | Ga0207698_10005977 | 3300026142 | Bacteria | 7563 |
| 1225 | Ga0207698_10007308 | 3300026142 | Bacteria | 6923 |
| 1226 | Ga0207698_10011617 | 3300026142 | Bacteria | 5719 |
| 1227 | Ga0207698_10014360 | 3300026142 | Bacteria | 5262 |
| 1228 | Ga0207698_10038140 | 3300026142 | Bacteria | 3547 |
| 1229 | Ga0207698_10044515 | 3300026142 | Bacteria | 3336 |
| 1230 | Ga0207698_10165669 | 3300026142 | Bacteria | 1939 |
| 1231 | Ga0207698_10271249 | 3300026142 | Bacteria | 1564 |
| 1232 | Ga0209371_1000402 | 3300027312 | Bacteria | 45205 |
| 1233 | Ga0209969_1002467 | 3300027360 | Bacteria | 2558 |
| 1234 | Ga0209969_1004138 | 3300027360 | Bacteria | 2030 |
| 1235 | Ga0209984_1006643 | 3300027424 | Bacteria | 1423 |
| 1236 | Ga0210000_1002839 | 3300027462 | Bacteria | 2473 |
| 1237 | Ga0209179_1001067 | 3300027512 | Bacteria | 3176 |
| 1238 | Ga0209968_1004405 | 3300027526 | Bacteria | 2113 |
| 1239 | Ga0209999_1000831 | 3300027543 | Bacteria | 5109 |
| 1240 | Ga0209999_1024095 | 3300027543 | Bacteria | 1122 |
| 1241 | Ga0209982_1002696 | 3300027552 | Bacteria | 2499 |
| 1242 | Ga0209970_1007495 | 3300027614 | Bacteria | 1789 |
| 1243 | Ga0210002_1009435 | 3300027617 | Bacteria | 1489 |
| 1244 | Ga0209983_1029795 | 3300027665 | Bacteria | 1161 |
| 1245 | Ga0209588_1013741 | 3300027671 | Bacteria | 2473 |
| 1246 | Ga0209971_1001096 | 3300027682 | Bacteria | 6876 |
| 1247 | Ga0209971_1001702 | 3300027682 | Bacteria | 5417 |
| 1248 | Ga0209971_1005689 | 3300027682 | Bacteria | 2956 |
| 1249 | Ga0209966_1002408 | 3300027695 | Bacteria | 3120 |
| 1250 | Ga0209974_10002606 | 3300027876 | Bacteria | 6548 |
| 1251 | Ga0209974_10009957 | 3300027876 | Bacteria | 3215 |
| 1252 | Ga0209974_10014357 | 3300027876 | Bacteria | 2636 |
| 1253 | Ga0209974_10014761 | 3300027876 | Bacteria | 2595 |
| 1254 | Ga0207428_10051032 | 3300027907 | Bacteria | 3307 |
| 1255 | Ga0265354_1001901 | 3300028016 | Bacteria | 2777 |
| 1256 | Ga0265356_1000958 | 3300028017 | Bacteria | 4619 |
| 1257 | Ga0265357_1001777 | 3300028023 | Bacteria | 1651 |
| 1258 | Ga0268266_10002350 | 3300028379 | Bacteria | 20457 |
| 1259 | Ga0268266_10006760 | 3300028379 | Bacteria | 10456 |
| 1260 | Ga0268266_10021331 | 3300028379 | Bacteria | 5519 |
| 1261 | Ga0268266_10030898 | 3300028379 | Bacteria | 4548 |
| 1262 | Ga0268266_10081031 | 3300028379 | Bacteria | 2829 |
| 1263 | Ga0268266_10364862 | 3300028379 | Bacteria | 1360 |
| 1264 | Ga0268265_10000166 | 3300028380 | Bacteria | 80256 |
| 1265 | Ga0268265_10004150 | 3300028380 | Bacteria | 10158 |
| 1266 | Ga0268265_10115159 | 3300028380 | Bacteria | 2203 |
| 1267 | Ga0268264_10000016 | 3300028381 | Bacteria | 502537 |
| 1268 | Ga0268264_10030656 | 3300028381 | Bacteria | 4408 |
| 1269 | Ga0268264_10036457 | 3300028381 | Bacteria | 4052 |
| 1270 | Ga0268264_10111651 | 3300028381 | Bacteria | 2395 |
| 1271 | Ga0268264_10150826 | 3300028381 | Bacteria | 2084 |
| 1272 | Ga0265334_10033440 | 3300028573 | Bacteria | 2047 |
| 1273 | Ga0265336_10000008 | 3300028666 | Bacteria | 336082 |
| 1274 | Ga0307517_10036337 | 3300028786 | Bacteria | 5544 |
| 1275 | Ga0307517_10201167 | 3300028786 | Bacteria | 1245 |
| 1276 | Ga0307515_10073692 | 3300028794 | Bacteria | 4583 |
| 1277 | Ga0307515_10131399 | 3300028794 | Bacteria | 2755 |
| 1278 | Ga0265338_10000147 | 3300028800 | Bacteria | 129297 |
| 1279 | Ga0265338_10015253 | 3300028800 | Bacteria | 8463 |
| 1280 | Ga0265338_10168423 | 3300028800 | Bacteria | 1683 |
| 1281 | Ga0268256_1000749 | 3300030500 | Bacteria | 23804 |
| 1282 | Ga0307511_10173324 | 3300030521 | Bacteria | 1180 |
| 1283 | Ga0265760_10000671 | 3300031090 | Bacteria | 9729 |
| 1284 | Ga0265340_10010905 | 3300031247 | Bacteria | 4848 |
| 1285 | Ga0265327_10000546 | 3300031251 | Bacteria | 64262 |
| 1286 | Ga0265327_10022058 | 3300031251 | Bacteria | 3822 |
| 1287 | Ga0265316_10032066 | 3300031344 | Bacteria | 4292 |
| 1288 | Ga0307513_10000013 | 3300031456 | Bacteria | 325682 |
| 1289 | Ga0307513_10000037 | 3300031456 | Bacteria | 175364 |
| 1290 | Ga0307513_10006109 | 3300031456 | Bacteria | 15809 |
| 1291 | Ga0307513_10009214 | 3300031456 | Bacteria | 12495 |
| 1292 | Ga0307513_10009485 | 3300031456 | Bacteria | 12308 |
| 1293 | Ga0307513_10025641 | 3300031456 | Bacteria | 6823 |
| 1294 | Ga0307513_10031639 | 3300031456 | Bacteria | 5988 |
| 1295 | Ga0307513_10126660 | 3300031456 | Bacteria | 2508 |
| 1296 | Ga0307513_10146530 | 3300031456 | Bacteria | 2278 |
| 1297 | Ga0307509_10040026 | 3300031507 | Bacteria | 5100 |
| 1298 | Ga0307509_10067018 | 3300031507 | Bacteria | 3763 |
| 1299 | Ga0307509_10102599 | 3300031507 | Bacteria | 2892 |
| 1300 | Ga0307509_10175361 | 3300031507 | Bacteria | 2017 |
| 1301 | Ga0307408_100016400 | 3300031548 | Bacteria | 4944 |
| 1302 | Ga0307408_100078785 | 3300031548 | Bacteria | 2457 |
| 1303 | Ga0307408_100084695 | 3300031548 | Bacteria | 2378 |
| 1304 | Ga0307408_100090577 | 3300031548 | Bacteria | 2308 |
| 1305 | Ga0307408_100098516 | 3300031548 | Bacteria | 2222 |
| 1306 | Ga0265313_10062816 | 3300031595 | Bacteria | 1734 |
| 1307 | Ga0307508_10010305 | 3300031616 | Bacteria | 8551 |
| 1308 | Ga0307508_10034874 | 3300031616 | Bacteria | 4534 |
| 1309 | Ga0316575_10016265 | 3300031665 | Bacteria | 2813 |
| 1310 | Ga0316575_10089516 | 3300031665 | Bacteria | 1246 |
| 1311 | Ga0265342_10000896 | 3300031712 | Bacteria | 29642 |
| 1312 | Ga0316576_10010553 | 3300031727 | Bacteria | 6008 |
| 1313 | Ga0316576_10125990 | 3300031727 | Bacteria | 1925 |
| 1314 | Ga0316576_10183694 | 3300031727 | Bacteria | 1577 |
| 1315 | Ga0316578_10101146 | 3300031728 | Bacteria | 1728 |
| 1316 | Ga0307516_10011653 | 3300031730 | Bacteria | 9540 |
| 1317 | Ga0307405_10114597 | 3300031731 | Bacteria | 1832 |
| 1318 | Ga0307405_10144803 | 3300031731 | Bacteria | 1662 |
| 1319 | Ga0316577_10035089 | 3300031733 | Bacteria | 2803 |
| 1320 | Ga0316577_10065256 | 3300031733 | Bacteria | 2032 |
| 1321 | Ga0307413_10000338 | 3300031824 | Bacteria | 14792 |
| 1322 | Ga0307413_10004322 | 3300031824 | Bacteria | 6165 |
| 1323 | Ga0307413_10010229 | 3300031824 | Bacteria | 4536 |
| 1324 | Ga0307413_10020874 | 3300031824 | Bacteria | 3494 |
| 1325 | Ga0307413_10065277 | 3300031824 | Bacteria | 2266 |
| 1326 | Ga0307413_10070999 | 3300031824 | Bacteria | 2192 |
| 1327 | Ga0307413_10216233 | 3300031824 | Bacteria | 1396 |
| 1328 | Ga0307410_10033725 | 3300031852 | Bacteria | 3307 |
| 1329 | Ga0307410_10036495 | 3300031852 | Bacteria | 3201 |
| 1330 | Ga0307410_10046331 | 3300031852 | Bacteria | 2900 |
| 1331 | Ga0307410_10053878 | 3300031852 | Bacteria | 2724 |
| 1332 | Ga0307410_10106896 | 3300031852 | Bacteria | 2017 |
| 1333 | Ga0307410_10119677 | 3300031852 | Bacteria | 1918 |
| 1334 | Ga0307410_10152060 | 3300031852 | Bacteria | 1724 |
| 1335 | Ga0307406_10003967 | 3300031901 | Bacteria | 8043 |
| 1336 | Ga0307406_10009035 | 3300031901 | Bacteria | 5573 |
| 1337 | Ga0307406_10022167 | 3300031901 | Bacteria | 3766 |
| 1338 | Ga0307406_10039119 | 3300031901 | Bacteria | 2940 |
| 1339 | Ga0307406_10040688 | 3300031901 | Bacteria | 2891 |
| 1340 | Ga0307406_10045880 | 3300031901 | Bacteria | 2747 |
| 1341 | Ga0307406_10125922 | 3300031901 | Bacteria | 1790 |
| 1342 | Ga0307407_10033693 | 3300031903 | Bacteria | 2797 |
| 1343 | Ga0307407_10047631 | 3300031903 | Bacteria | 2434 |
| 1344 | Ga0307412_10000445 | 3300031911 | Bacteria | 25038 |
| 1345 | Ga0307412_10003289 | 3300031911 | Bacteria | 8965 |
| 1346 | Ga0307412_10006797 | 3300031911 | Bacteria | 6488 |
| 1347 | Ga0307412_10114727 | 3300031911 | Bacteria | 1929 |
| 1348 | Ga0307412_10149165 | 3300031911 | Bacteria | 1723 |
| 1349 | Ga0307412_10152871 | 3300031911 | Bacteria | 1705 |
| 1350 | Ga0307412_10274744 | 3300031911 | Bacteria | 1320 |
| 1351 | Ga0307412_10291024 | 3300031911 | Bacteria | 1286 |
| 1352 | Ga0307409_100002862 | 3300031995 | Bacteria | 9137 |
| 1353 | Ga0307409_100003524 | 3300031995 | Bacteria | 8531 |
| 1354 | Ga0307409_100028252 | 3300031995 | Bacteria | 3992 |
| 1355 | Ga0307409_100060791 | 3300031995 | Bacteria | 2948 |
| 1356 | Ga0307409_100132612 | 3300031995 | Bacteria | 2132 |
| 1357 | Ga0307409_100302238 | 3300031995 | Bacteria | 1489 |
| 1358 | Ga0307416_100009355 | 3300032002 | Bacteria | 6410 |
| 1359 | Ga0307416_100043067 | 3300032002 | Bacteria | 3531 |
| 1360 | Ga0307416_100129481 | 3300032002 | Bacteria | 2268 |
| 1361 | Ga0307416_100201961 | 3300032002 | Bacteria | 1887 |
| 1362 | Ga0307416_100336778 | 3300032002 | Bacteria | 1519 |
| 1363 | Ga0307416_100572901 | 3300032002 | Bacteria | 1205 |
| 1364 | Ga0307414_10003324 | 3300032004 | Bacteria | 8582 |
| 1365 | Ga0307414_10034680 | 3300032004 | Bacteria | 3349 |
| 1366 | Ga0307414_10039804 | 3300032004 | Bacteria | 3169 |
| 1367 | Ga0307414_10040002 | 3300032004 | Bacteria | 3163 |
| 1368 | Ga0307414_10067337 | 3300032004 | Bacteria | 2565 |
| 1369 | Ga0307414_10072543 | 3300032004 | Bacteria | 2487 |
| 1370 | Ga0307414_10078692 | 3300032004 | Bacteria | 2404 |
| 1371 | Ga0307414_10081381 | 3300032004 | Bacteria | 2371 |
| 1372 | Ga0307414_10086675 | 3300032004 | Bacteria | 2311 |
| 1373 | Ga0307414_10342435 | 3300032004 | Bacteria | 1280 |
| 1374 | Ga0307414_10408430 | 3300032004 | Bacteria | 1181 |
| 1375 | Ga0307411_10001485 | 3300032005 | Bacteria | 9629 |
| 1376 | Ga0307411_10003060 | 3300032005 | Bacteria | 7641 |
| 1377 | Ga0307411_10004620 | 3300032005 | Bacteria | 6628 |
| 1378 | Ga0307411_10040251 | 3300032005 | Bacteria | 2963 |
| 1379 | Ga0307411_10104301 | 3300032005 | Bacteria | 2013 |
| 1380 | Ga0307415_100003431 | 3300032126 | Bacteria | 8062 |
| 1381 | Ga0307415_100068728 | 3300032126 | Bacteria | 2481 |
| 1382 | Ga0307415_100190061 | 3300032126 | Bacteria | 1619 |
| 1383 | Ga0307415_100304614 | 3300032126 | Bacteria | 1321 |
| 1384 | Ga0307415_100315497 | 3300032126 | Bacteria | 1301 |
| 1385 | Ga0307415_100378283 | 3300032126 | Bacteria | 1201 |
| 1386 | Ga0316583_10005720 | 3300032133 | Bacteria | 4469 |
| 1387 | Ga0316585_10000970 | 3300032137 | Bacteria | 7377 |
| 1388 | Ga0316585_10008103 | 3300032137 | Bacteria | 3042 |
| 1389 | Ga0316580_10021814 | 3300032139 | Bacteria | 1976 |
| 1390 | Ga0307507_10035501 | 3300033179 | Bacteria | 5121 |
| 1391 | Ga0307507_10069877 | 3300033179 | Bacteria | 3191 |
| 1392 | Ga0373934_0008204 | 3300035086 | Bacteria | 3889 |
| 1393 | Ga0373934_0052308 | 3300035086 | Bacteria | 1619 |
| 1394 | Ga0373944_0021727 | 3300035089 | Bacteria | 1860 |
| 1395 | Ga0373923_0000056 | 3300035111 | Bacteria | 17507 |
| 1396 | Ga0373936_0000074 | 3300035113 | Bacteria | 39201 |
| 1397 | Ga0373936_0015945 | 3300035113 | Bacteria | 2883 |
| 1398 | Ga0373939_0023803 | 3300035114 | Bacteria | 1700 |
| 1399 | Ga0373953_0005940 | 3300035117 | Bacteria | 3995 |
| 1400 | Ga0373953_0124420 | 3300035117 | Bacteria | 1097 |
| 1401 | Ga0373954_0007256 | 3300035118 | Bacteria | 4842 |
| 1402 | Ga0373954_0015620 | 3300035118 | Bacteria | 3395 |
| 1403 | Ga0373954_0021985 | 3300035118 | Bacteria | 2891 |
| 1404 | Ga0373956_0005453 | 3300035119 | Bacteria | 5094 |
| 1405 | Ga0373956_0088997 | 3300035119 | Bacteria | 1423 |
| 1406 | Ga0373957_0008067 | 3300035120 | Bacteria | 3397 |
| 1407 | Ga0373957_0014212 | 3300035120 | Bacteria | 2718 |
| 1408 | Ga0373957_0021645 | 3300035120 | Bacteria | 2284 |
| 1409 | Ga0373957_0027152 | 3300035120 | Bacteria | 2077 |
| 1410 | Ga0373946_0058209 | 3300035171 | Bacteria | 1636 |
| 1411 | Ga0373955_0001249 | 3300035172 | Bacteria | 10804 |
| 1412 | Ga0373955_0005370 | 3300035172 | Bacteria | 5753 |
| 1413 | Ga0373955_0042797 | 3300035172 | Bacteria | 2433 |
| 1414 | Ga0373955_0063169 | 3300035172 | Bacteria | 2050 |
| 1415 | Ga0373961_0000126 | 3300035241 | Bacteria | 39091 |
| 1416 | Ga0373962_0007891 | 3300035242 | Bacteria | 2612 |
| 1417 | Ga0316574_0001239 | 3300035398 | Bacteria | 11904 |
| 1418 | Ga0316574_0005525 | 3300035398 | Bacteria | 6750 |
| 1419 | Ga0316574_0026641 | 3300035398 | Bacteria | 3478 |
| 1420 | Ga0316574_0099027 | 3300035398 | Bacteria | 1865 |
| 1421 | Ga0316574_0139144 | 3300035398 | Bacteria | 1564 |
| 1422 | Ga0316574_0286433 | 3300035398 | Bacteria | 1049 |
| 1423 | Ga0373924_0032456 | 3300035410 | Bacteria | 2104 |
| 1424 | Ga0373931_0015899 | 3300035691 | Bacteria | 3696 |
| 1425 | Ga0373935_0131967 | 3300035692 | Bacteria | 1679 |
| 1426 | Ga0373935_0143274 | 3300035692 | Bacteria | 1616 |
| 1427 | Ga0373927_0000615 | 3300035695 | Bacteria | 27027 |
| 1428 | Ga0373927_0002114 | 3300035695 | Bacteria | 14645 |
| 1429 | Ga0373927_0058213 | 3300035695 | Bacteria | 2499 |
| 1430 | Ga0373933_0035998 | 3300035724 | Bacteria | 2894 |
| 1431 | Ga0373933_0194331 | 3300035724 | Bacteria | 1297 |
| 1432 | Ga0373947_0044769 | 3300035725 | Bacteria | 2647 |
| 1433 | Ga0373947_0074317 | 3300035725 | Bacteria | 2091 |
| 1434 | Ga0373937_0009412 | 3300036401 | Bacteria | 8492 |
| 1435 | Ga0373937_0065983 | 3300036401 | Bacteria | 3332 |
| 1436 | Ga0373937_0076730 | 3300036401 | Bacteria | 3087 |
| 1437 | Ga0373937_0198343 | 3300036401 | Bacteria | 1886 |
| 1438 | Ga0373937_0441480 | 3300036401 | Bacteria | 1235 |
| 1439 | Ga0316582_0000277 | 3300036647 | Bacteria | 17504 |
| 1440 | Ga0316582_0023018 | 3300036647 | Bacteria | 3707 |
| 1441 | Ga0316582_0059868 | 3300036647 | Bacteria | 2440 |
| 1442 | Ga0316582_0063495 | 3300036647 | Bacteria | 2373 |
| 1443 | Ga0316584_0001500 | 3300036712 | Bacteria | 14048 |
| 1444 | Ga0316584_0011002 | 3300036712 | Bacteria | 6342 |
| 1445 | Ga0316584_0030295 | 3300036712 | Bacteria | 3997 |
| 1446 | Ga0316584_0036370 | 3300036712 | Bacteria | 3653 |
| 1447 | Ga0316584_0053546 | 3300036712 | Bacteria | 3020 |
| 1448 | Ga0316584_0102259 | 3300036712 | Bacteria | 2146 |
| 1449 | Ga0316584_0138468 | 3300036712 | Bacteria | 1816 |
| 1450 | Ga0373925_0000278 | 3300037068 | Bacteria | 53402 |
| 1451 | Ga0373925_0011317 | 3300037068 | Bacteria | 6474 |
| 1452 | Ga0373925_0276282 | 3300037068 | Bacteria | 1352 |
| 1453 | Ga0395899_0000261 | 3300037312 | Bacteria | 69173 |
| 1454 | Ga0395899_0000309 | 3300037312 | Bacteria | 62448 |
| 1455 | Ga0395899_0014151 | 3300037312 | Bacteria | 6088 |
| 1456 | Ga0395899_0015844 | 3300037312 | Bacteria | 5747 |
| 1457 | Ga0395899_0040051 | 3300037312 | Bacteria | 3505 |
| 1458 | Ga0395899_0041062 | 3300037312 | Bacteria | 3457 |
| 1459 | Ga0395899_0053950 | 3300037312 | Bacteria | 2975 |
| 1460 | Ga0395899_0080294 | 3300037312 | Bacteria | 2374 |
| 1461 | Ga0395899_0081700 | 3300037312 | Bacteria | 2351 |
| 1462 | Ga0395899_0100636 | 3300037312 | Bacteria | 2087 |
| 1463 | Ga0395899_0149996 | 3300037312 | Bacteria | 1653 |
| 1464 | Ga0395899_0162039 | 3300037312 | Bacteria | 1579 |
| 1465 | Ga0395899_0217919 | 3300037312 | Bacteria | 1323 |
| 1466 | Ga0395900_0000036 | 3300037418 | Bacteria | 250619 |
| 1467 | Ga0395900_0000421 | 3300037418 | Bacteria | 61155 |
| 1468 | Ga0395900_0000463 | 3300037418 | Bacteria | 58345 |
| 1469 | Ga0395900_0002071 | 3300037418 | Bacteria | 22508 |
| 1470 | Ga0395900_0004593 | 3300037418 | Bacteria | 14573 |
| 1471 | Ga0395900_0005687 | 3300037418 | Bacteria | 13035 |
| 1472 | Ga0395900_0013849 | 3300037418 | Bacteria | 8230 |
| 1473 | Ga0395900_0022152 | 3300037418 | Bacteria | 6499 |
| 1474 | Ga0395900_0030670 | 3300037418 | Bacteria | 5521 |
| 1475 | Ga0395900_0043088 | 3300037418 | Bacteria | 4650 |
| 1476 | Ga0395900_0045251 | 3300037418 | Bacteria | 4533 |
| 1477 | Ga0395900_0081366 | 3300037418 | Bacteria | 3327 |
| 1478 | Ga0395900_0112961 | 3300037418 | Bacteria | 2789 |
| 1479 | Ga0395900_0139380 | 3300037418 | Bacteria | 2484 |
| 1480 | Ga0395900_0145385 | 3300037418 | Bacteria | 2424 |
| 1481 | Ga0395900_0146395 | 3300037418 | Bacteria | 2415 |
| 1482 | Ga0395900_0152379 | 3300037418 | Bacteria | 2361 |
| 1483 | Ga0395900_0158473 | 3300037418 | Bacteria | 2310 |
| 1484 | Ga0395900_0167565 | 3300037418 | Bacteria | 2238 |
| 1485 | Ga0395900_0168010 | 3300037418 | Bacteria | 2234 |
| 1486 | Ga0395900_0175775 | 3300037418 | Bacteria | 2178 |
| 1487 | Ga0395900_0176108 | 3300037418 | Bacteria | 2175 |
| 1488 | Ga0395900_0184034 | 3300037418 | Bacteria | 2121 |
| 1489 | Ga0395900_0269389 | 3300037418 | Bacteria | 1698 |
| 1490 | Ga0395900_0319660 | 3300037418 | Bacteria | 1533 |
| 1491 | Ga0395900_0605659 | 3300037418 | Bacteria | 1036 |
| 1492 | Ga0395898_0000305 | 3300037466 | Bacteria | 116565 |
| 1493 | Ga0395898_0000485 | 3300037466 | Bacteria | 78871 |
| 1494 | Ga0395898_0011241 | 3300037466 | Bacteria | 9315 |
| 1495 | Ga0395898_0011477 | 3300037466 | Bacteria | 9200 |
| 1496 | Ga0395898_0014192 | 3300037466 | Bacteria | 8192 |
| 1497 | Ga0395898_0016672 | 3300037466 | Bacteria | 7510 |
| 1498 | Ga0395898_0019437 | 3300037466 | Bacteria | 6913 |
| 1499 | Ga0395898_0020422 | 3300037466 | Bacteria | 6726 |
| 1500 | Ga0395898_0034473 | 3300037466 | Bacteria | 5044 |
| 1501 | Ga0395898_0035939 | 3300037466 | Bacteria | 4923 |
| 1502 | Ga0395898_0037985 | 3300037466 | Bacteria | 4774 |
| 1503 | Ga0395898_0042918 | 3300037466 | Bacteria | 4460 |
| 1504 | Ga0395898_0076987 | 3300037466 | Bacteria | 3220 |
| 1505 | Ga0395898_0107552 | 3300037466 | Bacteria | 2674 |
| 1506 | Ga0395898_0171768 | 3300037466 | Bacteria | 2072 |
| 1507 | Ga0395898_0188804 | 3300037466 | Bacteria | 1969 |
| 1508 | Ga0395898_0220915 | 3300037466 | Bacteria | 1807 |
| 1509 | Ga0395898_0221856 | 3300037466 | Bacteria | 1803 |
| 1510 | Ga0395898_0253128 | 3300037466 | Bacteria | 1679 |
| 1511 | Ga0395905_0018294 | 3300037471 | Bacteria | 6651 |
| 1512 | Ga0395905_0018671 | 3300037471 | Bacteria | 6577 |
| 1513 | Ga0395905_0034234 | 3300037471 | Bacteria | 4769 |
| 1514 | Ga0395905_0048902 | 3300037471 | Bacteria | 3962 |
| 1515 | Ga0395905_0059563 | 3300037471 | Bacteria | 3569 |
| 1516 | Ga0395905_0092636 | 3300037471 | Bacteria | 2834 |
| 1517 | Ga0395905_0095282 | 3300037471 | Bacteria | 2793 |
| 1518 | Ga0395905_0134658 | 3300037471 | Bacteria | 2324 |
| 1519 | Ga0395905_0154853 | 3300037471 | Bacteria | 2155 |
| 1520 | Ga0395905_0194649 | 3300037471 | Bacteria | 1901 |
| 1521 | Ga0395905_0296101 | 3300037471 | Bacteria | 1505 |
| 1522 | Ga0395905_0299238 | 3300037471 | Bacteria | 1496 |
| 1523 | Ga0316581_0019015 | 3300037588 | Bacteria | 2000 |
| 1524 | Ga0316581_0024562 | 3300037588 | Bacteria | 1788 |
| 1525 | Ga0395901_0000036 | 3300038443 | Bacteria | 214274 |
| 1526 | Ga0395901_0000188 | 3300038443 | Bacteria | 78908 |
| 1527 | Ga0395901_0000604 | 3300038443 | Bacteria | 41808 |
| 1528 | Ga0395901_0000913 | 3300038443 | Bacteria | 32275 |
| 1529 | Ga0395901_0001198 | 3300038443 | Bacteria | 27598 |
| 1530 | Ga0395901_0002697 | 3300038443 | Bacteria | 17888 |
| 1531 | Ga0395901_0003975 | 3300038443 | Bacteria | 14871 |
| 1532 | Ga0395901_0009119 | 3300038443 | Bacteria | 10047 |
| 1533 | Ga0395901_0015319 | 3300038443 | Bacteria | 7803 |
| 1534 | Ga0395901_0023104 | 3300038443 | Bacteria | 6373 |
| 1535 | Ga0395901_0030354 | 3300038443 | Bacteria | 5568 |
| 1536 | Ga0395901_0054449 | 3300038443 | Bacteria | 4158 |
| 1537 | Ga0395901_0055205 | 3300038443 | Bacteria | 4130 |
| 1538 | Ga0395901_0090263 | 3300038443 | Bacteria | 3207 |
| 1539 | Ga0395901_0116576 | 3300038443 | Bacteria | 2805 |
| 1540 | Ga0395901_0119581 | 3300038443 | Bacteria | 2768 |
| 1541 | Ga0395901_0120156 | 3300038443 | Bacteria | 2761 |
| 1542 | Ga0395901_0131771 | 3300038443 | Bacteria | 2627 |
| 1543 | Ga0395901_0149284 | 3300038443 | Bacteria | 2456 |
| 1544 | Ga0395901_0169395 | 3300038443 | Bacteria | 2291 |
| 1545 | Ga0395901_0177660 | 3300038443 | Bacteria | 2232 |
| 1546 | Ga0395901_0182239 | 3300038443 | Bacteria | 2203 |
| 1547 | Ga0395901_0449665 | 3300038443 | Bacteria | 1318 |
| 1548 | Ga0395901_0481965 | 3300038443 | Bacteria | 1265 |
| 1549 | Ga0395901_0519707 | 3300038443 | Bacteria | 1209 |
| 1550 | Ga0395901_0620186 | 3300038443 | Bacteria | 1088 |
| 1551 | Ga0237819_00728 | 3300038705 | Bacteria | 10584 |
| 1552 | Ga0237816_02003 | 3300039145 | Bacteria | 1604 |
| 1553 | Ga0436365_0871778 | 3300039437 | Bacteria | 8451 |
| 1554 | Ga0436360_0701846 | 3300039438 | Bacteria | 5048 |
| 1555 | Ga0436360_1373761 | 3300039438 | Bacteria | 4302 |
| 1556 | Ga0436361_1117061 | 3300039447 | Bacteria | 1170 |
| 1557 | Ga0436361_1214005 | 3300039447 | Bacteria | 5642 |
| 1558 | Ga0436363_1223925 | 3300039450 | Bacteria | 1002 |
| 1559 | Ga0436363_1399761 | 3300039450 | Bacteria | 8237 |
| 1560 | Ga0439436_0000023 | 3300041404 | Bacteria | 58899 |
| 1561 | Ga0439436_0012204 | 3300041404 | Bacteria | 2607 |
| 1562 | Ga0439436_0033111 | 3300041404 | Bacteria | 1497 |
| 1563 | Ga0439439_0043679 | 3300041406 | Bacteria | 1166 |
| 1564 | Ga0439465_0033940 | 3300041413 | Bacteria | 1632 |
| 1565 | Ga0451787_571574 | 3300041441 | Bacteria | 1217 |
| 1566 | Ga0451789_0461212 | 3300041443 | Bacteria | 1484 |
| 1567 | Ga0451807_0322861 | 3300041486 | Bacteria | 8947 |
| 1568 | Ga0451807_2136315 | 3300041486 | Bacteria | 4400 |
| 1569 | Ga0451853_0162710 | 3300041512 | Bacteria | 8567 |
| 1570 | Ga0439441_021491 | 3300042001 | Bacteria | 1192 |
| 1571 | Ga0439443_006540 | 3300042003 | Bacteria | 1596 |
| 1572 | Ga0439432_018244 | 3300042006 | Bacteria | 2346 |
| 1573 | Ga0439432_044976 | 3300042006 | Bacteria | 1390 |
| 1574 | Ga0439455_0003442 | 3300042012 | Bacteria | 3024 |
| 1575 | Ga0439457_018740 | 3300042014 | Bacteria | 1538 |
| 1576 | Ga0439462_0026691 | 3300042015 | Bacteria | 1523 |
| 1577 | Ga0450911_000006 | 3300042115 | Bacteria | 222143 |
| 1578 | Ga0450913_000424 | 3300042117 | Bacteria | 1752 |
| 1579 | Ga0450898_006509 | 3300042134 | Bacteria | 1796 |
| 1580 | Ga0450904_000100 | 3300042139 | Bacteria | 19264 |
| 1581 | Ga0439446_0027405 | 3300042156 | Bacteria | 1635 |
| 1582 | Ga0450908_000069 | 3300042184 | Bacteria | 20399 |
| 1583 | Ga0451577_0000256 | 3300042876 | Bacteria | 104951 |
| 1584 | Ga0466969_0000992 | 3300044656 | Bacteria | 15335 |
| 1585 | Ga0466969_0016933 | 3300044656 | Bacteria | 3809 |
| 1586 | Ga0466969_0055710 | 3300044656 | Bacteria | 1933 |
| 1587 | Ga0466969_0105306 | 3300044656 | Bacteria | 1324 |
| 1588 | Ga0466982_0000109 | 3300044672 | Bacteria | 20352 |
| 1589 | Ga0453683_0002195 | 3300044673 | Bacteria | 15518 |
| 1590 | Ga0453683_0067547 | 3300044673 | Bacteria | 2235 |
| 1591 | Ga0466966_0000004 | 3300044684 | Bacteria | 223594 |
| 1592 | Ga0466966_0002380 | 3300044684 | Bacteria | 12282 |
| 1593 | Ga0466966_0066226 | 3300044684 | Bacteria | 2270 |
| 1594 | Ga0466966_0077247 | 3300044684 | Bacteria | 2078 |
| 1595 | Ga0466966_0104783 | 3300044684 | Bacteria | 1746 |
| 1596 | Ga0466961_0000220 | 3300044693 | Bacteria | 38742 |
| 1597 | Ga0466961_0000978 | 3300044693 | Bacteria | 17723 |
| 1598 | Ga0466961_0004586 | 3300044693 | Bacteria | 8676 |
| 1599 | Ga0466961_0132258 | 3300044693 | Bacteria | 1563 |
| 1600 | Ga0466963_0001670 | 3300044694 | Bacteria | 12091 |
| 1601 | Ga0466963_0025535 | 3300044694 | Bacteria | 3769 |
| 1602 | Ga0466963_0034194 | 3300044694 | Bacteria | 3306 |
| 1603 | Ga0466963_0106828 | 3300044694 | Bacteria | 1919 |
| 1604 | Ga0466964_0012863 | 3300044706 | Bacteria | 3170 |
| 1605 | Ga0453684_0000842 | 3300044712 | Bacteria | 103487 |
| 1606 | Ga0453684_0005726 | 3300044712 | Bacteria | 24318 |
| 1607 | Ga0453684_0229822 | 3300044712 | Bacteria | 2142 |
| 1608 | Ga0466971_0002396 | 3300044719 | Bacteria | 7915 |
| 1609 | Ga0466970_0001613 | 3300044765 | Bacteria | 10869 |
| 1610 | Ga0466970_0001995 | 3300044765 | Bacteria | 9873 |
| 1611 | Ga0466970_0021702 | 3300044765 | Bacteria | 3346 |
| 1612 | Ga0466957_0018706 | 3300044842 | Bacteria | 4070 |
| 1613 | Ga0466957_0029399 | 3300044842 | Bacteria | 3277 |
| 1614 | Ga0466957_0082242 | 3300044842 | Bacteria | 2007 |
| 1615 | Ga0466957_0140031 | 3300044842 | Bacteria | 1558 |
| 1616 | Ga0466960_0063911 | 3300044901 | Bacteria | 1813 |
| 1617 | Ga0466960_0224388 | 3300044901 | Bacteria | 1035 |
| 1618 | Ga0466959_0000847 | 3300045049 | Bacteria | 18071 |
| 1619 | Ga0466959_0000978 | 3300045049 | Bacteria | 16998 |
| 1620 | Ga0466959_0009479 | 3300045049 | Bacteria | 6927 |
| 1621 | Ga0466959_0141147 | 3300045049 | Bacteria | 1702 |
| 1622 | Ga0466959_0248444 | 3300045049 | Bacteria | 1227 |
| 1623 | Ga0466958_0004196 | 3300045836 | Bacteria | 7576 |
| 1624 | Ga0466958_0082202 | 3300045836 | Bacteria | 1984 |
| 1625 | Ga0466958_0114592 | 3300045836 | Bacteria | 1684 |
| 1626 | Ga0466967_0016847 | 3300045976 | Bacteria | 5779 |
| 1627 | Ga0466967_0023353 | 3300045976 | Bacteria | 5066 |
| 1628 | Ga0466967_0043468 | 3300045976 | Bacteria | 3890 |
| 1629 | Ga0466967_0316416 | 3300045976 | Bacteria | 1504 |
| 1630 | Ga0495592_0004872 | 3300046454 | Bacteria | 9878 |
| 1631 | Ga0495603_0000388 | 3300046455 | Bacteria | 24093 |
| 1632 | Ga0495603_0040809 | 3300046455 | Bacteria | 2777 |
| 1633 | Ga0495590_0001068 | 3300046457 | Bacteria | 12077 |
| 1634 | Ga0495590_0006992 | 3300046457 | Bacteria | 4375 |
| 1635 | Ga0495590_0019091 | 3300046457 | Bacteria | 2447 |
| 1636 | Ga0495590_0093949 | 3300046457 | Bacteria | 1062 |
| 1637 | Ga0495590_0113147 | 3300046457 | Bacteria | 969 |
| 1638 | Ga0495591_002511 | 3300046458 | Bacteria | 10141 |
| 1639 | Ga0495629_0003174 | 3300046459 | Bacteria | 12452 |
| 1640 | Ga0495638_0000728 | 3300046460 | Bacteria | 35408 |
| 1641 | Ga0495638_0001464 | 3300046460 | Bacteria | 21323 |
| 1642 | Ga0495638_0005121 | 3300046460 | Bacteria | 9815 |
| 1643 | Ga0495638_0007439 | 3300046460 | Bacteria | 7850 |
| 1644 | Ga0495638_0040718 | 3300046460 | Bacteria | 2943 |
| 1645 | Ga0495638_0102411 | 3300046460 | Bacteria | 1711 |
| 1646 | Ga0495641_0008790 | 3300046461 | Bacteria | 6092 |
| 1647 | Ga0495641_0026207 | 3300046461 | Bacteria | 2848 |
| 1648 | Ga0495653_0004188 | 3300046463 | Bacteria | 11677 |
| 1649 | Ga0495650_0000024 | 3300046471 | Bacteria | 496674 |
| 1650 | Ga0495650_0077945 | 3300046471 | Bacteria | 1284 |
| 1651 | Ga0495580_0016401 | 3300046472 | Bacteria | 5558 |
| 1652 | Ga0495580_0041640 | 3300046472 | Bacteria | 3275 |
| 1653 | Ga0495582_0001097 | 3300046473 | Bacteria | 15190 |
| 1654 | Ga0495582_0013960 | 3300046473 | Bacteria | 4425 |
| 1655 | Ga0495605_0000271 | 3300046474 | Bacteria | 58816 |
| 1656 | Ga0495639_0008348 | 3300046475 | Bacteria | 4443 |
| 1657 | Ga0495585_0000027 | 3300046492 | Bacteria | 147955 |
| 1658 | Ga0495585_0085265 | 3300046492 | Bacteria | 1707 |
| 1659 | Ga0495594_0000118 | 3300046499 | Bacteria | 37004 |
| 1660 | Ga0495596_0000007 | 3300046500 | Bacteria | 151548 |
| 1661 | Ga0495596_0045858 | 3300046500 | Bacteria | 1718 |
| 1662 | Ga0495607_0015636 | 3300046501 | Bacteria | 4914 |
| 1663 | Ga0495583_0000005 | 3300046506 | Bacteria | 636894 |
| 1664 | Ga0495583_0000149 | 3300046506 | Bacteria | 117980 |
| 1665 | Ga0495583_0000249 | 3300046506 | Bacteria | 89010 |
| 1666 | Ga0495606_0002446 | 3300046507 | Bacteria | 21590 |
| 1667 | Ga0495608_0107355 | 3300046511 | Bacteria | 1796 |
| 1668 | Ga0495610_0000465 | 3300046512 | Bacteria | 41856 |
| 1669 | Ga0495610_0001255 | 3300046512 | Bacteria | 22785 |
| 1670 | Ga0495610_0001341 | 3300046512 | Bacteria | 21846 |
| 1671 | Ga0495610_0011263 | 3300046512 | Bacteria | 5480 |
| 1672 | Ga0495610_0033321 | 3300046512 | Bacteria | 2665 |
| 1673 | Ga0495616_0016634 | 3300046513 | Bacteria | 4067 |
| 1674 | Ga0495616_0019285 | 3300046513 | Bacteria | 3723 |
| 1675 | Ga0495620_0016023 | 3300046515 | Bacteria | 3772 |
| 1676 | Ga0495628_0013802 | 3300046516 | Bacteria | 6788 |
| 1677 | Ga0495630_0012679 | 3300046517 | Bacteria | 6125 |
| 1678 | Ga0495631_0012499 | 3300046518 | Bacteria | 4144 |
| 1679 | Ga0495631_0014835 | 3300046518 | Bacteria | 3750 |
| 1680 | Ga0495632_0004886 | 3300046519 | Bacteria | 8985 |
| 1681 | Ga0495632_0019802 | 3300046519 | Bacteria | 3658 |
| 1682 | Ga0495632_0065291 | 3300046519 | Bacteria | 1758 |
| 1683 | Ga0495637_0008788 | 3300046520 | Bacteria | 4946 |
| 1684 | Ga0495637_0099481 | 3300046520 | Bacteria | 1138 |
| 1685 | Ga0495643_0015990 | 3300046522 | Bacteria | 4417 |
| 1686 | Ga0495644_0111145 | 3300046523 | Bacteria | 1040 |
| 1687 | Ga0495648_0000029 | 3300046524 | Bacteria | 223499 |
| 1688 | Ga0495648_0100364 | 3300046524 | Bacteria | 1599 |
| 1689 | Ga0495663_0000379 | 3300046525 | Bacteria | 16472 |
| 1690 | Ga0495666_0006889 | 3300046526 | Bacteria | 5708 |
| 1691 | Ga0495652_0103151 | 3300046529 | Bacteria | 2309 |
| 1692 | Ga0495654_0000226 | 3300046530 | Bacteria | 52630 |
| 1693 | Ga0495665_0044109 | 3300046531 | Bacteria | 2370 |
| 1694 | Ga0495640_0006086 | 3300046533 | Bacteria | 9569 |
| 1695 | Ga0495586_0117398 | 3300046535 | Bacteria | 1484 |
| 1696 | Ga0495587_0014439 | 3300046536 | Bacteria | 4954 |
| 1697 | Ga0495587_0191616 | 3300046536 | Bacteria | 1157 |
| 1698 | Ga0495609_0000052 | 3300046538 | Bacteria | 150695 |
| 1699 | Ga0495621_0013656 | 3300046539 | Bacteria | 2556 |
| 1700 | Ga0495597_0017049 | 3300046542 | Bacteria | 3423 |
| 1701 | Ga0495622_0004272 | 3300046557 | Bacteria | 6648 |
| 1702 | Ga0495633_0000162 | 3300046558 | Bacteria | 87434 |
| 1703 | Ga0495667_0008613 | 3300046559 | Bacteria | 6923 |
| 1704 | Ga0495667_0020228 | 3300046559 | Bacteria | 4491 |
| 1705 | Ga0495668_0000141 | 3300046616 | Bacteria | 108840 |
| 1706 | Ga0495668_0007336 | 3300046616 | Bacteria | 7065 |
| 1707 | Ga0495668_0011331 | 3300046616 | Bacteria | 5347 |
| 1708 | Ga0495668_0058761 | 3300046616 | Bacteria | 2122 |
| 1709 | Ga0495634_0002446 | 3300046642 | Bacteria | 15427 |
| 1710 | Ga0495611_0000565 | 3300046648 | Bacteria | 21341 |
| 1711 | Ga0495625_0000398 | 3300046660 | Bacteria | 66474 |
| 1712 | Ga0495625_0010691 | 3300046660 | Bacteria | 7562 |
| 1713 | Ga0495625_0015161 | 3300046660 | Bacteria | 6116 |
| 1714 | Ga0495625_0036300 | 3300046660 | Bacteria | 3624 |
| 1715 | Ga0495625_0042417 | 3300046660 | Bacteria | 3306 |
| 1716 | Ga0495625_0111871 | 3300046660 | Bacteria | 1866 |
| 1717 | Ga0495625_0116865 | 3300046660 | Bacteria | 1819 |
| 1718 | Ga0495625_0130092 | 3300046660 | Bacteria | 1706 |
| 1719 | Ga0495635_0025209 | 3300046663 | Bacteria | 4142 |
| 1720 | Ga0495588_0057082 | 3300046674 | Bacteria | 2016 |
| 1721 | Ga0495657_0022358 | 3300046675 | Bacteria | 4531 |
| 1722 | Ga0495657_0089723 | 3300046675 | Bacteria | 1974 |
| 1723 | Ga0495599_0018838 | 3300046678 | Bacteria | 4302 |
| 1724 | Ga0495599_0023815 | 3300046678 | Bacteria | 3828 |
| 1725 | Ga0495623_0039267 | 3300046679 | Bacteria | 3026 |
| 1726 | Ga0495647_0000113 | 3300046681 | Bacteria | 20397 |
| 1727 | Ga0495647_0007512 | 3300046681 | Bacteria | 3656 |
| 1728 | Ga0495658_0002474 | 3300046683 | Bacteria | 9302 |
| 1729 | Ga0495658_0013350 | 3300046683 | Bacteria | 4179 |
| 1730 | Ga0495613_0008625 | 3300046689 | Bacteria | 7562 |
| 1731 | Ga0495613_0029688 | 3300046689 | Bacteria | 4064 |
| 1732 | Ga0495670_0001410 | 3300046691 | Bacteria | 11784 |
| 1733 | Ga0495671_0011736 | 3300046692 | Bacteria | 4805 |
| 1734 | Ga0495649_0000165 | 3300046694 | Bacteria | 57643 |
| 1735 | Ga0495649_0000396 | 3300046694 | Bacteria | 37744 |
| 1736 | Ga0495649_0010627 | 3300046694 | Bacteria | 5423 |
| 1737 | Ga0495649_0021738 | 3300046694 | Bacteria | 3594 |
| 1738 | Ga0495589_0024889 | 3300046794 | Bacteria | 3040 |
| 1739 | Ga0495600_0009720 | 3300046809 | Bacteria | 5944 |
| 1740 | Ga0495600_0025908 | 3300046809 | Bacteria | 3782 |
| 1741 | Ga0495660_0005715 | 3300046810 | Bacteria | 7426 |
| 1742 | Ga0495581_0090757 | 3300047315 | Bacteria | 1772 |
| 1743 | Ga0495604_0003696 | 3300047317 | Bacteria | 12188 |
| 1744 | Ga0495636_0002340 | 3300047318 | Bacteria | 7283 |
| 1745 | Ga0495636_0018436 | 3300047318 | Bacteria | 2800 |
| 1746 | Ga0495636_0035560 | 3300047318 | Bacteria | 2052 |
| 1747 | Ga0495674_0065303 | 3300047319 | Bacteria | 3161 |
| 1748 | Ga0495672_0011303 | 3300047320 | Bacteria | 6309 |
| 1749 | Ga0495672_0128180 | 3300047320 | Bacteria | 1338 |
| 1750 | Ga0495676_0170342 | 3300047321 | Bacteria | 1533 |
| 1751 | Ga0495680_0042645 | 3300047322 | Bacteria | 3599 |
| 1752 | Ga0495680_0087469 | 3300047322 | Bacteria | 2343 |
| 1753 | Ga0495680_0361099 | 3300047322 | Bacteria | 1009 |
| 1754 | Ga0495683_0000002 | 3300047323 | Bacteria | 638279 |
| 1755 | Ga0495683_0077491 | 3300047323 | Bacteria | 1625 |
| 1756 | Ga0495683_0142506 | 3300047323 | Bacteria | 1122 |
| 1757 | Ga0495675_0090651 | 3300047444 | Bacteria | 1919 |
| 1758 | Ga0495679_000035 | 3300047446 | Bacteria | 164777 |
| 1759 | Ga0495679_000056 | 3300047446 | Bacteria | 111387 |
| 1760 | Ga0495679_003586 | 3300047446 | Bacteria | 7410 |
| 1761 | Ga0495685_046996 | 3300047447 | Bacteria | 1468 |
| 1762 | Ga0495673_0000342 | 3300047469 | Bacteria | 58945 |
| 1763 | Ga0495673_0002882 | 3300047469 | Bacteria | 11693 |
| 1764 | Ga0495681_0079948 | 3300047470 | Bacteria | 1461 |
| 1765 | Ga0495684_0078492 | 3300047471 | Bacteria | 2506 |
| 1766 | Ga0495684_0094860 | 3300047471 | Bacteria | 2258 |
| 1767 | Ga0495686_0001836 | 3300047472 | Bacteria | 21329 |
| 1768 | Ga0495686_0001859 | 3300047472 | Bacteria | 21181 |
| 1769 | Ga0495593_0000987 | 3300047673 | Bacteria | 16704 |
| 1770 | Ga0495602_0014733 | 3300048088 | Bacteria | 7929 |
| 1771 | Ga0495602_0044383 | 3300048088 | Bacteria | 4033 |
| 1772 | Ga0495602_0374641 | 3300048088 | Bacteria | 1021 |
| 1773 | Ga0495614_0042029 | 3300048089 | Bacteria | 1960 |
| 1774 | Ga0496100_0102199 | 3300048903 | Bacteria | 1977 |
| 1775 | Ga0496100_0216104 | 3300048903 | Bacteria | 1405 |
| 1776 | Ga0496101_0015659 | 3300048904 | Bacteria | 5116 |
| 1777 | Ga0496101_0017706 | 3300048904 | Bacteria | 4832 |
| 1778 | Ga0496101_0022049 | 3300048904 | Bacteria | 4381 |
| 1779 | Ga0496101_0024655 | 3300048904 | Bacteria | 4165 |
| 1780 | Ga0496101_0279814 | 3300048904 | Bacteria | 1304 |
| 1781 | Ga0496102_0039951 | 3300048905 | Bacteria | 4242 |
| 1782 | Ga0496102_0047630 | 3300048905 | Bacteria | 3897 |
| 1783 | Ga0496102_0083221 | 3300048905 | Bacteria | 2952 |
| 1784 | Ga0496102_0250431 | 3300048905 | Bacteria | 1670 |
| 1785 | Ga0496103_0040376 | 3300048906 | Bacteria | 2867 |
| 1786 | Ga0496103_0079880 | 3300048906 | Bacteria | 2056 |
| 1787 | Ga0496103_0129682 | 3300048906 | Bacteria | 1610 |
| 1788 | Ga0496104_0032285 | 3300048907 | Bacteria | 4873 |
| 1789 | Ga0496104_0034981 | 3300048907 | Bacteria | 4688 |
| 1790 | Ga0496104_0055115 | 3300048907 | Bacteria | 3759 |
| 1791 | Ga0496104_0097848 | 3300048907 | Bacteria | 2808 |
| 1792 | Ga0496104_0186776 | 3300048907 | Bacteria | 1983 |
| 1793 | Ga0496105_0009632 | 3300048908 | Bacteria | 7560 |
| 1794 | Ga0496105_0019536 | 3300048908 | Bacteria | 5467 |
| 1795 | Ga0496105_0292398 | 3300048908 | Bacteria | 1311 |
| 1796 | Ga0496106_0047561 | 3300048909 | Bacteria | 3229 |
| 1797 | Ga0496106_0063844 | 3300048909 | Bacteria | 2800 |
| 1798 | Ga0496106_0271146 | 3300048909 | Bacteria | 1359 |
| 1799 | Ga0496106_0287665 | 3300048909 | Bacteria | 1317 |
| 1800 | Ga0496107_0000214 | 3300048910 | Bacteria | 30453 |
| 1801 | Ga0496107_0019860 | 3300048910 | Bacteria | 4744 |
| 1802 | Ga0496107_0077760 | 3300048910 | Bacteria | 2417 |
| 1803 | Ga0496107_0183845 | 3300048910 | Bacteria | 1552 |
| 1804 | Ga0496107_0186394 | 3300048910 | Bacteria | 1541 |
| 1805 | Ga0496108_0003688 | 3300048911 | Bacteria | 12288 |
| 1806 | Ga0496108_0016259 | 3300048911 | Bacteria | 6066 |
| 1807 | Ga0496108_0027517 | 3300048911 | Bacteria | 4696 |
| 1808 | Ga0496108_0126533 | 3300048911 | Bacteria | 2194 |
| 1809 | Ga0496108_0185152 | 3300048911 | Bacteria | 1804 |
| 1810 | Ga0496108_0384164 | 3300048911 | Bacteria | 1226 |
| 1811 | Ga0496109_0001865 | 3300048912 | Bacteria | 17465 |
| 1812 | Ga0496109_0048552 | 3300048912 | Bacteria | 3862 |
| 1813 | Ga0496109_0087095 | 3300048912 | Bacteria | 2884 |
| 1814 | Ga0496109_0091181 | 3300048912 | Bacteria | 2818 |
| 1815 | Ga0496109_0186498 | 3300048912 | Bacteria | 1949 |
| 1816 | Ga0496109_0188056 | 3300048912 | Bacteria | 1940 |
| 1817 | Ga0496109_0206078 | 3300048912 | Bacteria | 1849 |
| 1818 | Ga0496109_0212961 | 3300048912 | Bacteria | 1817 |
| 1819 | Ga0496110_0012559 | 3300048913 | Bacteria | 6967 |
| 1820 | Ga0496110_0074788 | 3300048913 | Bacteria | 3009 |
| 1821 | Ga0496110_0077735 | 3300048913 | Bacteria | 2953 |
| 1822 | Ga0496110_0150420 | 3300048913 | Bacteria | 2108 |
| 1823 | Ga0496110_0156563 | 3300048913 | Bacteria | 2064 |
| 1824 | Ga0496110_0457692 | 3300048913 | Bacteria | 1163 |
| 1825 | Ga0496111_0011770 | 3300048914 | Bacteria | 5906 |
| 1826 | Ga0496111_0022773 | 3300048914 | Bacteria | 4390 |
| 1827 | Ga0496111_0239824 | 3300048914 | Bacteria | 1346 |
| 1828 | Ga0496112_0003292 | 3300048915 | Bacteria | 13337 |
| 1829 | Ga0496112_0027176 | 3300048915 | Bacteria | 5517 |
| 1830 | Ga0496112_0072298 | 3300048915 | Bacteria | 3409 |
| 1831 | Ga0496112_0175465 | 3300048915 | Bacteria | 2108 |
| 1832 | Ga0496112_0190432 | 3300048915 | Bacteria | 2013 |
| 1833 | Ga0496112_0453340 | 3300048915 | Bacteria | 1220 |
| 1834 | Ga0496113_0424119 | 3300048916 | Bacteria | 1068 |
| 1835 | Ga0496114_0006303 | 3300048917 | Bacteria | 9336 |
| 1836 | Ga0496114_0098484 | 3300048917 | Bacteria | 2493 |
| 1837 | Ga0496114_0136746 | 3300048917 | Bacteria | 2119 |
| 1838 | Ga0496114_0160550 | 3300048917 | Bacteria | 1954 |
| 1839 | Ga0496114_0221649 | 3300048917 | Bacteria | 1660 |
| 1840 | Ga0496114_0352639 | 3300048917 | Bacteria | 1301 |
| 1841 | Ga0496115_0006041 | 3300048918 | Bacteria | 8841 |
| 1842 | Ga0496115_0169765 | 3300048918 | Bacteria | 1804 |
| 1843 | Ga0496115_0197088 | 3300048918 | Bacteria | 1664 |
| 1844 | Ga0496115_0271290 | 3300048918 | Bacteria | 1394 |
| 1845 | Ga0496116_0028883 | 3300048919 | Bacteria | 4009 |
| 1846 | Ga0496116_0038439 | 3300048919 | Bacteria | 3323 |
| 1847 | Ga0496117_0016132 | 3300048920 | Bacteria | 6318 |
| 1848 | Ga0496117_0040086 | 3300048920 | Bacteria | 3450 |
| 1849 | Ga0496117_0054532 | 3300048920 | Bacteria | 2800 |
| 1850 | Ga0496118_0001967 | 3300048921 | Bacteria | 29146 |
| 1851 | Ga0496118_0003890 | 3300048921 | Bacteria | 18327 |
| 1852 | Ga0496118_0029873 | 3300048921 | Bacteria | 4561 |
| 1853 | Ga0496118_0119622 | 3300048921 | Bacteria | 1721 |
| 1854 | Ga0496119_0000733 | 3300048922 | Bacteria | 44239 |
| 1855 | Ga0496119_0005178 | 3300048922 | Bacteria | 12605 |
| 1856 | Ga0496119_0011034 | 3300048922 | Bacteria | 7534 |
| 1857 | Ga0496119_0012759 | 3300048922 | Bacteria | 6785 |
| 1858 | Ga0496120_0000671 | 3300048923 | Bacteria | 50340 |
| 1859 | Ga0496120_0015992 | 3300048923 | Bacteria | 4921 |
| 1860 | Ga0496121_0000021 | 3300048924 | Bacteria | 478544 |
| 1861 | Ga0496121_0000042 | 3300048924 | Bacteria | 342304 |
| 1862 | Ga0496121_0000145 | 3300048924 | Bacteria | 156655 |
| 1863 | Ga0496121_0033279 | 3300048924 | Bacteria | 4669 |
| 1864 | Ga0496121_0099155 | 3300048924 | Bacteria | 2252 |
| 1865 | Ga0496122_0000029 | 3300048925 | Bacteria | 336396 |
| 1866 | Ga0496122_0000749 | 3300048925 | Bacteria | 63273 |
| 1867 | Ga0496122_0013321 | 3300048925 | Bacteria | 8059 |
| 1868 | Ga0496122_0098434 | 3300048925 | Bacteria | 1964 |
| 1869 | Ga0496123_0000216 | 3300048926 | Bacteria | 117098 |
| 1870 | Ga0496123_0000566 | 3300048926 | Bacteria | 63317 |
| 1871 | Ga0496123_0000974 | 3300048926 | Bacteria | 44176 |
| 1872 | Ga0496123_0006678 | 3300048926 | Bacteria | 11119 |
| 1873 | Ga0496123_0041704 | 3300048926 | Bacteria | 3177 |
| 1874 | Ga0496124_0000681 | 3300048927 | Bacteria | 55817 |
| 1875 | Ga0496124_0088371 | 3300048927 | Bacteria | 2533 |
| 1876 | Ga0496124_0147417 | 3300048927 | Bacteria | 1850 |
| 1877 | Ga0496125_0001102 | 3300048928 | Bacteria | 41526 |
| 1878 | Ga0496125_0001807 | 3300048928 | Bacteria | 29544 |
| 1879 | Ga0496125_0018499 | 3300048928 | Bacteria | 6617 |
| 1880 | Ga0496125_0029699 | 3300048928 | Bacteria | 4907 |
| 1881 | Ga0496126_0021905 | 3300048929 | Bacteria | 6232 |
| 1882 | Ga0496126_0073787 | 3300048929 | Bacteria | 3032 |
| 1883 | Ga0496126_0305946 | 3300048929 | Bacteria | 1310 |
| 1884 | Ga0495678_003651 | 3300049459 | Bacteria | 9339 |
| 1885 | Ga0495682_0022008 | 3300049460 | Bacteria | 2387 |
| 1886 | Ga0501031_0003304 | 3300049568 | Bacteria | 10348 |
| 1887 | Ga0501031_0036277 | 3300049568 | Bacteria | 3216 |
| 1888 | Ga0501032_0002277 | 3300049569 | Bacteria | 15078 |
| 1889 | Ga0501033_0016780 | 3300049570 | Bacteria | 5538 |
| 1890 | Ga0501033_0020882 | 3300049570 | Bacteria | 4943 |
| 1891 | Ga0501033_0060379 | 3300049570 | Bacteria | 2797 |
| 1892 | Ga0501033_0072968 | 3300049570 | Bacteria | 2520 |
| 1893 | Ga0501034_0003528 | 3300049571 | Bacteria | 17767 |
| 1894 | Ga0501034_0013919 | 3300049571 | Bacteria | 8282 |
| 1895 | Ga0501034_0026913 | 3300049571 | Bacteria | 5851 |
| 1896 | Ga0501034_0043094 | 3300049571 | Bacteria | 4568 |
| 1897 | Ga0501034_0046443 | 3300049571 | Bacteria | 4388 |
| 1898 | Ga0501034_0056312 | 3300049571 | Bacteria | 3956 |
| 1899 | Ga0501034_0382079 | 3300049571 | Bacteria | 1333 |
| 1900 | Ga0501036_0087742 | 3300049572 | Bacteria | 2629 |
| 1901 | Ga0501036_0113245 | 3300049572 | Bacteria | 2293 |
| 1902 | Ga0501036_0129900 | 3300049572 | Bacteria | 2127 |
| 1903 | Ga0501036_0140941 | 3300049572 | Bacteria | 2035 |
| 1904 | Ga0501037_0046554 | 3300049573 | Bacteria | 3180 |
| 1905 | Ga0501038_0000654 | 3300049574 | Bacteria | 30791 |
| 1906 | Ga0501038_0009310 | 3300049574 | Bacteria | 9010 |
| 1907 | Ga0501038_0023889 | 3300049574 | Bacteria | 5459 |
| 1908 | Ga0501038_0087373 | 3300049574 | Bacteria | 2618 |
| 1909 | Ga0501039_0235261 | 3300049575 | Bacteria | 1440 |
| 1910 | Ga0501039_0265879 | 3300049575 | Bacteria | 1348 |
| 1911 | Ga0501040_0001815 | 3300049576 | Bacteria | 13724 |
| 1912 | Ga0501041_0000192 | 3300049577 | Bacteria | 27903 |
| 1913 | Ga0501042_0000054 | 3300049578 | Bacteria | 40211 |
| 1914 | Ga0501042_0000271 | 3300049578 | Bacteria | 25300 |
| 1915 | Ga0501042_0120352 | 3300049578 | Bacteria | 1890 |
| 1916 | Ga0501043_0034251 | 3300049579 | Bacteria | 3995 |
| 1917 | Ga0501043_0085298 | 3300049579 | Bacteria | 2481 |
| 1918 | Ga0501043_0112989 | 3300049579 | Bacteria | 2133 |
| 1919 | Ga0501046_0000108 | 3300049580 | Bacteria | 87513 |
| 1920 | Ga0501046_0015253 | 3300049580 | Bacteria | 6462 |
| 1921 | Ga0501047_0002839 | 3300049581 | Bacteria | 16426 |
| 1922 | Ga0501047_0013253 | 3300049581 | Bacteria | 7808 |
| 1923 | Ga0501047_0017768 | 3300049581 | Bacteria | 6814 |
| 1924 | Ga0501047_0019890 | 3300049581 | Bacteria | 6444 |
| 1925 | Ga0501047_0021564 | 3300049581 | Bacteria | 6187 |
| 1926 | Ga0501047_0043063 | 3300049581 | Bacteria | 4362 |
| 1927 | Ga0501047_0060215 | 3300049581 | Bacteria | 3665 |
| 1928 | Ga0501047_0122096 | 3300049581 | Bacteria | 2486 |
| 1929 | Ga0501047_0176192 | 3300049581 | Bacteria | 2005 |
| 1930 | Ga0501047_0181887 | 3300049581 | Bacteria | 1969 |
| 1931 | Ga0501048_0034331 | 3300049582 | Bacteria | 3660 |
| 1932 | Ga0501067_0043101 | 3300049583 | Bacteria | 2506 |
| 1933 | Ga0501067_0114492 | 3300049583 | Bacteria | 1500 |
| 1934 | Ga0501069_0101362 | 3300049585 | Bacteria | 1634 |
| 1935 | Ga0501069_0185100 | 3300049585 | Bacteria | 1204 |
| 1936 | Ga0501069_0217959 | 3300049585 | Bacteria | 1108 |
| 1937 | Ga0501070_0000102 | 3300049586 | Bacteria | 74839 |
| 1938 | Ga0501070_0023819 | 3300049586 | Bacteria | 5131 |
| 1939 | Ga0501070_0044639 | 3300049586 | Bacteria | 3686 |
| 1940 | Ga0501070_0051997 | 3300049586 | Bacteria | 3400 |
| 1941 | Ga0501070_0058239 | 3300049586 | Bacteria | 3202 |
| 1942 | Ga0501070_0173712 | 3300049586 | Bacteria | 1774 |
| 1943 | Ga0501070_0352055 | 3300049586 | Bacteria | 1195 |
| 1944 | Ga0501070_0423843 | 3300049586 | Bacteria | 1074 |
| 1945 | Ga0501071_0016296 | 3300049587 | Bacteria | 5110 |
| 1946 | Ga0501071_0018432 | 3300049587 | Bacteria | 4832 |
| 1947 | Ga0501071_0139032 | 3300049587 | Bacteria | 1808 |
| 1948 | Ga0501072_0000655 | 3300049588 | Bacteria | 24933 |
| 1949 | Ga0501073_0008965 | 3300049589 | Bacteria | 7389 |
| 1950 | Ga0501073_0013754 | 3300049589 | Bacteria | 5886 |
| 1951 | Ga0501073_0018310 | 3300049589 | Bacteria | 5061 |
| 1952 | Ga0501073_0051133 | 3300049589 | Bacteria | 2895 |
| 1953 | Ga0501074_0002305 | 3300049590 | Bacteria | 13281 |
| 1954 | Ga0501074_0033737 | 3300049590 | Bacteria | 3710 |
| 1955 | Ga0501074_0063087 | 3300049590 | Bacteria | 2669 |
| 1956 | Ga0501075_0032811 | 3300049591 | Bacteria | 3860 |
| 1957 | Ga0501075_0036165 | 3300049591 | Bacteria | 3686 |
| 1958 | Ga0501075_0049268 | 3300049591 | Bacteria | 3166 |
| 1959 | Ga0501076_0000057 | 3300049592 | Bacteria | 55044 |
| 1960 | Ga0501076_0100931 | 3300049592 | Bacteria | 2325 |
| 1961 | Ga0501077_0000637 | 3300049593 | Bacteria | 21303 |
| 1962 | Ga0501077_0013351 | 3300049593 | Bacteria | 5151 |
| 1963 | Ga0501239_000595 | 3300049672 | Bacteria | 2848 |
| 1964 | Ga0501079_0000283 | 3300049741 | Bacteria | 31327 |
| 1965 | Ga0501079_0041115 | 3300049741 | Bacteria | 3568 |
| 1966 | Ga0501079_0145936 | 3300049741 | Bacteria | 1844 |
| 1967 | Ga0501080_0000480 | 3300049742 | Bacteria | 31084 |
| 1968 | Ga0501080_0015766 | 3300049742 | Bacteria | 6970 |
| 1969 | Ga0501080_0016767 | 3300049742 | Bacteria | 6766 |
| 1970 | Ga0501080_0022903 | 3300049742 | Bacteria | 5790 |
| 1971 | Ga0501080_0029568 | 3300049742 | Bacteria | 5101 |
| 1972 | Ga0501080_0034741 | 3300049742 | Bacteria | 4707 |
| 1973 | Ga0501080_0051306 | 3300049742 | Bacteria | 3838 |
| 1974 | Ga0501080_0132429 | 3300049742 | Bacteria | 2308 |
| 1975 | Ga0501080_0207020 | 3300049742 | Bacteria | 1799 |
| 1976 | Ga0501080_0364050 | 3300049742 | Bacteria | 1304 |
| 1977 | Ga0501081_0000123 | 3300049743 | Bacteria | 33954 |
| 1978 | Ga0501083_0014104 | 3300049744 | Bacteria | 5588 |
| 1979 | Ga0501083_0020544 | 3300049744 | Bacteria | 4593 |
| 1980 | Ga0501083_0044708 | 3300049744 | Bacteria | 2997 |
| 1981 | Ga0501083_0069462 | 3300049744 | Bacteria | 2344 |
| 1982 | Ga0501083_0149667 | 3300049744 | Bacteria | 1528 |
| 1983 | Ga0501035_0003292 | 3300049822 | Bacteria | 15485 |
| 1984 | Ga0501035_0003439 | 3300049822 | Bacteria | 15151 |
| 1985 | Ga0501035_0019304 | 3300049822 | Bacteria | 6273 |
| 1986 | Ga0501035_0057698 | 3300049822 | Bacteria | 3461 |
| 1987 | Ga0501035_0059231 | 3300049822 | Bacteria | 3410 |
| 1988 | Ga0501035_0069916 | 3300049822 | Bacteria | 3110 |
| 1989 | Ga0501035_0078600 | 3300049822 | Bacteria | 2914 |
| 1990 | Ga0501035_0090106 | 3300049822 | Bacteria | 2700 |
| 1991 | Ga0501035_0099716 | 3300049822 | Bacteria | 2549 |
| 1992 | Ga0501035_0269396 | 3300049822 | Bacteria | 1442 |
| 1993 | Ga0501035_0383847 | 3300049822 | Bacteria | 1171 |
| 1994 | Ga0501044_0002339 | 3300049823 | Bacteria | 21617 |
| 1995 | Ga0501044_0024481 | 3300049823 | Bacteria | 6406 |
| 1996 | Ga0501044_0045879 | 3300049823 | Bacteria | 4526 |
| 1997 | Ga0501044_0053284 | 3300049823 | Bacteria | 4162 |
| 1998 | Ga0501044_0085608 | 3300049823 | Bacteria | 3185 |
| 1999 | Ga0501044_0092573 | 3300049823 | Bacteria | 3049 |
| 2000 | Ga0501044_0094691 | 3300049823 | Bacteria | 3010 |
| 2001 | Ga0501044_0189704 | 3300049823 | Bacteria | 2019 |
| 2002 | Ga0501045_0002226 | 3300049824 | Bacteria | 13171 |
| 2003 | Ga0501226_000012 | 3300049853 | Bacteria | 175419 |
| 2004 | nmdc:mga03683_72905_c1 | 3300050489 | Bacteria | 1471 |
| 2005 | nmdc:mga00v17_36848_c2 | 3300050491 | Bacteria | 1902 |
| 2006 | nmdc:mga0yw44_222117_c1 | 3300050492 | Bacteria | 1252 |
| 2007 | nmdc:mga0k408_259977_c1 | 3300050493 | Bacteria | 1037 |
| 2008 | nmdc:mga0k408_34917_c1 | 3300050493 | Bacteria | 2881 |
| 2009 | nmdc:mga0k408_45210_c1 | 3300050493 | Bacteria | 2540 |
| 2010 | nmdc:mga07m45_119838_c1 | 3300050496 | Bacteria | 1519 |
| 2011 | nmdc:mga07m45_85713_c1 | 3300050496 | Bacteria | 1801 |
| 2012 | nmdc:mga05p37_155916_c1 | 3300050507 | Bacteria | 2791 |
| 2013 | nmdc:mga05p37_52817_c1 | 3300050507 | Bacteria | 4997 |
| 2014 | nmdc:mga05p37_716_c1 | 3300050507 | Bacteria | 36551 |
| 2015 | nmdc:mga09592_39528_c1 | 3300050508 | Bacteria | 3963 |
| 2016 | nmdc:mga0qj67_3310_c1 | 3300050509 | Bacteria | 11610 |
| 2017 | nmdc:mga0qj67_36852_c1 | 3300050509 | Bacteria | 3829 |
| 2018 | nmdc:mga0qj67_8357_c1 | 3300050509 | Bacteria | 7675 |
| 2019 | nmdc:mga06r32_106735_c1 | 3300050510 | Bacteria | 2752 |
| 2020 | nmdc:mga06r32_45534_c1 | 3300050510 | Bacteria | 4183 |
| 2021 | nmdc:mga06r32_7880_c1 | 3300050510 | Bacteria | 9573 |
| 2022 | nmdc:mga08y16_50166_c1 | 3300050511 | Bacteria | 4367 |
| 2023 | nmdc:mga08y16_67396_c1 | 3300050511 | Bacteria | 3734 |
| 2024 | nmdc:mga0n895_214105_c1 | 3300050512 | Bacteria | 1957 |
| 2025 | nmdc:mga0rr50_222830_c1 | 3300050513 | Bacteria | 1558 |
| 2026 | nmdc:mga0rr50_300447_c1 | 3300050513 | Bacteria | 1343 |
| 2027 | nmdc:mga08x19_26318_c1 | 3300050514 | Bacteria | 3629 |
| 2028 | nmdc:mga0a205_139417_c1 | 3300050515 | Bacteria | 2325 |
| 2029 | nmdc:mga0a205_8602_c1 | 3300050515 | Bacteria | 9288 |
| 2030 | Ga0495601_0002701 | 3300053077 | Bacteria | 10069 |
| 2031 | Ga0495601_0051546 | 3300053077 | Bacteria | 2597 |
| 2032 | Ga0495601_0169115 | 3300053077 | Bacteria | 1429 |
| 2033 | Ga0495601_0260732 | 3300053077 | Bacteria | 1131 |
| 2034 | Ga0495612_0025055 | 3300053078 | Bacteria | 2396 |
| 2035 | Ga0500635_0000140 | 3300053080 | Bacteria | 41240 |
| 2036 | Ga0500635_0043193 | 3300053080 | Bacteria | 1515 |
| 2037 | Ga0495655_0000320 | 3300053083 | Bacteria | 8521 |
| 2038 | Ga0495595_0007105 | 3300053084 | Bacteria | 4576 |
| 2039 | Ga0495595_0008305 | 3300053084 | Bacteria | 4262 |
| 2040 | Ga0495619_0002898 | 3300053085 | Bacteria | 11141 |
| 2041 | Ga0495619_0015975 | 3300053085 | Bacteria | 4751 |
| 2042 | Ga0495619_0077528 | 3300053085 | Bacteria | 2232 |
| 2043 | Ga0500578_0000102 | 3300053086 | Bacteria | 99108 |
| 2044 | Ga0500578_0213203 | 3300053086 | Bacteria | 1177 |
| 2045 | Ga0500643_001069 | 3300053087 | Bacteria | 16551 |
| 2046 | Ga0500643_001428 | 3300053087 | Bacteria | 13776 |
| 2047 | Ga0500643_002015 | 3300053087 | Bacteria | 10931 |
| 2048 | Ga0500643_037967 | 3300053087 | Bacteria | 1430 |
| 2049 | Ga0500644_0000290 | 3300053088 | Bacteria | 27182 |
| 2050 | Ga0500644_0006534 | 3300053088 | Bacteria | 2994 |
| 2051 | Ga0500644_0073460 | 3300053088 | Bacteria | 1239 |
| 2052 | Ga0500647_0003059 | 3300053091 | Bacteria | 6418 |
| 2053 | Ga0500651_0000984 | 3300053093 | Bacteria | 14035 |
| 2054 | Ga0500651_0013402 | 3300053093 | Bacteria | 4996 |
| 2055 | Ga0500566_0004593 | 3300053094 | Bacteria | 8226 |
| 2056 | Ga0500640_000515 | 3300053095 | Bacteria | 9693 |
| 2057 | Ga0500555_006631 | 3300053103 | Bacteria | 3290 |
| 2058 | Ga0500556_0000200 | 3300053104 | Bacteria | 49207 |
| 2059 | Ga0500556_0001879 | 3300053104 | Bacteria | 7539 |
| 2060 | Ga0500562_000497 | 3300053108 | Bacteria | 9556 |
| 2061 | Ga0500572_000529 | 3300053111 | Bacteria | 12963 |
| 2062 | Ga0500593_001627 | 3300053117 | Bacteria | 8090 |
| 2063 | Ga0500594_0002267 | 3300053118 | Bacteria | 4165 |
| 2064 | Ga0500597_000028 | 3300053120 | Bacteria | 31391 |
| 2065 | Ga0500608_000158 | 3300053122 | Bacteria | 28168 |
| 2066 | Ga0500614_004049 | 3300053123 | Bacteria | 3121 |
| 2067 | Ga0500614_005413 | 3300053123 | Bacteria | 2679 |
| 2068 | Ga0500618_000120 | 3300053125 | Bacteria | 64103 |
| 2069 | Ga0500628_000537 | 3300053129 | Bacteria | 6931 |
| 2070 | Ga0500642_0064213 | 3300053130 | Bacteria | 1657 |
| 2071 | Ga0500642_0083140 | 3300053130 | Bacteria | 1473 |
| 2072 | Ga0500658_0021557 | 3300053134 | Bacteria | 2442 |
| 2073 | Ga0500559_0000403 | 3300053136 | Bacteria | 31068 |
| 2074 | Ga0500559_0005605 | 3300053136 | Bacteria | 5755 |
| 2075 | Ga0500559_0021028 | 3300053136 | Bacteria | 2762 |
| 2076 | Ga0500559_0021554 | 3300053136 | Bacteria | 2731 |
| 2077 | Ga0500564_000115 | 3300053138 | Bacteria | 20253 |
| 2078 | Ga0500564_000291 | 3300053138 | Bacteria | 13918 |
| 2079 | Ga0500568_0016301 | 3300053139 | Bacteria | 3307 |
| 2080 | Ga0500568_0025658 | 3300053139 | Bacteria | 2483 |
| 2081 | Ga0500573_0044788 | 3300053140 | Bacteria | 2551 |
| 2082 | Ga0500616_0052065 | 3300053153 | Bacteria | 2154 |
| 2083 | Ga0500622_0000674 | 3300053156 | Bacteria | 30184 |
| 2084 | Ga0500622_0004041 | 3300053156 | Bacteria | 9441 |
| 2085 | Ga0500622_0020591 | 3300053156 | Bacteria | 3502 |
| 2086 | Ga0500622_0074155 | 3300053156 | Bacteria | 1715 |
| 2087 | Ga0500624_000075 | 3300053157 | Bacteria | 56822 |
| 2088 | Ga0500636_0000055 | 3300053177 | Bacteria | 54438 |
| 2089 | Ga0500637_0000681 | 3300053178 | Bacteria | 13513 |
| 2090 | Ga0500637_0053754 | 3300053178 | Bacteria | 2299 |
| 2091 | Ga0500567_001143 | 3300053723 | Bacteria | 10405 |
| 2092 | Ga0500625_000012 | 3300053729 | Bacteria | 127269 |
| 2093 | Ga0500625_009792 | 3300053729 | Bacteria | 4287 |
| 2094 | Ga0500645_000250 | 3300053730 | Bacteria | 40018 |
| 2095 | Ga0500645_001003 | 3300053730 | Bacteria | 15923 |
| 2096 | Ga0500645_008241 | 3300053730 | Bacteria | 3573 |
| 2097 | Ga0500645_008698 | 3300053730 | Bacteria | 3446 |
| 2098 | Ga0500609_001387 | 3300053731 | Bacteria | 3552 |
| 2099 | Ga0500587_001238 | 3300053739 | Bacteria | 3556 |
| 2100 | Ga0501084_0001450 | 3300054114 | Bacteria | 18818 |
| 2101 | Ga0501084_0012475 | 3300054114 | Bacteria | 7041 |
| 2102 | Ga0501082_0005168 | 3300060353 | Bacteria | 11354 |
| 2103 | Ga0501082_0006095 | 3300060353 | Bacteria | 10465 |
| 2104 | Ga0501082_0033315 | 3300060353 | Bacteria | 4445 |
| 2105 | Ga0466962_0000555 | 3300061719 | Bacteria | 16376 |
| 2106 | Ga0466962_0005147 | 3300061719 | Bacteria | 6290 |
| 2107 | Ga0530510_0000267 | 3300061734 | Bacteria | 32744 |
| 2108 | Ga0530510_0121791 | 3300061734 | Bacteria | 1915 |
| 2109 | 2501406879 | 2501025504 | Bacteria | 8008976 |
| 2110 | 2511097785 | 2510917014 | Bacteria | 8296963 |
| 2111 | 2511245969 | 2511231002 | Bacteria | 5042903 |
| 2112 | 2519460345 | 2519103095 | Bacteria | 6629912 |
| 2113 | 2525558312 | 2524614729 | Bacteria | 3091755 |
| 2114 | 2572255971 | 2571042365 | Bacteria | 3289345 |
| 2115 | 2585292648 | 2582581311 | Bacteria | 6763856 |
| 2116 | 2587759172 | 2585428062 | Bacteria | 6842168 |
| 2117 | 2595447692 | 2593339238 | Bacteria | 4182970 |
| 2118 | 2595450382 | 2593339239 | Bacteria | 4124669 |
| 2119 | 2599741329 | 2599185239 | Bacteria | 8686614 |
| 2120 | 2599747260 | 2599185240 | Bacteria | 7968121 |
| 2121 | 2599905713 | 2599185292 | Bacteria | 6290804 |
| 2122 | 2600209115 | 2599185355 | Bacteria | 7968906 |
| 2123 | 2630650300 | 2627854209 | Bacteria | 3093011 |
| 2124 | 2643860596 | 2643221569 | Bacteria | 6064337 |
| 2125 | 2643882244 | 2643221574 | Bacteria | 2789653 |
| 2126 | 2643981540 | 2643221594 | Bacteria | 5811388 |
| 2127 | 2644353395 | 2643221663 | Bacteria | 3425771 |
| 2128 | 2644549315 | 2643221699 | Bacteria | 5731501 |
| 2129 | 2644551440 | 2643221699 | Bacteria | 5731501 |
| 2130 | 2676745144 | 2675903129 | Bacteria | 7964495 |
| 2131 | 2729148598 | 2728369097 | Bacteria | 4333476 |
| 2132 | 2774871110 | 2773857925 | Bacteria | 6472445 |
| 2133 | 2808906743 | 2808606373 | Bacteria | 4423627 |
| 2134 | 2808973025 | 2808606384 | Bacteria | 8474373 |
| 2135 | 2809008147 | 2808606390 | Bacteria | 8476311 |
| 2136 | 2809014950 | 2808606391 | Bacteria | 8308166 |
| 2137 | 2809035447 | 2808606395 | Bacteria | 6020352 |
| 2138 | 2817257863 | 2816332253 | Bacteria | 6764532 |
| 2139 | 2817455998 | 2816332286 | Bacteria | 6853759 |
| 2140 | 2819635188 | 2818991452 | Bacteria | 8442785 |
| 2141 | 2819662386 | 2818991457 | Bacteria | 5323295 |
| 2142 | 2842922452 | 2842918807 | Bacteria | 4289178 |
| 2143 | 2852687898 | 2852684882 | Bacteria | 5463342 |
| 2144 | 2863427857 | 2863421361 | Bacteria | 7300805 |
| 2145 | 2870073562 | 2870068957 | Bacteria | 8925310 |
| 2146 | 2894512120 | 2894510363 | Bacteria | 5121143 |
| 2147 | 2904567559 | 2904564687 | Bacteria | 7609577 |
| 2148 | 2904574604 | 2904571731 | Bacteria | 7608790 |
| 2149 | 2919133032 | 2919130084 | Bacteria | 5301837 |
| 2150 | 2928158354 | 2928157003 | Bacteria | 7522202 |
| 2151 | 2928167442 | 2928163908 | Bacteria | 7561269 |
| 2152 | 2928177009 | 2928170801 | Bacteria | 8785406 |
| 2153 | 2928540281 | 2928536128 | Bacteria | 7657547 |
| 2154 | 2928966402 | 2928963466 | Bacteria | 5165703 |
| 2155 | 2929199329 | 2929195423 | Bacteria | 5325372 |
| 2156 | 2953996913 | 2953994433 | Bacteria | 4303959 |
| 2157 | 2981991815 | 2981990288 | Bacteria | 7590678 |
| 2158 | 642417434 | 641736154 | Bacteria | 7689995 |
| 2159 | 8001523336 | 8001522603 | Bacteria | 4726425 |
| 2160 | 8002394536 | 8002392321 | Bacteria | 4159911 |
| 2161 | 8003017602 | 8003014200 | Bacteria | 4059994 |
| 2162 | 8018850205 | 8018845410 | Bacteria | 8933938 |
| 2163 | 8020812240 | 8020807995 | Bacteria | 6801506 |
| 2164 | 8020941215 | 8020938398 | Bacteria | 7472757 |
| 2165 | 8020946740 | 8020945358 | Bacteria | 8467355 |
| 2166 | 8020958469 | 8020953355 | Bacteria | 7439080 |
| 2167 | 8021123866 | 8021120328 | Bacteria | 8782274 |
| 2168 | 8039100380 | 8039098773 | Bacteria | 6602928 |
| 2169 | 8040170759 | 8040167225 | Bacteria | 6542727 |
| 2170 | 8040176964 | 8040173305 | Bacteria | 6827067 |
| 2171 | 8045868635 | 8045864390 | Bacteria | 5043873 |
| 2172 | JGI25151J46595_10007622 | |||
| 2173 | SwRhRL2b_contig_719950 | |||
| 2174 | JGI24736J21556_1003706 | |||
| 2175 | JGI24736J21556_1018176 | |||
| 2176 | JGI24741J21665_1000800 | |||
| 2177 | JGI24741J21665_1000867 | |||
| 2178 | JGI24741J21665_1000873 | |||
| 2179 | JGI24741J21665_1002927 | |||
| 2180 | JGI24740J21852_10000833 | |||
| 2181 | JGI24740J21852_10002444 | |||
| 2182 | JGI24740J21852_10003279 | |||
| 2183 | JGI24740J21852_10011531 | |||
| 2184 | JGI24740J21852_10050988 | |||
| 2185 | JGI24739J22299_10003761 | |||
| 2186 | JGI24739J22299_10003964 | |||
| 2187 | JGI24737J22298_10004736 | |||
| 2188 | JGI24743J22301_10001171 | |||
| 2189 | JGI24735J21928_10001752 | |||
| 2190 | JGI24735J21928_10005070 | |||
| 2191 | JGI24738J21930_10002476 | |||
| 2192 | JGI24749J21850_1001805 | |||
| 2193 | JGI24033J26618_1001172 | |||
| 2194 | JGI24034J26672_10005980 | |||
| 2195 | JGI25155J39150_1000057 | |||
| 2196 | JGI25156J39149_1000073 | |||
| 2197 | JGI25156J39149_1000673 | |||
| 2198 | JGI25156J39149_1002242 | |||
| 2199 | JGI25162J39368_1000468 | |||
| 2200 | JGI25162J39368_1000971 | |||
| 2201 | JGI25162J39368_1001279 | |||
| 2202 | JGI25154J39366_1000097 | |||
| 2203 | JGI25154J39366_1001421 | |||
| 2204 | JGI25157J39369_1000075 | |||
| 2205 | JGI25157J39369_1000089 | |||
| 2206 | JGI25157J39369_1000469 | |||
| 2207 | JGI25157J39369_1000772 | |||
| 2208 | JGI25164J39214_1000193 | |||
| 2209 | JGI25164J39214_1000242 | |||
| 2210 | JGI25159J45721_1001136 | |||
| 2211 | JGI25159J45721_1005739 | |||
| 2212 | JGI25151J46595_10004543 | |||
| 2213 | JGI25151J46595_10029108 | |||
| 2214 | JGI25406J46586_10025745 | |||
| 2215 | JGI25165J46597_1000335 | |||
| 2216 | JGI25165J46597_1002530 | |||
| 2217 | JGI25160J50197_1000076 | |||
| 2218 | JGI26145J50221_1001413 | |||
| 2219 | JGI25161J50226_1000058 | |||
| 2220 | Ga0055539_1002563 | |||
| 2221 | Ga0055533_1000011 | |||
| 2222 | Ga0055533_1005444 | |||
| 2223 | Ga0055525_1000089 | |||
| 2224 | Ga0055525_1001594 | |||
| 2225 | Ga0055527_1000084 | |||
| 2226 | Ga0055527_1000206 | |||
| 2227 | Ga0055535_1000426 | |||
| 2228 | Ga0055535_1000639 | |||
| 2229 | Ga0055535_1000728 | |||
| 2230 | Ga0055542_1000057 | |||
| 2231 | Ga0055542_1000107 | |||
| 2232 | Ga0055542_1000195 | |||
| 2233 | Ga0055542_1000455 | |||
| 2234 | Ga0055529_1000460 | |||
| 2235 | Ga0055529_1000881 | |||
| 2236 | Ga0055526_1005666 | |||
| 2237 | Ga0055526_1005854 | |||
| 2238 | Ga0055537_1000730 | |||
| 2239 | Ga0055537_1014657 | |||
| 2240 | Ga0055524_1001067 | |||
| 2241 | Ga0055524_1003977 | |||
| 2242 | Ga0055536_1000621 | |||
| 2243 | Ga0055536_1001793 | |||
| 2244 | Ga0055536_1008264 | |||
| 2245 | Ga0055536_1008702 | |||
| 2246 | Ga0055534_1002014 | |||
| 2247 | Ga0055528_1006463 | |||
| 2248 | Ga0055530_10002477 | |||
| 2249 | Ga0055530_10006463 | |||
| 2250 | Ga0055530_10009456 | |||
| 2251 | Ga0055530_10014991 | |||
| 2252 | Ga0055540_1001926 | |||
| 2253 | Ga0055540_1005515 | |||
| 2254 | Ga0055531_10000450 | |||
| 2255 | Ga0055531_10002822 | |||
| 2256 | Ga0055531_10008906 | |||
| 2257 | Ga0055531_10010909 | |||
| 2258 | Ga0055531_10013622 | |||
| 2259 | Ga0055531_10040125 | |||
| 2260 | Ga0055531_10041520 | |||
| 2261 | Ga0058692_1000142 | |||
| 2262 | Ga0058692_1015531 | |||
| 2263 | Ga0055543_1002375 | |||
| 2264 | Ga0065165_1000949 | |||
| 2265 | Ga0065165_1004485 | |||
| 2266 | Ga0065165_1023570 | |||
| 2267 | Ga0065165_1037799 | |||
| 2268 | Ga0065165_1040512 | |||
| 2269 | Ga0065712_10084506 | |||
| 2270 | Ga0065715_10023686 | |||
| 2271 | Ga0065715_10118965 | |||
| 2272 | Ga0065715_10181169 | |||
| 2273 | Ga0065707_10118060 | |||
| 2274 | Ga0070658_10001353 | |||
| 2275 | Ga0070658_10003530 | |||
| 2276 | Ga0070658_10005606 | |||
| 2277 | Ga0070658_10011570 | |||
| 2278 | Ga0070658_10058004 | |||
| 2279 | Ga0070658_10070760 | |||
| 2280 | Ga0070658_10091592 | |||
| 2281 | Ga0070658_10117242 | |||
| 2282 | Ga0070658_10136788 | |||
| 2283 | Ga0070676_10015962 | |||
| 2284 | Ga0070676_10044461 | |||
| 2285 | Ga0070683_100007585 | |||
| 2286 | Ga0070683_100024660 | |||
| 2287 | Ga0070683_100037375 | |||
| 2288 | Ga0070683_100045251 | |||
| 2289 | Ga0070683_100064518 | |||
| 2290 | Ga0070690_100011275 | |||
| 2291 | Ga0070690_100015791 | |||
| 2292 | Ga0070690_100044508 | |||
| 2293 | Ga0070670_100000002 | |||
| 2294 | Ga0070670_100080375 | |||
| 2295 | Ga0070670_100101779 | |||
| 2296 | Ga0070670_100102372 | |||
| 2297 | Ga0070670_100102443 | |||
| 2298 | Ga0070670_100416273 | |||
| 2299 | Ga0070677_10008613 | |||
| 2300 | Ga0070677_10014193 | |||
| 2301 | Ga0068869_100025426 | |||
| 2302 | Ga0068869_100036648 | |||
| 2303 | Ga0068869_100049779 | |||
| 2304 | Ga0068869_100274068 | |||
| 2305 | Ga0070666_10122162 | |||
| 2306 | Ga0070680_100004287 | |||
| 2307 | Ga0070680_100008203 | |||
| 2308 | Ga0070680_100035878 | |||
| 2309 | Ga0070680_100055851 | |||
| 2310 | Ga0070680_100065166 | |||
| 2311 | Ga0070680_100128398 | |||
| 2312 | Ga0070680_100197564 | |||
| 2313 | Ga0070680_100204475 | |||
| 2314 | Ga0070680_100249745 | |||
| 2315 | Ga0070680_100286698 | |||
| 2316 | Ga0070682_100003586 | |||
| 2317 | Ga0070682_100057489 | |||
| 2318 | Ga0070682_100068347 | |||
| 2319 | Ga0070682_100080136 | |||
| 2320 | Ga0070682_100087362 | |||
| 2321 | Ga0070682_100221678 | |||
| 2322 | Ga0068868_100028093 | |||
| 2323 | Ga0068868_100062772 | |||
| 2324 | Ga0070660_100000006 | |||
| 2325 | Ga0070660_100000378 | |||
| 2326 | Ga0070660_100004561 | |||
| 2327 | Ga0070660_100005115 | |||
| 2328 | Ga0070660_100025856 | |||
| 2329 | Ga0070660_100031954 | |||
| 2330 | Ga0070660_100036722 | |||
| 2331 | Ga0070660_100046895 | |||
| 2332 | Ga0070660_100047116 | |||
| 2333 | Ga0070660_100048131 | |||
| 2334 | Ga0070689_100000001 | |||
| 2335 | Ga0070689_100000908 | |||
| 2336 | Ga0070689_100034696 | |||
| 2337 | Ga0070689_100078629 | |||
| 2338 | Ga0070689_100349627 | |||
| 2339 | Ga0070691_10000225 | |||
| 2340 | Ga0070691_10037443 | |||
| 2341 | Ga0070687_100054025 | |||
| 2342 | Ga0070661_100000697 | |||
| 2343 | Ga0070661_100002483 | |||
| 2344 | Ga0070661_100006538 | |||
| 2345 | Ga0070661_100007312 | |||
| 2346 | Ga0070661_100007351 | |||
| 2347 | Ga0070661_100008194 | |||
| 2348 | Ga0070661_100017270 | |||
| 2349 | Ga0070661_100093035 | |||
| 2350 | Ga0070661_100094016 | |||
| 2351 | Ga0070661_100143156 | |||
| 2352 | Ga0070661_100163917 | |||
| 2353 | Ga0070661_100178757 | |||
| 2354 | Ga0070692_10022026 | |||
| 2355 | Ga0070692_10209677 | |||
| 2356 | Ga0070668_100020914 | |||
| 2357 | Ga0070668_100026755 | |||
| 2358 | Ga0070668_100101492 | |||
| 2359 | Ga0070669_100002974 | |||
| 2360 | Ga0070669_100025109 | |||
| 2361 | Ga0070669_100072519 | |||
| 2362 | Ga0070669_100110163 | |||
| 2363 | Ga0070669_100131910 | |||
| 2364 | Ga0070675_100027074 | |||
| 2365 | Ga0070675_100060456 | |||
| 2366 | Ga0070675_100152298 | |||
| 2367 | Ga0070675_100170806 | |||
| 2368 | Ga0070671_100000047 | |||
| 2369 | Ga0070671_100001263 | |||
| 2370 | Ga0070671_100018028 | |||
| 2371 | Ga0070671_100042151 | |||
| 2372 | Ga0070671_100092608 | |||
| 2373 | Ga0070671_100166376 | |||
| 2374 | Ga0070671_100304197 | |||
| 2375 | Ga0070671_100304496 | |||
| 2376 | Ga0070673_100001025 | |||
| 2377 | Ga0070673_100038215 | |||
| 2378 | Ga0070673_100133891 | |||
| 2379 | Ga0070673_100178224 | |||
| 2380 | Ga0070673_100240206 | |||
| 2381 | Ga0070688_100029825 | |||
| 2382 | Ga0070688_100126319 | |||
| 2383 | Ga0070688_100141474 | |||
| 2384 | Ga0070659_100000082 | |||
| 2385 | Ga0070659_100001873 | |||
| 2386 | Ga0070659_100003652 | |||
| 2387 | Ga0070659_100013172 | |||
| 2388 | Ga0070659_100026087 | |||
| 2389 | Ga0070659_100029716 | |||
| 2390 | Ga0070659_100044848 | |||
| 2391 | Ga0070659_100050838 | |||
| 2392 | Ga0070659_100082379 | |||
| 2393 | Ga0070659_100083949 | |||
| 2394 | Ga0070659_100209363 | |||
| 2395 | Ga0070659_100348957 | |||
| 2396 | Ga0070667_100000018 | |||
| 2397 | Ga0070667_100000136 | |||
| 2398 | Ga0070667_100001189 | |||
| 2399 | Ga0070667_100002630 | |||
| 2400 | Ga0070667_100152524 | |||
| 2401 | Ga0070667_100287926 | |||
| 2402 | Ga0070667_100332894 | |||
| 2403 | Ga0070709_10002390 | |||
| 2404 | Ga0070709_10011717 | |||
| 2405 | Ga0070714_100000079 | |||
| 2406 | Ga0070714_100001813 | |||
| 2407 | Ga0070714_100003909 | |||
| 2408 | Ga0070714_100005545 | |||
| 2409 | Ga0070714_100016187 | |||
| 2410 | Ga0070714_100032402 | |||
| 2411 | Ga0070714_100106704 | |||
| 2412 | Ga0070713_100027496 | |||
| 2413 | Ga0070713_100027807 | |||
| 2414 | Ga0070711_100022012 | |||
| 2415 | Ga0070711_100113121 | |||
| 2416 | Ga0070705_100008150 | |||
| 2417 | Ga0070705_100066153 | |||
| 2418 | Ga0070700_100009824 | |||
| 2419 | Ga0070700_100040823 | |||
| 2420 | Ga0070700_100050672 | |||
| 2421 | Ga0070708_100090787 | |||
| 2422 | Ga0070663_100000069 | |||
| 2423 | Ga0070663_100000204 | |||
| 2424 | Ga0070663_100002048 | |||
| 2425 | Ga0070663_100010569 | |||
| 2426 | Ga0070663_100011864 | |||
| 2427 | Ga0070663_100017483 | |||
| 2428 | Ga0070663_100056714 | |||
| 2429 | Ga0070663_100070594 | |||
| 2430 | Ga0070663_100087373 | |||
| 2431 | Ga0070663_100124726 | |||
| 2432 | Ga0070663_100156761 | |||
| 2433 | Ga0070663_100165351 | |||
| 2434 | Ga0070663_100206060 | |||
| 2435 | Ga0070663_100373390 | |||
| 2436 | Ga0070678_100004415 | |||
| 2437 | Ga0070678_100035451 | |||
| 2438 | Ga0070678_100072802 | |||
| 2439 | Ga0070678_100092613 | |||
| 2440 | Ga0070678_100294093 | |||
| 2441 | Ga0070662_100000546 | |||
| 2442 | Ga0070662_100038980 | |||
| 2443 | Ga0070662_100103515 | |||
| 2444 | Ga0070681_10000186 | |||
| 2445 | Ga0070681_10001722 | |||
| 2446 | Ga0070681_10001805 | |||
| 2447 | Ga0070681_10016914 | |||
| 2448 | Ga0070681_10028888 | |||
| 2449 | Ga0070681_10209235 | |||
| 2450 | Ga0070681_10313016 | |||
| 2451 | Ga0070685_10000011 | |||
| 2452 | Ga0070685_10005572 | |||
| 2453 | Ga0070685_10012813 | |||
| 2454 | Ga0070685_10037523 | |||
| 2455 | Ga0070685_10202572 | |||
| 2456 | Ga0070706_100075356 | |||
| 2457 | Ga0070698_100002222 | |||
| 2458 | Ga0070699_100006475 | |||
| 2459 | Ga0070699_100093465 | |||
| 2460 | Ga0070679_100000168 | |||
| 2461 | Ga0070679_100000209 | |||
| 2462 | Ga0070679_100006033 | |||
| 2463 | Ga0070679_100015243 | |||
| 2464 | Ga0070679_100017095 | |||
| 2465 | Ga0070679_100046964 | |||
| 2466 | Ga0070679_100098164 | |||
| 2467 | Ga0070679_100222455 | |||
| 2468 | Ga0070679_100245652 | |||
| 2469 | Ga0070679_100246614 | |||
| 2470 | Ga0070679_100321364 | |||
| 2471 | Ga0070684_100004281 | |||
| 2472 | Ga0070684_100013549 | |||
| 2473 | Ga0070684_100020604 | |||
| 2474 | Ga0070684_100051000 | |||
| 2475 | Ga0068853_100002701 | |||
| 2476 | Ga0068853_100008568 | |||
| 2477 | Ga0068853_100018661 | |||
| 2478 | Ga0068853_100025749 | |||
| 2479 | Ga0068853_100067167 | |||
| 2480 | Ga0068853_100116026 | |||
| 2481 | Ga0068853_100143380 | |||
| 2482 | Ga0068853_100156669 | |||
| 2483 | Ga0068853_100212350 | |||
| 2484 | Ga0068853_100295223 | |||
| 2485 | Ga0070672_100021972 | |||
| 2486 | Ga0070672_100043703 | |||
| 2487 | Ga0070672_100142343 | |||
| 2488 | Ga0070672_100297086 | |||
| 2489 | Ga0070686_100030021 | |||
| 2490 | Ga0070695_100008874 | |||
| 2491 | Ga0070696_100001072 | |||
| 2492 | Ga0070696_100003297 | |||
| 2493 | Ga0070696_100030889 | |||
| 2494 | Ga0070696_100055603 | |||
| 2495 | Ga0070696_100064029 | |||
| 2496 | Ga0070693_100034600 | |||
| 2497 | Ga0070693_100036637 | |||
| 2498 | Ga0070693_100082785 | |||
| 2499 | Ga0070665_100003964 | |||
| 2500 | Ga0070665_100007774 | |||
| 2501 | Ga0070665_100019771 | |||
| 2502 | Ga0070665_100025711 | |||
| 2503 | Ga0070665_100057362 | |||
| 2504 | Ga0068855_100000036 | |||
| 2505 | Ga0068855_100000480 | |||
| 2506 | Ga0068855_100001533 | |||
| 2507 | Ga0068855_100004530 | |||
| 2508 | Ga0068855_100007664 | |||
| 2509 | Ga0068855_100026190 | |||
| 2510 | Ga0068855_100026592 | |||
| 2511 | Ga0068855_100030225 | |||
| 2512 | Ga0068855_100050548 | |||
| 2513 | Ga0068855_100102087 | |||
| 2514 | Ga0068855_100109262 | |||
| 2515 | Ga0068855_100136938 | |||
| 2516 | Ga0068855_100171276 | |||
| 2517 | Ga0068855_100197425 | |||
| 2518 | Ga0068855_100399817 | |||
| 2519 | Ga0070664_100000152 | |||
| 2520 | Ga0070664_100002216 | |||
| 2521 | Ga0070664_100002766 | |||
| 2522 | Ga0070664_100004863 | |||
| 2523 | Ga0070664_100031462 | |||
| 2524 | Ga0070664_100037535 | |||
| 2525 | Ga0070664_100065976 | |||
| 2526 | Ga0070664_100192630 | |||
| 2527 | Ga0070664_100335752 | |||
| 2528 | Ga0068857_100011649 | |||
| 2529 | Ga0068857_100018647 | |||
| 2530 | Ga0068857_100020611 | |||
| 2531 | Ga0068857_100023989 | |||
| 2532 | Ga0068857_100080701 | |||
| 2533 | Ga0068857_100090959 | |||
| 2534 | Ga0068857_100125818 | |||
| 2535 | Ga0068857_100560876 | |||
| 2536 | Ga0068854_100000190 | |||
| 2537 | Ga0068854_100005665 | |||
| 2538 | Ga0068854_100007267 | |||
| 2539 | Ga0068854_100014610 | |||
| 2540 | Ga0068854_100014693 | |||
| 2541 | Ga0068854_100019713 | |||
| 2542 | Ga0068854_100089482 | |||
| 2543 | Ga0068854_100129743 | |||
| 2544 | Ga0068854_100132664 | |||
| 2545 | Ga0068856_100000409 | |||
| 2546 | Ga0068856_100000871 | |||
| 2547 | Ga0068856_100004156 | |||
| 2548 | Ga0068856_100004503 | |||
| 2549 | Ga0068856_100020224 | |||
| 2550 | Ga0068856_100062649 | |||
| 2551 | Ga0068856_100067352 | |||
| 2552 | Ga0068856_100077891 | |||
| 2553 | Ga0068856_100149033 | |||
| 2554 | Ga0068856_100282905 | |||
| 2555 | Ga0068856_100343183 | |||
| 2556 | Ga0068856_100375518 | |||
| 2557 | Ga0068856_100460519 | |||
| 2558 | Ga0070702_100026916 | |||
| 2559 | Ga0070702_100038356 | |||
| 2560 | Ga0070702_100207622 | |||
| 2561 | Ga0068852_100006255 | |||
| 2562 | Ga0068852_100012065 | |||
| 2563 | Ga0068852_100015026 | |||
| 2564 | Ga0068852_100023687 | |||
| 2565 | Ga0068852_100035141 | |||
| 2566 | Ga0068852_100048219 | |||
| 2567 | Ga0068852_100052885 | |||
| 2568 | Ga0068852_100122524 | |||
| 2569 | Ga0068852_100318374 | |||
| 2570 | Ga0068859_100003324 | |||
| 2571 | Ga0068859_100013908 | |||
| 2572 | Ga0068859_100018022 | |||
| 2573 | Ga0068859_100034393 | |||
| 2574 | Ga0068859_100091461 | |||
| 2575 | Ga0068864_100000003 | |||
| 2576 | Ga0068864_100015374 | |||
| 2577 | Ga0068864_100022493 | |||
| 2578 | Ga0068864_100029374 | |||
| 2579 | Ga0068864_100032138 | |||
| 2580 | Ga0068864_100038634 | |||
| 2581 | Ga0068864_100051693 | |||
| 2582 | Ga0068864_100065129 | |||
| 2583 | Ga0068864_100065381 | |||
| 2584 | Ga0068864_100072359 | |||
| 2585 | Ga0068864_100130939 | |||
| 2586 | Ga0068864_100139768 | |||
| 2587 | Ga0068864_100168939 | |||
| 2588 | Ga0068866_10004226 | |||
| 2589 | Ga0068861_100008881 | |||
| 2590 | Ga0068861_100022627 | |||
| 2591 | Ga0068861_100022771 | |||
| 2592 | Ga0068861_100069845 | |||
| 2593 | Ga0068851_10003350 | |||
| 2594 | Ga0068851_10010852 | |||
| 2595 | Ga0068851_10016754 | |||
| 2596 | Ga0068851_10025248 | |||
| 2597 | Ga0068851_10120751 | |||
| 2598 | Ga0068863_100000676 | |||
| 2599 | Ga0068863_100015016 | |||
| 2600 | Ga0068863_100018221 | |||
| 2601 | Ga0068863_100020554 | |||
| 2602 | Ga0068863_100043692 | |||
| 2603 | Ga0068863_100047277 | |||
| 2604 | Ga0068863_100089543 | |||
| 2605 | Ga0068863_100105072 | |||
| 2606 | Ga0068863_100177808 | |||
| 2607 | Ga0068858_100007507 | |||
| 2608 | Ga0068858_100183499 | |||
| 2609 | Ga0068860_100004338 | |||
| 2610 | Ga0068860_100005019 | |||
| 2611 | Ga0068860_100032807 | |||
| 2612 | Ga0068860_100034112 | |||
| 2613 | Ga0068860_100048959 | |||
| 2614 | Ga0068860_100074436 | |||
| 2615 | Ga0068862_100000550 | |||
| 2616 | Ga0068862_100001116 | |||
| 2617 | Ga0068862_100024262 | |||
| 2618 | Ga0068862_100028576 | |||
| 2619 | Ga0068862_100048865 | |||
| 2620 | Ga0068862_100531222 | |||
| 2621 | Ga0081455_10000066 | |||
| 2622 | Ga0081455_10001237 | |||
| 2623 | Ga0081539_10001910 | |||
| 2624 | Ga0070717_10002720 | |||
| 2625 | Ga0070717_10003857 | |||
| 2626 | Ga0070717_10048918 | |||
| 2627 | Ga0070717_10472666 | |||
| 2628 | Ga0075365_10060459 | |||
| 2629 | Ga0075363_100011681 | |||
| 2630 | Ga0075363_100147866 | |||
| 2631 | Ga0075364_10026765 | |||
| 2632 | Ga0070716_100073708 | |||
| 2633 | Ga0070716_100147098 | |||
| 2634 | Ga0075369_10052301 | |||
| 2635 | Ga0075366_10012523 | |||
| 2636 | Ga0075366_10099029 | |||
| 2637 | Ga0075366_10101296 | |||
| 2638 | Ga0097621_100005667 | |||
| 2639 | Ga0097621_100029431 | |||
| 2640 | Ga0097621_100038404 | |||
| 2641 | Ga0097621_100054938 | |||
| 2642 | Ga0097621_100213191 | |||
| 2643 | Ga0097621_100219439 | |||
| 2644 | Ga0097621_100490550 | |||
| 2645 | Ga0075370_10004592 | |||
| 2646 | Ga0075370_10008051 | |||
| 2647 | Ga0075370_10026557 | |||
| 2648 | Ga0075370_10090032 | |||
| 2649 | Ga0075370_10110310 | |||
| 2650 | Ga0068871_100000930 | |||
| 2651 | Ga0068871_100053826 | |||
| 2652 | Ga0068871_100054239 | |||
| 2653 | Ga0068871_100148555 | |||
| 2654 | Ga0068871_100169330 | |||
| 2655 | Ga0068871_100201616 | |||
| 2656 | Ga0075428_100317283 | |||
| 2657 | Ga0075430_100006474 | |||
| 2658 | Ga0075430_100028405 | |||
| 2659 | Ga0075430_100274356 | |||
| 2660 | Ga0075431_100019689 | |||
| 2661 | Ga0075431_100032826 | |||
| 2662 | Ga0075431_100057239 | |||
| 2663 | Ga0075433_10023918 | |||
| 2664 | Ga0075434_100438413 | |||
| 2665 | Ga0075429_100168055 | |||
| 2666 | Ga0068865_100038247 | |||
| 2667 | Ga0068865_100087868 | |||
| 2668 | Ga0075436_100038337 | |||
| 2669 | Ga0097620_100003324 | |||
| 2670 | Ga0097620_100013909 | |||
| 2671 | Ga0097620_100018020 | |||
| 2672 | Ga0097620_100034393 | |||
| 2673 | Ga0097620_100091464 | |||
| 2674 | Ga0079104_1016454 | |||
| 2675 | Ga0075435_100062520 | |||
| 2676 | Ga0075435_100240315 | |||
| 2677 | Ga0099794_10007575 | |||
| 2678 | Ga0099795_10000375 | |||
| 2679 | Ga0105240_10001797 | |||
| 2680 | Ga0105240_10004421 | |||
| 2681 | Ga0105240_10023500 | |||
| 2682 | Ga0105240_10028258 | |||
| 2683 | Ga0105240_10039469 | |||
| 2684 | Ga0105240_10068076 | |||
| 2685 | Ga0105240_10140267 | |||
| 2686 | Ga0105240_10195986 | |||
| 2687 | Ga0105240_10263066 | |||
| 2688 | Ga0105240_10306918 | |||
| 2689 | Ga0105240_10656185 | |||
| 2690 | Ga0111539_10057264 | |||
| 2691 | Ga0105245_10015709 | |||
| 2692 | Ga0105245_10272104 | |||
| 2693 | Ga0105247_10055366 | |||
| 2694 | Ga0114129_10010131 | |||
| 2695 | Ga0114129_10028488 | |||
| 2696 | Ga0114129_10110971 | |||
| 2697 | Ga0114129_10199985 | |||
| 2698 | Ga0114129_10596294 | |||
| 2699 | Ga0105243_10098111 | |||
| 2700 | Ga0105243_10142412 | |||
| 2701 | Ga0105241_10016286 | |||
| 2702 | Ga0105241_10023539 | |||
| 2703 | Ga0105241_10214386 | |||
| 2704 | Ga0105241_10290255 | |||
| 2705 | Ga0105242_10140285 | |||
| 2706 | Ga0105248_10001300 | |||
| 2707 | Ga0105248_10003092 | |||
| 2708 | Ga0105248_10011726 | |||
| 2709 | Ga0105248_10038844 | |||
| 2710 | Ga0105248_10075626 | |||
| 2711 | Ga0105248_10145097 | |||
| 2712 | Ga0105248_10224022 | |||
| 2713 | Ga0105248_10253051 | |||
| 2714 | Ga0105248_10295518 | |||
| 2715 | Ga0105248_10399827 | |||
| 2716 | Ga0105248_10436412 | |||
| 2717 | Ga0105237_10020873 | |||
| 2718 | Ga0105237_10046769 | |||
| 2719 | Ga0105237_10060291 | |||
| 2720 | Ga0105237_10061882 | |||
| 2721 | Ga0105237_10113145 | |||
| 2722 | Ga0105237_10248072 | |||
| 2723 | Ga0105237_10396390 | |||
| 2724 | Ga0105237_10422306 | |||
| 2725 | Ga0105238_10000864 | |||
| 2726 | Ga0105238_10003335 | |||
| 2727 | Ga0105238_10010092 | |||
| 2728 | Ga0105238_10057176 | |||
| 2729 | Ga0105238_10071848 | |||
| 2730 | Ga0105238_10078033 | |||
| 2731 | Ga0105238_10141550 | |||
| 2732 | Ga0105238_10141928 | |||
| 2733 | Ga0105238_10154215 | |||
| 2734 | Ga0105238_10161842 | |||
| 2735 | Ga0105238_10208849 | |||
| 2736 | Ga0105238_10239149 | |||
| 2737 | Ga0105238_10362978 | |||
| 2738 | Ga0105249_10000195 | |||
| 2739 | Ga0105249_10021588 | |||
| 2740 | Ga0105249_10028673 | |||
| 2741 | Ga0105249_10078976 | |||
| 2742 | Ga0099796_10000691 | |||
| 2743 | Ga0105239_10029266 | |||
| 2744 | Ga0105239_10048993 | |||
| 2745 | Ga0105239_10067091 | |||
| 2746 | Ga0105239_10082305 | |||
| 2747 | Ga0105239_10090653 | |||
| 2748 | Ga0105239_10096260 | |||
| 2749 | Ga0105239_10122764 | |||
| 2750 | Ga0105246_10043591 | |||
| 2751 | Ga0105246_10243297 | |||
| 2752 | Ga0157373_10011386 | |||
| 2753 | Ga0157373_10012292 | |||
| 2754 | Ga0157373_10022939 | |||
| 2755 | Ga0157373_10036718 | |||
| 2756 | Ga0157373_10062337 | |||
| 2757 | Ga0157373_10084911 | |||
| 2758 | Ga0157373_10113382 | |||
| 2759 | Ga0157373_10129460 | |||
| 2760 | Ga0157373_10158310 | |||
| 2761 | Ga0157371_10001396 | |||
| 2762 | Ga0157371_10083526 | |||
| 2763 | Ga0157371_10092881 | |||
| 2764 | Ga0157371_10093688 | |||
| 2765 | Ga0157371_10120715 | |||
| 2766 | Ga0157371_10125727 | |||
| 2767 | Ga0157370_10000793 | |||
| 2768 | Ga0157370_10006992 | |||
| 2769 | Ga0157370_10007658 | |||
| 2770 | Ga0157370_10017138 | |||
| 2771 | Ga0157370_10112349 | |||
| 2772 | Ga0157370_10128016 | |||
| 2773 | Ga0157370_10145186 | |||
| 2774 | Ga0157370_10179950 | |||
| 2775 | Ga0157370_10181923 | |||
| 2776 | Ga0157370_10285818 | |||
| 2777 | Ga0157370_10323000 | |||
| 2778 | Ga0157370_10383065 | |||
| 2779 | Ga0157369_10000185 | |||
| 2780 | Ga0157369_10004153 | |||
| 2781 | Ga0157369_10008454 | |||
| 2782 | Ga0157369_10040968 | |||
| 2783 | Ga0157369_10065759 | |||
| 2784 | Ga0157369_10135362 | |||
| 2785 | Ga0157369_10509066 | |||
| 2786 | Ga0157374_10019967 | |||
| 2787 | Ga0157374_10034227 | |||
| 2788 | Ga0157374_10080136 | |||
| 2789 | Ga0157374_10086107 | |||
| 2790 | Ga0157374_10090083 | |||
| 2791 | Ga0157374_10107629 | |||
| 2792 | Ga0157374_10137624 | |||
| 2793 | Ga0157374_10175451 | |||
| 2794 | Ga0157374_10401366 | |||
| 2795 | Ga0157378_10034473 | |||
| 2796 | Ga0157378_10214988 | |||
| 2797 | Ga0157378_10341662 | |||
| 2798 | Ga0163162_10000021 | |||
| 2799 | Ga0163162_10081285 | |||
| 2800 | Ga0163162_10815076 | |||
| 2801 | Ga0157372_10002671 | |||
| 2802 | Ga0157372_10024015 | |||
| 2803 | Ga0157372_10025492 | |||
| 2804 | Ga0157372_10026197 | |||
| 2805 | Ga0157372_10059284 | |||
| 2806 | Ga0157372_10101095 | |||
| 2807 | Ga0157372_10104398 | |||
| 2808 | Ga0157372_10120965 | |||
| 2809 | Ga0157372_10142936 | |||
| 2810 | Ga0157372_10193241 | |||
| 2811 | Ga0157372_10201177 | |||
| 2812 | Ga0157372_10232360 | |||
| 2813 | Ga0157372_10252443 | |||
| 2814 | Ga0157372_10280912 | |||
| 2815 | Ga0157372_10454398 | |||
| 2816 | Ga0157375_10002586 | |||
| 2817 | Ga0157375_10007788 | |||
| 2818 | Ga0157375_10019559 | |||
| 2819 | Ga0157375_10036322 | |||
| 2820 | Ga0157375_10054977 | |||
| 2821 | Ga0157375_10078869 | |||
| 2822 | Ga0157375_10173230 | |||
| 2823 | Ga0163163_10000132 | |||
| 2824 | Ga0163163_10001449 | |||
| 2825 | Ga0163163_10036340 | |||
| 2826 | Ga0163163_10130413 | |||
| 2827 | Ga0163163_10228447 | |||
| 2828 | Ga0163163_10400697 | |||
| 2829 | Ga0163163_10458181 | |||
| 2830 | Ga0157380_10000114 | |||
| 2831 | Ga0157380_10040570 | |||
| 2832 | Ga0182008_10008704 | |||
| 2833 | Ga0182008_10008890 | |||
| 2834 | Ga0157377_10057967 | |||
| 2835 | Ga0157379_10000505 | |||
| 2836 | Ga0157379_10009200 | |||
| 2837 | Ga0157379_10017855 | |||
| 2838 | Ga0157379_10224730 | |||
| 2839 | Ga0157376_10002600 | |||
| 2840 | Ga0157376_10030928 | |||
| 2841 | Ga0157376_10042383 | |||
| 2842 | Ga0157376_10100800 | |||
| 2843 | Ga0157376_10129041 | |||
| 2844 | Ga0157376_10240571 | |||
| 2845 | Ga0157376_10571598 | |||
| 2846 | Ga0182006_1000161 | |||
| 2847 | Ga0182006_1022511 | |||
| 2848 | Ga0182007_10009993 | |||
| 2849 | Ga0182007_10031769 | |||
| 2850 | Ga0182005_1004688 | |||
| 2851 | Ga0182005_1004909 | |||
| 2852 | Ga0183368_1003 | |||
| 2853 | Ga0163161_10046242 | |||
| 2854 | Ga0163161_10131379 | |||
| 2855 | Ga0163161_10188067 | |||
| 2856 | Ga0206356_10235604 | |||
| 2857 | Ga0206351_10193420 | |||
| 2858 | Ga0206354_10341756 | |||
| 2859 | Ga0206353_10095998 | |||
| 2860 | Ga0154015_1244858 | |||
| 2861 | Ga0154015_1402022 | |||
| 2862 | Ga0213873_10024325 | |||
| 2863 | Ga0213874_10033033 | |||
| 2864 | Ga0213876_10011988 | |||
| 2865 | Ga0213876_10023781 | |||
| 2866 | Ga0209435_100008 | |||
| 2867 | Ga0209436_110535 | |||
| 2868 | Ga0209566_100231 | |||
| 2869 | Ga0209674_100003 | |||
| 2870 | Ga0209674_100086 | |||
| 2871 | Ga0209674_100488 | |||
| 2872 | Ga0209674_100751 | |||
| 2873 | Ga0209672_100020 | |||
| 2874 | Ga0209672_100029 | |||
| 2875 | Ga0209672_100049 | |||
| 2876 | Ga0209672_100066 | |||
| 2877 | Ga0209147_100024 | |||
| 2878 | Ga0209147_100084 | |||
| 2879 | Ga0209563_100010 | |||
| 2880 | Ga0209563_100051 | |||
| 2881 | Ga0207427_100117 | |||
| 2882 | Ga0207427_100178 | |||
| 2883 | Ga0207427_101735 | |||
| 2884 | Ga0207427_102934 | |||
| 2885 | Ga0209437_100240 | |||
| 2886 | Ga0209437_100304 | |||
| 2887 | Ga0209437_100482 | |||
| 2888 | Ga0209437_101084 | |||
| 2889 | Ga0209258_100053 | |||
| 2890 | Ga0209258_100084 | |||
| 2891 | Ga0209258_100087 | |||
| 2892 | Ga0209258_100117 | |||
| 2893 | Ga0209258_100144 | |||
| 2894 | Ga0209258_100647 | |||
| 2895 | Ga0209258_102270 | |||
| 2896 | Ga0207425_1010948 | |||
| 2897 | Ga0209646_1000029 | |||
| 2898 | Ga0209646_1000066 | |||
| 2899 | Ga0209026_1000016 | |||
| 2900 | Ga0209026_1000027 | |||
| 2901 | Ga0209026_1000074 | |||
| 2902 | Ga0209026_1000093 | |||
| 2903 | Ga0209026_1001064 | |||
| 2904 | Ga0209677_100044 | |||
| 2905 | Ga0209677_100128 | |||
| 2906 | Ga0209677_101339 | |||
| 2907 | Ga0209677_102377 | |||
| 2908 | Ga0209148_1000009 | |||
| 2909 | Ga0209148_1000055 | |||
| 2910 | Ga0209148_1000096 | |||
| 2911 | Ga0209148_1000114 | |||
| 2912 | Ga0209148_1000141 | |||
| 2913 | Ga0209148_1000148 | |||
| 2914 | Ga0209148_1001683 | |||
| 2915 | Ga0209759_1000016 | |||
| 2916 | Ga0209759_1000110 | |||
| 2917 | Ga0209759_1000387 | |||
| 2918 | Ga0209759_1006844 | |||
| 2919 | Ga0209759_1008612 | |||
| 2920 | Ga0209129_1009361 | |||
| 2921 | Ga0209233_1000083 | |||
| 2922 | Ga0209233_1000287 | |||
| 2923 | Ga0209233_1000417 | |||
| 2924 | Ga0209565_1000041 | |||
| 2925 | Ga0209565_1000597 | |||
| 2926 | Ga0209565_1003353 | |||
| 2927 | Ga0209565_1008241 | |||
| 2928 | Ga0209455_1000060 | |||
| 2929 | Ga0209455_1000088 | |||
| 2930 | Ga0209455_1000110 | |||
| 2931 | Ga0209455_1003953 | |||
| 2932 | Ga0209673_1000057 | |||
| 2933 | Ga0209673_1001316 | |||
| 2934 | Ga0209673_1002473 | |||
| 2935 | Ga0209130_1000014 | |||
| 2936 | Ga0209130_1003456 | |||
| 2937 | Ga0209130_1005797 | |||
| 2938 | Ga0209675_1000783 | |||
| 2939 | Ga0209675_1010551 | |||
| 2940 | Ga0209675_1012756 | |||
| 2941 | Ga0209676_1000013 | |||
| 2942 | Ga0209676_1000153 | |||
| 2943 | Ga0209676_1000414 | |||
| 2944 | Ga0209676_1000928 | |||
| 2945 | Ga0209676_1000971 | |||
| 2946 | Ga0209676_1001166 | |||
| 2947 | Ga0209676_1002764 | |||
| 2948 | Ga0209676_1005511 | |||
| 2949 | Ga0209025_1000819 | |||
| 2950 | Ga0209025_1003991 | |||
| 2951 | Ga0209025_1013203 | |||
| 2952 | Ga0209564_1001403 | |||
| 2953 | Ga0209564_1002122 | |||
| 2954 | Ga0209564_1004135 | |||
| 2955 | Ga0209564_1005783 | |||
| 2956 | Ga0209564_1013128 | |||
| 2957 | Ga0209564_1017578 | |||
| 2958 | Ga0209758_1004353 | |||
| 2959 | Ga0209758_1004543 | |||
| 2960 | Ga0209758_1010044 | |||
| 2961 | Ga0209758_1032092 | |||
| 2962 | Ga0209050_1000008 | |||
| 2963 | Ga0209050_1001001 | |||
| 2964 | Ga0209050_1001040 | |||
| 2965 | Ga0209050_1002812 | |||
| 2966 | Ga0209050_1005563 | |||
| 2967 | Ga0209050_1006477 | |||
| 2968 | Ga0209050_1012340 | |||
| 2969 | Ga0209050_1013887 | |||
| 2970 | Ga0209256_1000039 | |||
| 2971 | Ga0209256_1000670 | |||
| 2972 | Ga0209256_1001995 | |||
| 2973 | Ga0209256_1010505 | |||
| 2974 | Ga0209256_1010741 | |||
| 2975 | Ga0209256_1013905 | |||
| 2976 | Ga0207426_1000174 | |||
| 2977 | Ga0207426_1002190 | |||
| 2978 | Ga0209051_1000005 | |||
| 2979 | Ga0209051_1000354 | |||
| 2980 | Ga0209051_1001411 | |||
| 2981 | Ga0209051_1011234 | |||
| 2982 | Ga0209051_1017460 | |||
| 2983 | Ga0209257_1000031 | |||
| 2984 | Ga0209257_1000184 | |||
| 2985 | Ga0209257_1000186 | |||
| 2986 | Ga0209257_1000616 | |||
| 2987 | Ga0209257_1000916 | |||
| 2988 | Ga0209257_1001656 | |||
| 2989 | Ga0209257_1002298 | |||
| 2990 | Ga0209257_1002620 | |||
| 2991 | Ga0209257_1008929 | |||
| 2992 | Ga0209257_1015048 | |||
| 2993 | Ga0207697_10000097 | |||
| 2994 | Ga0207697_10010256 | |||
| 2995 | Ga0207697_10028013 | |||
| 2996 | Ga0207656_10001616 | |||
| 2997 | Ga0207656_10020861 | |||
| 2998 | Ga0207656_10029893 | |||
| 2999 | Ga0207656_10089236 | |||
| 3000 | Ga0207682_10000606 | |||
| 3001 | Ga0207682_10009513 | |||
| 3002 | Ga0207688_10000116 | |||
| 3003 | Ga0207680_10017501 | |||
| 3004 | Ga0207647_10001462 | |||
| 3005 | Ga0207647_10001869 | |||
| 3006 | Ga0207647_10006674 | |||
| 3007 | Ga0207647_10008408 | |||
| 3008 | Ga0207647_10015485 | |||
| 3009 | Ga0207647_10050884 | |||
| 3010 | Ga0207647_10064672 | |||
| 3011 | Ga0207699_10007949 | |||
| 3012 | Ga0207645_10000751 | |||
| 3013 | Ga0207645_10049349 | |||
| 3014 | Ga0207643_10000178 | |||
| 3015 | Ga0207643_10073745 | |||
| 3016 | Ga0207705_10000003 | |||
| 3017 | Ga0207705_10000131 | |||
| 3018 | Ga0207705_10000146 | |||
| 3019 | Ga0207705_10003397 | |||
| 3020 | Ga0207705_10003406 | |||
| 3021 | Ga0207705_10003729 | |||
| 3022 | Ga0207705_10005607 | |||
| 3023 | Ga0207705_10007205 | |||
| 3024 | Ga0207705_10008024 | |||
| 3025 | Ga0207705_10008884 | |||
| 3026 | Ga0207705_10020214 | |||
| 3027 | Ga0207705_10033292 | |||
| 3028 | Ga0207705_10061477 | |||
| 3029 | Ga0207705_10075461 | |||
| 3030 | Ga0207705_10097427 | |||
| 3031 | Ga0207654_10012458 | |||
| 3032 | Ga0207654_10107726 | |||
| 3033 | Ga0207654_10192013 | |||
| 3034 | Ga0207707_10000168 | |||
| 3035 | Ga0207707_10000215 | |||
| 3036 | Ga0207707_10006842 | |||
| 3037 | Ga0207707_10006998 | |||
| 3038 | Ga0207707_10014027 | |||
| 3039 | Ga0207707_10014706 | |||
| 3040 | Ga0207707_10033686 | |||
| 3041 | Ga0207707_10036106 | |||
| 3042 | Ga0207707_10078805 | |||
| 3043 | Ga0207707_10110001 | |||
| 3044 | Ga0207707_10170473 | |||
| 3045 | Ga0207707_10238315 | |||
| 3046 | Ga0207695_10001113 | |||
| 3047 | Ga0207695_10001799 | |||
| 3048 | Ga0207695_10006878 | |||
| 3049 | Ga0207695_10015367 | |||
| 3050 | Ga0207695_10022510 | |||
| 3051 | Ga0207695_10027319 | |||
| 3052 | Ga0207695_10030192 | |||
| 3053 | Ga0207695_10035912 | |||
| 3054 | Ga0207695_10148734 | |||
| 3055 | Ga0207695_10159823 | |||
| 3056 | Ga0207695_10163005 | |||
| 3057 | Ga0207695_10165850 | |||
| 3058 | Ga0207695_10166453 | |||
| 3059 | Ga0207671_10021180 | |||
| 3060 | Ga0207671_10136168 | |||
| 3061 | Ga0207671_10213308 | |||
| 3062 | Ga0207671_10217718 | |||
| 3063 | Ga0207693_10067411 | |||
| 3064 | Ga0207693_10206708 | |||
| 3065 | Ga0207660_10000227 | |||
| 3066 | Ga0207660_10002134 | |||
| 3067 | Ga0207660_10003818 | |||
| 3068 | Ga0207660_10004969 | |||
| 3069 | Ga0207660_10005823 | |||
| 3070 | Ga0207660_10017556 | |||
| 3071 | Ga0207660_10083176 | |||
| 3072 | Ga0207660_10117507 | |||
| 3073 | Ga0207660_10139263 | |||
| 3074 | Ga0207662_10015909 | |||
| 3075 | Ga0207657_10000003 | |||
| 3076 | Ga0207657_10001611 | |||
| 3077 | Ga0207657_10001988 | |||
| 3078 | Ga0207657_10005362 | |||
| 3079 | Ga0207657_10006429 | |||
| 3080 | Ga0207657_10006601 | |||
| 3081 | Ga0207657_10007281 | |||
| 3082 | Ga0207657_10008053 | |||
| 3083 | Ga0207657_10009315 | |||
| 3084 | Ga0207657_10009409 | |||
| 3085 | Ga0207657_10011673 | |||
| 3086 | Ga0207657_10015108 | |||
| 3087 | Ga0207657_10043281 | |||
| 3088 | Ga0207657_10119040 | |||
| 3089 | Ga0207657_10169956 | |||
| 3090 | Ga0207657_10174880 | |||
| 3091 | Ga0207657_10182020 | |||
| 3092 | Ga0207657_10342971 | |||
| 3093 | Ga0207649_10000589 | |||
| 3094 | Ga0207649_10001798 | |||
| 3095 | Ga0207649_10003120 | |||
| 3096 | Ga0207649_10022398 | |||
| 3097 | Ga0207649_10029248 | |||
| 3098 | Ga0207649_10030793 | |||
| 3099 | Ga0207649_10054677 | |||
| 3100 | Ga0207649_10056667 | |||
| 3101 | Ga0207649_10060806 | |||
| 3102 | Ga0207649_10173575 | |||
| 3103 | Ga0207652_10000158 | |||
| 3104 | Ga0207652_10000282 | |||
| 3105 | Ga0207652_10000956 | |||
| 3106 | Ga0207652_10004584 | |||
| 3107 | Ga0207652_10005330 | |||
| 3108 | Ga0207652_10007449 | |||
| 3109 | Ga0207652_10012340 | |||
| 3110 | Ga0207652_10028196 | |||
| 3111 | Ga0207652_10061330 | |||
| 3112 | Ga0207652_10094510 | |||
| 3113 | Ga0207652_10129621 | |||
| 3114 | Ga0207652_10247259 | |||
| 3115 | Ga0207652_10277873 | |||
| 3116 | Ga0207681_10007817 | |||
| 3117 | Ga0207681_10022395 | |||
| 3118 | Ga0207681_10045690 | |||
| 3119 | Ga0207681_10050848 | |||
| 3120 | Ga0207681_10084941 | |||
| 3121 | Ga0207681_10136124 | |||
| 3122 | Ga0207681_10137195 | |||
| 3123 | Ga0207694_10002683 | |||
| 3124 | Ga0207694_10005613 | |||
| 3125 | Ga0207694_10008293 | |||
| 3126 | Ga0207694_10024724 | |||
| 3127 | Ga0207694_10062475 | |||
| 3128 | Ga0207694_10138033 | |||
| 3129 | Ga0207694_10175408 | |||
| 3130 | Ga0207694_10195737 | |||
| 3131 | Ga0207694_10203323 | |||
| 3132 | Ga0207650_10000003 | |||
| 3133 | Ga0207650_10002909 | |||
| 3134 | Ga0207650_10008403 | |||
| 3135 | Ga0207650_10032987 | |||
| 3136 | Ga0207650_10033415 | |||
| 3137 | Ga0207650_10055555 | |||
| 3138 | Ga0207650_10105568 | |||
| 3139 | Ga0207650_10185133 | |||
| 3140 | Ga0207650_10318920 | |||
| 3141 | Ga0207650_10413278 | |||
| 3142 | Ga0207659_10004458 | |||
| 3143 | Ga0207659_10017662 | |||
| 3144 | Ga0207659_10202659 | |||
| 3145 | Ga0207687_10000298 | |||
| 3146 | Ga0207687_10061436 | |||
| 3147 | Ga0207700_10030366 | |||
| 3148 | Ga0207700_10033041 | |||
| 3149 | Ga0207700_10059559 | |||
| 3150 | Ga0207700_10154748 | |||
| 3151 | Ga0207700_10232598 | |||
| 3152 | Ga0207700_10499686 | |||
| 3153 | Ga0207664_10000036 | |||
| 3154 | Ga0207664_10001394 | |||
| 3155 | Ga0207664_10011395 | |||
| 3156 | Ga0207664_10015374 | |||
| 3157 | Ga0207664_10029328 | |||
| 3158 | Ga0207664_10051411 | |||
| 3159 | Ga0207664_10260182 | |||
| 3160 | Ga0207644_10000055 | |||
| 3161 | Ga0207644_10000272 | |||
| 3162 | Ga0207644_10003350 | |||
| 3163 | Ga0207644_10050006 | |||
| 3164 | Ga0207644_10081484 | |||
| 3165 | Ga0207644_10095215 | |||
| 3166 | Ga0207644_10117940 | |||
| 3167 | Ga0207644_10216232 | |||
| 3168 | Ga0207644_10233212 | |||
| 3169 | Ga0207690_10000007 | |||
| 3170 | Ga0207690_10000839 | |||
| 3171 | Ga0207690_10000957 | |||
| 3172 | Ga0207690_10001891 | |||
| 3173 | Ga0207690_10002067 | |||
| 3174 | Ga0207690_10002972 | |||
| 3175 | Ga0207690_10004750 | |||
| 3176 | Ga0207690_10016359 | |||
| 3177 | Ga0207690_10041918 | |||
| 3178 | Ga0207690_10121720 | |||
| 3179 | Ga0207690_10197854 | |||
| 3180 | Ga0207690_10372173 | |||
| 3181 | Ga0207706_10000267 | |||
| 3182 | Ga0207706_10004822 | |||
| 3183 | Ga0207706_10007955 | |||
| 3184 | Ga0207706_10022681 | |||
| 3185 | Ga0207706_10117762 | |||
| 3186 | Ga0207706_10267750 | |||
| 3187 | Ga0207709_10002291 | |||
| 3188 | Ga0207709_10101806 | |||
| 3189 | Ga0207709_10372408 | |||
| 3190 | Ga0207670_10000036 | |||
| 3191 | Ga0207670_10017186 | |||
| 3192 | Ga0207670_10028630 | |||
| 3193 | Ga0207670_10033733 | |||
| 3194 | Ga0207670_10037814 | |||
| 3195 | Ga0207669_10061952 | |||
| 3196 | Ga0207669_10083924 | |||
| 3197 | Ga0207704_10125238 | |||
| 3198 | Ga0207665_10056330 | |||
| 3199 | Ga0207665_10073092 | |||
| 3200 | Ga0207691_10010387 | |||
| 3201 | Ga0207691_10011417 | |||
| 3202 | Ga0207691_10013709 | |||
| 3203 | Ga0207691_10019796 | |||
| 3204 | Ga0207691_10020605 | |||
| 3205 | Ga0207691_10045931 | |||
| 3206 | Ga0207691_10052482 | |||
| 3207 | Ga0207691_10131637 | |||
| 3208 | Ga0207711_10000855 | |||
| 3209 | Ga0207711_10000945 | |||
| 3210 | Ga0207711_10013434 | |||
| 3211 | Ga0207711_10013551 | |||
| 3212 | Ga0207711_10022316 | |||
| 3213 | Ga0207711_10070317 | |||
| 3214 | Ga0207711_10287045 | |||
| 3215 | Ga0207689_10000289 | |||
| 3216 | Ga0207689_10046883 | |||
| 3217 | Ga0207689_10118439 | |||
| 3218 | Ga0207689_10265165 | |||
| 3219 | Ga0207661_10009656 | |||
| 3220 | Ga0207661_10030731 | |||
| 3221 | Ga0207661_10143425 | |||
| 3222 | Ga0207661_10313935 | |||
| 3223 | Ga0207679_10000467 | |||
| 3224 | Ga0207679_10004621 | |||
| 3225 | Ga0207679_10007563 | |||
| 3226 | Ga0207679_10023274 | |||
| 3227 | Ga0207679_10034382 | |||
| 3228 | Ga0207679_10043417 | |||
| 3229 | Ga0207679_10088413 | |||
| 3230 | Ga0207679_10182615 | |||
| 3231 | Ga0207667_10000007 | |||
| 3232 | Ga0207667_10000586 | |||
| 3233 | Ga0207667_10001159 | |||
| 3234 | Ga0207667_10001393 | |||
| 3235 | Ga0207667_10003714 | |||
| 3236 | Ga0207667_10005210 | |||
| 3237 | Ga0207667_10014484 | |||
| 3238 | Ga0207667_10016531 | |||
| 3239 | Ga0207667_10020707 | |||
| 3240 | Ga0207667_10022920 | |||
| 3241 | Ga0207667_10023090 | |||
| 3242 | Ga0207667_10032515 | |||
| 3243 | Ga0207667_10058758 | |||
| 3244 | Ga0207667_10091006 | |||
| 3245 | Ga0207667_10099628 | |||
| 3246 | Ga0207667_10104865 | |||
| 3247 | Ga0207667_10114164 | |||
| 3248 | Ga0207667_10118201 | |||
| 3249 | Ga0207667_10288238 | |||
| 3250 | Ga0207667_10350065 | |||
| 3251 | Ga0207667_10408828 | |||
| 3252 | Ga0207651_10001867 | |||
| 3253 | Ga0207651_10031395 | |||
| 3254 | Ga0207651_10039497 | |||
| 3255 | Ga0207651_10056704 | |||
| 3256 | Ga0207651_10087761 | |||
| 3257 | Ga0207651_10090027 | |||
| 3258 | Ga0207712_10003682 | |||
| 3259 | Ga0207712_10074461 | |||
| 3260 | Ga0207712_10096205 | |||
| 3261 | Ga0207668_10039433 | |||
| 3262 | Ga0207668_10059489 | |||
| 3263 | Ga0207668_10240923 | |||
| 3264 | Ga0207640_10000291 | |||
| 3265 | Ga0207640_10002225 | |||
| 3266 | Ga0207640_10003065 | |||
| 3267 | Ga0207640_10004131 | |||
| 3268 | Ga0207640_10004350 | |||
| 3269 | Ga0207640_10006559 | |||
| 3270 | Ga0207640_10006932 | |||
| 3271 | Ga0207640_10017678 | |||
| 3272 | Ga0207640_10101615 | |||
| 3273 | Ga0207640_10132263 | |||
| 3274 | Ga0207658_10000004 | |||
| 3275 | Ga0207658_10000640 | |||
| 3276 | Ga0207658_10002188 | |||
| 3277 | Ga0207658_10025984 | |||
| 3278 | Ga0207658_10190401 | |||
| 3279 | Ga0207658_10192318 | |||
| 3280 | Ga0207658_10276021 | |||
| 3281 | Ga0207677_10053833 | |||
| 3282 | Ga0207677_10070786 | |||
| 3283 | Ga0207677_10120548 | |||
| 3284 | Ga0207677_10177041 | |||
| 3285 | Ga0207703_10131295 | |||
| 3286 | Ga0207639_10003451 | |||
| 3287 | Ga0207639_10003476 | |||
| 3288 | Ga0207639_10009437 | |||
| 3289 | Ga0207639_10030575 | |||
| 3290 | Ga0207639_10065211 | |||
| 3291 | Ga0207639_10070898 | |||
| 3292 | Ga0207639_10074999 | |||
| 3293 | Ga0207639_10171253 | |||
| 3294 | Ga0207639_10171553 | |||
| 3295 | Ga0207639_10181683 | |||
| 3296 | Ga0207639_10246362 | |||
| 3297 | Ga0207639_10301140 | |||
| 3298 | Ga0207678_10000160 | |||
| 3299 | Ga0207678_10001430 | |||
| 3300 | Ga0207678_10001471 | |||
| 3301 | Ga0207678_10001480 | |||
| 3302 | Ga0207678_10001640 | |||
| 3303 | Ga0207678_10001768 | |||
| 3304 | Ga0207678_10004079 | |||
| 3305 | Ga0207678_10005267 | |||
| 3306 | Ga0207678_10006377 | |||
| 3307 | Ga0207678_10007045 | |||
| 3308 | Ga0207678_10027423 | |||
| 3309 | Ga0207678_10048833 | |||
| 3310 | Ga0207678_10092102 | |||
| 3311 | Ga0207678_10149634 | |||
| 3312 | Ga0207678_10232695 | |||
| 3313 | Ga0207678_10238032 | |||
| 3314 | Ga0207678_10353405 | |||
| 3315 | Ga0207708_10000668 | |||
| 3316 | Ga0207708_10017052 | |||
| 3317 | Ga0207708_10041195 | |||
| 3318 | Ga0207708_10119680 | |||
| 3319 | Ga0207702_10000128 | |||
| 3320 | Ga0207702_10000244 | |||
| 3321 | Ga0207702_10000432 | |||
| 3322 | Ga0207702_10001083 | |||
| 3323 | Ga0207702_10001776 | |||
| 3324 | Ga0207702_10002471 | |||
| 3325 | Ga0207702_10002683 | |||
| 3326 | Ga0207702_10004484 | |||
| 3327 | Ga0207702_10008817 | |||
| 3328 | Ga0207702_10020180 | |||
| 3329 | Ga0207702_10026919 | |||
| 3330 | Ga0207702_10142809 | |||
| 3331 | Ga0207702_10144806 | |||
| 3332 | Ga0207702_10290341 | |||
| 3333 | Ga0207702_10311971 | |||
| 3334 | Ga0207641_10012760 | |||
| 3335 | Ga0207641_10025413 | |||
| 3336 | Ga0207641_10029638 | |||
| 3337 | Ga0207641_10041063 | |||
| 3338 | Ga0207641_10052892 | |||
| 3339 | Ga0207641_10055781 | |||
| 3340 | Ga0207641_10077897 | |||
| 3341 | Ga0207641_10118221 | |||
| 3342 | Ga0207641_10134443 | |||
| 3343 | Ga0207641_10203206 | |||
| 3344 | Ga0207641_10347728 | |||
| 3345 | Ga0207648_10002794 | |||
| 3346 | Ga0207648_10028635 | |||
| 3347 | Ga0207648_10040163 | |||
| 3348 | Ga0207648_10083374 | |||
| 3349 | Ga0207648_10202405 | |||
| 3350 | Ga0207648_10244865 | |||
| 3351 | Ga0207648_10312090 | |||
| 3352 | Ga0207648_10378584 | |||
| 3353 | Ga0207676_10000003 | |||
| 3354 | Ga0207676_10002722 | |||
| 3355 | Ga0207676_10017485 | |||
| 3356 | Ga0207676_10048100 | |||
| 3357 | Ga0207676_10105712 | |||
| 3358 | Ga0207676_10115176 | |||
| 3359 | Ga0207676_10207077 | |||
| 3360 | Ga0207676_10211234 | |||
| 3361 | Ga0207676_10273043 | |||
| 3362 | Ga0207674_10000039 | |||
| 3363 | Ga0207674_10003404 | |||
| 3364 | Ga0207674_10004794 | |||
| 3365 | Ga0207674_10005001 | |||
| 3366 | Ga0207674_10005506 | |||
| 3367 | Ga0207674_10007751 | |||
| 3368 | Ga0207674_10008565 | |||
| 3369 | Ga0207674_10011756 | |||
| 3370 | Ga0207674_10041750 | |||
| 3371 | Ga0207674_10051162 | |||
| 3372 | Ga0207674_10088975 | |||
| 3373 | Ga0207674_10154524 | |||
| 3374 | Ga0207675_100003529 | |||
| 3375 | Ga0207675_100007814 | |||
| 3376 | Ga0207675_100037403 | |||
| 3377 | Ga0207675_100045722 | |||
| 3378 | Ga0207675_100056446 | |||
| 3379 | Ga0207675_100153901 | |||
| 3380 | Ga0207675_100161405 | |||
| 3381 | Ga0207675_100185942 | |||
| 3382 | Ga0207675_100231854 | |||
| 3383 | Ga0207683_10003397 | |||
| 3384 | Ga0207683_10004053 | |||
| 3385 | Ga0207683_10016296 | |||
| 3386 | Ga0207683_10028344 | |||
| 3387 | Ga0207683_10028751 | |||
| 3388 | Ga0207683_10043033 | |||
| 3389 | Ga0207683_10145620 | |||
| 3390 | Ga0207683_10303500 | |||
| 3391 | Ga0207683_10391103 | |||
| 3392 | Ga0207698_10000511 | |||
| 3393 | Ga0207698_10000772 | |||
| 3394 | Ga0207698_10002291 | |||
| 3395 | Ga0207698_10005977 | |||
| 3396 | Ga0207698_10007308 | |||
| 3397 | Ga0207698_10011617 | |||
| 3398 | Ga0207698_10014360 | |||
| 3399 | Ga0207698_10038140 | |||
| 3400 | Ga0207698_10044515 | |||
| 3401 | Ga0207698_10165669 | |||
| 3402 | Ga0207698_10271249 | |||
| 3403 | Ga0209371_1000402 | |||
| 3404 | Ga0209969_1002467 | |||
| 3405 | Ga0209969_1004138 | |||
| 3406 | Ga0209984_1006643 | |||
| 3407 | Ga0210000_1002839 | |||
| 3408 | Ga0209179_1001067 | |||
| 3409 | Ga0209968_1004405 | |||
| 3410 | Ga0209999_1000831 | |||
| 3411 | Ga0209999_1024095 | |||
| 3412 | Ga0209982_1002696 | |||
| 3413 | Ga0209970_1007495 | |||
| 3414 | Ga0210002_1009435 | |||
| 3415 | Ga0209983_1029795 | |||
| 3416 | Ga0209588_1013741 | |||
| 3417 | Ga0209971_1001096 | |||
| 3418 | Ga0209971_1001702 | |||
| 3419 | Ga0209971_1005689 | |||
| 3420 | Ga0209966_1002408 | |||
| 3421 | Ga0209974_10002606 | |||
| 3422 | Ga0209974_10009957 | |||
| 3423 | Ga0209974_10014357 | |||
| 3424 | Ga0209974_10014761 | |||
| 3425 | Ga0207428_10051032 | |||
| 3426 | Ga0265354_1001901 | |||
| 3427 | Ga0265356_1000958 | |||
| 3428 | Ga0265357_1001777 | |||
| 3429 | Ga0268266_10002350 | |||
| 3430 | Ga0268266_10006760 | |||
| 3431 | Ga0268266_10021331 | |||
| 3432 | Ga0268266_10030898 | |||
| 3433 | Ga0268266_10081031 | |||
| 3434 | Ga0268266_10364862 | |||
| 3435 | Ga0268265_10000166 | |||
| 3436 | Ga0268265_10004150 | |||
| 3437 | Ga0268265_10115159 | |||
| 3438 | Ga0268264_10000016 | |||
| 3439 | Ga0268264_10030656 | |||
| 3440 | Ga0268264_10036457 | |||
| 3441 | Ga0268264_10111651 | |||
| 3442 | Ga0268264_10150826 | |||
| 3443 | Ga0265334_10033440 | |||
| 3444 | Ga0265336_10000008 | |||
| 3445 | Ga0307517_10036337 | |||
| 3446 | Ga0307517_10201167 | |||
| 3447 | Ga0307515_10073692 | |||
| 3448 | Ga0307515_10131399 | |||
| 3449 | Ga0265338_10000147 | |||
| 3450 | Ga0265338_10015253 | |||
| 3451 | Ga0265338_10168423 | |||
| 3452 | Ga0268256_1000749 | |||
| 3453 | Ga0307511_10173324 | |||
| 3454 | Ga0265760_10000671 | |||
| 3455 | Ga0265340_10010905 | |||
| 3456 | Ga0265327_10000546 | |||
| 3457 | Ga0265327_10022058 | |||
| 3458 | Ga0265316_10032066 | |||
| 3459 | Ga0307513_10000013 | |||
| 3460 | Ga0307513_10000037 | |||
| 3461 | Ga0307513_10006109 | |||
| 3462 | Ga0307513_10009214 | |||
| 3463 | Ga0307513_10009485 | |||
| 3464 | Ga0307513_10025641 | |||
| 3465 | Ga0307513_10031639 | |||
| 3466 | Ga0307513_10126660 | |||
| 3467 | Ga0307513_10146530 | |||
| 3468 | Ga0307509_10040026 | |||
| 3469 | Ga0307509_10067018 | |||
| 3470 | Ga0307509_10102599 | |||
| 3471 | Ga0307509_10175361 | |||
| 3472 | Ga0307408_100016400 | |||
| 3473 | Ga0307408_100078785 | |||
| 3474 | Ga0307408_100084695 | |||
| 3475 | Ga0307408_100090577 | |||
| 3476 | Ga0307408_100098516 | |||
| 3477 | Ga0265313_10062816 | |||
| 3478 | Ga0307508_10010305 | |||
| 3479 | Ga0307508_10034874 | |||
| 3480 | Ga0316575_10016265 | |||
| 3481 | Ga0316575_10089516 | |||
| 3482 | Ga0265342_10000896 | |||
| 3483 | Ga0316576_10010553 | |||
| 3484 | Ga0316576_10125990 | |||
| 3485 | Ga0316576_10183694 | |||
| 3486 | Ga0316578_10101146 | |||
| 3487 | Ga0307516_10011653 | |||
| 3488 | Ga0307405_10114597 | |||
| 3489 | Ga0307405_10144803 | |||
| 3490 | Ga0316577_10035089 | |||
| 3491 | Ga0316577_10065256 | |||
| 3492 | Ga0307413_10000338 | |||
| 3493 | Ga0307413_10004322 | |||
| 3494 | Ga0307413_10010229 | |||
| 3495 | Ga0307413_10020874 | |||
| 3496 | Ga0307413_10065277 | |||
| 3497 | Ga0307413_10070999 | |||
| 3498 | Ga0307413_10216233 | |||
| 3499 | Ga0307410_10033725 | |||
| 3500 | Ga0307410_10036495 | |||
| 3501 | Ga0307410_10046331 | |||
| 3502 | Ga0307410_10053878 | |||
| 3503 | Ga0307410_10106896 | |||
| 3504 | Ga0307410_10119677 | |||
| 3505 | Ga0307410_10152060 | |||
| 3506 | Ga0307406_10003967 | |||
| 3507 | Ga0307406_10009035 | |||
| 3508 | Ga0307406_10022167 | |||
| 3509 | Ga0307406_10039119 | |||
| 3510 | Ga0307406_10040688 | |||
| 3511 | Ga0307406_10045880 | |||
| 3512 | Ga0307406_10125922 | |||
| 3513 | Ga0307407_10033693 | |||
| 3514 | Ga0307407_10047631 | |||
| 3515 | Ga0307412_10000445 | |||
| 3516 | Ga0307412_10003289 | |||
| 3517 | Ga0307412_10006797 | |||
| 3518 | Ga0307412_10114727 | |||
| 3519 | Ga0307412_10149165 | |||
| 3520 | Ga0307412_10152871 | |||
| 3521 | Ga0307412_10274744 | |||
| 3522 | Ga0307412_10291024 | |||
| 3523 | Ga0307409_100002862 | |||
| 3524 | Ga0307409_100003524 | |||
| 3525 | Ga0307409_100028252 | |||
| 3526 | Ga0307409_100060791 | |||
| 3527 | Ga0307409_100132612 | |||
| 3528 | Ga0307409_100302238 | |||
| 3529 | Ga0307416_100009355 | |||
| 3530 | Ga0307416_100043067 | |||
| 3531 | Ga0307416_100129481 | |||
| 3532 | Ga0307416_100201961 | |||
| 3533 | Ga0307416_100336778 | |||
| 3534 | Ga0307416_100572901 | |||
| 3535 | Ga0307414_10003324 | |||
| 3536 | Ga0307414_10034680 | |||
| 3537 | Ga0307414_10039804 | |||
| 3538 | Ga0307414_10040002 | |||
| 3539 | Ga0307414_10067337 | |||
| 3540 | Ga0307414_10072543 | |||
| 3541 | Ga0307414_10078692 | |||
| 3542 | Ga0307414_10081381 | |||
| 3543 | Ga0307414_10086675 | |||
| 3544 | Ga0307414_10342435 | |||
| 3545 | Ga0307414_10408430 | |||
| 3546 | Ga0307411_10001485 | |||
| 3547 | Ga0307411_10003060 | |||
| 3548 | Ga0307411_10004620 | |||
| 3549 | Ga0307411_10040251 | |||
| 3550 | Ga0307411_10104301 | |||
| 3551 | Ga0307415_100003431 | |||
| 3552 | Ga0307415_100068728 | |||
| 3553 | Ga0307415_100190061 | |||
| 3554 | Ga0307415_100304614 | |||
| 3555 | Ga0307415_100315497 | |||
| 3556 | Ga0307415_100378283 | |||
| 3557 | Ga0316583_10005720 | |||
| 3558 | Ga0316585_10000970 | |||
| 3559 | Ga0316585_10008103 | |||
| 3560 | Ga0316580_10021814 | |||
| 3561 | Ga0307507_10035501 | |||
| 3562 | Ga0307507_10069877 | |||
| 3563 | Ga0373934_0008204 | |||
| 3564 | Ga0373934_0052308 | |||
| 3565 | Ga0373944_0021727 | |||
| 3566 | Ga0373923_0000056 | |||
| 3567 | Ga0373936_0000074 | |||
| 3568 | Ga0373936_0015945 | |||
| 3569 | Ga0373939_0023803 | |||
| 3570 | Ga0373953_0005940 | |||
| 3571 | Ga0373953_0124420 | |||
| 3572 | Ga0373954_0007256 | |||
| 3573 | Ga0373954_0015620 | |||
| 3574 | Ga0373954_0021985 | |||
| 3575 | Ga0373956_0005453 | |||
| 3576 | Ga0373956_0088997 | |||
| 3577 | Ga0373957_0008067 | |||
| 3578 | Ga0373957_0014212 | |||
| 3579 | Ga0373957_0021645 | |||
| 3580 | Ga0373957_0027152 | |||
| 3581 | Ga0373946_0058209 | |||
| 3582 | Ga0373955_0001249 | |||
| 3583 | Ga0373955_0005370 | |||
| 3584 | Ga0373955_0042797 | |||
| 3585 | Ga0373955_0063169 | |||
| 3586 | Ga0373961_0000126 | |||
| 3587 | Ga0373962_0007891 | |||
| 3588 | Ga0316574_0001239 | |||
| 3589 | Ga0316574_0005525 | |||
| 3590 | Ga0316574_0026641 | |||
| 3591 | Ga0316574_0099027 | |||
| 3592 | Ga0316574_0139144 | |||
| 3593 | Ga0316574_0286433 | |||
| 3594 | Ga0373924_0032456 | |||
| 3595 | Ga0373931_0015899 | |||
| 3596 | Ga0373935_0131967 | |||
| 3597 | Ga0373935_0143274 | |||
| 3598 | Ga0373927_0000615 | |||
| 3599 | Ga0373927_0002114 | |||
| 3600 | Ga0373927_0058213 | |||
| 3601 | Ga0373933_0035998 | |||
| 3602 | Ga0373933_0194331 | |||
| 3603 | Ga0373947_0044769 | |||
| 3604 | Ga0373947_0074317 | |||
| 3605 | Ga0373937_0009412 | |||
| 3606 | Ga0373937_0065983 | |||
| 3607 | Ga0373937_0076730 | |||
| 3608 | Ga0373937_0198343 | |||
| 3609 | Ga0373937_0441480 | |||
| 3610 | Ga0316582_0000277 | |||
| 3611 | Ga0316582_0023018 | |||
| 3612 | Ga0316582_0059868 | |||
| 3613 | Ga0316582_0063495 | |||
| 3614 | Ga0316584_0001500 | |||
| 3615 | Ga0316584_0011002 | |||
| 3616 | Ga0316584_0030295 | |||
| 3617 | Ga0316584_0036370 | |||
| 3618 | Ga0316584_0053546 | |||
| 3619 | Ga0316584_0102259 | |||
| 3620 | Ga0316584_0138468 | |||
| 3621 | Ga0373925_0000278 | |||
| 3622 | Ga0373925_0011317 | |||
| 3623 | Ga0373925_0276282 | |||
| 3624 | Ga0395899_0000261 | |||
| 3625 | Ga0395899_0000309 | |||
| 3626 | Ga0395899_0014151 | |||
| 3627 | Ga0395899_0015844 | |||
| 3628 | Ga0395899_0040051 | |||
| 3629 | Ga0395899_0041062 | |||
| 3630 | Ga0395899_0053950 | |||
| 3631 | Ga0395899_0080294 | |||
| 3632 | Ga0395899_0081700 | |||
| 3633 | Ga0395899_0100636 | |||
| 3634 | Ga0395899_0149996 | |||
| 3635 | Ga0395899_0162039 | |||
| 3636 | Ga0395899_0217919 | |||
| 3637 | Ga0395900_0000036 | |||
| 3638 | Ga0395900_0000421 | |||
| 3639 | Ga0395900_0000463 | |||
| 3640 | Ga0395900_0002071 | |||
| 3641 | Ga0395900_0004593 | |||
| 3642 | Ga0395900_0005687 | |||
| 3643 | Ga0395900_0013849 | |||
| 3644 | Ga0395900_0022152 | |||
| 3645 | Ga0395900_0030670 | |||
| 3646 | Ga0395900_0043088 | |||
| 3647 | Ga0395900_0045251 | |||
| 3648 | Ga0395900_0081366 | |||
| 3649 | Ga0395900_0112961 | |||
| 3650 | Ga0395900_0139380 | |||
| 3651 | Ga0395900_0145385 | |||
| 3652 | Ga0395900_0146395 | |||
| 3653 | Ga0395900_0152379 | |||
| 3654 | Ga0395900_0158473 | |||
| 3655 | Ga0395900_0167565 | |||
| 3656 | Ga0395900_0168010 | |||
| 3657 | Ga0395900_0175775 | |||
| 3658 | Ga0395900_0176108 | |||
| 3659 | Ga0395900_0184034 | |||
| 3660 | Ga0395900_0269389 | |||
| 3661 | Ga0395900_0319660 | |||
| 3662 | Ga0395900_0605659 | |||
| 3663 | Ga0395898_0000305 | |||
| 3664 | Ga0395898_0000485 | |||
| 3665 | Ga0395898_0011241 | |||
| 3666 | Ga0395898_0011477 | |||
| 3667 | Ga0395898_0014192 | |||
| 3668 | Ga0395898_0016672 | |||
| 3669 | Ga0395898_0019437 | |||
| 3670 | Ga0395898_0020422 | |||
| 3671 | Ga0395898_0034473 | |||
| 3672 | Ga0395898_0035939 | |||
| 3673 | Ga0395898_0037985 | |||
| 3674 | Ga0395898_0042918 | |||
| 3675 | Ga0395898_0076987 | |||
| 3676 | Ga0395898_0107552 | |||
| 3677 | Ga0395898_0171768 | |||
| 3678 | Ga0395898_0188804 | |||
| 3679 | Ga0395898_0220915 | |||
| 3680 | Ga0395898_0221856 | |||
| 3681 | Ga0395898_0253128 | |||
| 3682 | Ga0395905_0018294 | |||
| 3683 | Ga0395905_0018671 | |||
| 3684 | Ga0395905_0034234 | |||
| 3685 | Ga0395905_0048902 | |||
| 3686 | Ga0395905_0059563 | |||
| 3687 | Ga0395905_0092636 | |||
| 3688 | Ga0395905_0095282 | |||
| 3689 | Ga0395905_0134658 | |||
| 3690 | Ga0395905_0154853 | |||
| 3691 | Ga0395905_0194649 | |||
| 3692 | Ga0395905_0296101 | |||
| 3693 | Ga0395905_0299238 | |||
| 3694 | Ga0316581_0019015 | |||
| 3695 | Ga0316581_0024562 | |||
| 3696 | Ga0395901_0000036 | |||
| 3697 | Ga0395901_0000188 | |||
| 3698 | Ga0395901_0000604 | |||
| 3699 | Ga0395901_0000913 | |||
| 3700 | Ga0395901_0001198 | |||
| 3701 | Ga0395901_0002697 | |||
| 3702 | Ga0395901_0003975 | |||
| 3703 | Ga0395901_0009119 | |||
| 3704 | Ga0395901_0015319 | |||
| 3705 | Ga0395901_0023104 | |||
| 3706 | Ga0395901_0030354 | |||
| 3707 | Ga0395901_0054449 | |||
| 3708 | Ga0395901_0055205 | |||
| 3709 | Ga0395901_0090263 | |||
| 3710 | Ga0395901_0116576 | |||
| 3711 | Ga0395901_0119581 | |||
| 3712 | Ga0395901_0120156 | |||
| 3713 | Ga0395901_0131771 | |||
| 3714 | Ga0395901_0149284 | |||
| 3715 | Ga0395901_0169395 | |||
| 3716 | Ga0395901_0177660 | |||
| 3717 | Ga0395901_0182239 | |||
| 3718 | Ga0395901_0449665 | |||
| 3719 | Ga0395901_0481965 | |||
| 3720 | Ga0395901_0519707 | |||
| 3721 | Ga0395901_0620186 | |||
| 3722 | Ga0237819_00728 | |||
| 3723 | Ga0237816_02003 | |||
| 3724 | Ga0436365_0871778 | |||
| 3725 | Ga0436360_0701846 | |||
| 3726 | Ga0436360_1373761 | |||
| 3727 | Ga0436361_1117061 | |||
| 3728 | Ga0436361_1214005 | |||
| 3729 | Ga0436363_1223925 | |||
| 3730 | Ga0436363_1399761 | |||
| 3731 | Ga0439436_0000023 | |||
| 3732 | Ga0439436_0012204 | |||
| 3733 | Ga0439436_0033111 | |||
| 3734 | Ga0439439_0043679 | |||
| 3735 | Ga0439465_0033940 | |||
| 3736 | Ga0451787_571574 | |||
| 3737 | Ga0451789_0461212 | |||
| 3738 | Ga0451807_0322861 | |||
| 3739 | Ga0451807_2136315 | |||
| 3740 | Ga0451853_0162710 | |||
| 3741 | Ga0439441_021491 | |||
| 3742 | Ga0439443_006540 | |||
| 3743 | Ga0439432_018244 | |||
| 3744 | Ga0439432_044976 | |||
| 3745 | Ga0439455_0003442 | |||
| 3746 | Ga0439457_018740 | |||
| 3747 | Ga0439462_0026691 | |||
| 3748 | Ga0450911_000006 | |||
| 3749 | Ga0450913_000424 | |||
| 3750 | Ga0450898_006509 | |||
| 3751 | Ga0450904_000100 | |||
| 3752 | Ga0439446_0027405 | |||
| 3753 | Ga0450908_000069 | |||
| 3754 | Ga0451577_0000256 | |||
| 3755 | Ga0466969_0000992 | |||
| 3756 | Ga0466969_0016933 | |||
| 3757 | Ga0466969_0055710 | |||
| 3758 | Ga0466969_0105306 | |||
| 3759 | Ga0466982_0000109 | |||
| 3760 | Ga0453683_0002195 | |||
| 3761 | Ga0453683_0067547 | |||
| 3762 | Ga0466966_0000004 | |||
| 3763 | Ga0466966_0002380 | |||
| 3764 | Ga0466966_0066226 | |||
| 3765 | Ga0466966_0077247 | |||
| 3766 | Ga0466966_0104783 | |||
| 3767 | Ga0466961_0000220 | |||
| 3768 | Ga0466961_0000978 | |||
| 3769 | Ga0466961_0004586 | |||
| 3770 | Ga0466961_0132258 | |||
| 3771 | Ga0466963_0001670 | |||
| 3772 | Ga0466963_0025535 | |||
| 3773 | Ga0466963_0034194 | |||
| 3774 | Ga0466963_0106828 | |||
| 3775 | Ga0466964_0012863 | |||
| 3776 | Ga0453684_0000842 | |||
| 3777 | Ga0453684_0005726 | |||
| 3778 | Ga0453684_0229822 | |||
| 3779 | Ga0466971_0002396 | |||
| 3780 | Ga0466970_0001613 | |||
| 3781 | Ga0466970_0001995 | |||
| 3782 | Ga0466970_0021702 | |||
| 3783 | Ga0466957_0018706 | |||
| 3784 | Ga0466957_0029399 | |||
| 3785 | Ga0466957_0082242 | |||
| 3786 | Ga0466957_0140031 | |||
| 3787 | Ga0466960_0063911 | |||
| 3788 | Ga0466960_0224388 | |||
| 3789 | Ga0466959_0000847 | |||
| 3790 | Ga0466959_0000978 | |||
| 3791 | Ga0466959_0009479 | |||
| 3792 | Ga0466959_0141147 | |||
| 3793 | Ga0466959_0248444 | |||
| 3794 | Ga0466958_0004196 | |||
| 3795 | Ga0466958_0082202 | |||
| 3796 | Ga0466958_0114592 | |||
| 3797 | Ga0466967_0016847 | |||
| 3798 | Ga0466967_0023353 | |||
| 3799 | Ga0466967_0043468 | |||
| 3800 | Ga0466967_0316416 | |||
| 3801 | Ga0495592_0004872 | |||
| 3802 | Ga0495603_0000388 | |||
| 3803 | Ga0495603_0040809 | |||
| 3804 | Ga0495590_0001068 | |||
| 3805 | Ga0495590_0006992 | |||
| 3806 | Ga0495590_0019091 | |||
| 3807 | Ga0495590_0093949 | |||
| 3808 | Ga0495590_0113147 | |||
| 3809 | Ga0495591_002511 | |||
| 3810 | Ga0495629_0003174 | |||
| 3811 | Ga0495638_0000728 | |||
| 3812 | Ga0495638_0001464 | |||
| 3813 | Ga0495638_0005121 | |||
| 3814 | Ga0495638_0007439 | |||
| 3815 | Ga0495638_0040718 | |||
| 3816 | Ga0495638_0102411 | |||
| 3817 | Ga0495641_0008790 | |||
| 3818 | Ga0495641_0026207 | |||
| 3819 | Ga0495653_0004188 | |||
| 3820 | Ga0495650_0000024 | |||
| 3821 | Ga0495650_0077945 | |||
| 3822 | Ga0495580_0016401 | |||
| 3823 | Ga0495580_0041640 | |||
| 3824 | Ga0495582_0001097 | |||
| 3825 | Ga0495582_0013960 | |||
| 3826 | Ga0495605_0000271 | |||
| 3827 | Ga0495639_0008348 | |||
| 3828 | Ga0495585_0000027 | |||
| 3829 | Ga0495585_0085265 | |||
| 3830 | Ga0495594_0000118 | |||
| 3831 | Ga0495596_0000007 | |||
| 3832 | Ga0495596_0045858 | |||
| 3833 | Ga0495607_0015636 | |||
| 3834 | Ga0495583_0000005 | |||
| 3835 | Ga0495583_0000149 | |||
| 3836 | Ga0495583_0000249 | |||
| 3837 | Ga0495606_0002446 | |||
| 3838 | Ga0495608_0107355 | |||
| 3839 | Ga0495610_0000465 | |||
| 3840 | Ga0495610_0001255 | |||
| 3841 | Ga0495610_0001341 | |||
| 3842 | Ga0495610_0011263 | |||
| 3843 | Ga0495610_0033321 | |||
| 3844 | Ga0495616_0016634 | |||
| 3845 | Ga0495616_0019285 | |||
| 3846 | Ga0495620_0016023 | |||
| 3847 | Ga0495628_0013802 | |||
| 3848 | Ga0495630_0012679 | |||
| 3849 | Ga0495631_0012499 | |||
| 3850 | Ga0495631_0014835 | |||
| 3851 | Ga0495632_0004886 | |||
| 3852 | Ga0495632_0019802 | |||
| 3853 | Ga0495632_0065291 | |||
| 3854 | Ga0495637_0008788 | |||
| 3855 | Ga0495637_0099481 | |||
| 3856 | Ga0495643_0015990 | |||
| 3857 | Ga0495644_0111145 | |||
| 3858 | Ga0495648_0000029 | |||
| 3859 | Ga0495648_0100364 | |||
| 3860 | Ga0495663_0000379 | |||
| 3861 | Ga0495666_0006889 | |||
| 3862 | Ga0495652_0103151 | |||
| 3863 | Ga0495654_0000226 | |||
| 3864 | Ga0495665_0044109 | |||
| 3865 | Ga0495640_0006086 | |||
| 3866 | Ga0495586_0117398 | |||
| 3867 | Ga0495587_0014439 | |||
| 3868 | Ga0495587_0191616 | |||
| 3869 | Ga0495609_0000052 | |||
| 3870 | Ga0495621_0013656 | |||
| 3871 | Ga0495597_0017049 | |||
| 3872 | Ga0495622_0004272 | |||
| 3873 | Ga0495633_0000162 | |||
| 3874 | Ga0495667_0008613 | |||
| 3875 | Ga0495667_0020228 | |||
| 3876 | Ga0495668_0000141 | |||
| 3877 | Ga0495668_0007336 | |||
| 3878 | Ga0495668_0011331 | |||
| 3879 | Ga0495668_0058761 | |||
| 3880 | Ga0495634_0002446 | |||
| 3881 | Ga0495611_0000565 | |||
| 3882 | Ga0495625_0000398 | |||
| 3883 | Ga0495625_0010691 | |||
| 3884 | Ga0495625_0015161 | |||
| 3885 | Ga0495625_0036300 | |||
| 3886 | Ga0495625_0042417 | |||
| 3887 | Ga0495625_0111871 | |||
| 3888 | Ga0495625_0116865 | |||
| 3889 | Ga0495625_0130092 | |||
| 3890 | Ga0495635_0025209 | |||
| 3891 | Ga0495588_0057082 | |||
| 3892 | Ga0495657_0022358 | |||
| 3893 | Ga0495657_0089723 | |||
| 3894 | Ga0495599_0018838 | |||
| 3895 | Ga0495599_0023815 | |||
| 3896 | Ga0495623_0039267 | |||
| 3897 | Ga0495647_0000113 | |||
| 3898 | Ga0495647_0007512 | |||
| 3899 | Ga0495658_0002474 | |||
| 3900 | Ga0495658_0013350 | |||
| 3901 | Ga0495613_0008625 | |||
| 3902 | Ga0495613_0029688 | |||
| 3903 | Ga0495670_0001410 | |||
| 3904 | Ga0495671_0011736 | |||
| 3905 | Ga0495649_0000165 | |||
| 3906 | Ga0495649_0000396 | |||
| 3907 | Ga0495649_0010627 | |||
| 3908 | Ga0495649_0021738 | |||
| 3909 | Ga0495589_0024889 | |||
| 3910 | Ga0495600_0009720 | |||
| 3911 | Ga0495600_0025908 | |||
| 3912 | Ga0495660_0005715 | |||
| 3913 | Ga0495581_0090757 | |||
| 3914 | Ga0495604_0003696 | |||
| 3915 | Ga0495636_0002340 | |||
| 3916 | Ga0495636_0018436 | |||
| 3917 | Ga0495636_0035560 | |||
| 3918 | Ga0495674_0065303 | |||
| 3919 | Ga0495672_0011303 | |||
| 3920 | Ga0495672_0128180 | |||
| 3921 | Ga0495676_0170342 | |||
| 3922 | Ga0495680_0042645 | |||
| 3923 | Ga0495680_0087469 | |||
| 3924 | Ga0495680_0361099 | |||
| 3925 | Ga0495683_0000002 | |||
| 3926 | Ga0495683_0077491 | |||
| 3927 | Ga0495683_0142506 | |||
| 3928 | Ga0495675_0090651 | |||
| 3929 | Ga0495679_000035 | |||
| 3930 | Ga0495679_000056 | |||
| 3931 | Ga0495679_003586 | |||
| 3932 | Ga0495685_046996 | |||
| 3933 | Ga0495673_0000342 | |||
| 3934 | Ga0495673_0002882 | |||
| 3935 | Ga0495681_0079948 | |||
| 3936 | Ga0495684_0078492 | |||
| 3937 | Ga0495684_0094860 | |||
| 3938 | Ga0495686_0001836 | |||
| 3939 | Ga0495686_0001859 | |||
| 3940 | Ga0495593_0000987 | |||
| 3941 | Ga0495602_0014733 | |||
| 3942 | Ga0495602_0044383 | |||
| 3943 | Ga0495602_0374641 | |||
| 3944 | Ga0495614_0042029 | |||
| 3945 | Ga0496100_0102199 | |||
| 3946 | Ga0496100_0216104 | |||
| 3947 | Ga0496101_0015659 | |||
| 3948 | Ga0496101_0017706 | |||
| 3949 | Ga0496101_0022049 | |||
| 3950 | Ga0496101_0024655 | |||
| 3951 | Ga0496101_0279814 | |||
| 3952 | Ga0496102_0039951 | |||
| 3953 | Ga0496102_0047630 | |||
| 3954 | Ga0496102_0083221 | |||
| 3955 | Ga0496102_0250431 | |||
| 3956 | Ga0496103_0040376 | |||
| 3957 | Ga0496103_0079880 | |||
| 3958 | Ga0496103_0129682 | |||
| 3959 | Ga0496104_0032285 | |||
| 3960 | Ga0496104_0034981 | |||
| 3961 | Ga0496104_0055115 | |||
| 3962 | Ga0496104_0097848 | |||
| 3963 | Ga0496104_0186776 | |||
| 3964 | Ga0496105_0009632 | |||
| 3965 | Ga0496105_0019536 | |||
| 3966 | Ga0496105_0292398 | |||
| 3967 | Ga0496106_0047561 | |||
| 3968 | Ga0496106_0063844 | |||
| 3969 | Ga0496106_0271146 | |||
| 3970 | Ga0496106_0287665 | |||
| 3971 | Ga0496107_0000214 | |||
| 3972 | Ga0496107_0019860 | |||
| 3973 | Ga0496107_0077760 | |||
| 3974 | Ga0496107_0183845 | |||
| 3975 | Ga0496107_0186394 | |||
| 3976 | Ga0496108_0003688 | |||
| 3977 | Ga0496108_0016259 | |||
| 3978 | Ga0496108_0027517 | |||
| 3979 | Ga0496108_0126533 | |||
| 3980 | Ga0496108_0185152 | |||
| 3981 | Ga0496108_0384164 | |||
| 3982 | Ga0496109_0001865 | |||
| 3983 | Ga0496109_0048552 | |||
| 3984 | Ga0496109_0087095 | |||
| 3985 | Ga0496109_0091181 | |||
| 3986 | Ga0496109_0186498 | |||
| 3987 | Ga0496109_0188056 | |||
| 3988 | Ga0496109_0206078 | |||
| 3989 | Ga0496109_0212961 | |||
| 3990 | Ga0496110_0012559 | |||
| 3991 | Ga0496110_0074788 | |||
| 3992 | Ga0496110_0077735 | |||
| 3993 | Ga0496110_0150420 | |||
| 3994 | Ga0496110_0156563 | |||
| 3995 | Ga0496110_0457692 | |||
| 3996 | Ga0496111_0011770 | |||
| 3997 | Ga0496111_0022773 | |||
| 3998 | Ga0496111_0239824 | |||
| 3999 | Ga0496112_0003292 | |||
| 4000 | Ga0496112_0027176 | |||
| 4001 | Ga0496112_0072298 | |||
| 4002 | Ga0496112_0175465 | |||
| 4003 | Ga0496112_0190432 | |||
| 4004 | Ga0496112_0453340 | |||
| 4005 | Ga0496113_0424119 | |||
| 4006 | Ga0496114_0006303 | |||
| 4007 | Ga0496114_0098484 | |||
| 4008 | Ga0496114_0136746 | |||
| 4009 | Ga0496114_0160550 | |||
| 4010 | Ga0496114_0221649 | |||
| 4011 | Ga0496114_0352639 | |||
| 4012 | Ga0496115_0006041 | |||
| 4013 | Ga0496115_0169765 | |||
| 4014 | Ga0496115_0197088 | |||
| 4015 | Ga0496115_0271290 | |||
| 4016 | Ga0496116_0028883 | |||
| 4017 | Ga0496116_0038439 | |||
| 4018 | Ga0496117_0016132 | |||
| 4019 | Ga0496117_0040086 | |||
| 4020 | Ga0496117_0054532 | |||
| 4021 | Ga0496118_0001967 | |||
| 4022 | Ga0496118_0003890 | |||
| 4023 | Ga0496118_0029873 | |||
| 4024 | Ga0496118_0119622 | |||
| 4025 | Ga0496119_0000733 | |||
| 4026 | Ga0496119_0005178 | |||
| 4027 | Ga0496119_0011034 | |||
| 4028 | Ga0496119_0012759 | |||
| 4029 | Ga0496120_0000671 | |||
| 4030 | Ga0496120_0015992 | |||
| 4031 | Ga0496121_0000021 | |||
| 4032 | Ga0496121_0000042 | |||
| 4033 | Ga0496121_0000145 | |||
| 4034 | Ga0496121_0033279 | |||
| 4035 | Ga0496121_0099155 | |||
| 4036 | Ga0496122_0000029 | |||
| 4037 | Ga0496122_0000749 | |||
| 4038 | Ga0496122_0013321 | |||
| 4039 | Ga0496122_0098434 | |||
| 4040 | Ga0496123_0000216 | |||
| 4041 | Ga0496123_0000566 | |||
| 4042 | Ga0496123_0000974 | |||
| 4043 | Ga0496123_0006678 | |||
| 4044 | Ga0496123_0041704 | |||
| 4045 | Ga0496124_0000681 | |||
| 4046 | Ga0496124_0088371 | |||
| 4047 | Ga0496124_0147417 | |||
| 4048 | Ga0496125_0001102 | |||
| 4049 | Ga0496125_0001807 | |||
| 4050 | Ga0496125_0018499 | |||
| 4051 | Ga0496125_0029699 | |||
| 4052 | Ga0496126_0021905 | |||
| 4053 | Ga0496126_0073787 | |||
| 4054 | Ga0496126_0305946 | |||
| 4055 | Ga0495678_003651 | |||
| 4056 | Ga0495682_0022008 | |||
| 4057 | Ga0501031_0003304 | |||
| 4058 | Ga0501031_0036277 | |||
| 4059 | Ga0501032_0002277 | |||
| 4060 | Ga0501033_0016780 | |||
| 4061 | Ga0501033_0020882 | |||
| 4062 | Ga0501033_0060379 | |||
| 4063 | Ga0501033_0072968 | |||
| 4064 | Ga0501034_0003528 | |||
| 4065 | Ga0501034_0013919 | |||
| 4066 | Ga0501034_0026913 | |||
| 4067 | Ga0501034_0043094 | |||
| 4068 | Ga0501034_0046443 | |||
| 4069 | Ga0501034_0056312 | |||
| 4070 | Ga0501034_0382079 | |||
| 4071 | Ga0501036_0087742 | |||
| 4072 | Ga0501036_0113245 | |||
| 4073 | Ga0501036_0129900 | |||
| 4074 | Ga0501036_0140941 | |||
| 4075 | Ga0501037_0046554 | |||
| 4076 | Ga0501038_0000654 | |||
| 4077 | Ga0501038_0009310 | |||
| 4078 | Ga0501038_0023889 | |||
| 4079 | Ga0501038_0087373 | |||
| 4080 | Ga0501039_0235261 | |||
| 4081 | Ga0501039_0265879 | |||
| 4082 | Ga0501040_0001815 | |||
| 4083 | Ga0501041_0000192 | |||
| 4084 | Ga0501042_0000054 | |||
| 4085 | Ga0501042_0000271 | |||
| 4086 | Ga0501042_0120352 | |||
| 4087 | Ga0501043_0034251 | |||
| 4088 | Ga0501043_0085298 | |||
| 4089 | Ga0501043_0112989 | |||
| 4090 | Ga0501046_0000108 | |||
| 4091 | Ga0501046_0015253 | |||
| 4092 | Ga0501047_0002839 | |||
| 4093 | Ga0501047_0013253 | |||
| 4094 | Ga0501047_0017768 | |||
| 4095 | Ga0501047_0019890 | |||
| 4096 | Ga0501047_0021564 | |||
| 4097 | Ga0501047_0043063 | |||
| 4098 | Ga0501047_0060215 | |||
| 4099 | Ga0501047_0122096 | |||
| 4100 | Ga0501047_0176192 | |||
| 4101 | Ga0501047_0181887 | |||
| 4102 | Ga0501048_0034331 | |||
| 4103 | Ga0501067_0043101 | |||
| 4104 | Ga0501067_0114492 | |||
| 4105 | Ga0501069_0101362 | |||
| 4106 | Ga0501069_0185100 | |||
| 4107 | Ga0501069_0217959 | |||
| 4108 | Ga0501070_0000102 | |||
| 4109 | Ga0501070_0023819 | |||
| 4110 | Ga0501070_0044639 | |||
| 4111 | Ga0501070_0051997 | |||
| 4112 | Ga0501070_0058239 | |||
| 4113 | Ga0501070_0173712 | |||
| 4114 | Ga0501070_0352055 | |||
| 4115 | Ga0501070_0423843 | |||
| 4116 | Ga0501071_0016296 | |||
| 4117 | Ga0501071_0018432 | |||
| 4118 | Ga0501071_0139032 | |||
| 4119 | Ga0501072_0000655 | |||
| 4120 | Ga0501073_0008965 | |||
| 4121 | Ga0501073_0013754 | |||
| 4122 | Ga0501073_0018310 | |||
| 4123 | Ga0501073_0051133 | |||
| 4124 | Ga0501074_0002305 | |||
| 4125 | Ga0501074_0033737 | |||
| 4126 | Ga0501074_0063087 | |||
| 4127 | Ga0501075_0032811 | |||
| 4128 | Ga0501075_0036165 | |||
| 4129 | Ga0501075_0049268 | |||
| 4130 | Ga0501076_0000057 | |||
| 4131 | Ga0501076_0100931 | |||
| 4132 | Ga0501077_0000637 | |||
| 4133 | Ga0501077_0013351 | |||
| 4134 | Ga0501239_000595 | |||
| 4135 | Ga0501079_0000283 | |||
| 4136 | Ga0501079_0041115 | |||
| 4137 | Ga0501079_0145936 | |||
| 4138 | Ga0501080_0000480 | |||
| 4139 | Ga0501080_0015766 | |||
| 4140 | Ga0501080_0016767 | |||
| 4141 | Ga0501080_0022903 | |||
| 4142 | Ga0501080_0029568 | |||
| 4143 | Ga0501080_0034741 | |||
| 4144 | Ga0501080_0051306 | |||
| 4145 | Ga0501080_0132429 | |||
| 4146 | Ga0501080_0207020 | |||
| 4147 | Ga0501080_0364050 | |||
| 4148 | Ga0501081_0000123 | |||
| 4149 | Ga0501083_0014104 | |||
| 4150 | Ga0501083_0020544 | |||
| 4151 | Ga0501083_0044708 | |||
| 4152 | Ga0501083_0069462 | |||
| 4153 | Ga0501083_0149667 | |||
| 4154 | Ga0501035_0003292 | |||
| 4155 | Ga0501035_0003439 | |||
| 4156 | Ga0501035_0019304 | |||
| 4157 | Ga0501035_0057698 | |||
| 4158 | Ga0501035_0059231 | |||
| 4159 | Ga0501035_0069916 | |||
| 4160 | Ga0501035_0078600 | |||
| 4161 | Ga0501035_0090106 | |||
| 4162 | Ga0501035_0099716 | |||
| 4163 | Ga0501035_0269396 | |||
| 4164 | Ga0501035_0383847 | |||
| 4165 | Ga0501044_0002339 | |||
| 4166 | Ga0501044_0024481 | |||
| 4167 | Ga0501044_0045879 | |||
| 4168 | Ga0501044_0053284 | |||
| 4169 | Ga0501044_0085608 | |||
| 4170 | Ga0501044_0092573 | |||
| 4171 | Ga0501044_0094691 | |||
| 4172 | Ga0501044_0189704 | |||
| 4173 | Ga0501045_0002226 | |||
| 4174 | Ga0501226_000012 | |||
| 4175 | nmdc:mga03683_72905_c1 | |||
| 4176 | nmdc:mga00v17_36848_c2 | |||
| 4177 | nmdc:mga0yw44_222117_c1 | |||
| 4178 | nmdc:mga0k408_259977_c1 | |||
| 4179 | nmdc:mga0k408_34917_c1 | |||
| 4180 | nmdc:mga0k408_45210_c1 | |||
| 4181 | nmdc:mga07m45_119838_c1 | |||
| 4182 | nmdc:mga07m45_85713_c1 | |||
| 4183 | nmdc:mga05p37_155916_c1 | |||
| 4184 | nmdc:mga05p37_52817_c1 | |||
| 4185 | nmdc:mga05p37_716_c1 | |||
| 4186 | nmdc:mga09592_39528_c1 | |||
| 4187 | nmdc:mga0qj67_3310_c1 | |||
| 4188 | nmdc:mga0qj67_36852_c1 | |||
| 4189 | nmdc:mga0qj67_8357_c1 | |||
| 4190 | nmdc:mga06r32_106735_c1 | |||
| 4191 | nmdc:mga06r32_45534_c1 | |||
| 4192 | nmdc:mga06r32_7880_c1 | |||
| 4193 | nmdc:mga08y16_50166_c1 | |||
| 4194 | nmdc:mga08y16_67396_c1 | |||
| 4195 | nmdc:mga0n895_214105_c1 | |||
| 4196 | nmdc:mga0rr50_222830_c1 | |||
| 4197 | nmdc:mga0rr50_300447_c1 | |||
| 4198 | nmdc:mga08x19_26318_c1 | |||
| 4199 | nmdc:mga0a205_139417_c1 | |||
| 4200 | nmdc:mga0a205_8602_c1 | |||
| 4201 | Ga0495601_0002701 | |||
| 4202 | Ga0495601_0051546 | |||
| 4203 | Ga0495601_0169115 | |||
| 4204 | Ga0495601_0260732 | |||
| 4205 | Ga0495612_0025055 | |||
| 4206 | Ga0500635_0000140 | |||
| 4207 | Ga0500635_0043193 | |||
| 4208 | Ga0495655_0000320 | |||
| 4209 | Ga0495595_0007105 | |||
| 4210 | Ga0495595_0008305 | |||
| 4211 | Ga0495619_0002898 | |||
| 4212 | Ga0495619_0015975 | |||
| 4213 | Ga0495619_0077528 | |||
| 4214 | Ga0500578_0000102 | |||
| 4215 | Ga0500578_0213203 | |||
| 4216 | Ga0500643_001069 | |||
| 4217 | Ga0500643_001428 | |||
| 4218 | Ga0500643_002015 | |||
| 4219 | Ga0500643_037967 | |||
| 4220 | Ga0500644_0000290 | |||
| 4221 | Ga0500644_0006534 | |||
| 4222 | Ga0500644_0073460 | |||
| 4223 | Ga0500647_0003059 | |||
| 4224 | Ga0500651_0000984 | |||
| 4225 | Ga0500651_0013402 | |||
| 4226 | Ga0500566_0004593 | |||
| 4227 | Ga0500640_000515 | |||
| 4228 | Ga0500555_006631 | |||
| 4229 | Ga0500556_0000200 | |||
| 4230 | Ga0500556_0001879 | |||
| 4231 | Ga0500562_000497 | |||
| 4232 | Ga0500572_000529 | |||
| 4233 | Ga0500593_001627 | |||
| 4234 | Ga0500594_0002267 | |||
| 4235 | Ga0500597_000028 | |||
| 4236 | Ga0500608_000158 | |||
| 4237 | Ga0500614_004049 | |||
| 4238 | Ga0500614_005413 | |||
| 4239 | Ga0500618_000120 | |||
| 4240 | Ga0500628_000537 | |||
| 4241 | Ga0500642_0064213 | |||
| 4242 | Ga0500642_0083140 | |||
| 4243 | Ga0500658_0021557 | |||
| 4244 | Ga0500559_0000403 | |||
| 4245 | Ga0500559_0005605 | |||
| 4246 | Ga0500559_0021028 | |||
| 4247 | Ga0500559_0021554 | |||
| 4248 | Ga0500564_000115 | |||
| 4249 | Ga0500564_000291 | |||
| 4250 | Ga0500568_0016301 | |||
| 4251 | Ga0500568_0025658 | |||
| 4252 | Ga0500573_0044788 | |||
| 4253 | Ga0500616_0052065 | |||
| 4254 | Ga0500622_0000674 | |||
| 4255 | Ga0500622_0004041 | |||
| 4256 | Ga0500622_0020591 | |||
| 4257 | Ga0500622_0074155 | |||
| 4258 | Ga0500624_000075 | |||
| 4259 | Ga0500636_0000055 | |||
| 4260 | Ga0500637_0000681 | |||
| 4261 | Ga0500637_0053754 | |||
| 4262 | Ga0500567_001143 | |||
| 4263 | Ga0500625_000012 | |||
| 4264 | Ga0500625_009792 | |||
| 4265 | Ga0500645_000250 | |||
| 4266 | Ga0500645_001003 | |||
| 4267 | Ga0500645_008241 | |||
| 4268 | Ga0500645_008698 | |||
| 4269 | Ga0500609_001387 | |||
| 4270 | Ga0500587_001238 | |||
| 4271 | Ga0501084_0001450 | |||
| 4272 | Ga0501084_0012475 | |||
| 4273 | Ga0501082_0005168 | |||
| 4274 | Ga0501082_0006095 | |||
| 4275 | Ga0501082_0033315 | |||
| 4276 | Ga0466962_0000555 | |||
| 4277 | Ga0466962_0005147 | |||
| 4278 | Ga0530510_0000267 | |||
| 4279 | Ga0530510_0121791 | |||
| 4280 | 2501406879 | |||
| 4281 | 2511097785 | |||
| 4282 | 2511245969 | |||
| 4283 | 2519460345 | |||
| 4284 | 2525558312 | |||
| 4285 | 2572255971 | |||
| 4286 | 2585292648 | |||
| 4287 | 2587759172 | |||
| 4288 | 2595447692 | |||
| 4289 | 2595450382 | |||
| 4290 | 2599741329 | |||
| 4291 | 2599747260 | |||
| 4292 | 2599905713 | |||
| 4293 | 2600209115 | |||
| 4294 | 2630650300 | |||
| 4295 | 2643860596 | |||
| 4296 | 2643882244 | |||
| 4297 | 2643981540 | |||
| 4298 | 2644353395 | |||
| 4299 | 2644549315 | |||
| 4300 | 2644551440 | |||
| 4301 | 2676745144 | |||
| 4302 | 2729148598 | |||
| 4303 | 2774871110 | |||
| 4304 | 2808906743 | |||
| 4305 | 2808973025 | |||
| 4306 | 2809008147 | |||
| 4307 | 2809014950 | |||
| 4308 | 2809035447 | |||
| 4309 | 2817257863 | |||
| 4310 | 2817455998 | |||
| 4311 | 2819635188 | |||
| 4312 | 2819662386 | |||
| 4313 | 2842922452 | |||
| 4314 | 2852687898 | |||
| 4315 | 2863427857 | |||
| 4316 | 2870073562 | |||
| 4317 | 2894512120 | |||
| 4318 | 2904567559 | |||
| 4319 | 2904574604 | |||
| 4320 | 2919133032 | |||
| 4321 | 2928158354 | |||
| 4322 | 2928167442 | |||
| 4323 | 2928177009 | |||
| 4324 | 2928540281 | |||
| 4325 | 2928966402 | |||
| 4326 | 2929199329 | |||
| 4327 | 2953996913 | |||
| 4328 | 2981991815 | |||
| 4329 | 642417434 | |||
| 4330 | 8001523336 | |||
| 4331 | 8002394536 | |||
| 4332 | 8003017602 | |||
| 4333 | 8018850205 | |||
| 4334 | 8020812240 | |||
| 4335 | 8020941215 | |||
| 4336 | 8020946740 | |||
| 4337 | 8020958469 | |||
| 4338 | 8021123866 | |||
| 4339 | 8039100380 | |||
| 4340 | 8040170759 | |||
| 4341 | 8040176964 | |||
| 4342 | 8045868635 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5x41-assembly1.cif.gz_B | 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo | 0.9414 | 1 | 222 |
| 5x41-assembly2.cif.gz_D | 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo | 0.9413 | 1 | 225 |
| 7ahc-assembly1.cif.gz_C | opua apo inward-facing | 0.939 | 5 | 216 |
| 6z4w-assembly1.cif.gz_A | ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) | 0.9365 | 3 | 218 |
| 7ch8-assembly1.cif.gz_J | cryo-em structure of p.aeruginosa mlafebd with adp-v | 0.9332 | 2 | 221 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1L8_1_252_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9475 | 3 | 219 | 3.40.50.300 |
| af_P0AAF6_1_241_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9467 | 5 | 222 | 3.40.50.300 |
| af_P33360_1_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9445 | 5 | 221 | 3.40.50.300 |
| af_Q1RS86_918_1157_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9434 | 1 | 208 | 3.40.50.300 |
| af_O33189_10_251_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.942 | 2 | 226 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y4ZA76-F1-model_v4 | ABC transporter ATP-binding protein | 0.9695 | 3 | 216 |
GO:0005524
GO:0016887 |
| AF-A0A348B4H2-F1-model_v4 | ABC transporter domain-containing protein | 0.9684 | 34 | 222 |
GO:0005524
GO:0016887 |
| AF-A0A0U3H3Q4-F1-model_v4 | ABC transporter ATP-binding protein | 0.9653 | 3 | 222 |
GO:0005524
GO:0016887 |
| AF-A0A7C6CAI4-F1-model_v4 | ABC transporter ATP-binding protein | 0.9637 | 3 | 225 |
GO:0005524
GO:0016887 |
| AF-A0A842N7Y0-F1-model_v4 | ABC transporter ATP-binding protein | 0.9629 | 37 | 219 |
GO:0005524
GO:0016887 |