F496505

General Info

Members Datasets Scaffolds Average Seq Length
2173 689 2045 233

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10000398|JGI24740J21852_1000039815
Length 261
Sequence MPDAKRWSVKSWARANKRGIGDVSMPSSILVVEDEPAIAELIAVNLQHAGHYPIRAYNAEQALSLMSDVLPDLVLLDWMLPGKSGVMFAKELRANERTRQIPIIMLTARSEEQDKIMGLDSGADDYVTKPFSPKELLARIKAVLRRRAPQLTDDVVAINGLKLDPATHRVTATNTEAENPIKLDLGPTEFRLLHFLMTHPERVHSRSQLLDQVWGDHVFVEERTVDVHIKRLRAALAPGGYSNMIETVRGSGYRLARNPGQ

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
10 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
11 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
12 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
13 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
14 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
15 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
16 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
17 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
18 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
19 2519103095 Burkholderia sp. KJ006 Isolate Nodule
20 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
21 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
22 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
23 2547132512 Azospira oryzae 6a3 Isolate Unclassified
24 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
25 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
26 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
27 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
28 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
29 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
30 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
31 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
32 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
33 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
34 2643221569 Achromobacter sp. Root565 Isolate Unclassified
35 2643221594 Achromobacter sp. Root170 Isolate Unclassified
36 2643221621 Achromobacter sp. Root83 Isolate Unclassified
37 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
38 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
39 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
40 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
41 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
42 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
43 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
44 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
45 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
46 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
47 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
48 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
49 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
50 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
51 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
52 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
53 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
54 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
55 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
56 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
57 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
58 2818991450 Burkholderia sp. 604 Isolate Unclassified
59 2818991452 Burkholderia cepacia 561 Isolate Unclassified
60 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
61 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
62 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
63 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
64 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
65 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
66 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
67 2855730933 Achromobacter sp. HZ28 Isolate Nodule
68 2855767633 Achromobacter sp. HZ34 Isolate Nodule
69 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
70 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
71 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
72 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
73 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
74 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
75 2858950400 Achromobacter sp. K91 Isolate Unclassified
76 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
77 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
78 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
79 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
80 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
81 2885266251 Ralstonia sp. SET104 Isolate Nodule
82 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
83 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
84 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
85 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
86 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
87 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
88 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
89 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
90 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
91 2904564687 Burkholderia sp. 571 Isolate Unclassified
92 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
93 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
94 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
95 2928058823 Ralstonia sp. 1138 Isolate Unclassified
96 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
97 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
98 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
99 2928163908 Burkholderia sp. 567 Isolate Unclassified
100 2928170801 Burkholderia sp. 572 Isolate Unclassified
101 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
102 2928536128 Burkholderia sola 565 Isolate Unclassified
103 2941479691
104 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
105 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
106 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
107 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
108 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
109 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
110 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
111 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
112 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
113 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
114 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
115 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
116 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
117 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
118 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
119 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
120 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
121 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
122 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
123 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
124 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
125 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
126 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
127 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
128 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
129 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
130 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
131 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
132 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
133 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
134 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
135 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
136 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
137 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
138 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
139 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
140 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
141 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
142 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
143 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
144 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
145 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
146 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
147 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
148 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
149 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
150 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
151 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
152 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
153 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
154 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
155 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
156 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
157 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
158 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
159 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
160 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
161 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
162 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
163 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
164 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
165 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
166 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
167 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
168 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
169 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
170 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
171 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
172 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
173 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
174 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
175 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
176 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
177 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
178 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
179 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
180 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
181 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
182 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
183 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
184 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
185 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
186 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
187 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
188 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
189 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
190 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
191 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
192 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
193 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
194 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
195 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
196 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
197 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
198 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
199 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
200 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
201 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
202 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
203 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
204 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
205 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
206 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
207 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
208 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
209 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
210 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
211 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
212 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
213 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
214 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
215 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
216 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
217 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
218 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
219 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
220 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
221 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
222 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
223 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
224 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
225 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
226 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
227 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
228 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
229 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
230 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
231 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
232 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
233 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
234 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
235 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
236 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
237 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
238 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
239 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
240 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
241 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
242 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
243 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
244 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
245 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
246 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
247 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
248 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
249 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
250 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
251 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
252 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
253 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
254 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
255 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
256 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
257 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
258 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
259 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
260 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
261 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
262 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
263 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
264 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
265 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
266 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
267 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
268 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
269 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
270 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
271 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
272 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
273 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
274 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
275 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
276 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
277 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
278 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
279 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
280 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
281 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
282 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
284 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
285 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
287 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
290 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
291 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
292 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
294 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
295 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
296 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
297 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
298 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
299 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
300 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
301 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
302 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
303 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
304 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
306 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
307 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
308 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
309 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
310 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
311 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
312 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
377 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
378 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
380 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
384 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
385 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
386 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
387 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
388 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
389 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
390 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
391 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
392 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
393 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
394 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
395 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
396 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
397 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
398 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
399 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
400 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
401 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
402 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
403 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
404 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
405 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
406 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
407 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
408 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
409 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
410 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
411 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
412 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
413 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
414 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
415 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
416 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
417 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
418 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
419 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
420 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
421 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
422 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
423 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
424 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
425 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
426 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
427 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
428 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
429 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
430 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
431 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
432 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
433 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
434 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
435 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
436 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
437 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
438 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
439 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
440 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
441 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
442 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
443 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
444 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
445 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
446 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
447 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
448 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
449 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
450 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
451 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
452 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
453 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
454 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
455 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
456 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
457 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
458 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
459 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
460 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
461 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
462 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
463 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
464 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
465 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
466 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
467 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
468 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
469 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
470 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
471 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
472 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
473 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
474 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
475 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
476 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
477 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
478 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
479 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
480 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
481 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
482 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
483 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
484 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
485 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
486 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
487 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
488 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
489 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
490 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
491 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
492 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
493 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
494 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
495 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
496 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
497 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
498 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
499 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
500 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
501 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
502 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
503 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
504 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
505 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
506 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
507 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
508 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
509 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
510 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
511 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
512 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
513 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
514 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
515 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
516 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
517 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
518 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
519 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
520 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
521 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
522 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
523 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
524 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
525 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
526 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
527 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
528 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
529 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
530 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
531 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
532 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
533 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
534 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
535 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
536 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
537 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
538 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
539 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
540 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
541 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
542 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
543 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
544 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
545 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
546 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
547 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
548 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
549 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
550 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
551 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
552 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
553 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
554 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
555 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
556 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
557 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
558 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
559 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
560 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
561 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
562 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
563 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
564 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
565 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
566 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
567 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
568 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
569 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
570 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
571 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
572 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
573 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
574 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
575 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
576 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
577 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
578 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
579 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
580 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
581 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
582 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
583 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
584 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
585 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
586 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
587 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
588 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
589 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
590 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
591 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
592 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
593 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
594 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
595 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
596 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
597 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
598 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
599 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
600 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
601 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
602 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
603 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
604 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
605 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
606 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
607 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
608 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
609 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
610 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
611 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
612 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
613 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
614 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
615 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
616 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
617 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
618 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
619 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
620 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
621 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
622 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
623 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
624 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
625 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
626 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
627 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
628 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
629 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
630 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
631 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
632 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
633 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
634 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
635 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
636 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
637 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
638 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
639 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
640 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
641 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
642 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
643 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
644 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
645 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
646 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
647 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
648 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
649 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
650 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
651 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
652 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
653 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
654 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
655 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
656 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
657 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
658 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
659 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
660 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
661 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
662 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
663 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
664 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
665 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
666 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
667 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
668 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
669 639633007 Azoarcus olearius BH72 Isolate Unclassified
670 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
671 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
672 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
673 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
674 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
675 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
676 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
677 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
678 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
679 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
680 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
681 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
682 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
683 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
684 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
685 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
686 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
687 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
688 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
689 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.56
Metatranscriptomes 0.55
Isolates 5.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.72
Nodule 1.24
Rhizoplane 3.87
Rhizosphere 81.64
Stem 0
Stem Tuber 0
Unclassified 6.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000285 3300001915 Bacteria 15304
2 JGI24740J21852_10000252 3300001979 Bacteria 22754
3 JGI24740J21852_10000398 3300001979 Bacteria 18653
4 JGI24740J21852_10001895 3300001979 Bacteria 9587
5 JGI24739J22299_10030828 3300001989 Bacteria 1857
6 JGI24739J22299_10037392 3300001989 Bacteria 1635
7 JGI24737J22298_10026376 3300001990 Bacteria 1835
8 JGI24735J21928_10000738 3300002067 Bacteria 11625
9 JGI24735J21928_10000807 3300002067 Bacteria 11150
10 JGI24735J21928_10000854 3300002067 Bacteria 10851
11 JGI24735J21928_10003967 3300002067 Bacteria 5005
12 JGI24735J21928_10017420 3300002067 Bacteria 2222
13 JGI24738J21930_10002891 3300002075 Bacteria 4396
14 JGI24738J21930_10003158 3300002075 Bacteria 4214
15 JGI24738J21930_10010689 3300002075 Bacteria 2037
16 JGI25155J39150_1000049 3300002704 Bacteria 78961
17 JGI25156J39149_1000948 3300002705 Bacteria 13917
18 JGI25156J39149_1001464 3300002705 Bacteria 9946
19 JGI25156J39149_1001497 3300002705 Bacteria 9749
20 JGI25156J39149_1008830 3300002705 Bacteria 2501
21 JGI25156J39149_1023578 3300002705 Bacteria 1022
22 JGI25156J39149_1028384 3300002705 Bacteria 864
23 JGI25154J39366_1000136 3300002738 Bacteria 57760
24 JGI25151J46595_10000170 3300003187 Bacteria 84454
25 JGI25151J46595_10002448 3300003187 Bacteria 11155
26 JGI25151J46595_10011528 3300003187 Bacteria 4059
27 JGI25151J46595_10022770 3300003187 Bacteria 2594
28 JGI25165J46597_1000966 3300003214 Bacteria 19475
29 rootH1_10024447 3300003316 Bacteria 1786
30 JGI25160J50197_1000082 3300003354 Bacteria 97878
31 Ga0006556J51387_1013307 3300003479 Bacteria 5765
32 Ga0006556J51387_1021740 3300003479 Bacteria 5607
33 Ga0006560J51390_1028492 3300003565 Bacteria 1734
34 Ga0055539_1000061 3300003752 Bacteria 144457
35 Ga0055533_1000093 3300003756 Bacteria 116829
36 Ga0055533_1002259 3300003756 Bacteria 4489
37 Ga0055533_1006879 3300003756 Bacteria 1615
38 Ga0055532_1000039 3300003758 Bacteria 198049
39 Ga0055532_1000042 3300003758 Bacteria 195195
40 Ga0055525_1001197 3300003759 Bacteria 5813
41 Ga0055527_1000024 3300003760 Bacteria 198049
42 Ga0055527_1000169 3300003760 Bacteria 45013
43 Ga0055527_1002371 3300003760 Bacteria 3227
44 Ga0055527_1004686 3300003760 Bacteria 1848
45 Ga0055527_1004802 3300003760 Bacteria 1819
46 Ga0055535_1000028 3300003761 Bacteria 198049
47 Ga0055535_1000031 3300003761 Bacteria 195195
48 Ga0055535_1004699 3300003761 Bacteria 3227
49 Ga0055535_1004754 3300003761 Bacteria 3188
50 Ga0055542_1000047 3300003762 Bacteria 198049
51 Ga0055542_1001101 3300003762 Bacteria 16344
52 Ga0055542_1004774 3300003762 Bacteria 3188
53 Ga0055542_1008253 3300003762 Bacteria 2048
54 Ga0055529_1000054 3300003763 Bacteria 198049
55 Ga0055529_1000075 3300003763 Bacteria 156291
56 Ga0055529_1000098 3300003763 Bacteria 131900
57 Ga0055529_1001431 3300003763 Bacteria 7485
58 Ga0055529_1001572 3300003763 Bacteria 6387
59 Ga0055526_1006956 3300003771 Bacteria 6006
60 Ga0055526_1007454 3300003771 Bacteria 5680
61 Ga0055526_1017826 3300003771 Bacteria 2688
62 Ga0055526_1019301 3300003771 Bacteria 2491
63 Ga0055537_1006032 3300003773 Bacteria 3140
64 Ga0055524_1001323 3300003775 Bacteria 14462
65 Ga0055536_1000108 3300003781 Bacteria 73142
66 Ga0055534_1000543 3300003784 Bacteria 20131
67 Ga0055534_1001109 3300003784 Bacteria 11455
68 Ga0055528_1002698 3300003790 Bacteria 9352
69 Ga0055541_1000186 3300003841 Bacteria 28517
70 Ga0055541_1003030 3300003841 Bacteria 3229
71 Ga0055541_1009628 3300003841 Bacteria 1484
72 Ga0058692_1014395 3300003856 Bacteria 1813
73 Ga0065165_1008398 3300005262 Bacteria 4841
74 Ga0065712_10086903 3300005290 Bacteria 2593
75 Ga0065712_10209770 3300005290 Bacteria 1077
76 Ga0065715_10311062 3300005293 Bacteria 1020
77 Ga0065707_10135451 3300005295 Bacteria 1849
78 Ga0070658_10031366 3300005327 Bacteria 4267
79 Ga0070658_10073816 3300005327 Bacteria 2798
80 Ga0070658_10382544 3300005327 Bacteria 1208
81 Ga0070658_10535762 3300005327 Bacteria 1013
82 Ga0070658_10747942 3300005327 Bacteria 849
83 Ga0070676_10001310 3300005328 Bacteria 12507
84 Ga0070676_10001681 3300005328 Bacteria 11232
85 Ga0070676_10038307 3300005328 Bacteria 2769
86 Ga0070676_10038934 3300005328 Bacteria 2747
87 Ga0070676_10048539 3300005328 Bacteria 2482
88 Ga0070676_10052947 3300005328 Bacteria 2388
89 Ga0070683_100004025 3300005329 Bacteria 12031
90 Ga0070690_100028545 3300005330 Bacteria 3456
91 Ga0070690_100067617 3300005330 Bacteria 2315
92 Ga0070690_100093800 3300005330 Bacteria 1980
93 Ga0070690_100135871 3300005330 Bacteria 1665
94 Ga0070690_100230664 3300005330 Bacteria 1302
95 Ga0070670_100000794 3300005331 Bacteria 24602
96 Ga0070670_100004276 3300005331 Bacteria 11950
97 Ga0070670_100010398 3300005331 Bacteria 7941
98 Ga0070670_100017893 3300005331 Bacteria 6083
99 Ga0070670_100035853 3300005331 Bacteria 4270
100 Ga0070670_100066298 3300005331 Bacteria 3098
101 Ga0070670_100084468 3300005331 Bacteria 2727
102 Ga0070670_100128694 3300005331 Bacteria 2186
103 Ga0070670_100204534 3300005331 Bacteria 1716
104 Ga0070670_100215530 3300005331 Bacteria 1670
105 Ga0070670_100440204 3300005331 Bacteria 1154
106 Ga0070670_100520714 3300005331 Bacteria 1059
107 Ga0070677_10004159 3300005333 Bacteria 4706
108 Ga0070677_10006407 3300005333 Bacteria 3909
109 Ga0068869_100002911 3300005334 Bacteria 10393
110 Ga0068869_100015884 3300005334 Bacteria 5063
111 Ga0068869_100048902 3300005334 Bacteria 3060
112 Ga0068869_100060452 3300005334 Bacteria 2777
113 Ga0068869_100193929 3300005334 Bacteria 1599
114 Ga0068869_100224634 3300005334 Bacteria 1490
115 Ga0070666_10001976 3300005335 Bacteria 12486
116 Ga0070666_10008795 3300005335 Bacteria 6275
117 Ga0070666_10012256 3300005335 Bacteria 5403
118 Ga0070666_10016970 3300005335 Bacteria 4662
119 Ga0070666_10056153 3300005335 Bacteria 2658
120 Ga0070666_10146578 3300005335 Bacteria 1645
121 Ga0070666_10323229 3300005335 Bacteria 1101
122 Ga0070680_100116647 3300005336 Bacteria 2226
123 Ga0070682_100099986 3300005337 Bacteria 1913
124 Ga0068868_100001492 3300005338 Bacteria 16136
125 Ga0068868_100005172 3300005338 Bacteria 9157
126 Ga0068868_100005877 3300005338 Bacteria 8653
127 Ga0068868_100023457 3300005338 Bacteria 4670
128 Ga0068868_100070443 3300005338 Bacteria 2788
129 Ga0068868_100079971 3300005338 Bacteria 2619
130 Ga0068868_100168329 3300005338 Bacteria 1813
131 Ga0068868_100357822 3300005338 Bacteria 1252
132 Ga0068868_100600575 3300005338 Bacteria 975
133 Ga0070660_100000004 3300005339 Bacteria 171018
134 Ga0070660_100000911 3300005339 Bacteria 19768
135 Ga0070660_100334072 3300005339 Bacteria 1246
136 Ga0070689_100035804 3300005340 Bacteria 3793
137 Ga0070689_100078773 3300005340 Bacteria 2584
138 Ga0070689_100216586 3300005340 Bacteria 1569
139 Ga0070689_100218131 3300005340 Bacteria 1564
140 Ga0070689_100239547 3300005340 Bacteria 1494
141 Ga0070689_100370730 3300005340 Bacteria 1205
142 Ga0070689_100516342 3300005340 Bacteria 1025
143 Ga0070691_10156484 3300005341 Bacteria 1172
144 Ga0070687_100006755 3300005343 Bacteria 4728
145 Ga0070687_100041806 3300005343 Bacteria 2319
146 Ga0070661_100003578 3300005344 Bacteria 10694
147 Ga0070661_100007892 3300005344 Bacteria 7352
148 Ga0070661_100031174 3300005344 Bacteria 3854
149 Ga0070661_100048988 3300005344 Bacteria 3094
150 Ga0070661_100083196 3300005344 Bacteria 2364
151 Ga0070661_100283948 3300005344 Bacteria 1285
152 Ga0070692_10035932 3300005345 Bacteria 2512
153 Ga0070668_100003500 3300005347 Bacteria 11577
154 Ga0070668_100024996 3300005347 Bacteria 4527
155 Ga0070668_100049826 3300005347 Bacteria 3223
156 Ga0070668_100058297 3300005347 Bacteria 2987
157 Ga0070668_100099258 3300005347 Bacteria 2305
158 Ga0070668_100254559 3300005347 Bacteria 1458
159 Ga0070668_100313315 3300005347 Bacteria 1319
160 Ga0070669_100005523 3300005353 Bacteria 9129
161 Ga0070669_100011664 3300005353 Bacteria 6234
162 Ga0070669_100014200 3300005353 Bacteria 5667
163 Ga0070669_100042334 3300005353 Bacteria 3314
164 Ga0070669_100061282 3300005353 Bacteria 2764
165 Ga0070669_100089138 3300005353 Bacteria 2310
166 Ga0070669_100387626 3300005353 Bacteria 1141
167 Ga0070669_100411446 3300005353 Bacteria 1108
168 Ga0070669_100431224 3300005353 Bacteria 1083
169 Ga0070675_100003273 3300005354 Bacteria 12286
170 Ga0070675_100006825 3300005354 Bacteria 8765
171 Ga0070675_100009726 3300005354 Bacteria 7491
172 Ga0070675_100012894 3300005354 Bacteria 6561
173 Ga0070675_100067948 3300005354 Bacteria 2950
174 Ga0070675_100094526 3300005354 Bacteria 2508
175 Ga0070675_100154067 3300005354 Bacteria 1972
176 Ga0070675_100167620 3300005354 Bacteria 1892
177 Ga0070675_100175883 3300005354 Bacteria 1848
178 Ga0070675_100220442 3300005354 Bacteria 1652
179 Ga0070671_100000589 3300005355 Bacteria 25917
180 Ga0070671_100002161 3300005355 Bacteria 15167
181 Ga0070671_100002417 3300005355 Bacteria 14433
182 Ga0070671_100044240 3300005355 Bacteria 3700
183 Ga0070671_100044775 3300005355 Bacteria 3677
184 Ga0070671_100128400 3300005355 Bacteria 2134
185 Ga0070671_100250841 3300005355 Bacteria 1503
186 Ga0070671_100938375 3300005355 Bacteria 757
187 Ga0070674_100014905 3300005356 Bacteria 4840
188 Ga0070674_100015926 3300005356 Bacteria 4705
189 Ga0070674_100044490 3300005356 Bacteria 3027
190 Ga0070674_100046998 3300005356 Bacteria 2955
191 Ga0070674_100047304 3300005356 Bacteria 2946
192 Ga0070674_100078820 3300005356 Bacteria 2348
193 Ga0070674_100103170 3300005356 Bacteria 2081
194 Ga0070674_100186035 3300005356 Bacteria 1594
195 Ga0070674_100229364 3300005356 Bacteria 1448
196 Ga0070674_100421346 3300005356 Bacteria 1095
197 Ga0070674_100979428 3300005356 Bacteria 741
198 Ga0070673_100001585 3300005364 Bacteria 13424
199 Ga0070673_100010613 3300005364 Bacteria 6243
200 Ga0070673_100021044 3300005364 Bacteria 4718
201 Ga0070673_100034094 3300005364 Bacteria 3849
202 Ga0070673_100050827 3300005364 Bacteria 3243
203 Ga0070673_100060619 3300005364 Bacteria 2999
204 Ga0070673_100067755 3300005364 Bacteria 2855
205 Ga0070673_100218481 3300005364 Bacteria 1649
206 Ga0070673_100238110 3300005364 Bacteria 1581
207 Ga0070673_100653599 3300005364 Bacteria 962
208 Ga0070688_100007351 3300005365 Bacteria 5935
209 Ga0070688_100167901 3300005365 Bacteria 1512
210 Ga0070688_100196454 3300005365 Bacteria 1409
211 Ga0070659_100000023 3300005366 Bacteria 150907
212 Ga0070659_100002349 3300005366 Bacteria 13451
213 Ga0070659_100014799 3300005366 Bacteria 5832
214 Ga0070659_100041302 3300005366 Bacteria 3605
215 Ga0070659_100676862 3300005366 Bacteria 891
216 Ga0070667_100013664 3300005367 Bacteria 6709
217 Ga0070667_100037902 3300005367 Bacteria 4042
218 Ga0070667_100136840 3300005367 Bacteria 2142
219 Ga0070667_100187790 3300005367 Bacteria 1829
220 Ga0070667_100199454 3300005367 Bacteria 1775
221 Ga0070667_100227316 3300005367 Bacteria 1663
222 Ga0070667_100270870 3300005367 Bacteria 1522
223 Ga0070667_100321783 3300005367 Bacteria 1396
224 Ga0070667_100338309 3300005367 Bacteria 1361
225 Ga0070709_10043427 3300005434 Bacteria 2780
226 Ga0070714_100015258 3300005435 Bacteria 6179
227 Ga0070713_100000532 3300005436 Bacteria 24168
228 Ga0070713_100015624 3300005436 Bacteria 5685
229 Ga0070713_100021655 3300005436 Bacteria 4950
230 Ga0070701_10030910 3300005438 Bacteria 2653
231 Ga0070701_10149864 3300005438 Bacteria 1342
232 Ga0070711_100010786 3300005439 Bacteria 5666
233 Ga0070711_100249430 3300005439 Bacteria 1392
234 Ga0070711_100348624 3300005439 Bacteria 1190
235 Ga0070711_100734650 3300005439 Bacteria 833
236 Ga0070705_100006646 3300005440 Bacteria 5683
237 Ga0070705_100297485 3300005440 Bacteria 1155
238 Ga0070700_100001947 3300005441 Bacteria 10467
239 Ga0070700_100047678 3300005441 Bacteria 2652
240 Ga0070700_100063019 3300005441 Bacteria 2344
241 Ga0070700_100157892 3300005441 Bacteria 1558
242 Ga0070694_100034731 3300005444 Bacteria 3327
243 Ga0070694_100135549 3300005444 Bacteria 1784
244 Ga0070694_100193692 3300005444 Bacteria 1511
245 Ga0070708_100127807 3300005445 Bacteria 2350
246 Ga0070663_100000086 3300005455 Bacteria 41783
247 Ga0070663_100001557 3300005455 Bacteria 12629
248 Ga0070663_100098249 3300005455 Bacteria 2181
249 Ga0070663_100222190 3300005455 Bacteria 1483
250 Ga0070663_100229371 3300005455 Bacteria 1461
251 Ga0070663_100292739 3300005455 Bacteria 1301
252 Ga0070663_100415188 3300005455 Bacteria 1103
253 Ga0070678_100005373 3300005456 Bacteria 7390
254 Ga0070678_100057050 3300005456 Bacteria 2859
255 Ga0070678_100158952 3300005456 Bacteria 1829
256 Ga0070678_100281530 3300005456 Bacteria 1406
257 Ga0070678_100690538 3300005456 Bacteria 919
258 Ga0070662_100019828 3300005457 Bacteria 4572
259 Ga0070662_100042912 3300005457 Bacteria 3233
260 Ga0070662_100099184 3300005457 Bacteria 2201
261 Ga0070662_100120049 3300005457 Bacteria 2014
262 Ga0070662_100205850 3300005457 Bacteria 1563
263 Ga0070662_100400099 3300005457 Bacteria 1133
264 Ga0070681_10001348 3300005458 Bacteria 21452
265 Ga0070681_10177737 3300005458 Bacteria 2050
266 Ga0070681_10219058 3300005458 Bacteria 1819
267 Ga0068867_100002638 3300005459 Bacteria 12648
268 Ga0068867_100002656 3300005459 Bacteria 12618
269 Ga0068867_100004997 3300005459 Bacteria 9348
270 Ga0068867_100011201 3300005459 Bacteria 6328
271 Ga0068867_100046296 3300005459 Bacteria 3194
272 Ga0068867_100052807 3300005459 Bacteria 3000
273 Ga0068867_100068295 3300005459 Bacteria 2652
274 Ga0068867_100092347 3300005459 Bacteria 2299
275 Ga0068867_100423190 3300005459 Bacteria 1129
276 Ga0070685_10000757 3300005466 Bacteria 17554
277 Ga0070685_10095575 3300005466 Bacteria 1807
278 Ga0070685_10129446 3300005466 Bacteria 1577
279 Ga0070685_10143976 3300005466 Bacteria 1504
280 Ga0070685_10356222 3300005466 Bacteria 1002
281 Ga0070706_100032692 3300005467 Bacteria 4799
282 Ga0070706_100087840 3300005467 Bacteria 2882
283 Ga0070706_100280087 3300005467 Bacteria 1556
284 Ga0070707_100009718 3300005468 Bacteria 8939
285 Ga0070707_100018971 3300005468 Bacteria 6478
286 Ga0070707_100062471 3300005468 Bacteria 3573
287 Ga0070698_100017560 3300005471 Bacteria 7540
288 Ga0070698_100103715 3300005471 Bacteria 2814
289 Ga0070698_100262156 3300005471 Bacteria 1660
290 Ga0070699_100149670 3300005518 Bacteria 2064
291 Ga0070679_100062237 3300005530 Bacteria 3720
292 Ga0070679_100734481 3300005530 Bacteria 930
293 Ga0070684_100033975 3300005535 Bacteria 4358
294 Ga0070684_100588050 3300005535 Bacteria 1034
295 Ga0070697_100068938 3300005536 Bacteria 2896
296 Ga0070697_100079450 3300005536 Bacteria 2700
297 Ga0068853_100047758 3300005539 Bacteria 3674
298 Ga0068853_100121727 3300005539 Bacteria 2328
299 Ga0068853_100264168 3300005539 Bacteria 1583
300 Ga0068853_100821306 3300005539 Bacteria 891
301 Ga0070672_100002422 3300005543 Bacteria 11820
302 Ga0070672_100002682 3300005543 Bacteria 11382
303 Ga0070672_100008126 3300005543 Bacteria 7172
304 Ga0070672_100052798 3300005543 Bacteria 3175
305 Ga0070672_100074503 3300005543 Bacteria 2708
306 Ga0070672_100086478 3300005543 Bacteria 2521
307 Ga0070686_100017705 3300005544 Bacteria 4168
308 Ga0070686_100094859 3300005544 Bacteria 2003
309 Ga0070695_100104355 3300005545 Bacteria 1914
310 Ga0070695_100246441 3300005545 Bacteria 1298
311 Ga0070695_100353331 3300005545 Bacteria 1102
312 Ga0070696_100008925 3300005546 Bacteria 6708
313 Ga0070696_100037988 3300005546 Bacteria 3322
314 Ga0070696_100074801 3300005546 Bacteria 2389
315 Ga0070696_100414815 3300005546 Bacteria 1056
316 Ga0070696_100451715 3300005546 Bacteria 1014
317 Ga0070693_100003520 3300005547 Bacteria 7299
318 Ga0070693_100080079 3300005547 Bacteria 1945
319 Ga0070693_100086299 3300005547 Bacteria 1883
320 Ga0070665_100039880 3300005548 Bacteria 4721
321 Ga0070665_100059918 3300005548 Bacteria 3815
322 Ga0070665_100150507 3300005548 Bacteria 2330
323 Ga0070665_100242480 3300005548 Bacteria 1803
324 Ga0070665_100259349 3300005548 Bacteria 1740
325 Ga0070665_100321841 3300005548 Bacteria 1551
326 Ga0070704_100024770 3300005549 Bacteria 3942
327 Ga0070704_100038893 3300005549 Bacteria 3262
328 Ga0070704_100136452 3300005549 Bacteria 1909
329 Ga0070704_100153612 3300005549 Bacteria 1813
330 Ga0068855_100002387 3300005563 Bacteria 23152
331 Ga0068855_100018420 3300005563 Bacteria 8390
332 Ga0068855_100018465 3300005563 Bacteria 8381
333 Ga0068855_100052505 3300005563 Bacteria 4799
334 Ga0068855_100683773 3300005563 Bacteria 1099
335 Ga0070664_100000210 3300005564 Bacteria 41664
336 Ga0070664_100001995 3300005564 Bacteria 16367
337 Ga0070664_100007567 3300005564 Bacteria 8771
338 Ga0070664_100021557 3300005564 Bacteria 5312
339 Ga0070664_100804411 3300005564 Bacteria 879
340 Ga0068857_100024223 3300005577 Bacteria 5342
341 Ga0068857_100051126 3300005577 Bacteria 3665
342 Ga0068857_100138790 3300005577 Bacteria 2196
343 Ga0068857_100825642 3300005577 Bacteria 886
344 Ga0068854_100000176 3300005578 Bacteria 43579
345 Ga0068854_100010139 3300005578 Bacteria 6104
346 Ga0068854_100073191 3300005578 Bacteria 2511
347 Ga0068854_100231570 3300005578 Bacteria 1467
348 Ga0068854_100530079 3300005578 Bacteria 996
349 Ga0068854_100618586 3300005578 Bacteria 926
350 Ga0068856_100000539 3300005614 Bacteria 41776
351 Ga0068856_100064342 3300005614 Bacteria 3624
352 Ga0068856_100127434 3300005614 Bacteria 2549
353 Ga0070702_100017659 3300005615 Bacteria 3685
354 Ga0070702_100025579 3300005615 Bacteria 3164
355 Ga0070702_100088974 3300005615 Bacteria 1868
356 Ga0070702_100095730 3300005615 Bacteria 1810
357 Ga0070702_100510421 3300005615 Bacteria 885
358 Ga0068852_100002615 3300005616 Bacteria 12439
359 Ga0068852_100031574 3300005616 Bacteria 4373
360 Ga0068852_100035275 3300005616 Bacteria 4171
361 Ga0068852_100064785 3300005616 Bacteria 3187
362 Ga0068852_100066436 3300005616 Bacteria 3149
363 Ga0068852_100203886 3300005616 Bacteria 1873
364 Ga0068852_100276485 3300005616 Bacteria 1617
365 Ga0068852_100323127 3300005616 Bacteria 1499
366 Ga0068859_100006668 3300005617 Bacteria 11718
367 Ga0068859_100020089 3300005617 Bacteria 6706
368 Ga0068859_100021016 3300005617 Bacteria 6551
369 Ga0068859_100035730 3300005617 Bacteria 4987
370 Ga0068859_100058396 3300005617 Bacteria 3886
371 Ga0068859_100062989 3300005617 Bacteria 3739
372 Ga0068859_100119219 3300005617 Bacteria 2705
373 Ga0068864_100002964 3300005618 Bacteria 14021
374 Ga0068864_100003851 3300005618 Bacteria 12362
375 Ga0068864_100006347 3300005618 Bacteria 9696
376 Ga0068864_100013687 3300005618 Bacteria 6727
377 Ga0068864_100018479 3300005618 Bacteria 5825
378 Ga0068864_100021943 3300005618 Bacteria 5352
379 Ga0068864_100029085 3300005618 Bacteria 4676
380 Ga0068864_100053236 3300005618 Bacteria 3491
381 Ga0068864_100069752 3300005618 Bacteria 3057
382 Ga0068864_100153115 3300005618 Bacteria 2090
383 Ga0068866_10042299 3300005718 Bacteria 2266
384 Ga0068866_10073302 3300005718 Bacteria 1816
385 Ga0068866_10197149 3300005718 Bacteria 1200
386 Ga0068866_10199630 3300005718 Bacteria 1194
387 Ga0068861_100013530 3300005719 Bacteria 5711
388 Ga0068861_100017467 3300005719 Bacteria 5095
389 Ga0068861_100019979 3300005719 Bacteria 4789
390 Ga0068861_100104490 3300005719 Bacteria 2260
391 Ga0068861_100172974 3300005719 Bacteria 1791
392 Ga0068861_100280783 3300005719 Bacteria 1434
393 Ga0068861_100646928 3300005719 Bacteria 976
394 Ga0068861_100977177 3300005719 Bacteria 807
395 Ga0068851_10028634 3300005834 Bacteria 2753
396 Ga0068851_10031457 3300005834 Bacteria 2636
397 Ga0068851_10149990 3300005834 Bacteria 1274
398 Ga0068851_10164223 3300005834 Bacteria 1221
399 Ga0068851_10246979 3300005834 Bacteria 1011
400 Ga0068870_10055846 3300005840 Bacteria 2105
401 Ga0068870_10104439 3300005840 Bacteria 1607
402 Ga0068870_10112648 3300005840 Bacteria 1556
403 Ga0068870_10190887 3300005840 Bacteria 1236
404 Ga0068863_100004310 3300005841 Bacteria 14014
405 Ga0068863_100009490 3300005841 Bacteria 9491
406 Ga0068863_100015125 3300005841 Bacteria 7412
407 Ga0068863_100036850 3300005841 Bacteria 4658
408 Ga0068863_100043595 3300005841 Bacteria 4258
409 Ga0068863_100303717 3300005841 Bacteria 1548
410 Ga0068863_100315337 3300005841 Bacteria 1518
411 Ga0068858_100002444 3300005842 Bacteria 18774
412 Ga0068858_100002652 3300005842 Bacteria 18019
413 Ga0068858_100009823 3300005842 Bacteria 9102
414 Ga0068858_100021681 3300005842 Bacteria 6003
415 Ga0068858_100085995 3300005842 Bacteria 2925
416 Ga0068858_100093216 3300005842 Bacteria 2804
417 Ga0068858_100347164 3300005842 Bacteria 1421
418 Ga0068860_100004770 3300005843 Bacteria 13817
419 Ga0068860_100015268 3300005843 Bacteria 7500
420 Ga0068860_100047745 3300005843 Bacteria 4080
421 Ga0068860_100052282 3300005843 Bacteria 3886
422 Ga0068860_100072265 3300005843 Bacteria 3278
423 Ga0068860_100180597 3300005843 Bacteria 2039
424 Ga0068860_100302283 3300005843 Bacteria 1568
425 Ga0068860_100870000 3300005843 Bacteria 916
426 Ga0068860_100964236 3300005843 Bacteria 870
427 Ga0068862_100028548 3300005844 Bacteria 4699
428 Ga0068862_100129761 3300005844 Bacteria 2228
429 Ga0068862_100197950 3300005844 Bacteria 1810
430 Ga0068862_100548622 3300005844 Bacteria 1103
431 Ga0068862_100955642 3300005844 Bacteria 845
432 Ga0075365_10055315 3300006038 Bacteria 2633
433 Ga0075364_10000753 3300006051 Bacteria 16980
434 Ga0075432_10004664 3300006058 Bacteria 4666
435 Ga0070715_10004690 3300006163 Bacteria 4514
436 Ga0070716_100022295 3300006173 Bacteria 3345
437 Ga0070716_100062376 3300006173 Bacteria 2161
438 Ga0070716_100365089 3300006173 Bacteria 1027
439 Ga0070712_100004028 3300006175 Bacteria 9017
440 Ga0070712_100145017 3300006175 Bacteria 1816
441 Ga0075362_10077635 3300006177 Bacteria 1526
442 Ga0075369_10032064 3300006186 Bacteria 2222
443 Ga0075366_10001330 3300006195 Bacteria 12345
444 Ga0075366_10236705 3300006195 Bacteria 1113
445 Ga0097621_100002149 3300006237 Bacteria 13490
446 Ga0097621_100005550 3300006237 Bacteria 8892
447 Ga0097621_100053543 3300006237 Bacteria 3289
448 Ga0097621_100053998 3300006237 Bacteria 3275
449 Ga0097621_100086775 3300006237 Bacteria 2612
450 Ga0097621_100152614 3300006237 Bacteria 1981
451 Ga0097621_100231710 3300006237 Bacteria 1612
452 Ga0097621_100246439 3300006237 Bacteria 1563
453 Ga0097621_100266002 3300006237 Bacteria 1505
454 Ga0097621_100407995 3300006237 Bacteria 1217
455 Ga0075370_10238179 3300006353 Bacteria 1077
456 Ga0068871_100001773 3300006358 Bacteria 14526
457 Ga0068871_100002481 3300006358 Bacteria 12584
458 Ga0068871_100009830 3300006358 Bacteria 6943
459 Ga0068871_100016020 3300006358 Bacteria 5632
460 Ga0068871_100020320 3300006358 Bacteria 5086
461 Ga0068871_100149719 3300006358 Bacteria 1989
462 Ga0068871_100181964 3300006358 Bacteria 1807
463 Ga0068871_100778655 3300006358 Bacteria 881
464 Ga0075428_100001468 3300006844 Bacteria 25238
465 Ga0075428_100206826 3300006844 Bacteria 2121
466 Ga0075430_100133248 3300006846 Bacteria 2071
467 Ga0075431_100085644 3300006847 Bacteria 3253
468 Ga0075431_100526472 3300006847 Bacteria 1171
469 Ga0075433_10000871 3300006852 Bacteria 21152
470 Ga0075433_10534841 3300006852 Bacteria 1031
471 Ga0075434_100000018 3300006871 Bacteria 73715
472 Ga0075434_100070328 3300006871 Bacteria 3490
473 Ga0075429_100000889 3300006880 Bacteria 23630
474 Ga0075429_100003291 3300006880 Bacteria 13752
475 Ga0068865_100001401 3300006881 Bacteria 14028
476 Ga0068865_100013582 3300006881 Bacteria 5151
477 Ga0068865_100125892 3300006881 Bacteria 1912
478 Ga0068865_100281207 3300006881 Bacteria 1325
479 Ga0068865_100461308 3300006881 Bacteria 1052
480 Ga0068865_100495696 3300006881 Bacteria 1017
481 Ga0075436_100003281 3300006914 Bacteria 11082
482 Ga0075436_100116995 3300006914 Bacteria 1863
483 Ga0075436_100122689 3300006914 Bacteria 1819
484 Ga0075436_100138160 3300006914 Bacteria 1712
485 Ga0097620_100006668 3300006931 Bacteria 11718
486 Ga0097620_100020089 3300006931 Bacteria 6706
487 Ga0097620_100021016 3300006931 Bacteria 6551
488 Ga0097620_100035731 3300006931 Bacteria 4987
489 Ga0097620_100058390 3300006931 Bacteria 3886
490 Ga0097620_100062985 3300006931 Bacteria 3739
491 Ga0097620_100119228 3300006931 Bacteria 2705
492 Ga0097620_100278111 3300006931 Bacteria 1766
493 Ga0099826_10000029 3300006948 Bacteria 128855
494 Ga0075435_100000388 3300007076 Bacteria 26867
495 Ga0075435_100113896 3300007076 Bacteria 2251
496 Ga0075435_100264267 3300007076 Bacteria 1467
497 Ga0099794_10159760 3300007265 Bacteria 1146
498 Ga0099795_10025370 3300007788 Bacteria 1988
499 Ga0099795_10149391 3300007788 Bacteria 956
500 Ga0105251_10000186 3300009011 Bacteria 62845
501 Ga0105251_10011338 3300009011 Bacteria 5097
502 Ga0105251_10130988 3300009011 Bacteria 1136
503 Ga0105250_10005986 3300009092 Bacteria 5366
504 Ga0105240_10003819 3300009093 Bacteria 23285
505 Ga0105240_10005824 3300009093 Bacteria 18279
506 Ga0105240_10071108 3300009093 Bacteria 4304
507 Ga0105240_10109151 3300009093 Bacteria 3351
508 Ga0105240_10148516 3300009093 Bacteria 2794
509 Ga0105240_10173430 3300009093 Bacteria 2552
510 Ga0111539_10063751 3300009094 Bacteria 4361
511 Ga0111539_10092043 3300009094 Bacteria 3563
512 Ga0111539_10122610 3300009094 Bacteria 3046
513 Ga0111539_10550302 3300009094 Bacteria 1344
514 Ga0111539_10806671 3300009094 Bacteria 1092
515 Ga0105245_10044022 3300009098 Bacteria 3983
516 Ga0105245_10044546 3300009098 Bacteria 3961
517 Ga0105245_10141882 3300009098 Bacteria 2263
518 Ga0105245_10147987 3300009098 Bacteria 2217
519 Ga0105245_10217854 3300009098 Bacteria 1840
520 Ga0105245_10233222 3300009098 Bacteria 1781
521 Ga0105247_10041596 3300009101 Bacteria 2813
522 Ga0105247_10067897 3300009101 Bacteria 2222
523 Ga0105247_10218031 3300009101 Bacteria 1290
524 Ga0114129_10000210 3300009147 Bacteria 65476
525 Ga0114129_10233201 3300009147 Bacteria 2478
526 Ga0114129_10566680 3300009147 Bacteria 1475
527 Ga0105243_10041383 3300009148 Bacteria 3604
528 Ga0105243_10143700 3300009148 Bacteria 2039
529 Ga0105243_10150297 3300009148 Bacteria 1997
530 Ga0105243_10226305 3300009148 Bacteria 1656
531 Ga0105243_10269452 3300009148 Bacteria 1528
532 Ga0105241_10016405 3300009174 Bacteria 5432
533 Ga0105241_10050855 3300009174 Bacteria 3159
534 Ga0105241_10051776 3300009174 Bacteria 3132
535 Ga0105241_10095695 3300009174 Bacteria 2351
536 Ga0105241_10289368 3300009174 Bacteria 1402
537 Ga0105241_10358565 3300009174 Bacteria 1268
538 Ga0105242_10019762 3300009176 Bacteria 5280
539 Ga0105242_10086091 3300009176 Bacteria 2637
540 Ga0105242_10100261 3300009176 Bacteria 2452
541 Ga0105242_10151095 3300009176 Bacteria 2025
542 Ga0105242_10294997 3300009176 Bacteria 1478
543 Ga0105248_10014013 3300009177 Bacteria 8821
544 Ga0105248_10067835 3300009177 Bacteria 4005
545 Ga0105248_10088995 3300009177 Bacteria 3475
546 Ga0105248_10094628 3300009177 Bacteria 3364
547 Ga0105248_10100388 3300009177 Bacteria 3261
548 Ga0105248_10176403 3300009177 Bacteria 2408
549 Ga0105248_10191981 3300009177 Bacteria 2301
550 Ga0105248_10255064 3300009177 Bacteria 1974
551 Ga0105248_10570357 3300009177 Bacteria 1277
552 Ga0105248_10846989 3300009177 Bacteria 1032
553 Ga0105248_10957160 3300009177 Bacteria 967
554 Ga0105237_10036836 3300009545 Bacteria 4948
555 Ga0105237_10050960 3300009545 Bacteria 4160
556 Ga0105237_10090750 3300009545 Bacteria 3044
557 Ga0105237_10472431 3300009545 Bacteria 1260
558 Ga0105238_10006191 3300009551 Bacteria 11881
559 Ga0105238_10074614 3300009551 Bacteria 3384
560 Ga0105238_10080283 3300009551 Bacteria 3251
561 Ga0105238_10141313 3300009551 Bacteria 2384
562 Ga0105249_10042317 3300009553 Bacteria 4142
563 Ga0105249_10156163 3300009553 Bacteria 2200
564 Ga0105249_10376664 3300009553 Bacteria 1444
565 Ga0105249_10430951 3300009553 Bacteria 1354
566 Ga0105249_10797171 3300009553 Bacteria 1008
567 Ga0105148_102784 3300009978 Bacteria 1233
568 Ga0105239_10001448 3300010375 Bacteria 31631
569 Ga0105239_10008327 3300010375 Bacteria 11816
570 Ga0105239_10008633 3300010375 Bacteria 11550
571 Ga0105239_10427714 3300010375 Bacteria 1501
572 Ga0105239_10532253 3300010375 Bacteria 1337
573 Ga0105239_11075465 3300010375 Bacteria 926
574 Ga0105246_10011859 3300011119 Bacteria 5421
575 Ga0105246_10123489 3300011119 Bacteria 1922
576 Ga0157373_10010740 3300013100 Bacteria 6738
577 Ga0157373_10016530 3300013100 Bacteria 5381
578 Ga0157373_10133706 3300013100 Bacteria 1744
579 Ga0157373_10454788 3300013100 Bacteria 922
580 Ga0157371_10001623 3300013102 Bacteria 23003
581 Ga0157371_10007831 3300013102 Bacteria 8577
582 Ga0157371_10565771 3300013102 Bacteria 843
583 Ga0157370_10000766 3300013104 Bacteria 40226
584 Ga0157370_10001020 3300013104 Bacteria 35257
585 Ga0157370_10001871 3300013104 Bacteria 25947
586 Ga0157370_10058227 3300013104 Bacteria 3673
587 Ga0157369_10000630 3300013105 Bacteria 45680
588 Ga0157369_10002244 3300013105 Bacteria 23243
589 Ga0157369_10003025 3300013105 Bacteria 20074
590 Ga0157369_10004121 3300013105 Bacteria 17217
591 Ga0157369_10053318 3300013105 Bacteria 4372
592 Ga0157369_10086548 3300013105 Bacteria 3347
593 Ga0157374_10000290 3300013296 Bacteria 46282
594 Ga0157374_10002806 3300013296 Bacteria 14623
595 Ga0157374_10004613 3300013296 Bacteria 11559
596 Ga0157374_10006109 3300013296 Bacteria 10195
597 Ga0157374_10066580 3300013296 Bacteria 3385
598 Ga0157374_10219823 3300013296 Bacteria 1864
599 Ga0157374_10672208 3300013296 Bacteria 1048
600 Ga0157374_10689978 3300013296 Bacteria 1034
601 Ga0157378_10172565 3300013297 Bacteria 2029
602 Ga0157378_10238470 3300013297 Bacteria 1736
603 Ga0157378_10357118 3300013297 Bacteria 1429
604 Ga0157378_10473962 3300013297 Bacteria 1246
605 Ga0157378_10727104 3300013297 Bacteria 1014
606 Ga0163162_10001332 3300013306 Bacteria 23030
607 Ga0163162_10009853 3300013306 Bacteria 9294
608 Ga0163162_10016830 3300013306 Bacteria 7147
609 Ga0163162_10024033 3300013306 Bacteria 6013
610 Ga0163162_10041740 3300013306 Bacteria 4590
611 Ga0163162_10059521 3300013306 Bacteria 3852
612 Ga0163162_10246545 3300013306 Bacteria 1918
613 Ga0163162_10461924 3300013306 Bacteria 1401
614 Ga0163162_10614739 3300013306 Bacteria 1212
615 Ga0163162_10654838 3300013306 Bacteria 1174
616 Ga0163162_10803344 3300013306 Bacteria 1058
617 Ga0157372_10004320 3300013307 Bacteria 15191
618 Ga0157372_10154511 3300013307 Bacteria 2650
619 Ga0157372_10187197 3300013307 Bacteria 2397
620 Ga0157372_10490629 3300013307 Bacteria 1432
621 Ga0157372_10746479 3300013307 Bacteria 1138
622 Ga0157375_10005150 3300013308 Bacteria 11345
623 Ga0157375_10020148 3300013308 Bacteria 6087
624 Ga0157375_10022043 3300013308 Bacteria 5858
625 Ga0157375_10026073 3300013308 Bacteria 5441
626 Ga0157375_10029988 3300013308 Bacteria 5122
627 Ga0157375_10056113 3300013308 Bacteria 3887
628 Ga0157375_10133366 3300013308 Bacteria 2605
629 Ga0157375_10272258 3300013308 Bacteria 1855
630 Ga0157375_10449955 3300013308 Bacteria 1453
631 Ga0163163_10002324 3300014325 Bacteria 16064
632 Ga0163163_10048894 3300014325 Bacteria 4161
633 Ga0163163_10319086 3300014325 Bacteria 1607
634 Ga0157380_10002573 3300014326 Bacteria 12261
635 Ga0157380_10083754 3300014326 Bacteria 2613
636 Ga0157380_10121530 3300014326 Bacteria 2213
637 Ga0157380_10190606 3300014326 Bacteria 1809
638 Ga0157380_10319419 3300014326 Bacteria 1439
639 Ga0157380_10496884 3300014326 Bacteria 1184
640 Ga0182008_10076418 3300014497 Bacteria 1648
641 Ga0157377_10159371 3300014745 Bacteria 1402
642 Ga0157379_10004048 3300014968 Bacteria 12504
643 Ga0157379_10010030 3300014968 Bacteria 8252
644 Ga0157379_10017536 3300014968 Bacteria 6302
645 Ga0157379_10029549 3300014968 Bacteria 4873
646 Ga0157379_10033777 3300014968 Bacteria 4563
647 Ga0157379_10090488 3300014968 Bacteria 2745
648 Ga0157379_10189023 3300014968 Bacteria 1861
649 Ga0157379_10300011 3300014968 Bacteria 1464
650 Ga0157376_10002530 3300014969 Bacteria 12392
651 Ga0157376_10005813 3300014969 Bacteria 8648
652 Ga0157376_10110755 3300014969 Bacteria 2416
653 Ga0157376_10180138 3300014969 Bacteria 1931
654 Ga0157376_10268722 3300014969 Bacteria 1601
655 Ga0157376_10480015 3300014969 Bacteria 1218
656 Ga0157376_10498258 3300014969 Bacteria 1197
657 Ga0182006_1003514 3300015261 Bacteria 7996
658 Ga0182006_1071558 3300015261 Bacteria 1285
659 Ga0182007_10007176 3300015262 Bacteria 4701
660 Ga0182007_10011697 3300015262 Bacteria 3408
661 Ga0182005_1067115 3300015265 Bacteria 983
662 Ga0183361_10036 3300016635 Bacteria 47056
663 Ga0163161_10032428 3300017792 Bacteria 3729
664 Ga0163161_10075707 3300017792 Bacteria 2470
665 Ga0163161_10083587 3300017792 Bacteria 2353
666 Ga0163161_10247905 3300017792 Bacteria 1387
667 Ga0163161_10290353 3300017792 Bacteria 1285
668 Ga0163161_10316367 3300017792 Bacteria 1233
669 Ga0163161_10475007 3300017792 Bacteria 1014
670 Ga0206356_11370595 3300020070 Bacteria 3185
671 Ga0206355_1446151 3300020076 Bacteria 3045
672 Ga0206351_10992658 3300020077 Bacteria 7604
673 Ga0206350_11630003 3300020080 Bacteria 798
674 Ga0154015_1153690 3300020610 Bacteria 31263
675 Ga0213872_10001609 3300021361 Bacteria 14288
676 Ga0213872_10015725 3300021361 Bacteria 3516
677 Ga0224712_10000026 3300022467 Bacteria 22158
678 Ga0209784_100003 3300025224 Bacteria 1379451
679 Ga0209784_100603 3300025224 Bacteria 11615
680 Ga0209566_100002 3300025225 Bacteria 2614868
681 Ga0209566_100330 3300025225 Bacteria 42404
682 Ga0209566_100726 3300025225 Bacteria 18606
683 Ga0209566_100783 3300025225 Bacteria 16858
684 Ga0209674_100013 3300025226 Bacteria 813140
685 Ga0209674_100094 3300025226 Bacteria 169506
686 Ga0209674_100160 3300025226 Bacteria 88210
687 Ga0209674_100242 3300025226 Bacteria 46068
688 Ga0209674_103147 3300025226 Bacteria 3133
689 Ga0209672_100010 3300025228 Bacteria 873151
690 Ga0209672_100019 3300025228 Bacteria 432215
691 Ga0209672_100065 3300025228 Bacteria 198168
692 Ga0209672_100096 3300025228 Bacteria 112947
693 Ga0209672_100465 3300025228 Bacteria 22847
694 Ga0209672_103202 3300025228 Bacteria 3492
695 Ga0209147_100002 3300025229 Bacteria 2158988
696 Ga0209147_100006 3300025229 Bacteria 873276
697 Ga0209147_100026 3300025229 Bacteria 421622
698 Ga0209147_100044 3300025229 Bacteria 300330
699 Ga0209147_100124 3300025229 Bacteria 133627
700 Ga0209563_100004 3300025230 Bacteria 1814108
701 Ga0209563_103092 3300025230 Bacteria 3531
702 Ga0207427_101311 3300025231 Bacteria 9341
703 Ga0209258_100002 3300025242 Bacteria 2158988
704 Ga0209258_100010 3300025242 Bacteria 873276
705 Ga0209258_100031 3300025242 Bacteria 463572
706 Ga0209258_100079 3300025242 Bacteria 263132
707 Ga0209646_1000019 3300025246 Bacteria 475248
708 Ga0209026_1001786 3300025250 Bacteria 8895
709 Ga0209677_100071 3300025253 Bacteria 139425
710 Ga0209677_104410 3300025253 Bacteria 4074
711 Ga0209148_1000018 3300025254 Bacteria 756247
712 Ga0209148_1000027 3300025254 Bacteria 616374
713 Ga0209148_1000118 3300025254 Bacteria 188330
714 Ga0209148_1003072 3300025254 Bacteria 4909
715 Ga0209759_1000148 3300025256 Bacteria 121104
716 Ga0209759_1000151 3300025256 Bacteria 120135
717 Ga0209759_1000307 3300025256 Bacteria 66493
718 Ga0209759_1001923 3300025256 Bacteria 10157
719 Ga0209759_1004000 3300025256 Bacteria 5649
720 Ga0209759_1004512 3300025256 Bacteria 5166
721 Ga0209759_1006777 3300025256 Bacteria 3796
722 Ga0209759_1015406 3300025256 Bacteria 1974
723 Ga0209233_1000135 3300025261 Bacteria 201057
724 Ga0209565_1000252 3300025263 Bacteria 56727
725 Ga0209565_1001414 3300025263 Bacteria 10642
726 Ga0209455_1000009 3300025272 Bacteria 1042273
727 Ga0209455_1000015 3300025272 Bacteria 756128
728 Ga0209455_1000058 3300025272 Bacteria 342028
729 Ga0209455_1000477 3300025272 Bacteria 29930
730 Ga0209455_1006336 3300025272 Bacteria 3507
731 Ga0209673_1000059 3300025273 Bacteria 268892
732 Ga0209673_1042713 3300025273 Bacteria 1273
733 Ga0209130_1016603 3300025284 Bacteria 1777
734 Ga0209130_1029262 3300025284 Bacteria 1149
735 Ga0209675_1000229 3300025291 Bacteria 56831
736 Ga0209675_1000667 3300025291 Bacteria 24113
737 Ga0209675_1003353 3300025291 Bacteria 7668
738 Ga0209675_1038064 3300025291 Bacteria 1075
739 Ga0209676_1000012 3300025292 Bacteria 841431
740 Ga0209025_1000071 3300025294 Bacteria 287297
741 Ga0209025_1000214 3300025294 Bacteria 138780
742 Ga0209025_1000341 3300025294 Bacteria 102793
743 Ga0209025_1000820 3300025294 Bacteria 49628
744 Ga0209025_1000963 3300025294 Bacteria 43359
745 Ga0209025_1036220 3300025294 Bacteria 2214
746 Ga0209564_1000907 3300025295 Bacteria 38809
747 Ga0209564_1000962 3300025295 Bacteria 36603
748 Ga0209564_1001183 3300025295 Bacteria 30180
749 Ga0209564_1001880 3300025295 Bacteria 18916
750 Ga0209564_1008533 3300025295 Bacteria 5040
751 Ga0209564_1021228 3300025295 Bacteria 2344
752 Ga0209758_1002660 3300025297 Bacteria 17682
753 Ga0209050_1002083 3300025298 Bacteria 18319
754 Ga0209256_1001006 3300025299 Bacteria 33408
755 Ga0209256_1002106 3300025299 Bacteria 17330
756 Ga0207426_1000240 3300025302 Bacteria 123149
757 Ga0207426_1002741 3300025302 Bacteria 10679
758 Ga0209051_1006632 3300025303 Bacteria 6484
759 Ga0209051_1026625 3300025303 Bacteria 2326
760 Ga0207697_10004124 3300025315 Bacteria 7013
761 Ga0207697_10005681 3300025315 Bacteria 5756
762 Ga0207697_10019852 3300025315 Bacteria 2753
763 Ga0207656_10008982 3300025321 Bacteria 3703
764 Ga0207656_10037508 3300025321 Bacteria 2040
765 Ga0207656_10070401 3300025321 Bacteria 1553
766 Ga0207656_10268088 3300025321 Bacteria 840
767 Ga0207696_1050351 3300025711 Bacteria 1192
768 Ga0207713_1000546 3300025735 Bacteria 37629
769 Ga0207713_1002150 3300025735 Bacteria 14659
770 Ga0207713_1025373 3300025735 Bacteria 2739
771 Ga0207682_10003143 3300025893 Bacteria 7233
772 Ga0207682_10008790 3300025893 Bacteria 3994
773 Ga0207682_10017555 3300025893 Bacteria 2795
774 Ga0207682_10052630 3300025893 Bacteria 1687
775 Ga0207682_10162259 3300025893 Bacteria 1013
776 Ga0207642_10006176 3300025899 Bacteria 3968
777 Ga0207642_10036870 3300025899 Bacteria 2102
778 Ga0207642_10186797 3300025899 Bacteria 1134
779 Ga0207642_10195103 3300025899 Bacteria 1114
780 Ga0207688_10075446 3300025901 Bacteria 1919
781 Ga0207680_10002896 3300025903 Bacteria 8046
782 Ga0207680_10005020 3300025903 Bacteria 6305
783 Ga0207680_10007198 3300025903 Bacteria 5409
784 Ga0207680_10036014 3300025903 Bacteria 2847
785 Ga0207680_10057463 3300025903 Bacteria 2354
786 Ga0207680_10092728 3300025903 Bacteria 1925
787 Ga0207680_10170667 3300025903 Bacteria 1465
788 Ga0207647_10000460 3300025904 Bacteria 33029
789 Ga0207647_10003851 3300025904 Bacteria 11221
790 Ga0207647_10007271 3300025904 Bacteria 8012
791 Ga0207647_10017307 3300025904 Bacteria 4900
792 Ga0207647_10027299 3300025904 Bacteria 3723
793 Ga0207647_10216678 3300025904 Bacteria 1104
794 Ga0207645_10000157 3300025907 Bacteria 53374
795 Ga0207645_10001039 3300025907 Bacteria 22955
796 Ga0207645_10011030 3300025907 Bacteria 6184
797 Ga0207645_10015559 3300025907 Bacteria 5052
798 Ga0207645_10024942 3300025907 Bacteria 3873
799 Ga0207645_10054366 3300025907 Bacteria 2557
800 Ga0207645_10184314 3300025907 Bacteria 1370
801 Ga0207643_10004642 3300025908 Bacteria 7379
802 Ga0207643_10022461 3300025908 Bacteria 3473
803 Ga0207705_10000796 3300025909 Bacteria 25906
804 Ga0207705_10049647 3300025909 Bacteria 3020
805 Ga0207705_10129978 3300025909 Bacteria 1874
806 Ga0207705_10168691 3300025909 Bacteria 1647
807 Ga0207705_10365804 3300025909 Bacteria 1113
808 Ga0207684_10025596 3300025910 Bacteria 5029
809 Ga0207684_10181954 3300025910 Bacteria 1812
810 Ga0207684_10216646 3300025910 Bacteria 1652
811 Ga0207654_10032147 3300025911 Bacteria 2896
812 Ga0207654_10134928 3300025911 Bacteria 1567
813 Ga0207654_10233030 3300025911 Bacteria 1227
814 Ga0207707_10003910 3300025912 Bacteria 13216
815 Ga0207707_10032338 3300025912 Bacteria 4578
816 Ga0207707_10033200 3300025912 Bacteria 4517
817 Ga0207707_10624416 3300025912 Bacteria 910
818 Ga0207695_10002683 3300025913 Bacteria 25975
819 Ga0207695_10002847 3300025913 Bacteria 25142
820 Ga0207695_10004748 3300025913 Bacteria 18391
821 Ga0207695_10008005 3300025913 Bacteria 13311
822 Ga0207695_10067015 3300025913 Bacteria 3684
823 Ga0207695_10634263 3300025913 Bacteria 950
824 Ga0207671_10006805 3300025914 Bacteria 10098
825 Ga0207671_10023562 3300025914 Bacteria 4641
826 Ga0207671_10071784 3300025914 Bacteria 2583
827 Ga0207671_10082706 3300025914 Bacteria 2410
828 Ga0207693_10003531 3300025915 Bacteria 13352
829 Ga0207693_10202853 3300025915 Bacteria 1559
830 Ga0207663_10032209 3300025916 Bacteria 3110
831 Ga0207663_10292972 3300025916 Bacteria 1213
832 Ga0207662_10007995 3300025918 Bacteria 5767
833 Ga0207662_10010427 3300025918 Bacteria 5131
834 Ga0207662_10094585 3300025918 Bacteria 1843
835 Ga0207657_10000001 3300025919 Bacteria 458536
836 Ga0207657_10000198 3300025919 Bacteria 62466
837 Ga0207657_10012356 3300025919 Bacteria 8432
838 Ga0207657_10195051 3300025919 Bacteria 1632
839 Ga0207657_10439086 3300025919 Bacteria 1025
840 Ga0207649_10003201 3300025920 Bacteria 8974
841 Ga0207649_10107125 3300025920 Bacteria 1861
842 Ga0207649_10371315 3300025920 Bacteria 1064
843 Ga0207652_10618029 3300025921 Bacteria 971
844 Ga0207646_10009033 3300025922 Bacteria 9905
845 Ga0207646_10078082 3300025922 Bacteria 2959
846 Ga0207646_10301237 3300025922 Bacteria 1448
847 Ga0207681_10002117 3300025923 Bacteria 12722
848 Ga0207681_10005258 3300025923 Bacteria 7952
849 Ga0207681_10006156 3300025923 Bacteria 7361
850 Ga0207681_10020261 3300025923 Bacteria 4211
851 Ga0207681_10056719 3300025923 Bacteria 2673
852 Ga0207681_10206561 3300025923 Bacteria 1511
853 Ga0207681_10880493 3300025923 Bacteria 749
854 Ga0207694_10027632 3300025924 Bacteria 4321
855 Ga0207694_10083620 3300025924 Bacteria 2510
856 Ga0207694_10163450 3300025924 Bacteria 1799
857 Ga0207694_10586828 3300025924 Bacteria 937
858 Ga0207650_10000615 3300025925 Bacteria 28443
859 Ga0207650_10000967 3300025925 Bacteria 21584
860 Ga0207650_10002811 3300025925 Bacteria 12019
861 Ga0207650_10006529 3300025925 Bacteria 7954
862 Ga0207650_10009189 3300025925 Bacteria 6755
863 Ga0207650_10027573 3300025925 Bacteria 4067
864 Ga0207650_10116147 3300025925 Bacteria 2078
865 Ga0207650_10134611 3300025925 Bacteria 1937
866 Ga0207650_10172762 3300025925 Bacteria 1718
867 Ga0207650_10354777 3300025925 Bacteria 1207
868 Ga0207650_10437136 3300025925 Bacteria 1087
869 Ga0207650_10567712 3300025925 Bacteria 952
870 Ga0207650_10584232 3300025925 Bacteria 938
871 Ga0207659_10002677 3300025926 Bacteria 10614
872 Ga0207659_10005173 3300025926 Bacteria 7905
873 Ga0207659_10021349 3300025926 Bacteria 4296
874 Ga0207659_10076086 3300025926 Bacteria 2466
875 Ga0207659_10496543 3300025926 Bacteria 1033
876 Ga0207687_10008163 3300025927 Bacteria 6852
877 Ga0207687_10037040 3300025927 Bacteria 3326
878 Ga0207687_10059426 3300025927 Bacteria 2693
879 Ga0207687_10089219 3300025927 Bacteria 2245
880 Ga0207687_10179164 3300025927 Bacteria 1641
881 Ga0207700_10000077 3300025928 Bacteria 60197
882 Ga0207700_10015267 3300025928 Bacteria 5058
883 Ga0207700_10049118 3300025928 Bacteria 3137
884 Ga0207664_10008388 3300025929 Bacteria 7203
885 Ga0207644_10000922 3300025931 Bacteria 18668
886 Ga0207644_10002195 3300025931 Bacteria 12655
887 Ga0207644_10003390 3300025931 Bacteria 10281
888 Ga0207644_10010411 3300025931 Bacteria 6127
889 Ga0207644_10016789 3300025931 Bacteria 4929
890 Ga0207644_10055222 3300025931 Bacteria 2862
891 Ga0207644_10122623 3300025931 Bacteria 1980
892 Ga0207644_10458475 3300025931 Bacteria 1048
893 Ga0207644_10907859 3300025931 Bacteria 738
894 Ga0207690_10000029 3300025932 Bacteria 160406
895 Ga0207690_10004494 3300025932 Bacteria 8238
896 Ga0207690_10026664 3300025932 Bacteria 3641
897 Ga0207690_10153199 3300025932 Bacteria 1711
898 Ga0207706_10002930 3300025933 Bacteria 16489
899 Ga0207706_10059021 3300025933 Bacteria 3379
900 Ga0207706_10072082 3300025933 Bacteria 3039
901 Ga0207706_10121649 3300025933 Bacteria 2295
902 Ga0207706_10152020 3300025933 Bacteria 2036
903 Ga0207706_10250794 3300025933 Bacteria 1546
904 Ga0207706_10290662 3300025933 Bacteria 1425
905 Ga0207706_10301994 3300025933 Bacteria 1395
906 Ga0207686_10001096 3300025934 Bacteria 15845
907 Ga0207686_10150337 3300025934 Bacteria 1620
908 Ga0207686_10185370 3300025934 Bacteria 1479
909 Ga0207709_10009812 3300025935 Bacteria 5273
910 Ga0207670_10031585 3300025936 Bacteria 3396
911 Ga0207670_10165960 3300025936 Bacteria 1652
912 Ga0207669_10003504 3300025937 Bacteria 6789
913 Ga0207669_10010350 3300025937 Bacteria 4486
914 Ga0207669_10025894 3300025937 Bacteria 3180
915 Ga0207669_10036071 3300025937 Bacteria 2821
916 Ga0207669_10058032 3300025937 Bacteria 2360
917 Ga0207669_10061342 3300025937 Bacteria 2310
918 Ga0207669_10172707 3300025937 Bacteria 1540
919 Ga0207669_10804400 3300025937 Bacteria 780
920 Ga0207704_10060620 3300025938 Bacteria 2342
921 Ga0207704_10063640 3300025938 Bacteria 2300
922 Ga0207704_10103514 3300025938 Bacteria 1904
923 Ga0207704_10128677 3300025938 Bacteria 1748
924 Ga0207704_10178142 3300025938 Bacteria 1533
925 Ga0207704_10289521 3300025938 Bacteria 1249
926 Ga0207704_10548321 3300025938 Bacteria 939
927 Ga0207704_10586562 3300025938 Bacteria 911
928 Ga0207665_10015112 3300025939 Bacteria 5070
929 Ga0207665_10024936 3300025939 Bacteria 3944
930 Ga0207665_10086143 3300025939 Bacteria 2169
931 Ga0207665_10353928 3300025939 Bacteria 1109
932 Ga0207691_10000844 3300025940 Bacteria 30503
933 Ga0207691_10003180 3300025940 Bacteria 16050
934 Ga0207691_10004096 3300025940 Bacteria 14151
935 Ga0207691_10016133 3300025940 Bacteria 7096
936 Ga0207691_10021667 3300025940 Bacteria 6066
937 Ga0207691_10025466 3300025940 Bacteria 5555
938 Ga0207691_10027631 3300025940 Bacteria 5319
939 Ga0207691_10054817 3300025940 Bacteria 3636
940 Ga0207691_10091024 3300025940 Bacteria 2734
941 Ga0207691_10094079 3300025940 Bacteria 2682
942 Ga0207691_10276894 3300025940 Bacteria 1444
943 Ga0207691_10361864 3300025940 Bacteria 1240
944 Ga0207711_10000688 3300025941 Bacteria 33317
945 Ga0207711_10003133 3300025941 Bacteria 14418
946 Ga0207711_10014436 3300025941 Bacteria 6561
947 Ga0207711_10029193 3300025941 Bacteria 4648
948 Ga0207711_10047632 3300025941 Bacteria 3666
949 Ga0207711_10056186 3300025941 Bacteria 3382
950 Ga0207711_10155483 3300025941 Bacteria 2067
951 Ga0207711_10297296 3300025941 Bacteria 1489
952 Ga0207711_10484978 3300025941 Bacteria 1152
953 Ga0207711_10617365 3300025941 Bacteria 1012
954 Ga0207711_10658792 3300025941 Bacteria 977
955 Ga0207711_10794921 3300025941 Bacteria 881
956 Ga0207689_10008154 3300025942 Bacteria 9135
957 Ga0207689_10014017 3300025942 Bacteria 6824
958 Ga0207689_10022581 3300025942 Bacteria 5287
959 Ga0207689_10029095 3300025942 Bacteria 4617
960 Ga0207689_10029822 3300025942 Bacteria 4549
961 Ga0207689_10038699 3300025942 Bacteria 3949
962 Ga0207689_10049038 3300025942 Bacteria 3484
963 Ga0207661_10019505 3300025944 Bacteria 5057
964 Ga0207679_10000240 3300025945 Bacteria 41798
965 Ga0207679_10007201 3300025945 Bacteria 7046
966 Ga0207679_10239651 3300025945 Bacteria 1536
967 Ga0207679_10251981 3300025945 Bacteria 1501
968 Ga0207679_10404676 3300025945 Bacteria 1201
969 Ga0207679_10884791 3300025945 Bacteria 816
970 Ga0207667_10000954 3300025949 Bacteria 36911
971 Ga0207667_10007209 3300025949 Bacteria 13412
972 Ga0207667_10044202 3300025949 Bacteria 4722
973 Ga0207667_10058592 3300025949 Bacteria 4038
974 Ga0207667_10060273 3300025949 Bacteria 3972
975 Ga0207651_10026537 3300025960 Bacteria 3621
976 Ga0207651_10081443 3300025960 Bacteria 2333
977 Ga0207651_10086390 3300025960 Bacteria 2279
978 Ga0207651_10089102 3300025960 Bacteria 2251
979 Ga0207651_10132699 3300025960 Bacteria 1909
980 Ga0207651_10178143 3300025960 Bacteria 1683
981 Ga0207651_10249472 3300025960 Bacteria 1451
982 Ga0207651_10593640 3300025960 Bacteria 967
983 Ga0207651_10730042 3300025960 Bacteria 874
984 Ga0207712_10114258 3300025961 Bacteria 2030
985 Ga0207668_10001885 3300025972 Bacteria 12262
986 Ga0207668_10025016 3300025972 Bacteria 3859
987 Ga0207668_10026624 3300025972 Bacteria 3756
988 Ga0207668_10076679 3300025972 Bacteria 2408
989 Ga0207668_10237220 3300025972 Bacteria 1473
990 Ga0207668_10348608 3300025972 Bacteria 1237
991 Ga0207668_10597805 3300025972 Bacteria 961
992 Ga0207640_10000049 3300025981 Bacteria 97025
993 Ga0207640_10097445 3300025981 Bacteria 2053
994 Ga0207640_10161787 3300025981 Bacteria 1657
995 Ga0207640_10762366 3300025981 Bacteria 835
996 Ga0207640_10854417 3300025981 Bacteria 792
997 Ga0207658_10005104 3300025986 Bacteria 9035
998 Ga0207658_10006163 3300025986 Bacteria 8186
999 Ga0207658_10015232 3300025986 Bacteria 5275
1000 Ga0207658_10038802 3300025986 Bacteria 3434
1001 Ga0207658_10102652 3300025986 Bacteria 2243
1002 Ga0207658_10247669 3300025986 Bacteria 1513
1003 Ga0207658_10269632 3300025986 Bacteria 1454
1004 Ga0207658_10570165 3300025986 Bacteria 1014
1005 Ga0207677_10000775 3300026023 Bacteria 18357
1006 Ga0207677_10005649 3300026023 Bacteria 6802
1007 Ga0207677_10067318 3300026023 Bacteria 2509
1008 Ga0207677_10162015 3300026023 Bacteria 1739
1009 Ga0207677_10168737 3300026023 Bacteria 1709
1010 Ga0207677_10209548 3300026023 Bacteria 1555
1011 Ga0207677_10283868 3300026023 Bacteria 1360
1012 Ga0207677_10331226 3300026023 Bacteria 1269
1013 Ga0207703_10003002 3300026035 Bacteria 14309
1014 Ga0207703_10004520 3300026035 Bacteria 11409
1015 Ga0207703_10005577 3300026035 Bacteria 10101
1016 Ga0207703_10007013 3300026035 Bacteria 8966
1017 Ga0207703_10017617 3300026035 Bacteria 5576
1018 Ga0207703_10081877 3300026035 Bacteria 2692
1019 Ga0207703_10305629 3300026035 Bacteria 1452
1020 Ga0207703_10349392 3300026035 Bacteria 1361
1021 Ga0207639_10012498 3300026041 Bacteria 5914
1022 Ga0207639_10745143 3300026041 Bacteria 911
1023 Ga0207678_10000353 3300026067 Bacteria 41741
1024 Ga0207678_10001065 3300026067 Bacteria 25105
1025 Ga0207678_10085134 3300026067 Bacteria 2703
1026 Ga0207678_10128364 3300026067 Bacteria 2163
1027 Ga0207678_10128401 3300026067 Bacteria 2162
1028 Ga0207678_10128717 3300026067 Bacteria 2159
1029 Ga0207678_10135949 3300026067 Bacteria 2097
1030 Ga0207678_10154233 3300026067 Bacteria 1961
1031 Ga0207678_10232304 3300026067 Bacteria 1579
1032 Ga0207678_10384440 3300026067 Bacteria 1214
1033 Ga0207678_10414708 3300026067 Bacteria 1167
1034 Ga0207708_10006027 3300026075 Bacteria 8984
1035 Ga0207708_10016389 3300026075 Bacteria 5572
1036 Ga0207708_10023225 3300026075 Bacteria 4685
1037 Ga0207708_10718792 3300026075 Bacteria 855
1038 Ga0207702_10000550 3300026078 Bacteria 41779
1039 Ga0207702_10197568 3300026078 Bacteria 1862
1040 Ga0207641_10002392 3300026088 Bacteria 17307
1041 Ga0207641_10004704 3300026088 Bacteria 11769
1042 Ga0207641_10008349 3300026088 Bacteria 8556
1043 Ga0207641_10008791 3300026088 Bacteria 8343
1044 Ga0207641_10030196 3300026088 Bacteria 4488
1045 Ga0207641_10204086 3300026088 Bacteria 1824
1046 Ga0207641_10295625 3300026088 Bacteria 1528
1047 Ga0207641_10542426 3300026088 Bacteria 1133
1048 Ga0207648_10005773 3300026089 Bacteria 12397
1049 Ga0207648_10006669 3300026089 Bacteria 11454
1050 Ga0207648_10013086 3300026089 Bacteria 7737
1051 Ga0207648_10022506 3300026089 Bacteria 5657
1052 Ga0207648_10040398 3300026089 Bacteria 4099
1053 Ga0207648_10043411 3300026089 Bacteria 3947
1054 Ga0207648_10062316 3300026089 Bacteria 3251
1055 Ga0207648_10096346 3300026089 Bacteria 2589
1056 Ga0207648_10281311 3300026089 Bacteria 1488
1057 Ga0207648_10294182 3300026089 Bacteria 1455
1058 Ga0207676_10001352 3300026095 Bacteria 18224
1059 Ga0207676_10004012 3300026095 Bacteria 10390
1060 Ga0207676_10008578 3300026095 Bacteria 7262
1061 Ga0207676_10022825 3300026095 Bacteria 4607
1062 Ga0207676_10070810 3300026095 Bacteria 2797
1063 Ga0207676_10150061 3300026095 Bacteria 2006
1064 Ga0207676_10212528 3300026095 Bacteria 1717
1065 Ga0207676_10676971 3300026095 Bacteria 997
1066 Ga0207676_11025714 3300026095 Bacteria 814
1067 Ga0207674_10001491 3300026116 Bacteria 30227
1068 Ga0207674_10004526 3300026116 Bacteria 16694
1069 Ga0207674_10011309 3300026116 Bacteria 10031
1070 Ga0207674_10037012 3300026116 Bacteria 5079
1071 Ga0207674_10153170 3300026116 Bacteria 2262
1072 Ga0207674_10610813 3300026116 Bacteria 1053
1073 Ga0207674_10785754 3300026116 Bacteria 919
1074 Ga0207675_100007435 3300026118 Bacteria 10352
1075 Ga0207675_100016680 3300026118 Bacteria 6858
1076 Ga0207675_100023103 3300026118 Bacteria 5783
1077 Ga0207675_100026990 3300026118 Bacteria 5346
1078 Ga0207675_100035399 3300026118 Bacteria 4657
1079 Ga0207675_100094743 3300026118 Bacteria 2808
1080 Ga0207675_100180097 3300026118 Bacteria 2023
1081 Ga0207675_100188621 3300026118 Bacteria 1977
1082 Ga0207675_100262861 3300026118 Bacteria 1673
1083 Ga0207683_10002496 3300026121 Bacteria 16045
1084 Ga0207683_10006508 3300026121 Bacteria 9999
1085 Ga0207683_10038245 3300026121 Bacteria 4181
1086 Ga0207683_10043482 3300026121 Bacteria 3926
1087 Ga0207683_10094597 3300026121 Bacteria 2663
1088 Ga0207683_10101788 3300026121 Bacteria 2565
1089 Ga0207683_10151602 3300026121 Bacteria 2092
1090 Ga0207683_10179940 3300026121 Bacteria 1917
1091 Ga0207683_10227567 3300026121 Bacteria 1700
1092 Ga0207683_10451302 3300026121 Bacteria 1185
1093 Ga0207683_10585617 3300026121 Bacteria 1032
1094 Ga0207683_10855872 3300026121 Bacteria 844
1095 Ga0207698_10002042 3300026142 Bacteria 11909
1096 Ga0207698_10033741 3300026142 Bacteria 3723
1097 Ga0207698_10051925 3300026142 Bacteria 3137
1098 Ga0207698_10195093 3300026142 Bacteria 1808
1099 Ga0207698_10348169 3300026142 Bacteria 1398
1100 Ga0207698_10369989 3300026142 Bacteria 1360
1101 Ga0207698_10534501 3300026142 Bacteria 1146
1102 Ga0207698_10732977 3300026142 Bacteria 986
1103 Ga0209371_1000243 3300027312 Bacteria 67855
1104 Ga0209371_1006254 3300027312 Bacteria 4457
1105 Ga0209282_1000045 3300027666 Bacteria 118401
1106 Ga0209588_1021082 3300027671 Bacteria 2044
1107 Ga0207428_10038564 3300027907 Bacteria 3883
1108 Ga0268266_10006814 3300028379 Bacteria 10407
1109 Ga0268266_10060329 3300028379 Bacteria 3270
1110 Ga0268266_10073323 3300028379 Bacteria 2971
1111 Ga0268266_10154846 3300028379 Bacteria 2069
1112 Ga0268266_10262097 3300028379 Bacteria 1602
1113 Ga0268266_10343008 3300028379 Bacteria 1402
1114 Ga0268266_10806272 3300028379 Bacteria 907
1115 Ga0268265_10025515 3300028380 Bacteria 4197
1116 Ga0268265_10492924 3300028380 Bacteria 1153
1117 Ga0268265_10925262 3300028380 Bacteria 857
1118 Ga0268264_10014386 3300028381 Bacteria 6504
1119 Ga0268264_10015053 3300028381 Bacteria 6345
1120 Ga0268264_10030230 3300028381 Bacteria 4440
1121 Ga0268264_10041101 3300028381 Bacteria 3823
1122 Ga0268264_10211330 3300028381 Bacteria 1781
1123 Ga0268264_10238297 3300028381 Bacteria 1684
1124 Ga0268264_10273312 3300028381 Bacteria 1579
1125 Ga0268264_10932313 3300028381 Bacteria 873
1126 Ga0265323_10024249 3300028653 Bacteria 2308
1127 Ga0265336_10000511 3300028666 Bacteria 22483
1128 Ga0265336_10037564 3300028666 Bacteria 1488
1129 Ga0307515_10241879 3300028794 Bacteria 1574
1130 Ga0265338_10000104 3300028800 Bacteria 156596
1131 Ga0265338_10025908 3300028800 Bacteria 5930
1132 Ga0265324_10000011 3300029957 Bacteria 218521
1133 Ga0265324_10000340 3300029957 Bacteria 34285
1134 Ga0268256_1000986 3300030500 Bacteria 19306
1135 Ga0268256_1006273 3300030500 Bacteria 4457
1136 Ga0307511_10003377 3300030521 Bacteria 16428
1137 Ga0265330_10009793 3300031235 Bacteria 4541
1138 Ga0265332_10000026 3300031238 Bacteria 193153
1139 Ga0265332_10004536 3300031238 Bacteria 6505
1140 Ga0265332_10005095 3300031238 Bacteria 6095
1141 Ga0265332_10009446 3300031238 Bacteria 4354
1142 Ga0265328_10005286 3300031239 Bacteria 5546
1143 Ga0265328_10028977 3300031239 Bacteria 2070
1144 Ga0265320_10020002 3300031240 Bacteria 3642
1145 Ga0265325_10000125 3300031241 Bacteria 52592
1146 Ga0265325_10010551 3300031241 Bacteria 5345
1147 Ga0265325_10050360 3300031241 Bacteria 2145
1148 Ga0265329_10010527 3300031242 Bacteria 3389
1149 Ga0265339_10051084 3300031249 Bacteria 2258
1150 Ga0265331_10010508 3300031250 Bacteria 5119
1151 Ga0265331_10024970 3300031250 Bacteria 3018
1152 Ga0265331_10028218 3300031250 Bacteria 2808
1153 Ga0265327_10000719 3300031251 Bacteria 52024
1154 Ga0265327_10003549 3300031251 Bacteria 14790
1155 Ga0265327_10020927 3300031251 Bacteria 3966
1156 Ga0265327_10076675 3300031251 Bacteria 1661
1157 Ga0265327_10124508 3300031251 Bacteria 1218
1158 Ga0265316_10010238 3300031344 Bacteria 8560
1159 Ga0265316_10055646 3300031344 Bacteria 3093
1160 Ga0265316_10060919 3300031344 Bacteria 2932
1161 Ga0307513_10000120 3300031456 Bacteria 110390
1162 Ga0307513_10020887 3300031456 Bacteria 7748
1163 Ga0307509_10000032 3300031507 Bacteria 202919
1164 Ga0307408_100002538 3300031548 Bacteria 12765
1165 Ga0307408_100638697 3300031548 Bacteria 950
1166 Ga0307508_10279096 3300031616 Bacteria 1264
1167 Ga0316575_10135516 3300031665 Bacteria 1011
1168 Ga0265314_10000134 3300031711 Bacteria 111395
1169 Ga0265314_10001425 3300031711 Bacteria 26784
1170 Ga0265314_10007756 3300031711 Bacteria 9281
1171 Ga0265314_10020023 3300031711 Bacteria 5172
1172 Ga0265314_10319595 3300031711 Bacteria 864
1173 Ga0265342_10011779 3300031712 Bacteria 5961
1174 Ga0307516_10003314 3300031730 Bacteria 20839
1175 Ga0307516_10170580 3300031730 Bacteria 1917
1176 Ga0307405_10038265 3300031731 Bacteria 2890
1177 Ga0307405_10066979 3300031731 Bacteria 2292
1178 Ga0307410_10170896 3300031852 Bacteria 1638
1179 Ga0307406_10016493 3300031901 Bacteria 4294
1180 Ga0307412_10000008 3300031911 Bacteria 461034
1181 Ga0307412_10000103 3300031911 Bacteria 69660
1182 Ga0307412_10010116 3300031911 Bacteria 5424
1183 Ga0307412_10066811 3300031911 Bacteria 2439
1184 Ga0307412_10473682 3300031911 Bacteria 1037
1185 Ga0307409_100083962 3300031995 Bacteria 2584
1186 Ga0307416_100823519 3300032002 Bacteria 1025
1187 Ga0307414_10080843 3300032004 Bacteria 2378
1188 Ga0307411_10102283 3300032005 Bacteria 2030
1189 Ga0307411_10145654 3300032005 Bacteria 1753
1190 Ga0307411_10607858 3300032005 Bacteria 941
1191 Ga0316583_10003098 3300032133 Bacteria 5841
1192 Ga0373948_0005492 3300034817 Bacteria 2060
1193 Ga0373948_0008529 3300034817 Bacteria 1746
1194 Ga0373958_0021374 3300034819 Bacteria 1200
1195 Ga0373959_0020677 3300034820 Bacteria 1257
1196 Ga0373926_0009025 3300035083 Bacteria 3325
1197 Ga0373928_0058650 3300035084 Bacteria 926
1198 Ga0373929_0038559 3300035085 Bacteria 1052
1199 Ga0373934_0004837 3300035086 Bacteria 4984
1200 Ga0373934_0114314 3300035086 Bacteria 1096
1201 Ga0373940_0005594 3300035088 Bacteria 2733
1202 Ga0373949_0004416 3300035090 Bacteria 3228
1203 Ga0373923_0002018 3300035111 Bacteria 6108
1204 Ga0373923_0160299 3300035111 Bacteria 1026
1205 Ga0373932_0011119 3300035112 Bacteria 2192
1206 Ga0373936_0001453 3300035113 Bacteria 8601
1207 Ga0373936_0010226 3300035113 Bacteria 3543
1208 Ga0373939_0045053 3300035114 Bacteria 1345
1209 Ga0373945_0036473 3300035116 Bacteria 1761
1210 Ga0373945_0137949 3300035116 Bacteria 981
1211 Ga0373953_0000903 3300035117 Bacteria 8306
1212 Ga0373953_0025925 3300035117 Bacteria 2243
1213 Ga0373954_0005584 3300035118 Bacteria 5447
1214 Ga0373954_0005824 3300035118 Bacteria 5350
1215 Ga0373956_0004475 3300035119 Bacteria 5589
1216 Ga0373956_0007480 3300035119 Bacteria 4401
1217 Ga0373956_0074984 3300035119 Bacteria 1547
1218 Ga0373956_0222981 3300035119 Bacteria 895
1219 Ga0373957_0002023 3300035120 Bacteria 5672
1220 Ga0373957_0048223 3300035120 Bacteria 1622
1221 Ga0373960_0006621 3300035121 Bacteria 2723
1222 Ga0373960_0027464 3300035121 Bacteria 1563
1223 Ga0373943_0019792 3300035170 Bacteria 3098
1224 Ga0373943_0022415 3300035170 Bacteria 2927
1225 Ga0373943_0103010 3300035170 Bacteria 1495
1226 Ga0373946_0011080 3300035171 Bacteria 3354
1227 Ga0373946_0018878 3300035171 Bacteria 2651
1228 Ga0373946_0020782 3300035171 Bacteria 2540
1229 Ga0373946_0041308 3300035171 Bacteria 1891
1230 Ga0373946_0234383 3300035171 Bacteria 890
1231 Ga0373955_0013227 3300035172 Bacteria 3983
1232 Ga0373955_0171956 3300035172 Bacteria 1283
1233 Ga0373961_0012522 3300035241 Bacteria 2125
1234 Ga0373961_0031074 3300035241 Bacteria 1489
1235 Ga0373961_0031516 3300035241 Bacteria 1481
1236 Ga0373962_0017639 3300035242 Bacteria 1851
1237 Ga0373924_0007221 3300035410 Bacteria 4004
1238 Ga0373924_0153155 3300035410 Bacteria 1009
1239 Ga0373924_0237255 3300035410 Bacteria 806
1240 Ga0373931_0002886 3300035691 Bacteria 7660
1241 Ga0373931_0069973 3300035691 Bacteria 1913
1242 Ga0373931_0174908 3300035691 Bacteria 1267
1243 Ga0373931_0412391 3300035691 Bacteria 857
1244 Ga0373935_0046917 3300035692 Bacteria 2730
1245 Ga0373935_0070021 3300035692 Bacteria 2260
1246 Ga0373935_0189842 3300035692 Bacteria 1415
1247 Ga0373927_0032778 3300035695 Bacteria 3383
1248 Ga0373927_0209851 3300035695 Bacteria 1279
1249 Ga0373933_0009336 3300035724 Bacteria 5358
1250 Ga0373933_0094003 3300035724 Bacteria 1853
1251 Ga0373933_0235857 3300035724 Bacteria 1176
1252 Ga0373933_0494143 3300035724 Bacteria 801
1253 Ga0373947_0055303 3300035725 Bacteria 2397
1254 Ga0373947_0438038 3300035725 Bacteria 884
1255 Ga0373937_0047877 3300036401 Bacteria 3912
1256 Ga0373937_0158055 3300036401 Bacteria 2125
1257 Ga0373937_0161364 3300036401 Bacteria 2101
1258 Ga0373937_0246019 3300036401 Bacteria 1685
1259 Ga0373937_0347979 3300036401 Bacteria 1404
1260 Ga0373937_0898964 3300036401 Bacteria 834
1261 Ga0373925_0066661 3300037068 Bacteria 2714
1262 Ga0373925_0106693 3300037068 Bacteria 2160
1263 Ga0373925_0125509 3300037068 Bacteria 1996
1264 Ga0373925_0415970 3300037068 Bacteria 1098
1265 Ga0395899_0000029 3300037312 Bacteria 329371
1266 Ga0395899_0003212 3300037312 Bacteria 12959
1267 Ga0395899_0009516 3300037312 Bacteria 7459
1268 Ga0395899_0017094 3300037312 Bacteria 5525
1269 Ga0395899_0099474 3300037312 Bacteria 2101
1270 Ga0395900_0000085 3300037418 Bacteria 172265
1271 Ga0395900_0011615 3300037418 Bacteria 9011
1272 Ga0395900_0015015 3300037418 Bacteria 7895
1273 Ga0395900_0022775 3300037418 Bacteria 6409
1274 Ga0395900_0034380 3300037418 Bacteria 5219
1275 Ga0395900_0054694 3300037418 Bacteria 4110
1276 Ga0395900_0059337 3300037418 Bacteria 3938
1277 Ga0395900_0143145 3300037418 Bacteria 2447
1278 Ga0395898_0000086 3300037466 Bacteria 239895
1279 Ga0395898_0007816 3300037466 Bacteria 11351
1280 Ga0395898_0009653 3300037466 Bacteria 10132
1281 Ga0395898_0023240 3300037466 Bacteria 6265
1282 Ga0395898_0078131 3300037466 Bacteria 3194
1283 Ga0395898_0209147 3300037466 Bacteria 1861
1284 Ga0395905_0000098 3300037471 Bacteria 145524
1285 Ga0395905_0006036 3300037471 Bacteria 12267
1286 Ga0395905_0009409 3300037471 Bacteria 9555
1287 Ga0395905_0026969 3300037471 Bacteria 5417
1288 Ga0395905_0054125 3300037471 Bacteria 3755
1289 Ga0395905_0114332 3300037471 Bacteria 2536
1290 Ga0395901_0000003 3300038443 Bacteria 701538
1291 Ga0395901_0000426 3300038443 Bacteria 49620
1292 Ga0395901_0004109 3300038443 Bacteria 14677
1293 Ga0395901_0021594 3300038443 Bacteria 6595
1294 Ga0395901_0259549 3300038443 Bacteria 1809
1295 Ga0395901_0916394 3300038443 Bacteria 857
1296 Ga0436365_0198629 3300039437 Bacteria 3357
1297 Ga0436365_1409848 3300039437 Bacteria 1651
1298 Ga0436361_0180590 3300039447 Bacteria 2589
1299 Ga0436361_0461322 3300039447 Bacteria 16290
1300 Ga0436361_0728592 3300039447 Bacteria 17361
1301 Ga0436361_1001960 3300039447 Bacteria 7365
1302 Ga0439453_0002835 3300041408 Bacteria 2431
1303 Ga0439465_0105633 3300041413 Bacteria 976
1304 Ga0451802_1722518 3300041460 Bacteria 1083
1305 Ga0439441_001742 3300042001 Bacteria 2933
1306 Ga0439441_002145 3300042001 Bacteria 2732
1307 Ga0439448_0005071 3300042005 Bacteria 3742
1308 Ga0439462_0003876 3300042015 Bacteria 3609
1309 Ga0450894_018754 3300042131 Bacteria 926
1310 Ga0450898_015685 3300042134 Bacteria 1286
1311 Ga0450898_018053 3300042134 Bacteria 1218
1312 Ga0450903_006682 3300042138 Bacteria 1911
1313 Ga0439446_0018832 3300042156 Bacteria 1938
1314 Ga0439446_0083529 3300042156 Bacteria 992
1315 Ga0439458_0048018 3300042157 Bacteria 1049
1316 Ga0439434_0108670 3300042435 Bacteria 897
1317 Ga0451577_0001121 3300042876 Bacteria 38000
1318 Ga0451577_0003657 3300042876 Bacteria 16861
1319 Ga0451577_0009017 3300042876 Bacteria 9634
1320 Ga0451577_0011404 3300042876 Bacteria 8410
1321 Ga0451577_0013884 3300042876 Bacteria 7522
1322 Ga0451577_0014840 3300042876 Bacteria 7258
1323 Ga0451577_0016732 3300042876 Bacteria 6782
1324 Ga0451577_0025893 3300042876 Bacteria 5318
1325 Ga0451577_0041062 3300042876 Bacteria 4154
1326 Ga0451577_0090871 3300042876 Bacteria 2725
1327 Ga0451577_0100666 3300042876 Bacteria 2581
1328 Ga0451577_0107586 3300042876 Bacteria 2492
1329 Ga0451577_0124940 3300042876 Bacteria 2305
1330 Ga0451577_0154576 3300042876 Bacteria 2064
1331 Ga0451577_0322525 3300042876 Bacteria 1401
1332 Ga0451577_0373441 3300042876 Bacteria 1294
1333 Ga0451577_0555208 3300042876 Bacteria 1042
1334 Ga0466969_0002241 3300044656 Bacteria 10332
1335 Ga0466969_0017083 3300044656 Bacteria 3792
1336 Ga0466969_0022973 3300044656 Bacteria 3215
1337 Ga0466969_0053311 3300044656 Bacteria 1984
1338 Ga0466972_0000217 3300044658 Bacteria 40421
1339 Ga0466972_0092674 3300044658 Bacteria 1432
1340 Ga0466973_0062346 3300044659 Bacteria 3369
1341 Ga0466977_0000941 3300044666 Bacteria 11072
1342 Ga0453683_0000047 3300044673 Bacteria 207763
1343 Ga0453683_0191373 3300044673 Bacteria 1298
1344 Ga0466965_0000039 3300044683 Bacteria 47097
1345 Ga0466965_0189794 3300044683 Bacteria 1086
1346 Ga0466966_0000005 3300044684 Bacteria 193939
1347 Ga0466966_0004841 3300044684 Bacteria 8859
1348 Ga0466966_0019191 3300044684 Bacteria 4499
1349 Ga0466966_0026026 3300044684 Bacteria 3820
1350 Ga0466961_0000027 3300044693 Bacteria 89008
1351 Ga0466961_0000078 3300044693 Bacteria 60385
1352 Ga0466961_0000089 3300044693 Bacteria 58380
1353 Ga0466961_0000582 3300044693 Bacteria 23185
1354 Ga0466961_0012185 3300044693 Bacteria 5498
1355 Ga0466961_0038395 3300044693 Bacteria 3071
1356 Ga0466961_0058677 3300044693 Bacteria 2448
1357 Ga0466961_0230445 3300044693 Bacteria 1140
1358 Ga0466963_0000523 3300044694 Bacteria 17972
1359 Ga0466963_0008655 3300044694 Bacteria 6108
1360 Ga0466963_0023485 3300044694 Bacteria 3917
1361 Ga0466964_0012388 3300044706 Bacteria 3227
1362 Ga0453684_0000014 3300044712 Bacteria 993311
1363 Ga0453684_0000142 3300044712 Bacteria 316405
1364 Ga0453684_0000158 3300044712 Bacteria 302033
1365 Ga0453684_0000273 3300044712 Bacteria 222658
1366 Ga0453684_0000302 3300044712 Bacteria 207763
1367 Ga0453684_0000384 3300044712 Bacteria 181189
1368 Ga0453684_0000824 3300044712 Bacteria 104740
1369 Ga0453684_0005850 3300044712 Bacteria 23909
1370 Ga0453684_0029770 3300044712 Bacteria 7738
1371 Ga0453684_0073846 3300044712 Bacteria 4297
1372 Ga0453684_0079226 3300044712 Bacteria 4107
1373 Ga0453684_0125327 3300044712 Bacteria 3093
1374 Ga0453684_0153511 3300044712 Bacteria 2733
1375 Ga0453684_0294987 3300044712 Bacteria 1844
1376 Ga0453684_0311853 3300044712 Bacteria 1785
1377 Ga0453684_0354276 3300044712 Bacteria 1654
1378 Ga0453684_0355326 3300044712 Bacteria 1651
1379 Ga0453684_0621111 3300044712 Bacteria 1182
1380 Ga0466971_0000524 3300044719 Bacteria 15175
1381 Ga0466971_0002893 3300044719 Bacteria 7279
1382 Ga0466971_0016100 3300044719 Bacteria 3295
1383 Ga0466968_0016893 3300044735 Bacteria 2910
1384 Ga0466968_0033612 3300044735 Bacteria 2137
1385 Ga0466968_0155058 3300044735 Bacteria 1054
1386 Ga0466970_0001517 3300044765 Bacteria 11163
1387 Ga0466970_0201310 3300044765 Bacteria 1108
1388 Ga0466957_0004027 3300044842 Bacteria 8130
1389 Ga0466957_0004351 3300044842 Bacteria 7872
1390 Ga0466957_0012097 3300044842 Bacteria 4991
1391 Ga0466957_0074278 3300044842 Bacteria 2108
1392 Ga0466957_0259608 3300044842 Bacteria 1157
1393 Ga0466959_0003412 3300045049 Bacteria 10392
1394 Ga0466959_0004303 3300045049 Bacteria 9503
1395 Ga0466959_0005425 3300045049 Bacteria 8727
1396 Ga0466959_0020155 3300045049 Bacteria 4909
1397 Ga0466959_0133682 3300045049 Bacteria 1757
1398 Ga0451576_0000116 3300045051 Bacteria 207763
1399 Ga0451576_0001489 3300045051 Bacteria 39571
1400 Ga0451576_0001917 3300045051 Bacteria 33315
1401 Ga0451576_0002526 3300045051 Bacteria 27094
1402 Ga0451576_0003061 3300045051 Bacteria 23512
1403 Ga0451576_0006384 3300045051 Bacteria 14478
1404 Ga0451576_0007349 3300045051 Bacteria 13205
1405 Ga0451576_0016680 3300045051 Bacteria 8102
1406 Ga0451576_0019515 3300045051 Bacteria 7398
1407 Ga0451576_0026585 3300045051 Bacteria 6224
1408 Ga0451576_0038933 3300045051 Bacteria 5032
1409 Ga0451576_0085745 3300045051 Bacteria 3276
1410 Ga0451576_0105464 3300045051 Bacteria 2932
1411 Ga0451576_0211066 3300045051 Bacteria 2027
1412 Ga0451576_0266791 3300045051 Bacteria 1789
1413 Ga0466958_0004150 3300045836 Bacteria 7606
1414 Ga0466958_0018581 3300045836 Bacteria 4036
1415 Ga0466958_0030911 3300045836 Bacteria 3183
1416 Ga0466958_0073084 3300045836 Bacteria 2100
1417 Ga0466967_1233104 3300045976 Bacteria 745
1418 Ga0495592_0011203 3300046454 Bacteria 6776
1419 Ga0495592_0025523 3300046454 Bacteria 4485
1420 Ga0495592_0034619 3300046454 Bacteria 3806
1421 Ga0495592_0038863 3300046454 Bacteria 3577
1422 Ga0495592_0050866 3300046454 Bacteria 3078
1423 Ga0495603_0004576 3300046455 Bacteria 8255
1424 Ga0495603_0027437 3300046455 Bacteria 3437
1425 Ga0495603_0030300 3300046455 Bacteria 3258
1426 Ga0495603_0101929 3300046455 Bacteria 1676
1427 Ga0495603_0286311 3300046455 Bacteria 947
1428 Ga0495590_0001202 3300046457 Bacteria 11309
1429 Ga0495590_0010158 3300046457 Bacteria 3548
1430 Ga0495591_001903 3300046458 Bacteria 12252
1431 Ga0495591_034331 3300046458 Bacteria 1494
1432 Ga0495629_0000141 3300046459 Bacteria 63284
1433 Ga0495629_0000228 3300046459 Bacteria 50287
1434 Ga0495629_0005940 3300046459 Bacteria 9094
1435 Ga0495629_0008513 3300046459 Bacteria 7552
1436 Ga0495629_0019418 3300046459 Bacteria 4854
1437 Ga0495629_0040760 3300046459 Bacteria 3266
1438 Ga0495629_0102655 3300046459 Bacteria 1995
1439 Ga0495629_0192970 3300046459 Bacteria 1409
1440 Ga0495638_0011649 3300046460 Bacteria 6056
1441 Ga0495641_0019394 3300046461 Bacteria 3481
1442 Ga0495641_0027355 3300046461 Bacteria 2774
1443 Ga0495641_0042270 3300046461 Bacteria 2113
1444 Ga0495651_0012880 3300046462 Bacteria 6461
1445 Ga0495651_0062133 3300046462 Bacteria 2858
1446 Ga0495651_0133499 3300046462 Bacteria 1810
1447 Ga0495651_0186439 3300046462 Bacteria 1464
1448 Ga0495653_0003974 3300046463 Bacteria 11939
1449 Ga0495653_0004897 3300046463 Bacteria 10864
1450 Ga0495653_0011983 3300046463 Bacteria 7080
1451 Ga0495653_0178440 3300046463 Bacteria 1460
1452 Ga0495650_0005333 3300046471 Bacteria 8389
1453 Ga0495650_0032907 3300046471 Bacteria 2313
1454 Ga0495650_0098137 3300046471 Bacteria 1103
1455 Ga0495580_0003817 3300046472 Bacteria 12756
1456 Ga0495580_0006337 3300046472 Bacteria 9652
1457 Ga0495580_0010515 3300046472 Bacteria 7205
1458 Ga0495580_0010739 3300046472 Bacteria 7111
1459 Ga0495580_0024583 3300046472 Bacteria 4407
1460 Ga0495580_0025641 3300046472 Bacteria 4309
1461 Ga0495580_0028012 3300046472 Bacteria 4097
1462 Ga0495580_0029927 3300046472 Bacteria 3948
1463 Ga0495580_0032194 3300046472 Bacteria 3785
1464 Ga0495580_0069347 3300046472 Bacteria 2463
1465 Ga0495580_0311235 3300046472 Bacteria 1071
1466 Ga0495582_0002843 3300046473 Bacteria 9686
1467 Ga0495582_0005733 3300046473 Bacteria 6917
1468 Ga0495582_0028356 3300046473 Bacteria 3072
1469 Ga0495605_0007499 3300046474 Bacteria 6187
1470 Ga0495605_0015392 3300046474 Bacteria 4164
1471 Ga0495605_0040473 3300046474 Bacteria 2327
1472 Ga0495605_0051672 3300046474 Bacteria 2000
1473 Ga0495605_0061733 3300046474 Bacteria 1792
1474 Ga0495639_0006486 3300046475 Bacteria 5031
1475 Ga0495639_0010935 3300046475 Bacteria 3907
1476 Ga0495639_0100689 3300046475 Bacteria 1364
1477 Ga0495662_0010730 3300046476 Bacteria 4480
1478 Ga0495662_0014755 3300046476 Bacteria 3799
1479 Ga0495662_0024507 3300046476 Bacteria 2911
1480 Ga0495664_0034488 3300046477 Bacteria 2977
1481 Ga0495664_0055476 3300046477 Bacteria 2357
1482 Ga0495664_0074522 3300046477 Bacteria 2030
1483 Ga0495664_0303661 3300046477 Bacteria 963
1484 Ga0495584_0092691 3300046491 Bacteria 1524
1485 Ga0495594_0064404 3300046499 Bacteria 2032
1486 Ga0495594_0106773 3300046499 Bacteria 1577
1487 Ga0495594_0116636 3300046499 Bacteria 1508
1488 Ga0495594_0276492 3300046499 Bacteria 957
1489 Ga0495596_0001569 3300046500 Bacteria 13023
1490 Ga0495596_0004055 3300046500 Bacteria 7215
1491 Ga0495596_0009658 3300046500 Bacteria 4239
1492 Ga0495607_0055820 3300046501 Bacteria 2270
1493 Ga0495607_0087397 3300046501 Bacteria 1697
1494 Ga0495583_0009863 3300046506 Bacteria 5651
1495 Ga0495583_0035092 3300046506 Bacteria 2397
1496 Ga0495606_0008837 3300046507 Bacteria 8636
1497 Ga0495606_0015624 3300046507 Bacteria 5835
1498 Ga0495606_0020785 3300046507 Bacteria 4826
1499 Ga0495606_0091312 3300046507 Bacteria 1872
1500 Ga0495608_0016142 3300046511 Bacteria 5164
1501 Ga0495608_0017692 3300046511 Bacteria 4928
1502 Ga0495608_0033940 3300046511 Bacteria 3445
1503 Ga0495610_0002004 3300046512 Bacteria 17417
1504 Ga0495610_0017811 3300046512 Bacteria 4038
1505 Ga0495616_0008065 3300046513 Bacteria 6271
1506 Ga0495616_0033297 3300046513 Bacteria 2686
1507 Ga0495616_0075512 3300046513 Bacteria 1622
1508 Ga0495618_0001157 3300046514 Bacteria 17866
1509 Ga0495618_0003759 3300046514 Bacteria 9392
1510 Ga0495618_0012604 3300046514 Bacteria 5136
1511 Ga0495618_0017788 3300046514 Bacteria 4362
1512 Ga0495618_0500698 3300046514 Bacteria 732
1513 Ga0495620_0004133 3300046515 Bacteria 8237
1514 Ga0495628_0010395 3300046516 Bacteria 7904
1515 Ga0495628_0013621 3300046516 Bacteria 6836
1516 Ga0495628_0019082 3300046516 Bacteria 5671
1517 Ga0495628_0028937 3300046516 Bacteria 4497
1518 Ga0495628_0046223 3300046516 Bacteria 3458
1519 Ga0495628_0159366 3300046516 Bacteria 1715
1520 Ga0495628_0173237 3300046516 Bacteria 1635
1521 Ga0495630_0001438 3300046517 Bacteria 16468
1522 Ga0495630_0007815 3300046517 Bacteria 7659
1523 Ga0495630_0011320 3300046517 Bacteria 6453
1524 Ga0495630_0016836 3300046517 Bacteria 5348
1525 Ga0495630_0023021 3300046517 Bacteria 4602
1526 Ga0495630_0097034 3300046517 Bacteria 2229
1527 Ga0495630_0272143 3300046517 Bacteria 1294
1528 Ga0495630_0338875 3300046517 Bacteria 1150
1529 Ga0495630_0404241 3300046517 Bacteria 1046
1530 Ga0495630_0571863 3300046517 Bacteria 866
1531 Ga0495631_0122373 3300046518 Bacteria 1119
1532 Ga0495644_0069818 3300046523 Bacteria 1320
1533 Ga0495648_0054793 3300046524 Bacteria 2407
1534 Ga0495648_0070966 3300046524 Bacteria 2021
1535 Ga0495666_0004083 3300046526 Bacteria 7376
1536 Ga0495666_0005010 3300046526 Bacteria 6700
1537 Ga0495666_0012680 3300046526 Bacteria 4200
1538 Ga0495666_0022716 3300046526 Bacteria 3105
1539 Ga0495666_0023140 3300046526 Bacteria 3073
1540 Ga0495666_0209026 3300046526 Bacteria 895
1541 Ga0495642_0018490 3300046528 Bacteria 2728
1542 Ga0495652_0012115 3300046529 Bacteria 7791
1543 Ga0495652_0022203 3300046529 Bacteria 5633
1544 Ga0495652_0037728 3300046529 Bacteria 4189
1545 Ga0495652_0064181 3300046529 Bacteria 3089
1546 Ga0495652_0095264 3300046529 Bacteria 2426
1547 Ga0495652_0249967 3300046529 Bacteria 1314
1548 Ga0495652_0440431 3300046529 Bacteria 914
1549 Ga0495652_0451205 3300046529 Bacteria 900
1550 Ga0495654_0008110 3300046530 Bacteria 5822
1551 Ga0495665_0002495 3300046531 Bacteria 9933
1552 Ga0495665_0008243 3300046531 Bacteria 5650
1553 Ga0495665_0010248 3300046531 Bacteria 5072
1554 Ga0495665_0013091 3300046531 Bacteria 4492
1555 Ga0495665_0051084 3300046531 Bacteria 2190
1556 Ga0495665_0103460 3300046531 Bacteria 1494
1557 Ga0495640_0002798 3300046533 Bacteria 14031
1558 Ga0495640_0003286 3300046533 Bacteria 13004
1559 Ga0495640_0013424 3300046533 Bacteria 6223
1560 Ga0495640_0027731 3300046533 Bacteria 4082
1561 Ga0495586_0007563 3300046535 Bacteria 5796
1562 Ga0495586_0011555 3300046535 Bacteria 4696
1563 Ga0495586_0069065 3300046535 Bacteria 1928
1564 Ga0495586_0072914 3300046535 Bacteria 1878
1565 Ga0495586_0076877 3300046535 Bacteria 1829
1566 Ga0495587_0004752 3300046536 Bacteria 8917
1567 Ga0495587_0005516 3300046536 Bacteria 8254
1568 Ga0495587_0010266 3300046536 Bacteria 5968
1569 Ga0495598_0002132 3300046537 Bacteria 4040
1570 Ga0495609_0007106 3300046538 Bacteria 5631
1571 Ga0495621_0055528 3300046539 Bacteria 1425
1572 Ga0495621_0083387 3300046539 Bacteria 1195
1573 Ga0495621_0138496 3300046539 Bacteria 951
1574 Ga0495621_0161513 3300046539 Bacteria 886
1575 Ga0495621_0220094 3300046539 Bacteria 768
1576 Ga0495597_0098174 3300046542 Bacteria 1237
1577 Ga0495645_0000044 3300046543 Bacteria 90950
1578 Ga0495645_0013228 3300046543 Bacteria 5832
1579 Ga0495645_0014282 3300046543 Bacteria 5630
1580 Ga0495645_0053649 3300046543 Bacteria 2930
1581 Ga0495645_0072345 3300046543 Bacteria 2484
1582 Ga0495645_0117410 3300046543 Bacteria 1877
1583 Ga0495645_0185481 3300046543 Bacteria 1422
1584 Ga0495622_0000552 3300046557 Bacteria 22467
1585 Ga0495667_0029969 3300046559 Bacteria 3658
1586 Ga0495667_0086450 3300046559 Bacteria 2034
1587 Ga0495656_0044338 3300046615 Bacteria 1872
1588 Ga0495634_0005463 3300046642 Bacteria 9774
1589 Ga0495634_0014214 3300046642 Bacteria 5743
1590 Ga0495634_0030822 3300046642 Bacteria 3698
1591 Ga0495634_0067067 3300046642 Bacteria 2374
1592 Ga0495634_0138371 3300046642 Bacteria 1548
1593 Ga0495611_0016681 3300046648 Bacteria 3139
1594 Ga0495611_0033058 3300046648 Bacteria 2282
1595 Ga0495625_0241827 3300046660 Bacteria 1175
1596 Ga0495635_0012660 3300046663 Bacteria 5915
1597 Ga0495635_0041757 3300046663 Bacteria 3168
1598 Ga0495635_0092457 3300046663 Bacteria 2068
1599 Ga0495635_0101440 3300046663 Bacteria 1967
1600 Ga0495635_0149563 3300046663 Bacteria 1589
1601 Ga0495635_0235600 3300046663 Bacteria 1236
1602 Ga0495635_0318557 3300046663 Bacteria 1041
1603 Ga0495659_0023134 3300046664 Bacteria 2109
1604 Ga0495661_0019169 3300046665 Bacteria 4488
1605 Ga0495661_0040681 3300046665 Bacteria 2880
1606 Ga0495588_0050504 3300046674 Bacteria 2140
1607 Ga0495657_0007778 3300046675 Bacteria 8233
1608 Ga0495599_0002539 3300046678 Bacteria 10629
1609 Ga0495599_0024745 3300046678 Bacteria 3754
1610 Ga0495599_0035091 3300046678 Bacteria 3148
1611 Ga0495599_0037199 3300046678 Bacteria 3057
1612 Ga0495599_0071391 3300046678 Bacteria 2167
1613 Ga0495599_0126995 3300046678 Bacteria 1585
1614 Ga0495623_0005996 3300046679 Bacteria 7905
1615 Ga0495623_0016127 3300046679 Bacteria 4827
1616 Ga0495623_0016195 3300046679 Bacteria 4815
1617 Ga0495623_0175068 3300046679 Bacteria 1251
1618 Ga0495646_0018589 3300046680 Bacteria 4400
1619 Ga0495646_0022305 3300046680 Bacteria 3994
1620 Ga0495646_0041112 3300046680 Bacteria 2842
1621 Ga0495646_0041581 3300046680 Bacteria 2823
1622 Ga0495646_0074597 3300046680 Bacteria 1990
1623 Ga0495647_0000256 3300046681 Bacteria 14582
1624 Ga0495647_0000484 3300046681 Bacteria 11579
1625 Ga0495647_0002242 3300046681 Bacteria 6060
1626 Ga0495647_0027576 3300046681 Bacteria 2088
1627 Ga0495647_0103325 3300046681 Bacteria 1182
1628 Ga0495647_0160777 3300046681 Bacteria 968
1629 Ga0495658_0008012 3300046683 Bacteria 5232
1630 Ga0495658_0015462 3300046683 Bacteria 3915
1631 Ga0495658_0109608 3300046683 Bacteria 1658
1632 Ga0495658_0136184 3300046683 Bacteria 1498
1633 Ga0495669_0084225 3300046684 Bacteria 1462
1634 Ga0495669_0097412 3300046684 Bacteria 1364
1635 Ga0495669_0147383 3300046684 Bacteria 1113
1636 Ga0495669_0237410 3300046684 Bacteria 875
1637 Ga0495613_0011949 3300046689 Bacteria 6453
1638 Ga0495613_0012641 3300046689 Bacteria 6276
1639 Ga0495613_0048608 3300046689 Bacteria 3133
1640 Ga0495613_0056442 3300046689 Bacteria 2883
1641 Ga0495624_0009989 3300046690 Bacteria 6559
1642 Ga0495624_0013046 3300046690 Bacteria 5666
1643 Ga0495624_0028337 3300046690 Bacteria 3661
1644 Ga0495624_0062349 3300046690 Bacteria 2332
1645 Ga0495624_0071671 3300046690 Bacteria 2156
1646 Ga0495624_0102295 3300046690 Bacteria 1763
1647 Ga0495624_0159680 3300046690 Bacteria 1377
1648 Ga0495670_0111544 3300046691 Bacteria 1415
1649 Ga0495671_0006420 3300046692 Bacteria 6789
1650 Ga0495671_0007835 3300046692 Bacteria 6044
1651 Ga0495649_0004442 3300046694 Bacteria 9164
1652 Ga0495649_0009961 3300046694 Bacteria 5619
1653 Ga0495589_0001760 3300046794 Bacteria 12336
1654 Ga0495589_0007195 3300046794 Bacteria 5829
1655 Ga0495589_0029749 3300046794 Bacteria 2754
1656 Ga0495589_0035521 3300046794 Bacteria 2499
1657 Ga0495600_0004598 3300046809 Bacteria 8266
1658 Ga0495600_0009373 3300046809 Bacteria 6049
1659 Ga0495600_0030832 3300046809 Bacteria 3472
1660 Ga0495600_0062630 3300046809 Bacteria 2430
1661 Ga0495581_0001249 3300047315 Bacteria 13988
1662 Ga0495581_0008056 3300047315 Bacteria 6099
1663 Ga0495581_0014229 3300047315 Bacteria 4613
1664 Ga0495581_0030581 3300047315 Bacteria 3120
1665 Ga0495604_0003591 3300047317 Bacteria 12363
1666 Ga0495604_0010202 3300047317 Bacteria 7440
1667 Ga0495604_0037503 3300047317 Bacteria 3816
1668 Ga0495604_0037860 3300047317 Bacteria 3796
1669 Ga0495604_0083275 3300047317 Bacteria 2391
1670 Ga0495604_0157870 3300047317 Bacteria 1605
1671 Ga0495604_0190682 3300047317 Bacteria 1428
1672 Ga0495604_0202842 3300047317 Bacteria 1375
1673 Ga0495604_0299989 3300047317 Bacteria 1079
1674 Ga0495636_0004727 3300047318 Bacteria 5342
1675 Ga0495674_0004635 3300047319 Bacteria 13217
1676 Ga0495674_0018384 3300047319 Bacteria 6506
1677 Ga0495674_0022190 3300047319 Bacteria 5856
1678 Ga0495674_0045121 3300047319 Bacteria 3914
1679 Ga0495674_0061355 3300047319 Bacteria 3277
1680 Ga0495674_0064871 3300047319 Bacteria 3173
1681 Ga0495674_0182592 3300047319 Bacteria 1746
1682 Ga0495674_0289600 3300047319 Bacteria 1339
1683 Ga0495672_0037026 3300047320 Bacteria 2990
1684 Ga0495672_0046029 3300047320 Bacteria 2605
1685 Ga0495672_0062553 3300047320 Bacteria 2140
1686 Ga0495676_0036569 3300047321 Bacteria 4098
1687 Ga0495676_0054502 3300047321 Bacteria 3178
1688 Ga0495676_0064335 3300047321 Bacteria 2854
1689 Ga0495676_0140651 3300047321 Bacteria 1730
1690 Ga0495676_0245766 3300047321 Bacteria 1223
1691 Ga0495680_0010859 3300047322 Bacteria 8098
1692 Ga0495680_0074116 3300047322 Bacteria 2585
1693 Ga0495680_0263945 3300047322 Bacteria 1217
1694 Ga0495680_0349866 3300047322 Bacteria 1029
1695 Ga0495683_0002673 3300047323 Bacteria 10633
1696 Ga0495683_0003991 3300047323 Bacteria 8486
1697 Ga0495683_0005333 3300047323 Bacteria 7141
1698 Ga0495683_0010164 3300047323 Bacteria 4986
1699 Ga0495683_0025102 3300047323 Bacteria 3056
1700 Ga0495683_0036927 3300047323 Bacteria 2478
1701 Ga0495687_000025 3300047443 Bacteria 310498
1702 Ga0495687_017086 3300047443 Bacteria 3632
1703 Ga0495687_039733 3300047443 Bacteria 2079
1704 Ga0495687_080396 3300047443 Bacteria 1278
1705 Ga0495675_0004812 3300047444 Bacteria 8206
1706 Ga0495675_0007596 3300047444 Bacteria 6685
1707 Ga0495675_0021453 3300047444 Bacteria 4113
1708 Ga0495675_0026320 3300047444 Bacteria 3708
1709 Ga0495675_0292786 3300047444 Bacteria 968
1710 Ga0495679_000067 3300047446 Bacteria 100636
1711 Ga0495679_000771 3300047446 Bacteria 20355
1712 Ga0495679_002362 3300047446 Bacteria 9667
1713 Ga0495673_0013569 3300047469 Bacteria 4274
1714 Ga0495673_0019111 3300047469 Bacteria 3439
1715 Ga0495673_0037915 3300047469 Bacteria 2197
1716 Ga0495681_0107746 3300047470 Bacteria 1210
1717 Ga0495684_0015253 3300047471 Bacteria 5919
1718 Ga0495684_0043873 3300047471 Bacteria 3423
1719 Ga0495686_0000032 3300047472 Bacteria 345132
1720 Ga0495686_0052646 3300047472 Bacteria 2552
1721 Ga0495686_0077930 3300047472 Bacteria 2029
1722 Ga0495686_0170468 3300047472 Bacteria 1266
1723 Ga0495593_0004737 3300047673 Bacteria 8086
1724 Ga0495593_0028607 3300047673 Bacteria 3061
1725 Ga0495593_0029262 3300047673 Bacteria 3021
1726 Ga0495593_0030834 3300047673 Bacteria 2931
1727 Ga0495593_0040491 3300047673 Bacteria 2509
1728 Ga0495593_0049655 3300047673 Bacteria 2225
1729 Ga0495593_0125356 3300047673 Bacteria 1305
1730 Ga0495602_0010219 3300048088 Bacteria 9742
1731 Ga0495602_0015846 3300048088 Bacteria 7593
1732 Ga0495602_0044170 3300048088 Bacteria 4045
1733 Ga0495602_0046712 3300048088 Bacteria 3908
1734 Ga0495602_0096464 3300048088 Bacteria 2438
1735 Ga0495602_0125167 3300048088 Bacteria 2060
1736 Ga0495614_0000156 3300048089 Bacteria 24794
1737 Ga0495614_0030182 3300048089 Bacteria 2332
1738 Ga0495614_0031094 3300048089 Bacteria 2298
1739 Ga0495614_0055428 3300048089 Bacteria 1700
1740 Ga0495626_0028084 3300048091 Bacteria 2731
1741 Ga0496100_0000308 3300048903 Bacteria 24150
1742 Ga0496100_0005703 3300048903 Bacteria 6734
1743 Ga0496100_0057768 3300048903 Bacteria 2543
1744 Ga0496100_0067735 3300048903 Bacteria 2372
1745 Ga0496101_0004864 3300048904 Bacteria 8522
1746 Ga0496101_0012056 3300048904 Bacteria 5759
1747 Ga0496101_0057893 3300048904 Bacteria 2804
1748 Ga0496101_0139009 3300048904 Bacteria 1850
1749 Ga0496101_0151922 3300048904 Bacteria 1772
1750 Ga0496101_0293626 3300048904 Bacteria 1272
1751 Ga0496101_0307120 3300048904 Bacteria 1243
1752 Ga0496102_0001201 3300048905 Bacteria 23502
1753 Ga0496102_0004856 3300048905 Bacteria 11371
1754 Ga0496102_0036876 3300048905 Bacteria 4407
1755 Ga0496102_0043950 3300048905 Bacteria 4052
1756 Ga0496102_0059805 3300048905 Bacteria 3485
1757 Ga0496102_0097975 3300048905 Bacteria 2720
1758 Ga0496102_0121117 3300048905 Bacteria 2443
1759 Ga0496102_0392616 3300048905 Bacteria 1305
1760 Ga0496102_0770178 3300048905 Bacteria 885
1761 Ga0496103_0001564 3300048906 Bacteria 15140
1762 Ga0496103_0003665 3300048906 Bacteria 9349
1763 Ga0496103_0040362 3300048906 Bacteria 2867
1764 Ga0496103_0092767 3300048906 Bacteria 1906
1765 Ga0496103_0312239 3300048906 Bacteria 1011
1766 Ga0496104_0000879 3300048907 Bacteria 25857
1767 Ga0496104_0021588 3300048907 Bacteria 5912
1768 Ga0496104_0039735 3300048907 Bacteria 4406
1769 Ga0496104_0178591 3300048907 Bacteria 2033
1770 Ga0496104_0301639 3300048907 Bacteria 1514
1771 Ga0496104_0376719 3300048907 Bacteria 1332
1772 Ga0496104_0708611 3300048907 Bacteria 914
1773 Ga0496105_0025937 3300048908 Bacteria 4775
1774 Ga0496105_0052828 3300048908 Bacteria 3356
1775 Ga0496105_0098345 3300048908 Bacteria 2416
1776 Ga0496106_0000019 3300048909 Bacteria 174698
1777 Ga0496106_0079172 3300048909 Bacteria 2523
1778 Ga0496106_0186367 3300048909 Bacteria 1648
1779 Ga0496106_0250498 3300048909 Bacteria 1416
1780 Ga0496107_0027163 3300048910 Bacteria 4064
1781 Ga0496107_0180968 3300048910 Bacteria 1565
1782 Ga0496108_0016989 3300048911 Bacteria 5948
1783 Ga0496108_0074421 3300048911 Bacteria 2868
1784 Ga0496108_0098157 3300048911 Bacteria 2496
1785 Ga0496108_0146450 3300048911 Bacteria 2036
1786 Ga0496108_0180016 3300048911 Bacteria 1830
1787 Ga0496108_0320392 3300048911 Bacteria 1352
1788 Ga0496108_0376051 3300048911 Bacteria 1240
1789 Ga0496109_0028392 3300048912 Bacteria 5003
1790 Ga0496109_0033871 3300048912 Bacteria 4598
1791 Ga0496109_0242241 3300048912 Bacteria 1697
1792 Ga0496109_0245341 3300048912 Bacteria 1686
1793 Ga0496110_0006222 3300048913 Bacteria 9416
1794 Ga0496110_0020532 3300048913 Bacteria 5578
1795 Ga0496110_0155895 3300048913 Bacteria 2069
1796 Ga0496110_0160827 3300048913 Bacteria 2036
1797 Ga0496110_0195719 3300048913 Bacteria 1836
1798 Ga0496110_0391569 3300048913 Bacteria 1267
1799 Ga0496110_0472893 3300048913 Bacteria 1142
1800 Ga0496111_0264235 3300048914 Bacteria 1277
1801 Ga0496112_0006737 3300048915 Bacteria 10119
1802 Ga0496112_0067336 3300048915 Bacteria 3534
1803 Ga0496112_0083191 3300048915 Bacteria 3165
1804 Ga0496112_0389659 3300048915 Bacteria 1334
1805 Ga0496112_0570229 3300048915 Bacteria 1065
1806 Ga0496113_0048286 3300048916 Bacteria 3166
1807 Ga0496113_0611561 3300048916 Bacteria 872
1808 Ga0496114_0038555 3300048917 Bacteria 3954
1809 Ga0496114_0120923 3300048917 Bacteria 2252
1810 Ga0496114_0122570 3300048917 Bacteria 2237
1811 Ga0496114_0150137 3300048917 Bacteria 2021
1812 Ga0496114_0159516 3300048917 Bacteria 1960
1813 Ga0496114_0367843 3300048917 Bacteria 1272
1814 Ga0496115_0022229 3300048918 Bacteria 4912
1815 Ga0496115_0103194 3300048918 Bacteria 2339
1816 Ga0496115_0239715 3300048918 Bacteria 1495
1817 Ga0496116_0002151 3300048919 Bacteria 20974
1818 Ga0496116_0023999 3300048919 Bacteria 4523
1819 Ga0496116_0038766 3300048919 Bacteria 3304
1820 Ga0496116_0243782 3300048919 Bacteria 900
1821 Ga0496117_0000537 3300048920 Bacteria 62312
1822 Ga0496117_0001148 3300048920 Bacteria 39885
1823 Ga0496117_0006421 3300048920 Bacteria 11912
1824 Ga0496117_0019222 3300048920 Bacteria 5619
1825 Ga0496117_0030785 3300048920 Bacteria 4109
1826 Ga0496117_0036371 3300048920 Bacteria 3685
1827 Ga0496117_0057904 3300048920 Bacteria 2687
1828 Ga0496118_0003723 3300048921 Bacteria 18876
1829 Ga0496118_0003850 3300048921 Bacteria 18443
1830 Ga0496118_0005022 3300048921 Bacteria 15269
1831 Ga0496118_0008675 3300048921 Bacteria 10449
1832 Ga0496118_0009315 3300048921 Bacteria 9953
1833 Ga0496118_0023620 3300048921 Bacteria 5334
1834 Ga0496118_0032814 3300048921 Bacteria 4269
1835 Ga0496118_0147261 3300048921 Bacteria 1480
1836 Ga0496119_0032254 3300048922 Bacteria 3494
1837 Ga0496119_0040771 3300048922 Bacteria 2965
1838 Ga0496120_0065176 3300048923 Bacteria 2020
1839 Ga0496120_0122037 3300048923 Bacteria 1346
1840 Ga0496121_0000280 3300048924 Bacteria 106251
1841 Ga0496121_0000503 3300048924 Bacteria 74670
1842 Ga0496121_0000628 3300048924 Bacteria 65856
1843 Ga0496121_0007639 3300048924 Bacteria 12989
1844 Ga0496121_0027993 3300048924 Bacteria 5259
1845 Ga0496121_0034462 3300048924 Bacteria 4556
1846 Ga0496121_0207010 3300048924 Bacteria 1393
1847 Ga0496121_0354264 3300048924 Bacteria 976
1848 Ga0496122_0000497 3300048925 Bacteria 81763
1849 Ga0496122_0004718 3300048925 Bacteria 16743
1850 Ga0496122_0005900 3300048925 Bacteria 14341
1851 Ga0496123_0000345 3300048926 Bacteria 87307
1852 Ga0496123_0015978 3300048926 Bacteria 6122
1853 Ga0496123_0028879 3300048926 Bacteria 4095
1854 Ga0496123_0136458 3300048926 Bacteria 1349
1855 Ga0496124_0000007 3300048927 Bacteria 883534
1856 Ga0496124_0007738 3300048927 Bacteria 11355
1857 Ga0496125_0000166 3300048928 Bacteria 147432
1858 Ga0496125_0002885 3300048928 Bacteria 21647
1859 Ga0496125_0008814 3300048928 Bacteria 10490
1860 Ga0496125_0025846 3300048928 Bacteria 5366
1861 Ga0496125_0204527 3300048928 Bacteria 1289
1862 Ga0496126_0000034 3300048929 Bacteria 362440
1863 Ga0496126_0000609 3300048929 Bacteria 67577
1864 Ga0496126_0001858 3300048929 Bacteria 30789
1865 Ga0496126_0003147 3300048929 Bacteria 21270
1866 Ga0496126_0024834 3300048929 Bacteria 5779
1867 Ga0496126_0057016 3300048929 Bacteria 3529
1868 Ga0496126_0101671 3300048929 Bacteria 2514
1869 Ga0496126_0263540 3300048929 Bacteria 1432
1870 Ga0495678_011771 3300049459 Bacteria 4173
1871 Ga0495678_040795 3300049459 Bacteria 1863
1872 Ga0495682_0027369 3300049460 Bacteria 2114
1873 Ga0495682_0073234 3300049460 Bacteria 1232
1874 Ga0501031_0037452 3300049568 Bacteria 3164
1875 Ga0501031_0064783 3300049568 Bacteria 2381
1876 Ga0501032_0004367 3300049569 Bacteria 10671
1877 Ga0501032_0180829 3300049569 Bacteria 1381
1878 Ga0501033_0002713 3300049570 Bacteria 14848
1879 Ga0501033_0020221 3300049570 Bacteria 5032
1880 Ga0501034_0000781 3300049571 Bacteria 47646
1881 Ga0501034_0004039 3300049571 Bacteria 16467
1882 Ga0501034_0066184 3300049571 Bacteria 3626
1883 Ga0501034_0088738 3300049571 Bacteria 3090
1884 Ga0501034_0091131 3300049571 Bacteria 3046
1885 Ga0501034_0168138 3300049571 Bacteria 2161
1886 Ga0501034_0623936 3300049571 Bacteria 982
1887 Ga0501036_0000051 3300049572 Bacteria 75057
1888 Ga0501036_0012556 3300049572 Bacteria 7027
1889 Ga0501036_0092700 3300049572 Bacteria 2552
1890 Ga0501037_0001916 3300049573 Bacteria 15094
1891 Ga0501037_0006366 3300049573 Bacteria 8634
1892 Ga0501037_0049401 3300049573 Bacteria 3080
1893 Ga0501037_0050426 3300049573 Bacteria 3046
1894 Ga0501037_0172690 3300049573 Bacteria 1536
1895 Ga0501037_0621620 3300049573 Bacteria 724
1896 Ga0501038_0001036 3300049574 Bacteria 25087
1897 Ga0501038_0295796 3300049574 Bacteria 1271
1898 Ga0501038_0384800 3300049574 Bacteria 1088
1899 Ga0501039_0006235 3300049575 Bacteria 9062
1900 Ga0501039_0070875 3300049575 Bacteria 2707
1901 Ga0501039_0247053 3300049575 Bacteria 1403
1902 Ga0501039_0589942 3300049575 Bacteria 871
1903 Ga0501039_0757289 3300049575 Bacteria 758
1904 Ga0501040_0018176 3300049576 Bacteria 4668
1905 Ga0501040_0040872 3300049576 Bacteria 3157
1906 Ga0501041_0003229 3300049577 Bacteria 9370
1907 Ga0501041_0121027 3300049577 Bacteria 1627
1908 Ga0501042_0009603 3300049578 Bacteria 6456
1909 Ga0501042_0069911 3300049578 Bacteria 2511
1910 Ga0501043_0002694 3300049579 Bacteria 14897
1911 Ga0501043_0031623 3300049579 Bacteria 4160
1912 Ga0501043_0059752 3300049579 Bacteria 2992
1913 Ga0501043_0067301 3300049579 Bacteria 2813
1914 Ga0501043_0162657 3300049579 Bacteria 1744
1915 Ga0501043_0323044 3300049579 Bacteria 1176
1916 Ga0501046_0000415 3300049580 Bacteria 42538
1917 Ga0501046_0045991 3300049580 Bacteria 3465
1918 Ga0501046_0078323 3300049580 Bacteria 2557
1919 Ga0501046_0127401 3300049580 Bacteria 1933
1920 Ga0501046_0213245 3300049580 Bacteria 1432
1921 Ga0501046_0329113 3300049580 Bacteria 1112
1922 Ga0501047_0001463 3300049581 Bacteria 23046
1923 Ga0501047_0001927 3300049581 Bacteria 19951
1924 Ga0501047_0077549 3300049581 Bacteria 3196
1925 Ga0501048_0102312 3300049582 Bacteria 2021
1926 Ga0501048_0325792 3300049582 Bacteria 1094
1927 Ga0501071_0007325 3300049587 Bacteria 7231
1928 Ga0501071_0028121 3300049587 Bacteria 3960
1929 Ga0501071_0080409 3300049587 Bacteria 2383
1930 Ga0501072_0038882 3300049588 Bacteria 3734
1931 Ga0501072_0113027 3300049588 Bacteria 2162
1932 Ga0501072_0172224 3300049588 Bacteria 1727
1933 Ga0501072_0388418 3300049588 Bacteria 1107
1934 Ga0501073_0064234 3300049589 Bacteria 2560
1935 Ga0501073_0252269 3300049589 Bacteria 1218
1936 Ga0501073_0641690 3300049589 Bacteria 733
1937 Ga0501074_0143982 3300049590 Bacteria 1704
1938 Ga0501074_0211837 3300049590 Bacteria 1380
1939 Ga0501074_0371112 3300049590 Bacteria 1015
1940 Ga0501075_0001427 3300049591 Bacteria 15537
1941 Ga0501075_0002610 3300049591 Bacteria 12038
1942 Ga0501075_0019547 3300049591 Bacteria 4916
1943 Ga0501076_0000262 3300049592 Bacteria 32481
1944 Ga0501076_0002023 3300049592 Bacteria 13877
1945 Ga0501076_0034318 3300049592 Bacteria 3965
1946 Ga0501076_0060466 3300049592 Bacteria 3014
1947 Ga0501076_0129293 3300049592 Bacteria 2048
1948 Ga0501077_0004208 3300049593 Bacteria 8694
1949 Ga0501077_0022436 3300049593 Bacteria 3999
1950 Ga0501077_0125168 3300049593 Bacteria 1629
1951 Ga0501079_0002649 3300049741 Bacteria 13020
1952 Ga0501079_0003739 3300049741 Bacteria 11225
1953 Ga0501079_0005503 3300049741 Bacteria 9438
1954 Ga0501080_0005936 3300049742 Bacteria 10946
1955 Ga0501080_0015698 3300049742 Bacteria 6983
1956 Ga0501080_0045265 3300049742 Bacteria 4096
1957 Ga0501080_0094714 3300049742 Bacteria 2773
1958 Ga0501080_0635919 3300049742 Bacteria 945
1959 Ga0501081_0002454 3300049743 Bacteria 11706
1960 Ga0501081_0006560 3300049743 Bacteria 7562
1961 Ga0501035_0001342 3300049822 Bacteria 25362
1962 Ga0501035_0015188 3300049822 Bacteria 7108
1963 Ga0501035_0018455 3300049822 Bacteria 6427
1964 Ga0501035_0025887 3300049822 Bacteria 5376
1965 Ga0501035_0037238 3300049822 Bacteria 4406
1966 Ga0501035_0086910 3300049822 Bacteria 2755
1967 Ga0501044_0000296 3300049823 Bacteria 63089
1968 Ga0501044_0000726 3300049823 Bacteria 39718
1969 Ga0501044_0002429 3300049823 Bacteria 21255
1970 Ga0501044_0016400 3300049823 Bacteria 7954
1971 Ga0501044_0055408 3300049823 Bacteria 4073
1972 Ga0501045_0013001 3300049824 Bacteria 5868
1973 Ga0501045_0036974 3300049824 Bacteria 3548
1974 Ga0501045_0065439 3300049824 Bacteria 2668
1975 nmdc:mga03683_50006_c1 3300050489 Bacteria 1742
1976 nmdc:mga00v17_101134_c1 3300050491 Bacteria 1820
1977 nmdc:mga00v17_80027_c1 3300050491 Bacteria 2038
1978 nmdc:mga00v17_800_c1 3300050491 Bacteria 17132
1979 nmdc:mga0k408_1140_c2 3300050493 Bacteria 8119
1980 nmdc:mga0k408_214977_c1 3300050493 Bacteria 1148
1981 nmdc:mga0k408_2565_c1 3300050493 Bacteria 9650
1982 nmdc:mga07m45_398724_c1 3300050496 Bacteria 799
1983 nmdc:mga05p37_3367_c1 3300050507 Bacteria 18658
1984 nmdc:mga09592_4718_c1 3300050508 Bacteria 11033
1985 nmdc:mga09592_646_c1 3300050508 Bacteria 26554
1986 nmdc:mga0qj67_140435_c1 3300050509 Bacteria 1958
1987 nmdc:mga06r32_120229_c1 3300050510 Bacteria 2590
1988 nmdc:mga06r32_450228_c1 3300050510 Bacteria 1267
1989 nmdc:mga06r32_452637_c1 3300050510 Bacteria 1263
1990 nmdc:mga06r32_488220_c1 3300050510 Bacteria 1209
1991 nmdc:mga06r32_587827_c1 3300050510 Bacteria 1085
1992 nmdc:mga08y16_1209_c1 3300050511 Bacteria 25503
1993 nmdc:mga08y16_127694_c1 3300050511 Bacteria 2645
1994 nmdc:mga08y16_207892_c1 3300050511 Bacteria 2027
1995 nmdc:mga08y16_28220_c1 3300050511 Bacteria 5916
1996 nmdc:mga08y16_606081_c1 3300050511 Bacteria 1103
1997 nmdc:mga08y16_884022_c1 3300050511 Bacteria 881
1998 nmdc:mga0n895_161_c1 3300050512 Bacteria 41386
1999 nmdc:mga0n895_41154_c1 3300050512 Bacteria 4491
2000 nmdc:mga0rr50_4564_c1 3300050513 Bacteria 8149
2001 nmdc:mga0rr50_60252_c1 3300050513 Bacteria 2854
2002 nmdc:mga0rr50_632462_c1 3300050513 Bacteria 913
2003 nmdc:mga08x19_105973_c1 3300050514 Bacteria 1870
2004 nmdc:mga08x19_123570_c1 3300050514 Bacteria 1737
2005 nmdc:mga08x19_141156_c1 3300050514 Bacteria 1627
2006 nmdc:mga08x19_2181_c1 3300050514 Bacteria 11958
2007 nmdc:mga0a205_935_c1 3300050515 Bacteria 24102
2008 nmdc:mga0sz30_5461_c1 3300050516 Bacteria 4664
2009 Ga0495601_0006915 3300053077 Bacteria 6645
2010 Ga0495601_0055509 3300053077 Bacteria 2508
2011 Ga0495601_0123638 3300053077 Bacteria 1682
2012 Ga0495601_0227931 3300053077 Bacteria 1217
2013 Ga0495612_0079538 3300053078 Bacteria 1376
2014 Ga0495595_0000798 3300053084 Bacteria 12002
2015 Ga0495619_0006963 3300053085 Bacteria 7154
2016 Ga0495619_0012391 3300053085 Bacteria 5368
2017 Ga0495619_0056245 3300053085 Bacteria 2608
2018 Ga0500583_0054654 3300053092 Bacteria 1865
2019 Ga0500651_0069870 3300053093 Bacteria 2186
2020 Ga0500650_0084413 3300053098 Bacteria 1486
2021 Ga0500593_001697 3300053117 Bacteria 7948
2022 Ga0500618_007818 3300053125 Bacteria 3022
2023 Ga0500642_0155727 3300053130 Bacteria 1072
2024 Ga0500655_013618 3300053133 Bacteria 1485
2025 Ga0500568_0012958 3300053139 Bacteria 3816
2026 Ga0500568_0030240 3300053139 Bacteria 2243
2027 Ga0500604_0000266 3300053151 Bacteria 14606
2028 Ga0500634_0030385 3300053161 Bacteria 2945
2029 Ga0500634_0050209 3300053161 Bacteria 2247
2030 Ga0500645_005497 3300053730 Bacteria 4651
2031 Ga0501084_0017847 3300054114 Bacteria 5906
2032 Ga0501084_0037790 3300054114 Bacteria 4035
2033 Ga0501084_0253784 3300054114 Bacteria 1484
2034 Ga0587083_0070640 3300059505 Bacteria 810
2035 Ga0587068_019477 3300059641 Bacteria 1100
2036 Ga0587072_000141 3300059643 Bacteria 6112
2037 Ga0501082_0001122 3300060353 Bacteria 23651
2038 Ga0501082_0004154 3300060353 Bacteria 12654
2039 Ga0501082_0029980 3300060353 Bacteria 4687
2040 Ga0466962_0002089 3300061719 Bacteria 9450
2041 Ga0466962_0010650 3300061719 Bacteria 4423
2042 Ga0466962_0022902 3300061719 Bacteria 3002
2043 Ga0466962_0026306 3300061719 Bacteria 2793
2044 Ga0466962_0045035 3300061719 Bacteria 2109
2045 Ga0530510_0004784 3300061734 Bacteria 9375

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042435 Ga0439434_0108670 Ga0439434_0108670_280_882 192
2 3300025899 Ga0207642_10186797 Ga0207642_101867971 197
3 3300007788 Ga0099795_10025370 Ga0099795_100253703 210
4 3300049589 Ga0501073_0252269 Ga0501073_0252269_25_684 212
5 3300025925 Ga0207650_10354777 Ga0207650_103547772 218
6 3300035114 Ga0373939_0045053 Ga0373939_0045053_57_746 222
7 3300005455 Ga0070663_100222190 Ga0070663_1002221902 223
8 3300037418 Ga0395900_0015015 Ga0395900_0015015_5902_6591 223
9 3300037466 Ga0395898_0078131 Ga0395898_0078131_1959_2648 223
10 3300038443 Ga0395901_0916394 Ga0395901_0916394_65_754 223
11 3300047317 Ga0495604_0157870 Ga0495604_0157870_894_1574 223
12 iso_pu_bacteria 2547132103 2547371653 224
13 iso_pu_bacteria 2843690924 2843695285 224
14 iso_pu_bacteria 2846033681 2846037605 224
15 iso_pu_bacteria 2846037992 2846041830 224
16 iso_pu_bacteria 2998344455 2998345287 224
17 3300005459 Ga0068867_100068295 Ga0068867_1000682952 225
18 3300005459 Ga0068867_100423190 Ga0068867_1004231902 225
19 3300014969 Ga0157376_10498258 Ga0157376_104982582 225
20 3300025893 Ga0207682_10162259 Ga0207682_101622592 225
21 3300031731 Ga0307405_10066979 Ga0307405_100669792 225
22 3300031852 Ga0307410_10170896 Ga0307410_101708962 225
23 3300031901 Ga0307406_10016493 Ga0307406_100164932 225
24 3300032002 Ga0307416_100823519 Ga0307416_1008235191 225
25 3300032005 Ga0307411_10607858 Ga0307411_106078582 225
26 3300037471 Ga0395905_0009409 Ga0395905_0009409_7339_8025 225
27 3300041460 Ga0451802_1722518 Ga0451802_1722518_36_740 225
28 3300042015 Ga0439462_0003876 Ga0439462_0003876_1019_1717 225
29 3300042156 Ga0439446_0083529 Ga0439446_0083529_244_948 225
30 iso_pu_bacteria 2526164512 2526212811 225
31 iso_pu_bacteria 2547132512 2548846313 225
32 3300005290 Ga0065712_10086903 Ga0065712_100869032 226
33 3300005290 Ga0065712_10209770 Ga0065712_102097702 226
34 3300005293 Ga0065715_10311062 Ga0065715_103110622 226
35 3300005327 Ga0070658_10382544 Ga0070658_103825442 226
36 3300005328 Ga0070676_10048539 Ga0070676_100485392 226
37 3300005328 Ga0070676_10052947 Ga0070676_100529473 226
38 3300005329 Ga0070683_100004025 Ga0070683_10000402513 226
39 3300005330 Ga0070690_100067617 Ga0070690_1000676172 226
40 3300005331 Ga0070670_100000794 Ga0070670_10000079411 226
41 3300005331 Ga0070670_100004276 Ga0070670_10000427610 226
42 3300005331 Ga0070670_100017893 Ga0070670_1000178933 226
43 3300005331 Ga0070670_100035853 Ga0070670_1000358532 226
44 3300005331 Ga0070670_100084468 Ga0070670_1000844683 226
45 3300005333 Ga0070677_10004159 Ga0070677_100041592 226
46 3300005333 Ga0070677_10006407 Ga0070677_100064073 226
47 3300005334 Ga0068869_100048902 Ga0068869_1000489023 226
48 3300005335 Ga0070666_10008795 Ga0070666_100087953 226
49 3300005335 Ga0070666_10016970 Ga0070666_100169705 226
50 3300005335 Ga0070666_10056153 Ga0070666_100561534 226
51 3300005338 Ga0068868_100001492 Ga0068868_10000149211 226
52 3300005338 Ga0068868_100005172 Ga0068868_1000051726 226
53 3300005338 Ga0068868_100168329 Ga0068868_1001683292 226
54 3300005338 Ga0068868_100357822 Ga0068868_1003578222 226
55 3300005338 Ga0068868_100600575 Ga0068868_1006005751 226
56 3300005340 Ga0070689_100035804 Ga0070689_1000358043 226
57 3300005340 Ga0070689_100218131 Ga0070689_1002181312 226
58 3300005340 Ga0070689_100239547 Ga0070689_1002395472 226
59 3300005340 Ga0070689_100370730 Ga0070689_1003707301 226
60 3300005343 Ga0070687_100006755 Ga0070687_1000067552 226
61 3300005343 Ga0070687_100041806 Ga0070687_1000418062 226
62 3300005344 Ga0070661_100007892 Ga0070661_1000078924 226
63 3300005344 Ga0070661_100031174 Ga0070661_1000311741 226
64 3300005344 Ga0070661_100283948 Ga0070661_1002839482 226
65 3300005347 Ga0070668_100099258 Ga0070668_1000992582 226
66 3300005347 Ga0070668_100254559 Ga0070668_1002545592 226
67 3300005353 Ga0070669_100005523 Ga0070669_1000055239 226
68 3300005353 Ga0070669_100387626 Ga0070669_1003876262 226
69 3300005353 Ga0070669_100411446 Ga0070669_1004114462 226
70 3300005354 Ga0070675_100003273 Ga0070675_10000327311 226
71 3300005354 Ga0070675_100006825 Ga0070675_1000068255 226
72 3300005354 Ga0070675_100167620 Ga0070675_1001676202 226
73 3300005354 Ga0070675_100175883 Ga0070675_1001758832 226
74 3300005355 Ga0070671_100002161 Ga0070671_1000021615 226
75 3300005355 Ga0070671_100002417 Ga0070671_1000024176 226
76 3300005355 Ga0070671_100128400 Ga0070671_1001284002 226
77 3300005355 Ga0070671_100250841 Ga0070671_1002508412 226
78 3300005356 Ga0070674_100044490 Ga0070674_1000444903 226
79 3300005356 Ga0070674_100046998 Ga0070674_1000469983 226
80 3300005356 Ga0070674_100047304 Ga0070674_1000473043 226
81 3300005356 Ga0070674_100078820 Ga0070674_1000788202 226
82 3300005356 Ga0070674_100229364 Ga0070674_1002293642 226
83 3300005364 Ga0070673_100021044 Ga0070673_1000210445 226
84 3300005364 Ga0070673_100034094 Ga0070673_1000340943 226
85 3300005364 Ga0070673_100653599 Ga0070673_1006535991 226
86 3300005366 Ga0070659_100676862 Ga0070659_1006768621 226
87 3300005367 Ga0070667_100136840 Ga0070667_1001368402 226
88 3300005367 Ga0070667_100270870 Ga0070667_1002708701 226
89 3300005367 Ga0070667_100338309 Ga0070667_1003383092 226
90 3300005441 Ga0070700_100063019 Ga0070700_1000630192 226
91 3300005444 Ga0070694_100135549 Ga0070694_1001355492 226
92 3300005456 Ga0070678_100057050 Ga0070678_1000570503 226
93 3300005456 Ga0070678_100158952 Ga0070678_1001589521 226
94 3300005456 Ga0070678_100281530 Ga0070678_1002815302 226
95 3300005457 Ga0070662_100019828 Ga0070662_1000198282 226
96 3300005457 Ga0070662_100099184 Ga0070662_1000991842 226
97 3300005457 Ga0070662_100205850 Ga0070662_1002058502 226
98 3300005459 Ga0068867_100002638 Ga0068867_1000026384 226
99 3300005459 Ga0068867_100052807 Ga0068867_1000528073 226
100 3300005466 Ga0070685_10129446 Ga0070685_101294462 226
101 3300005466 Ga0070685_10356222 Ga0070685_103562222 226
102 3300005535 Ga0070684_100033975 Ga0070684_1000339751 226
103 3300005539 Ga0068853_100264168 Ga0068853_1002641682 226
104 3300005543 Ga0070672_100002422 Ga0070672_10000242211 226
105 3300005543 Ga0070672_100002682 Ga0070672_1000026829 226
106 3300005543 Ga0070672_100052798 Ga0070672_1000527984 226
107 3300005543 Ga0070672_100074503 Ga0070672_1000745033 226
108 3300005548 Ga0070665_100059918 Ga0070665_1000599182 226
109 3300005548 Ga0070665_100259349 Ga0070665_1002593492 226
110 3300005549 Ga0070704_100024770 Ga0070704_1000247704 226
111 3300005549 Ga0070704_100136452 Ga0070704_1001364522 226
112 3300005564 Ga0070664_100001995 Ga0070664_10000199510 226
113 3300005564 Ga0070664_100007567 Ga0070664_1000075676 226
114 3300005578 Ga0068854_100073191 Ga0068854_1000731912 226
115 3300005578 Ga0068854_100231570 Ga0068854_1002315702 226
116 3300005578 Ga0068854_100618586 Ga0068854_1006185862 226
117 3300005615 Ga0070702_100025579 Ga0070702_1000255791 226
118 3300005615 Ga0070702_100510421 Ga0070702_1005104211 226
119 3300005616 Ga0068852_100002615 Ga0068852_1000026152 226
120 3300005616 Ga0068852_100031574 Ga0068852_1000315742 226
121 3300005616 Ga0068852_100203886 Ga0068852_1002038862 226
122 3300005616 Ga0068852_100276485 Ga0068852_1002764852 226
123 3300005617 Ga0068859_100021016 Ga0068859_1000210162 226
124 3300005617 Ga0068859_100035730 Ga0068859_1000357303 226
125 3300005617 Ga0068859_100062989 Ga0068859_1000629892 226
126 3300005618 Ga0068864_100002964 Ga0068864_10000296410 226
127 3300005618 Ga0068864_100006347 Ga0068864_1000063474 226
128 3300005618 Ga0068864_100013687 Ga0068864_1000136874 226
129 3300005618 Ga0068864_100029085 Ga0068864_1000290853 226
130 3300005618 Ga0068864_100153115 Ga0068864_1001531152 226
131 3300005718 Ga0068866_10042299 Ga0068866_100422992 226
132 3300005719 Ga0068861_100017467 Ga0068861_1000174672 226
133 3300005719 Ga0068861_100172974 Ga0068861_1001729742 226
134 3300005834 Ga0068851_10028634 Ga0068851_100286343 226
135 3300005834 Ga0068851_10149990 Ga0068851_101499902 226
136 3300005834 Ga0068851_10164223 Ga0068851_101642232 226
137 3300005840 Ga0068870_10055846 Ga0068870_100558462 226
138 3300005840 Ga0068870_10104439 Ga0068870_101044392 226
139 3300005840 Ga0068870_10112648 Ga0068870_101126482 226
140 3300005841 Ga0068863_100009490 Ga0068863_1000094905 226
141 3300005841 Ga0068863_100036850 Ga0068863_1000368503 226
142 3300005841 Ga0068863_100303717 Ga0068863_1003037172 226
143 3300005842 Ga0068858_100002444 Ga0068858_10000244415 226
144 3300005842 Ga0068858_100002652 Ga0068858_1000026525 226
145 3300005843 Ga0068860_100004770 Ga0068860_1000047705 226
146 3300005843 Ga0068860_100870000 Ga0068860_1008700002 226
147 3300005844 Ga0068862_100028548 Ga0068862_1000285486 226
148 3300005844 Ga0068862_100129761 Ga0068862_1001297612 226
149 3300005844 Ga0068862_100197950 Ga0068862_1001979502 226
150 3300005844 Ga0068862_100548622 Ga0068862_1005486221 226
151 3300006173 Ga0070716_100365089 Ga0070716_1003650892 226
152 3300006237 Ga0097621_100002149 Ga0097621_10000214914 226
153 3300006237 Ga0097621_100086775 Ga0097621_1000867752 226
154 3300006237 Ga0097621_100231710 Ga0097621_1002317102 226
155 3300006237 Ga0097621_100407995 Ga0097621_1004079952 226
156 3300006358 Ga0068871_100001773 Ga0068871_1000017733 226
157 3300006358 Ga0068871_100181964 Ga0068871_1001819643 226
158 3300006358 Ga0068871_100778655 Ga0068871_1007786551 226
159 3300006881 Ga0068865_100013582 Ga0068865_1000135823 226
160 3300006881 Ga0068865_100125892 Ga0068865_1001258922 226
161 3300006881 Ga0068865_100461308 Ga0068865_1004613081 226
162 3300006881 Ga0068865_100495696 Ga0068865_1004956961 226
163 3300006931 Ga0097620_100021016 Ga0097620_1000210167 226
164 3300006931 Ga0097620_100035731 Ga0097620_1000357313 226
165 3300006931 Ga0097620_100062985 Ga0097620_1000629852 226
166 3300006931 Ga0097620_100278111 Ga0097620_1002781112 226
167 3300009094 Ga0111539_10063751 Ga0111539_100637512 226
168 3300009094 Ga0111539_10550302 Ga0111539_105503022 226
169 3300009098 Ga0105245_10141882 Ga0105245_101418822 226
170 3300009098 Ga0105245_10147987 Ga0105245_101479872 226
171 3300009101 Ga0105247_10067897 Ga0105247_100678972 226
172 3300009147 Ga0114129_10566680 Ga0114129_105666803 226
173 3300009148 Ga0105243_10041383 Ga0105243_100413832 226
174 3300009148 Ga0105243_10269452 Ga0105243_102694522 226
175 3300009176 Ga0105242_10086091 Ga0105242_100860913 226
176 3300009176 Ga0105242_10100261 Ga0105242_101002613 226
177 3300009176 Ga0105242_10151095 Ga0105242_101510952 226
178 3300009176 Ga0105242_10294997 Ga0105242_102949972 226
179 3300009177 Ga0105248_10014013 Ga0105248_100140134 226
180 3300009177 Ga0105248_10094628 Ga0105248_100946282 226
181 3300009177 Ga0105248_10100388 Ga0105248_101003883 226
182 3300009177 Ga0105248_10570357 Ga0105248_105703572 226
183 3300009177 Ga0105248_10846989 Ga0105248_108469892 226
184 3300009553 Ga0105249_10156163 Ga0105249_101561632 226
185 3300009553 Ga0105249_10430951 Ga0105249_104309512 226
186 3300010375 Ga0105239_10532253 Ga0105239_105322532 226
187 3300013100 Ga0157373_10454788 Ga0157373_104547881 226
188 3300013296 Ga0157374_10002806 Ga0157374_1000280610 226
189 3300013296 Ga0157374_10672208 Ga0157374_106722081 226
190 3300013296 Ga0157374_10689978 Ga0157374_106899782 226
191 3300013306 Ga0163162_10016830 Ga0163162_100168305 226
192 3300013306 Ga0163162_10024033 Ga0163162_100240334 226
193 3300013306 Ga0163162_10041740 Ga0163162_100417402 226
194 3300013306 Ga0163162_10246545 Ga0163162_102465452 226
195 3300013306 Ga0163162_10614739 Ga0163162_106147392 226
196 3300013306 Ga0163162_10654838 Ga0163162_106548382 226
197 3300013307 Ga0157372_10490629 Ga0157372_104906292 226
198 3300013308 Ga0157375_10022043 Ga0157375_100220435 226
199 3300013308 Ga0157375_10026073 Ga0157375_100260733 226
200 3300013308 Ga0157375_10133366 Ga0157375_101333662 226
201 3300013308 Ga0157375_10449955 Ga0157375_104499552 226
202 3300014325 Ga0163163_10048894 Ga0163163_100488944 226
203 3300014325 Ga0163163_10319086 Ga0163163_103190862 226
204 3300014326 Ga0157380_10002573 Ga0157380_100025739 226
205 3300014326 Ga0157380_10083754 Ga0157380_100837542 226
206 3300014326 Ga0157380_10121530 Ga0157380_101215302 226
207 3300014968 Ga0157379_10033777 Ga0157379_100337775 226
208 3300014968 Ga0157379_10090488 Ga0157379_100904884 226
209 3300014968 Ga0157379_10189023 Ga0157379_101890232 226
210 3300014969 Ga0157376_10005813 Ga0157376_100058134 226
211 3300014969 Ga0157376_10480015 Ga0157376_104800152 226
212 3300017792 Ga0163161_10032428 Ga0163161_100324285 226
213 3300017792 Ga0163161_10083587 Ga0163161_100835872 226
214 3300017792 Ga0163161_10247905 Ga0163161_102479052 226
215 3300017792 Ga0163161_10290353 Ga0163161_102903532 226
216 3300017792 Ga0163161_10316367 Ga0163161_103163672 226
217 3300017792 Ga0163161_10475007 Ga0163161_104750072 226
218 3300025315 Ga0207697_10019852 Ga0207697_100198521 226
219 3300025321 Ga0207656_10008982 Ga0207656_100089823 226
220 3300025893 Ga0207682_10003143 Ga0207682_100031435 226
221 3300025893 Ga0207682_10008790 Ga0207682_100087902 226
222 3300025893 Ga0207682_10017555 Ga0207682_100175552 226
223 3300025893 Ga0207682_10052630 Ga0207682_100526302 226
224 3300025901 Ga0207688_10075446 Ga0207688_100754462 226
225 3300025903 Ga0207680_10005020 Ga0207680_100050203 226
226 3300025903 Ga0207680_10007198 Ga0207680_100071983 226
227 3300025907 Ga0207645_10011030 Ga0207645_100110303 226
228 3300025907 Ga0207645_10024942 Ga0207645_100249422 226
229 3300025908 Ga0207643_10004642 Ga0207643_100046426 226
230 3300025908 Ga0207643_10022461 Ga0207643_100224614 226
231 3300025909 Ga0207705_10049647 Ga0207705_100496472 226
232 3300025909 Ga0207705_10129978 Ga0207705_101299782 226
233 3300025918 Ga0207662_10007995 Ga0207662_100079953 226
234 3300025918 Ga0207662_10094585 Ga0207662_100945852 226
235 3300025919 Ga0207657_10195051 Ga0207657_101950512 226
236 3300025919 Ga0207657_10439086 Ga0207657_104390862 226
237 3300025920 Ga0207649_10107125 Ga0207649_101071252 226
238 3300025920 Ga0207649_10371315 Ga0207649_103713152 226
239 3300025923 Ga0207681_10002117 Ga0207681_100021177 226
240 3300025923 Ga0207681_10206561 Ga0207681_102065612 226
241 3300025923 Ga0207681_10880493 Ga0207681_108804931 226
242 3300025925 Ga0207650_10000967 Ga0207650_100009679 226
243 3300025925 Ga0207650_10002811 Ga0207650_100028118 226
244 3300025925 Ga0207650_10009189 Ga0207650_100091896 226
245 3300025925 Ga0207650_10027573 Ga0207650_100275733 226
246 3300025925 Ga0207650_10116147 Ga0207650_101161472 226
247 3300025925 Ga0207650_10134611 Ga0207650_101346112 226
248 3300025925 Ga0207650_10437136 Ga0207650_104371362 226
249 3300025925 Ga0207650_10567712 Ga0207650_105677122 226
250 3300025926 Ga0207659_10005173 Ga0207659_100051732 226
251 3300025926 Ga0207659_10021349 Ga0207659_100213492 226
252 3300025926 Ga0207659_10076086 Ga0207659_100760863 226
253 3300025931 Ga0207644_10000922 Ga0207644_1000092210 226
254 3300025931 Ga0207644_10003390 Ga0207644_100033903 226
255 3300025931 Ga0207644_10010411 Ga0207644_100104114 226
256 3300025931 Ga0207644_10122623 Ga0207644_101226232 226
257 3300025931 Ga0207644_10458475 Ga0207644_104584752 226
258 3300025933 Ga0207706_10072082 Ga0207706_100720822 226
259 3300025933 Ga0207706_10121649 Ga0207706_101216493 226
260 3300025933 Ga0207706_10152020 Ga0207706_101520202 226
261 3300025934 Ga0207686_10150337 Ga0207686_101503372 226
262 3300025934 Ga0207686_10185370 Ga0207686_101853702 226
263 3300025935 Ga0207709_10009812 Ga0207709_100098126 226
264 3300025936 Ga0207670_10031585 Ga0207670_100315854 226
265 3300025937 Ga0207669_10003504 Ga0207669_100035045 226
266 3300025937 Ga0207669_10036071 Ga0207669_100360712 226
267 3300025937 Ga0207669_10058032 Ga0207669_100580321 226
268 3300025938 Ga0207704_10060620 Ga0207704_100606202 226
269 3300025938 Ga0207704_10103514 Ga0207704_101035143 226
270 3300025938 Ga0207704_10178142 Ga0207704_101781422 226
271 3300025938 Ga0207704_10289521 Ga0207704_102895212 226
272 3300025939 Ga0207665_10353928 Ga0207665_103539282 226
273 3300025940 Ga0207691_10003180 Ga0207691_100031804 226
274 3300025940 Ga0207691_10016133 Ga0207691_100161335 226
275 3300025940 Ga0207691_10021667 Ga0207691_100216675 226
276 3300025940 Ga0207691_10027631 Ga0207691_100276315 226
277 3300025940 Ga0207691_10054817 Ga0207691_100548172 226
278 3300025940 Ga0207691_10091024 Ga0207691_100910243 226
279 3300025940 Ga0207691_10276894 Ga0207691_102768942 226
280 3300025940 Ga0207691_10361864 Ga0207691_103618642 226
281 3300025941 Ga0207711_10003133 Ga0207711_100031334 226
282 3300025941 Ga0207711_10014436 Ga0207711_100144365 226
283 3300025941 Ga0207711_10056186 Ga0207711_100561862 226
284 3300025941 Ga0207711_10484978 Ga0207711_104849782 226
285 3300025941 Ga0207711_10794921 Ga0207711_107949211 226
286 3300025942 Ga0207689_10022581 Ga0207689_100225815 226
287 3300025942 Ga0207689_10049038 Ga0207689_100490383 226
288 3300025944 Ga0207661_10019505 Ga0207661_100195053 226
289 3300025945 Ga0207679_10007201 Ga0207679_100072016 226
290 3300025945 Ga0207679_10251981 Ga0207679_102519812 226
291 3300025945 Ga0207679_10404676 Ga0207679_104046762 226
292 3300025945 Ga0207679_10884791 Ga0207679_108847911 226
293 3300025960 Ga0207651_10081443 Ga0207651_100814433 226
294 3300025960 Ga0207651_10089102 Ga0207651_100891022 226
295 3300025960 Ga0207651_10132699 Ga0207651_101326992 226
296 3300025960 Ga0207651_10730042 Ga0207651_107300422 226
297 3300025972 Ga0207668_10026624 Ga0207668_100266243 226
298 3300025972 Ga0207668_10348608 Ga0207668_103486082 226
299 3300025981 Ga0207640_10097445 Ga0207640_100974452 226
300 3300025981 Ga0207640_10161787 Ga0207640_101617872 226
301 3300025981 Ga0207640_10762366 Ga0207640_107623661 226
302 3300025981 Ga0207640_10854417 Ga0207640_108544171 226
303 3300025986 Ga0207658_10005104 Ga0207658_100051045 226
304 3300025986 Ga0207658_10015232 Ga0207658_100152322 226
305 3300025986 Ga0207658_10102652 Ga0207658_101026522 226
306 3300025986 Ga0207658_10247669 Ga0207658_102476692 226
307 3300025986 Ga0207658_10269632 Ga0207658_102696322 226
308 3300025986 Ga0207658_10570165 Ga0207658_105701652 226
309 3300026023 Ga0207677_10005649 Ga0207677_100056492 226
310 3300026023 Ga0207677_10168737 Ga0207677_101687372 226
311 3300026023 Ga0207677_10331226 Ga0207677_103312262 226
312 3300026035 Ga0207703_10003002 Ga0207703_100030028 226
313 3300026035 Ga0207703_10005577 Ga0207703_100055776 226
314 3300026041 Ga0207639_10745143 Ga0207639_107451431 226
315 3300026067 Ga0207678_10085134 Ga0207678_100851342 226
316 3300026067 Ga0207678_10232304 Ga0207678_102323041 226
317 3300026075 Ga0207708_10016389 Ga0207708_100163894 226
318 3300026088 Ga0207641_10004704 Ga0207641_100047045 226
319 3300026088 Ga0207641_10008791 Ga0207641_100087916 226
320 3300026088 Ga0207641_10542426 Ga0207641_105424262 226
321 3300026089 Ga0207648_10006669 Ga0207648_100066699 226
322 3300026089 Ga0207648_10040398 Ga0207648_100403983 226
323 3300026089 Ga0207648_10043411 Ga0207648_100434113 226
324 3300026089 Ga0207648_10096346 Ga0207648_100963463 226
325 3300026089 Ga0207648_10281311 Ga0207648_102813112 226
326 3300026089 Ga0207648_10294182 Ga0207648_102941822 226
327 3300026095 Ga0207676_10004012 Ga0207676_100040126 226
328 3300026095 Ga0207676_10008578 Ga0207676_100085784 226
329 3300026095 Ga0207676_10022825 Ga0207676_100228252 226
330 3300026095 Ga0207676_10150061 Ga0207676_101500612 226
331 3300026095 Ga0207676_11025714 Ga0207676_110257141 226
332 3300026118 Ga0207675_100016680 Ga0207675_1000166803 226
333 3300026118 Ga0207675_100023103 Ga0207675_1000231033 226
334 3300026118 Ga0207675_100035399 Ga0207675_1000353992 226
335 3300026118 Ga0207675_100262861 Ga0207675_1002628612 226
336 3300026121 Ga0207683_10043482 Ga0207683_100434822 226
337 3300026121 Ga0207683_10094597 Ga0207683_100945972 226
338 3300026121 Ga0207683_10101788 Ga0207683_101017882 226
339 3300026121 Ga0207683_10151602 Ga0207683_101516023 226
340 3300026121 Ga0207683_10179940 Ga0207683_101799402 226
341 3300026121 Ga0207683_10451302 Ga0207683_104513022 226
342 3300026121 Ga0207683_10585617 Ga0207683_105856171 226
343 3300026142 Ga0207698_10002042 Ga0207698_100020422 226
344 3300026142 Ga0207698_10348169 Ga0207698_103481692 226
345 3300026142 Ga0207698_10369989 Ga0207698_103699892 226
346 3300026142 Ga0207698_10534501 Ga0207698_105345012 226
347 3300026142 Ga0207698_10732977 Ga0207698_107329772 226
348 3300028379 Ga0268266_10262097 Ga0268266_102620972 226
349 3300028380 Ga0268265_10025515 Ga0268265_100255154 226
350 3300028381 Ga0268264_10015053 Ga0268264_100150534 226
351 3300028381 Ga0268264_10932313 Ga0268264_109323132 226
352 3300031235 Ga0265330_10009793 Ga0265330_100097935 226
353 3300031238 Ga0265332_10005095 Ga0265332_100050955 226
354 3300031239 Ga0265328_10005286 Ga0265328_100052864 226
355 3300031240 Ga0265320_10020002 Ga0265320_100200022 226
356 3300031242 Ga0265329_10010527 Ga0265329_100105274 226
357 3300031249 Ga0265339_10051084 Ga0265339_100510842 226
358 3300031250 Ga0265331_10024970 Ga0265331_100249704 226
359 3300031344 Ga0265316_10060919 Ga0265316_100609194 226
360 3300031616 Ga0307508_10279096 Ga0307508_102790961 226
361 3300031711 Ga0265314_10001425 Ga0265314_1000142526 226
362 3300031712 Ga0265342_10011779 Ga0265342_100117795 226
363 3300031911 Ga0307412_10066811 Ga0307412_100668113 226
364 3300035086 Ga0373934_0114314 Ga0373934_0114314_142_840 226
365 3300035111 Ga0373923_0160299 Ga0373923_0160299_306_1004 226
366 3300035119 Ga0373956_0074984 Ga0373956_0074984_121_819 226
367 3300035170 Ga0373943_0022415 Ga0373943_0022415_1812_2510 226
368 3300035695 Ga0373927_0209851 Ga0373927_0209851_167_865 226
369 3300035724 Ga0373933_0494143 Ga0373933_0494143_35_733 226
370 3300035725 Ga0373947_0055303 Ga0373947_0055303_622_1320 226
371 3300035725 Ga0373947_0438038 Ga0373947_0438038_173_871 226
372 3300036401 Ga0373937_0047877 Ga0373937_0047877_893_1591 226
373 3300036401 Ga0373937_0158055 Ga0373937_0158055_335_1033 226
374 3300037068 Ga0373925_0106693 Ga0373925_0106693_650_1348 226
375 3300037068 Ga0373925_0415970 Ga0373925_0415970_111_809 226
376 3300037312 Ga0395899_0017094 Ga0395899_0017094_4575_5267 226
377 3300037418 Ga0395900_0022775 Ga0395900_0022775_2592_3284 226
378 3300037418 Ga0395900_0143145 Ga0395900_0143145_1092_1790 226
379 3300037466 Ga0395898_0007816 Ga0395898_0007816_1209_1901 226
380 3300037471 Ga0395905_0026969 Ga0395905_0026969_1191_1889 226
381 3300037471 Ga0395905_0114332 Ga0395905_0114332_139_828 226
382 3300038443 Ga0395901_0021594 Ga0395901_0021594_1241_1933 226
383 3300038443 Ga0395901_0259549 Ga0395901_0259549_270_968 226
384 3300042876 Ga0451577_0003657 Ga0451577_0003657_8415_9125 226
385 3300044693 Ga0466961_0230445 Ga0466961_0230445_218_910 226
386 3300046455 Ga0495603_0286311 Ga0495603_0286311_149_847 226
387 3300046459 Ga0495629_0102655 Ga0495629_0102655_614_1312 226
388 3300046462 Ga0495651_0186439 Ga0495651_0186439_21_728 226
389 3300046463 Ga0495653_0178440 Ga0495653_0178440_23_721 226
390 3300046472 Ga0495580_0311235 Ga0495580_0311235_282_980 226
391 3300046514 Ga0495618_0500698 Ga0495618_0500698_12_710 226
392 3300046517 Ga0495630_0571863 Ga0495630_0571863_93_791 226
393 3300046539 Ga0495621_0083387 Ga0495621_0083387_407_1105 226
394 3300046539 Ga0495621_0138496 Ga0495621_0138496_223_906 226
395 3300046539 Ga0495621_0220094 Ga0495621_0220094_15_713 226
396 3300046543 Ga0495645_0117410 Ga0495645_0117410_956_1654 226
397 3300046559 Ga0495667_0086450 Ga0495667_0086450_716_1414 226
398 3300046663 Ga0495635_0235600 Ga0495635_0235600_209_907 226
399 3300046663 Ga0495635_0318557 Ga0495635_0318557_111_809 226
400 3300046681 Ga0495647_0027576 Ga0495647_0027576_30_728 226
401 3300046681 Ga0495647_0103325 Ga0495647_0103325_351_1049 226
402 3300046681 Ga0495647_0160777 Ga0495647_0160777_69_767 226
403 3300046683 Ga0495658_0109608 Ga0495658_0109608_871_1569 226
404 3300046683 Ga0495658_0136184 Ga0495658_0136184_389_1087 226
405 3300046689 Ga0495613_0048608 Ga0495613_0048608_225_923 226
406 3300047322 Ga0495680_0349866 Ga0495680_0349866_258_956 226
407 3300048904 Ga0496101_0151922 Ga0496101_0151922_840_1538 226
408 3300048904 Ga0496101_0293626 Ga0496101_0293626_370_1053 226
409 3300048907 Ga0496104_0039735 Ga0496104_0039735_717_1415 226
410 3300048907 Ga0496104_0178591 Ga0496104_0178591_756_1439 226
411 3300048907 Ga0496104_0376719 Ga0496104_0376719_558_1256 226
412 3300048907 Ga0496104_0708611 Ga0496104_0708611_195_878 226
413 3300048908 Ga0496105_0098345 Ga0496105_0098345_151_849 226
414 3300048909 Ga0496106_0250498 Ga0496106_0250498_252_935 226
415 3300048911 Ga0496108_0016989 Ga0496108_0016989_2321_3004 226
416 3300048911 Ga0496108_0180016 Ga0496108_0180016_926_1624 226
417 3300048911 Ga0496108_0320392 Ga0496108_0320392_161_844 226
418 3300048912 Ga0496109_0033871 Ga0496109_0033871_1620_2303 226
419 3300048913 Ga0496110_0020532 Ga0496110_0020532_4607_5290 226
420 3300048913 Ga0496110_0155895 Ga0496110_0155895_700_1383 226
421 3300048913 Ga0496110_0391569 Ga0496110_0391569_491_1189 226
422 3300048913 Ga0496110_0472893 Ga0496110_0472893_233_931 226
423 3300048917 Ga0496114_0120923 Ga0496114_0120923_360_1058 226
424 3300048917 Ga0496114_0159516 Ga0496114_0159516_311_1009 226
425 3300048917 Ga0496114_0367843 Ga0496114_0367843_544_1227 226
426 3300050511 nmdc:mga08y16_884022_c1 nmdc:mga08y16_884022_c1_48_746 226
427 3300053077 Ga0495601_0055509 Ga0495601_0055509_1171_1869 226
428 3300053077 Ga0495601_0123638 Ga0495601_0123638_800_1498 226
429 3300053085 Ga0495619_0056245 Ga0495619_0056245_1068_1766 226
430 iso_pu_bacteria 2574179768 2574429947 226
431 iso_pu_bacteria 2599185292 2599904744 226
432 iso_pu_bacteria 2643221569 2643861287 226
433 iso_pu_bacteria 2643221594 2643983070 226
434 iso_pu_bacteria 2643221621 2644120598 226
435 iso_pu_bacteria 2739367655 2739611473 226
436 iso_pu_bacteria 2808606395 2809032839 226
437 iso_pu_bacteria 2855730933 2855735208 226
438 iso_pu_bacteria 2855767633 2855770992 226
439 iso_pu_bacteria 2857537821 2857540649 226
440 iso_pu_bacteria 2857542790 2857544046 226
441 iso_pu_bacteria 2857576091 2857578765 226
442 iso_pu_bacteria 2858950400 2858956332 226
443 iso_pu_bacteria 2881412998 2881418376 226
444 iso_pu_bacteria 2881927736 2881931401 226
445 iso_pu_bacteria 2887375801 2887376848 226
446 iso_pu_bacteria 2891633521 2891636481 226
447 iso_pu_bacteria 2941479691 2941482936 226
448 iso_pu_bacteria 639633007 639785270 226
449 iso_pu_bacteria 8002392321 8002395671 226
450 iso_pu_bacteria 8048746797 8048747276 226
451 3300002704 JGI25155J39150_1000049 JGI25155J39150_100004925 227
452 3300003771 Ga0055526_1019301 Ga0055526_10193013 227
453 3300005295 Ga0065707_10135451 Ga0065707_101354511 227
454 3300005327 Ga0070658_10073816 Ga0070658_100738162 227
455 3300005328 Ga0070676_10001310 Ga0070676_100013106 227
456 3300005328 Ga0070676_10038934 Ga0070676_100389344 227
457 3300005330 Ga0070690_100028545 Ga0070690_1000285451 227
458 3300005330 Ga0070690_100230664 Ga0070690_1002306641 227
459 3300005331 Ga0070670_100128694 Ga0070670_1001286942 227
460 3300005331 Ga0070670_100204534 Ga0070670_1002045342 227
461 3300005331 Ga0070670_100440204 Ga0070670_1004402041 227
462 3300005334 Ga0068869_100002911 Ga0068869_1000029119 227
463 3300005334 Ga0068869_100060452 Ga0068869_1000604523 227
464 3300005334 Ga0068869_100193929 Ga0068869_1001939292 227
465 3300005334 Ga0068869_100224634 Ga0068869_1002246342 227
466 3300005337 Ga0070682_100099986 Ga0070682_1000999861 227
467 3300005338 Ga0068868_100079971 Ga0068868_1000799713 227
468 3300005340 Ga0070689_100078773 Ga0070689_1000787733 227
469 3300005340 Ga0070689_100216586 Ga0070689_1002165861 227
470 3300005341 Ga0070691_10156484 Ga0070691_101564841 227
471 3300005344 Ga0070661_100083196 Ga0070661_1000831962 227
472 3300005347 Ga0070668_100058297 Ga0070668_1000582972 227
473 3300005353 Ga0070669_100011664 Ga0070669_1000116644 227
474 3300005353 Ga0070669_100014200 Ga0070669_1000142007 227
475 3300005353 Ga0070669_100089138 Ga0070669_1000891382 227
476 3300005354 Ga0070675_100009726 Ga0070675_1000097266 227
477 3300005354 Ga0070675_100012894 Ga0070675_1000128945 227
478 3300005354 Ga0070675_100067948 Ga0070675_1000679482 227
479 3300005355 Ga0070671_100000589 Ga0070671_10000058926 227
480 3300005355 Ga0070671_100044240 Ga0070671_1000442404 227
481 3300005356 Ga0070674_100015926 Ga0070674_1000159267 227
482 3300005356 Ga0070674_100103170 Ga0070674_1001031703 227
483 3300005356 Ga0070674_100186035 Ga0070674_1001860352 227
484 3300005356 Ga0070674_100979428 Ga0070674_1009794281 227
485 3300005364 Ga0070673_100001585 Ga0070673_10000158514 227
486 3300005364 Ga0070673_100050827 Ga0070673_1000508273 227
487 3300005364 Ga0070673_100067755 Ga0070673_1000677554 227
488 3300005365 Ga0070688_100167901 Ga0070688_1001679012 227
489 3300005367 Ga0070667_100227316 Ga0070667_1002273162 227
490 3300005441 Ga0070700_100047678 Ga0070700_1000476782 227
491 3300005457 Ga0070662_100400099 Ga0070662_1004000991 227
492 3300005458 Ga0070681_10001348 Ga0070681_1000134817 227
493 3300005458 Ga0070681_10219058 Ga0070681_102190582 227
494 3300005459 Ga0068867_100011201 Ga0068867_1000112013 227
495 3300005459 Ga0068867_100046296 Ga0068867_1000462962 227
496 3300005466 Ga0070685_10095575 Ga0070685_100955751 227
497 3300005466 Ga0070685_10143976 Ga0070685_101439762 227
498 3300005539 Ga0068853_100047758 Ga0068853_1000477584 227
499 3300005543 Ga0070672_100008126 Ga0070672_1000081266 227
500 3300005544 Ga0070686_100094859 Ga0070686_1000948593 227
501 3300005545 Ga0070695_100104355 Ga0070695_1001043552 227
502 3300005546 Ga0070696_100074801 Ga0070696_1000748013 227
503 3300005547 Ga0070693_100080079 Ga0070693_1000800792 227
504 3300005548 Ga0070665_100150507 Ga0070665_1001505071 227
505 3300005549 Ga0070704_100153612 Ga0070704_1001536122 227
506 3300005563 Ga0068855_100018420 Ga0068855_1000184208 227
507 3300005564 Ga0070664_100021557 Ga0070664_1000215576 227
508 3300005564 Ga0070664_100804411 Ga0070664_1008044111 227
509 3300005577 Ga0068857_100138790 Ga0068857_1001387903 227
510 3300005615 Ga0070702_100088974 Ga0070702_1000889742 227
511 3300005616 Ga0068852_100066436 Ga0068852_1000664362 227
512 3300005617 Ga0068859_100119219 Ga0068859_1001192192 227
513 3300005618 Ga0068864_100053236 Ga0068864_1000532361 227
514 3300005718 Ga0068866_10197149 Ga0068866_101971492 227
515 3300005719 Ga0068861_100977177 Ga0068861_1009771771 227
516 3300005841 Ga0068863_100315337 Ga0068863_1003153372 227
517 3300005842 Ga0068858_100093216 Ga0068858_1000932162 227
518 3300005843 Ga0068860_100015268 Ga0068860_1000152686 227
519 3300006038 Ga0075365_10055315 Ga0075365_100553152 227
520 3300006195 Ga0075366_10236705 Ga0075366_102367052 227
521 3300006237 Ga0097621_100005550 Ga0097621_1000055507 227
522 3300006237 Ga0097621_100053543 Ga0097621_1000535433 227
523 3300006237 Ga0097621_100053998 Ga0097621_1000539984 227
524 3300006237 Ga0097621_100266002 Ga0097621_1002660022 227
525 3300006358 Ga0068871_100009830 Ga0068871_1000098304 227
526 3300006358 Ga0068871_100020320 Ga0068871_1000203205 227
527 3300006844 Ga0075428_100206826 Ga0075428_1002068262 227
528 3300006846 Ga0075430_100133248 Ga0075430_1001332482 227
529 3300006847 Ga0075431_100085644 Ga0075431_1000856443 227
530 3300006931 Ga0097620_100119228 Ga0097620_1001192282 227
531 3300007076 Ga0075435_100113896 Ga0075435_1001138962 227
532 3300009098 Ga0105245_10217854 Ga0105245_102178542 227
533 3300009098 Ga0105245_10233222 Ga0105245_102332222 227
534 3300009148 Ga0105243_10143700 Ga0105243_101437003 227
535 3300009148 Ga0105243_10226305 Ga0105243_102263052 227
536 3300009174 Ga0105241_10016405 Ga0105241_100164055 227
537 3300009177 Ga0105248_10088995 Ga0105248_100889954 227
538 3300009177 Ga0105248_10255064 Ga0105248_102550642 227
539 3300009545 Ga0105237_10472431 Ga0105237_104724312 227
540 3300009551 Ga0105238_10074614 Ga0105238_100746142 227
541 3300009553 Ga0105249_10376664 Ga0105249_103766642 227
542 3300010375 Ga0105239_10008633 Ga0105239_1000863312 227
543 3300010375 Ga0105239_10427714 Ga0105239_104277142 227
544 3300013296 Ga0157374_10219823 Ga0157374_102198232 227
545 3300013297 Ga0157378_10238470 Ga0157378_102384702 227
546 3300013297 Ga0157378_10473962 Ga0157378_104739622 227
547 3300013306 Ga0163162_10803344 Ga0163162_108033441 227
548 3300013307 Ga0157372_10187197 Ga0157372_101871972 227
549 3300013308 Ga0157375_10056113 Ga0157375_100561132 227
550 3300013308 Ga0157375_10272258 Ga0157375_102722582 227
551 3300014326 Ga0157380_10496884 Ga0157380_104968842 227
552 3300014968 Ga0157379_10029549 Ga0157379_100295495 227
553 3300014969 Ga0157376_10268722 Ga0157376_102687221 227
554 3300017792 Ga0163161_10075707 Ga0163161_100757074 227
555 3300025295 Ga0209564_1000962 Ga0209564_100096218 227
556 3300025315 Ga0207697_10005681 Ga0207697_100056816 227
557 3300025321 Ga0207656_10070401 Ga0207656_100704012 227
558 3300025899 Ga0207642_10006176 Ga0207642_100061765 227
559 3300025899 Ga0207642_10195103 Ga0207642_101951032 227
560 3300025903 Ga0207680_10002896 Ga0207680_100028967 227
561 3300025907 Ga0207645_10000157 Ga0207645_1000015753 227
562 3300025907 Ga0207645_10001039 Ga0207645_1000103914 227
563 3300025907 Ga0207645_10015559 Ga0207645_100155592 227
564 3300025911 Ga0207654_10032147 Ga0207654_100321471 227
565 3300025912 Ga0207707_10003910 Ga0207707_100039102 227
566 3300025912 Ga0207707_10624416 Ga0207707_106244162 227
567 3300025913 Ga0207695_10634263 Ga0207695_106342631 227
568 3300025914 Ga0207671_10006805 Ga0207671_100068055 227
569 3300025923 Ga0207681_10005258 Ga0207681_100052585 227
570 3300025923 Ga0207681_10006156 Ga0207681_100061566 227
571 3300025924 Ga0207694_10163450 Ga0207694_101634502 227
572 3300025925 Ga0207650_10000615 Ga0207650_1000061516 227
573 3300025925 Ga0207650_10584232 Ga0207650_105842321 227
574 3300025927 Ga0207687_10059426 Ga0207687_100594262 227
575 3300025927 Ga0207687_10179164 Ga0207687_101791642 227
576 3300025931 Ga0207644_10002195 Ga0207644_1000219514 227
577 3300025933 Ga0207706_10290662 Ga0207706_102906622 227
578 3300025937 Ga0207669_10025894 Ga0207669_100258942 227
579 3300025937 Ga0207669_10172707 Ga0207669_101727072 227
580 3300025937 Ga0207669_10804400 Ga0207669_108044001 227
581 3300025938 Ga0207704_10063640 Ga0207704_100636402 227
582 3300025940 Ga0207691_10000844 Ga0207691_100008444 227
583 3300025940 Ga0207691_10025466 Ga0207691_100254661 227
584 3300025941 Ga0207711_10029193 Ga0207711_100291931 227
585 3300025941 Ga0207711_10297296 Ga0207711_102972962 227
586 3300025942 Ga0207689_10008154 Ga0207689_100081543 227
587 3300025942 Ga0207689_10029822 Ga0207689_100298223 227
588 3300025949 Ga0207667_10044202 Ga0207667_100442026 227
589 3300025960 Ga0207651_10026537 Ga0207651_100265372 227
590 3300025972 Ga0207668_10597805 Ga0207668_105978052 227
591 3300025986 Ga0207658_10006163 Ga0207658_100061636 227
592 3300025986 Ga0207658_10038802 Ga0207658_100388023 227
593 3300026023 Ga0207677_10283868 Ga0207677_102838682 227
594 3300026035 Ga0207703_10081877 Ga0207703_100818774 227
595 3300026035 Ga0207703_10349392 Ga0207703_103493921 227
596 3300026067 Ga0207678_10128364 Ga0207678_101283642 227
597 3300026075 Ga0207708_10023225 Ga0207708_100232253 227
598 3300026075 Ga0207708_10718792 Ga0207708_107187921 227
599 3300026078 Ga0207702_10197568 Ga0207702_101975682 227
600 3300026088 Ga0207641_10030196 Ga0207641_100301963 227
601 3300026089 Ga0207648_10013086 Ga0207648_100130865 227
602 3300026095 Ga0207676_10212528 Ga0207676_102125281 227
603 3300026116 Ga0207674_10011309 Ga0207674_100113096 227
604 3300026116 Ga0207674_10610813 Ga0207674_106108132 227
605 3300026118 Ga0207675_100094743 Ga0207675_1000947431 227
606 3300026118 Ga0207675_100188621 Ga0207675_1001886211 227
607 3300026121 Ga0207683_10038245 Ga0207683_100382451 227
608 3300028379 Ga0268266_10073323 Ga0268266_100733233 227
609 3300028379 Ga0268266_10343008 Ga0268266_103430082 227
610 3300028653 Ga0265323_10024249 Ga0265323_100242492 227
611 3300028666 Ga0265336_10000511 Ga0265336_1000051112 227
612 3300028666 Ga0265336_10037564 Ga0265336_100375642 227
613 3300029957 Ga0265324_10000011 Ga0265324_10000011204 227
614 3300029957 Ga0265324_10000340 Ga0265324_1000034013 227
615 3300031238 Ga0265332_10004536 Ga0265332_100045364 227
616 3300031239 Ga0265328_10028977 Ga0265328_100289772 227
617 3300031241 Ga0265325_10000125 Ga0265325_1000012536 227
618 3300031241 Ga0265325_10010551 Ga0265325_100105512 227
619 3300031241 Ga0265325_10050360 Ga0265325_100503602 227
620 3300031250 Ga0265331_10010508 Ga0265331_100105083 227
621 3300031250 Ga0265331_10028218 Ga0265331_100282182 227
622 3300031251 Ga0265327_10000719 Ga0265327_1000071916 227
623 3300031251 Ga0265327_10003549 Ga0265327_100035495 227
624 3300031251 Ga0265327_10020927 Ga0265327_100209273 227
625 3300031344 Ga0265316_10010238 Ga0265316_100102386 227
626 3300031456 Ga0307513_10000120 Ga0307513_10000120104 227
627 3300031456 Ga0307513_10020887 Ga0307513_100208874 227
628 3300031548 Ga0307408_100638697 Ga0307408_1006386972 227
629 3300031711 Ga0265314_10000134 Ga0265314_1000013410 227
630 3300031711 Ga0265314_10007756 Ga0265314_100077563 227
631 3300031711 Ga0265314_10020023 Ga0265314_100200236 227
632 3300031730 Ga0307516_10003314 Ga0307516_100033144 227
633 3300031730 Ga0307516_10170580 Ga0307516_101705801 227
634 3300032004 Ga0307414_10080843 Ga0307414_100808432 227
635 3300034817 Ga0373948_0005492 Ga0373948_0005492_393_1079 227
636 3300036401 Ga0373937_0898964 Ga0373937_0898964_73_759 227
637 3300037471 Ga0395905_0054125 Ga0395905_0054125_2336_3049 227
638 3300039437 Ga0436365_1409848 Ga0436365_1409848_48_734 227
639 3300041408 Ga0439453_0002835 Ga0439453_0002835_1126_1839 227
640 3300041413 Ga0439465_0105633 Ga0439465_0105633_192_905 227
641 3300042001 Ga0439441_002145 Ga0439441_002145_850_1542 227
642 3300042131 Ga0450894_018754 Ga0450894_018754_187_900 227
643 3300042134 Ga0450898_018053 Ga0450898_018053_136_849 227
644 3300042138 Ga0450903_006682 Ga0450903_006682_225_938 227
645 3300042156 Ga0439446_0018832 Ga0439446_0018832_1021_1734 227
646 3300042157 Ga0439458_0048018 Ga0439458_0048018_62_775 227
647 3300042876 Ga0451577_0009017 Ga0451577_0009017_2486_3172 227
648 3300042876 Ga0451577_0013884 Ga0451577_0013884_127_813 227
649 3300042876 Ga0451577_0016732 Ga0451577_0016732_5887_6573 227
650 3300042876 Ga0451577_0090871 Ga0451577_0090871_577_1278 227
651 3300042876 Ga0451577_0100666 Ga0451577_0100666_1777_2466 227
652 3300042876 Ga0451577_0107586 Ga0451577_0107586_814_1500 227
653 3300042876 Ga0451577_0124940 Ga0451577_0124940_1483_2169 227
654 3300042876 Ga0451577_0322525 Ga0451577_0322525_358_1044 227
655 3300044673 Ga0453683_0000047 Ga0453683_0000047_14752_15453 227
656 3300044673 Ga0453683_0191373 Ga0453683_0191373_424_1122 227
657 3300044712 Ga0453684_0000142 Ga0453684_0000142_131619_132305 227
658 3300044712 Ga0453684_0000273 Ga0453684_0000273_207068_207769 227
659 3300044712 Ga0453684_0000302 Ga0453684_0000302_192311_193012 227
660 3300044712 Ga0453684_0000824 Ga0453684_0000824_44504_45190 227
661 3300044712 Ga0453684_0073846 Ga0453684_0073846_1055_1741 227
662 3300044712 Ga0453684_0079226 Ga0453684_0079226_712_1398 227
663 3300044712 Ga0453684_0125327 Ga0453684_0125327_1306_1992 227
664 3300044712 Ga0453684_0153511 Ga0453684_0153511_1768_2454 227
665 3300044712 Ga0453684_0311853 Ga0453684_0311853_414_1103 227
666 3300044712 Ga0453684_0354276 Ga0453684_0354276_907_1593 227
667 3300045051 Ga0451576_0000116 Ga0451576_0000116_14752_15453 227
668 3300045051 Ga0451576_0002526 Ga0451576_0002526_15086_15772 227
669 3300045051 Ga0451576_0003061 Ga0451576_0003061_4279_4989 227
670 3300045051 Ga0451576_0007349 Ga0451576_0007349_3994_4680 227
671 3300045051 Ga0451576_0016680 Ga0451576_0016680_3371_4057 227
672 3300045051 Ga0451576_0038933 Ga0451576_0038933_4290_5000 227
673 3300045051 Ga0451576_0085745 Ga0451576_0085745_1348_2034 227
674 3300046454 Ga0495592_0050866 Ga0495592_0050866_165_851 227
675 3300046499 Ga0495594_0276492 Ga0495594_0276492_73_759 227
676 3300046539 Ga0495621_0161513 Ga0495621_0161513_58_771 227
677 3300047318 Ga0495636_0004727 Ga0495636_0004727_1992_2678 227
678 3300048904 Ga0496101_0307120 Ga0496101_0307120_270_956 227
679 3300048905 Ga0496102_0059805 Ga0496102_0059805_760_1446 227
680 3300048907 Ga0496104_0301639 Ga0496104_0301639_275_961 227
681 3300048911 Ga0496108_0074421 Ga0496108_0074421_1012_1698 227
682 3300048912 Ga0496109_0245341 Ga0496109_0245341_170_856 227
683 3300048915 Ga0496112_0570229 Ga0496112_0570229_180_866 227
684 3300048917 Ga0496114_0150137 Ga0496114_0150137_192_878 227
685 3300048918 Ga0496115_0239715 Ga0496115_0239715_376_1062 227
686 3300049571 Ga0501034_0091131 Ga0501034_0091131_1072_1758 227
687 3300049572 Ga0501036_0012556 Ga0501036_0012556_2742_3428 227
688 3300049573 Ga0501037_0006366 Ga0501037_0006366_7854_8540 227
689 3300049573 Ga0501037_0621620 Ga0501037_0621620_16_702 227
690 3300049575 Ga0501039_0070875 Ga0501039_0070875_1510_2196 227
691 3300049575 Ga0501039_0757289 Ga0501039_0757289_54_740 227
692 3300049576 Ga0501040_0018176 Ga0501040_0018176_2055_2741 227
693 3300049578 Ga0501042_0069911 Ga0501042_0069911_1674_2360 227
694 3300049579 Ga0501043_0031623 Ga0501043_0031623_2972_3658 227
695 3300049580 Ga0501046_0078323 Ga0501046_0078323_209_895 227
696 3300049580 Ga0501046_0329113 Ga0501046_0329113_195_881 227
697 3300049581 Ga0501047_0077549 Ga0501047_0077549_1089_1775 227
698 3300049582 Ga0501048_0325792 Ga0501048_0325792_114_800 227
699 3300049587 Ga0501071_0028121 Ga0501071_0028121_1266_1952 227
700 3300049588 Ga0501072_0388418 Ga0501072_0388418_326_1012 227
701 3300049590 Ga0501074_0211837 Ga0501074_0211837_74_760 227
702 3300049591 Ga0501075_0019547 Ga0501075_0019547_2035_2721 227
703 3300049592 Ga0501076_0060466 Ga0501076_0060466_2089_2775 227
704 3300049593 Ga0501077_0125168 Ga0501077_0125168_731_1417 227
705 3300049741 Ga0501079_0005503 Ga0501079_0005503_970_1656 227
706 3300049742 Ga0501080_0045265 Ga0501080_0045265_875_1561 227
707 3300049742 Ga0501080_0635919 Ga0501080_0635919_40_726 227
708 3300049743 Ga0501081_0002454 Ga0501081_0002454_6435_7121 227
709 3300049823 Ga0501044_0000296 Ga0501044_0000296_6836_7522 227
710 3300049824 Ga0501045_0013001 Ga0501045_0013001_5043_5729 227
711 3300050493 nmdc:mga0k408_214977_c1 nmdc:mga0k408_214977_c1_179_871 227
712 3300050509 nmdc:mga0qj67_140435_c1 nmdc:mga0qj67_140435_c1_959_1645 227
713 3300050510 nmdc:mga06r32_120229_c1 nmdc:mga06r32_120229_c1_790_1476 227
714 3300050510 nmdc:mga06r32_450228_c1 nmdc:mga06r32_450228_c1_429_1115 227
715 3300050511 nmdc:mga08y16_207892_c1 nmdc:mga08y16_207892_c1_1237_1938 227
716 3300050511 nmdc:mga08y16_606081_c1 nmdc:mga08y16_606081_c1_250_936 227
717 3300050512 nmdc:mga0n895_41154_c1 nmdc:mga0n895_41154_c1_290_976 227
718 3300050513 nmdc:mga0rr50_4564_c1 nmdc:mga0rr50_4564_c1_7431_8117 227
719 3300053093 Ga0500651_0069870 Ga0500651_0069870_608_1336 227
720 3300053117 Ga0500593_001697 Ga0500593_001697_7098_7823 227
721 3300053730 Ga0500645_005497 Ga0500645_005497_2877_3602 227
722 3300054114 Ga0501084_0037790 Ga0501084_0037790_1847_2533 227
723 3300060353 Ga0501082_0004154 Ga0501082_0004154_1885_2571 227
724 3300005327 Ga0070658_10747942 Ga0070658_107479421 228
725 3300005328 Ga0070676_10001681 Ga0070676_100016819 228
726 3300005328 Ga0070676_10038307 Ga0070676_100383072 228
727 3300005330 Ga0070690_100135871 Ga0070690_1001358713 228
728 3300005331 Ga0070670_100010398 Ga0070670_1000103989 228
729 3300005331 Ga0070670_100215530 Ga0070670_1002155302 228
730 3300005334 Ga0068869_100015884 Ga0068869_1000158846 228
731 3300005335 Ga0070666_10001976 Ga0070666_100019769 228
732 3300005336 Ga0070680_100116647 Ga0070680_1001166472 228
733 3300005338 Ga0068868_100005877 Ga0068868_1000058777 228
734 3300005345 Ga0070692_10035932 Ga0070692_100359322 228
735 3300005347 Ga0070668_100003500 Ga0070668_1000035003 228
736 3300005347 Ga0070668_100024996 Ga0070668_1000249964 228
737 3300005347 Ga0070668_100049826 Ga0070668_1000498263 228
738 3300005347 Ga0070668_100313315 Ga0070668_1003133152 228
739 3300005353 Ga0070669_100042334 Ga0070669_1000423344 228
740 3300005353 Ga0070669_100061282 Ga0070669_1000612822 228
741 3300005353 Ga0070669_100431224 Ga0070669_1004312242 228
742 3300005354 Ga0070675_100094526 Ga0070675_1000945262 228
743 3300005354 Ga0070675_100220442 Ga0070675_1002204422 228
744 3300005356 Ga0070674_100421346 Ga0070674_1004213461 228
745 3300005364 Ga0070673_100010613 Ga0070673_1000106133 228
746 3300005364 Ga0070673_100060619 Ga0070673_1000606192 228
747 3300005364 Ga0070673_100218481 Ga0070673_1002184812 228
748 3300005364 Ga0070673_100238110 Ga0070673_1002381101 228
749 3300005365 Ga0070688_100196454 Ga0070688_1001964541 228
750 3300005367 Ga0070667_100013664 Ga0070667_1000136645 228
751 3300005367 Ga0070667_100321783 Ga0070667_1003217831 228
752 3300005436 Ga0070713_100000532 Ga0070713_1000005322 228
753 3300005438 Ga0070701_10030910 Ga0070701_100309101 228
754 3300005441 Ga0070700_100001947 Ga0070700_1000019473 228
755 3300005441 Ga0070700_100157892 Ga0070700_1001578922 228
756 3300005444 Ga0070694_100193692 Ga0070694_1001936921 228
757 3300005455 Ga0070663_100229371 Ga0070663_1002293712 228
758 3300005457 Ga0070662_100120049 Ga0070662_1001200492 228
759 3300005458 Ga0070681_10177737 Ga0070681_101777373 228
760 3300005459 Ga0068867_100002656 Ga0068867_1000026566 228
761 3300005459 Ga0068867_100004997 Ga0068867_1000049979 228
762 3300005467 Ga0070706_100087840 Ga0070706_1000878404 228
763 3300005467 Ga0070706_100280087 Ga0070706_1002800872 228
764 3300005468 Ga0070707_100018971 Ga0070707_1000189714 228
765 3300005468 Ga0070707_100062471 Ga0070707_1000624712 228
766 3300005471 Ga0070698_100017560 Ga0070698_1000175608 228
767 3300005471 Ga0070698_100103715 Ga0070698_1001037151 228
768 3300005536 Ga0070697_100068938 Ga0070697_1000689382 228
769 3300005543 Ga0070672_100086478 Ga0070672_1000864782 228
770 3300005546 Ga0070696_100451715 Ga0070696_1004517152 228
771 3300005548 Ga0070665_100039880 Ga0070665_1000398802 228
772 3300005548 Ga0070665_100321841 Ga0070665_1003218411 228
773 3300005563 Ga0068855_100052505 Ga0068855_1000525053 228
774 3300005577 Ga0068857_100051126 Ga0068857_1000511262 228
775 3300005578 Ga0068854_100530079 Ga0068854_1005300792 228
776 3300005617 Ga0068859_100006668 Ga0068859_1000066689 228
777 3300005617 Ga0068859_100058396 Ga0068859_1000583966 228
778 3300005618 Ga0068864_100003851 Ga0068864_10000385111 228
779 3300005618 Ga0068864_100021943 Ga0068864_1000219436 228
780 3300005718 Ga0068866_10199630 Ga0068866_101996301 228
781 3300005719 Ga0068861_100013530 Ga0068861_1000135306 228
782 3300005719 Ga0068861_100019979 Ga0068861_1000199794 228
783 3300005719 Ga0068861_100104490 Ga0068861_1001044902 228
784 3300005719 Ga0068861_100280783 Ga0068861_1002807832 228
785 3300005719 Ga0068861_100646928 Ga0068861_1006469281 228
786 3300005834 Ga0068851_10246979 Ga0068851_102469792 228
787 3300005840 Ga0068870_10190887 Ga0068870_101908871 228
788 3300005841 Ga0068863_100004310 Ga0068863_1000043105 228
789 3300005841 Ga0068863_100015125 Ga0068863_1000151256 228
790 3300005841 Ga0068863_100043595 Ga0068863_1000435952 228
791 3300005842 Ga0068858_100009823 Ga0068858_1000098237 228
792 3300005842 Ga0068858_100021681 Ga0068858_1000216816 228
793 3300005842 Ga0068858_100347164 Ga0068858_1003471641 228
794 3300005843 Ga0068860_100052282 Ga0068860_1000522823 228
795 3300005843 Ga0068860_100072265 Ga0068860_1000722652 228
796 3300005843 Ga0068860_100964236 Ga0068860_1009642361 228
797 3300005844 Ga0068862_100955642 Ga0068862_1009556422 228
798 3300006058 Ga0075432_10004664 Ga0075432_100046642 228
799 3300006173 Ga0070716_100022295 Ga0070716_1000222952 228
800 3300006175 Ga0070712_100145017 Ga0070712_1001450172 228
801 3300006177 Ga0075362_10077635 Ga0075362_100776352 228
802 3300006186 Ga0075369_10032064 Ga0075369_100320642 228
803 3300006195 Ga0075366_10001330 Ga0075366_100013309 228
804 3300006353 Ga0075370_10238179 Ga0075370_102381791 228
805 3300006358 Ga0068871_100002481 Ga0068871_1000024819 228
806 3300006847 Ga0075431_100526472 Ga0075431_1005264722 228
807 3300006871 Ga0075434_100070328 Ga0075434_1000703283 228
808 3300006880 Ga0075429_100003291 Ga0075429_1000032917 228
809 3300006881 Ga0068865_100001401 Ga0068865_1000014013 228
810 3300006931 Ga0097620_100006668 Ga0097620_1000066689 228
811 3300006931 Ga0097620_100058390 Ga0097620_1000583906 228
812 3300009094 Ga0111539_10092043 Ga0111539_100920433 228
813 3300009147 Ga0114129_10233201 Ga0114129_102332014 228
814 3300009148 Ga0105243_10150297 Ga0105243_101502972 228
815 3300009174 Ga0105241_10358565 Ga0105241_103585652 228
816 3300009177 Ga0105248_10067835 Ga0105248_100678352 228
817 3300009177 Ga0105248_10957160 Ga0105248_109571602 228
818 3300009553 Ga0105249_10042317 Ga0105249_100423173 228
819 3300009553 Ga0105249_10797171 Ga0105249_107971712 228
820 3300013296 Ga0157374_10006109 Ga0157374_100061092 228
821 3300013297 Ga0157378_10727104 Ga0157378_107271042 228
822 3300013306 Ga0163162_10009853 Ga0163162_100098533 228
823 3300013306 Ga0163162_10461924 Ga0163162_104619242 228
824 3300013308 Ga0157375_10005150 Ga0157375_100051509 228
825 3300014325 Ga0163163_10002324 Ga0163163_100023242 228
826 3300014326 Ga0157380_10190606 Ga0157380_101906063 228
827 3300014326 Ga0157380_10319419 Ga0157380_103194191 228
828 3300014968 Ga0157379_10004048 Ga0157379_100040486 228
829 3300014968 Ga0157379_10017536 Ga0157379_100175365 228
830 3300014968 Ga0157379_10300011 Ga0157379_103000111 228
831 3300014969 Ga0157376_10002530 Ga0157376_100025307 228
832 3300021361 Ga0213872_10001609 Ga0213872_100016096 228
833 3300021361 Ga0213872_10015725 Ga0213872_100157253 228
834 3300025315 Ga0207697_10004124 Ga0207697_100041242 228
835 3300025321 Ga0207656_10268088 Ga0207656_102680882 228
836 3300025903 Ga0207680_10170667 Ga0207680_101706672 228
837 3300025907 Ga0207645_10184314 Ga0207645_101843142 228
838 3300025910 Ga0207684_10025596 Ga0207684_100255962 228
839 3300025910 Ga0207684_10181954 Ga0207684_101819542 228
840 3300025910 Ga0207684_10216646 Ga0207684_102166462 228
841 3300025915 Ga0207693_10202853 Ga0207693_102028532 228
842 3300025922 Ga0207646_10009033 Ga0207646_100090332 228
843 3300025922 Ga0207646_10078082 Ga0207646_100780822 228
844 3300025923 Ga0207681_10020261 Ga0207681_100202616 228
845 3300025923 Ga0207681_10056719 Ga0207681_100567194 228
846 3300025924 Ga0207694_10586828 Ga0207694_105868281 228
847 3300025925 Ga0207650_10006529 Ga0207650_100065292 228
848 3300025925 Ga0207650_10172762 Ga0207650_101727623 228
849 3300025926 Ga0207659_10002677 Ga0207659_100026777 228
850 3300025926 Ga0207659_10496543 Ga0207659_104965433 228
851 3300025928 Ga0207700_10000077 Ga0207700_1000007726 228
852 3300025931 Ga0207644_10055222 Ga0207644_100552224 228
853 3300025932 Ga0207690_10153199 Ga0207690_101531992 228
854 3300025933 Ga0207706_10250794 Ga0207706_102507942 228
855 3300025933 Ga0207706_10301994 Ga0207706_103019942 228
856 3300025936 Ga0207670_10165960 Ga0207670_101659603 228
857 3300025937 Ga0207669_10010350 Ga0207669_100103502 228
858 3300025937 Ga0207669_10061342 Ga0207669_100613422 228
859 3300025939 Ga0207665_10024936 Ga0207665_100249364 228
860 3300025940 Ga0207691_10004096 Ga0207691_1000409610 228
861 3300025940 Ga0207691_10094079 Ga0207691_100940793 228
862 3300025941 Ga0207711_10658792 Ga0207711_106587922 228
863 3300025942 Ga0207689_10014017 Ga0207689_100140177 228
864 3300025942 Ga0207689_10038699 Ga0207689_100386992 228
865 3300025949 Ga0207667_10058592 Ga0207667_100585926 228
866 3300025960 Ga0207651_10178143 Ga0207651_101781432 228
867 3300025960 Ga0207651_10249472 Ga0207651_102494722 228
868 3300025960 Ga0207651_10593640 Ga0207651_105936402 228
869 3300025961 Ga0207712_10114258 Ga0207712_101142582 228
870 3300025972 Ga0207668_10001885 Ga0207668_1000188510 228
871 3300025972 Ga0207668_10025016 Ga0207668_100250162 228
872 3300025972 Ga0207668_10076679 Ga0207668_100766792 228
873 3300025972 Ga0207668_10237220 Ga0207668_102372202 228
874 3300026023 Ga0207677_10067318 Ga0207677_100673182 228
875 3300026023 Ga0207677_10162015 Ga0207677_101620152 228
876 3300026035 Ga0207703_10007013 Ga0207703_100070137 228
877 3300026035 Ga0207703_10017617 Ga0207703_100176175 228
878 3300026035 Ga0207703_10305629 Ga0207703_103056291 228
879 3300026067 Ga0207678_10135949 Ga0207678_101359492 228
880 3300026075 Ga0207708_10006027 Ga0207708_100060278 228
881 3300026088 Ga0207641_10008349 Ga0207641_100083497 228
882 3300026088 Ga0207641_10204086 Ga0207641_102040864 228
883 3300026088 Ga0207641_10295625 Ga0207641_102956252 228
884 3300026089 Ga0207648_10005773 Ga0207648_100057739 228
885 3300026089 Ga0207648_10022506 Ga0207648_100225066 228
886 3300026095 Ga0207676_10070810 Ga0207676_100708104 228
887 3300026095 Ga0207676_10676971 Ga0207676_106769711 228
888 3300026116 Ga0207674_10037012 Ga0207674_100370123 228
889 3300026116 Ga0207674_10153170 Ga0207674_101531701 228
890 3300026118 Ga0207675_100007435 Ga0207675_1000074356 228
891 3300026118 Ga0207675_100026990 Ga0207675_1000269902 228
892 3300026118 Ga0207675_100180097 Ga0207675_1001800972 228
893 3300026121 Ga0207683_10002496 Ga0207683_100024967 228
894 3300026121 Ga0207683_10855872 Ga0207683_108558721 228
895 3300028379 Ga0268266_10006814 Ga0268266_100068146 228
896 3300028379 Ga0268266_10154846 Ga0268266_101548462 228
897 3300028380 Ga0268265_10492924 Ga0268265_104929242 228
898 3300028380 Ga0268265_10925262 Ga0268265_109252621 228
899 3300028381 Ga0268264_10014386 Ga0268264_100143862 228
900 3300028381 Ga0268264_10030230 Ga0268264_100302306 228
901 3300028381 Ga0268264_10211330 Ga0268264_102113303 228
902 3300028794 Ga0307515_10241879 Ga0307515_102418792 228
903 3300030521 Ga0307511_10003377 Ga0307511_1000337711 228
904 3300031251 Ga0265327_10076675 Ga0265327_100766752 228
905 3300031911 Ga0307412_10473682 Ga0307412_104736822 228
906 3300031995 Ga0307409_100083962 Ga0307409_1000839622 228
907 3300032005 Ga0307411_10102283 Ga0307411_101022833 228
908 3300032133 Ga0316583_10003098 Ga0316583_100030983 228
909 3300035085 Ga0373929_0038559 Ga0373929_0038559_108_797 228
910 3300035119 Ga0373956_0222981 Ga0373956_0222981_128_817 228
911 3300035691 Ga0373931_0069973 Ga0373931_0069973_895_1620 228
912 3300036401 Ga0373937_0347979 Ga0373937_0347979_462_1151 228
913 3300039447 Ga0436361_0180590 Ga0436361_0180590_47_736 228
914 3300039447 Ga0436361_0461322 Ga0436361_0461322_10467_11156 228
915 3300039447 Ga0436361_0728592 Ga0436361_0728592_1089_1778 228
916 3300042134 Ga0450898_015685 Ga0450898_015685_227_922 228
917 3300044656 Ga0466969_0017083 Ga0466969_0017083_837_1526 228
918 3300044693 Ga0466961_0000089 Ga0466961_0000089_36558_37247 228
919 3300044735 Ga0466968_0155058 Ga0466968_0155058_153_842 228
920 3300045049 Ga0466959_0005425 Ga0466959_0005425_7054_7743 228
921 3300045049 Ga0466959_0133682 Ga0466959_0133682_1033_1722 228
922 3300046472 Ga0495580_0029927 Ga0495580_0029927_1867_2556 228
923 3300046530 Ga0495654_0008110 Ga0495654_0008110_2383_3117 228
924 3300048905 Ga0496102_0121117 Ga0496102_0121117_1130_1819 228
925 3300048906 Ga0496103_0092767 Ga0496103_0092767_964_1653 228
926 3300048909 Ga0496106_0079172 Ga0496106_0079172_1162_1851 228
927 3300048911 Ga0496108_0098157 Ga0496108_0098157_740_1429 228
928 3300048911 Ga0496108_0146450 Ga0496108_0146450_1098_1790 228
929 3300048912 Ga0496109_0028392 Ga0496109_0028392_1294_1983 228
930 3300048913 Ga0496110_0195719 Ga0496110_0195719_1050_1739 228
931 3300048914 Ga0496111_0264235 Ga0496111_0264235_394_1086 228
932 3300048915 Ga0496112_0006737 Ga0496112_0006737_2999_3691 228
933 3300048916 Ga0496113_0611561 Ga0496113_0611561_146_838 228
934 3300049568 Ga0501031_0064783 Ga0501031_0064783_1335_2039 228
935 3300049589 Ga0501073_0064234 Ga0501073_0064234_1379_2086 228
936 3300049589 Ga0501073_0641690 Ga0501073_0641690_18_707 228
937 3300049590 Ga0501074_0371112 Ga0501074_0371112_66_773 228
938 3300049742 Ga0501080_0094714 Ga0501080_0094714_1048_1755 228
939 3300050489 nmdc:mga03683_50006_c1 nmdc:mga03683_50006_c1_228_929 228
940 3300050491 nmdc:mga00v17_101134_c1 nmdc:mga00v17_101134_c1_781_1485 228
941 3300050493 nmdc:mga0k408_2565_c1 nmdc:mga0k408_2565_c1_8548_9273 228
942 3300050496 nmdc:mga07m45_398724_c1 nmdc:mga07m45_398724_c1_27_731 228
943 3300050508 nmdc:mga09592_4718_c1 nmdc:mga09592_4718_c1_3686_4375 228
944 3300050510 nmdc:mga06r32_488220_c1 nmdc:mga06r32_488220_c1_131_820 228
945 3300050511 nmdc:mga08y16_28220_c1 nmdc:mga08y16_28220_c1_3583_4272 228
946 3300050516 nmdc:mga0sz30_5461_c1 nmdc:mga0sz30_5461_c1_3048_3809 228
947 3300053092 Ga0500583_0054654 Ga0500583_0054654_124_828 228
948 3300053098 Ga0500650_0084413 Ga0500650_0084413_559_1251 228
949 3300053125 Ga0500618_007818 Ga0500618_007818_127_867 228
950 3300053130 Ga0500642_0155727 Ga0500642_0155727_40_744 228
951 3300053133 Ga0500655_013618 Ga0500655_013618_58_762 228
952 3300053139 Ga0500568_0012958 Ga0500568_0012958_1389_2102 228
953 3300053139 Ga0500568_0030240 Ga0500568_0030240_589_1293 228
954 3300053151 Ga0500604_0000266 Ga0500604_0000266_13005_13709 228
955 3300053161 Ga0500634_0030385 Ga0500634_0030385_685_1374 228
956 3300005331 Ga0070670_100066298 Ga0070670_1000662982 229
957 3300005331 Ga0070670_100520714 Ga0070670_1005207142 229
958 3300005335 Ga0070666_10012256 Ga0070666_100122562 229
959 3300005335 Ga0070666_10146578 Ga0070666_101465782 229
960 3300005338 Ga0068868_100023457 Ga0068868_1000234573 229
961 3300005338 Ga0068868_100070443 Ga0068868_1000704432 229
962 3300005339 Ga0070660_100334072 Ga0070660_1003340722 229
963 3300005340 Ga0070689_100516342 Ga0070689_1005163421 229
964 3300005355 Ga0070671_100044775 Ga0070671_1000447753 229
965 3300005356 Ga0070674_100014905 Ga0070674_1000149053 229
966 3300005365 Ga0070688_100007351 Ga0070688_1000073518 229
967 3300005366 Ga0070659_100014799 Ga0070659_1000147995 229
968 3300005367 Ga0070667_100037902 Ga0070667_1000379023 229
969 3300005367 Ga0070667_100199454 Ga0070667_1001994542 229
970 3300005434 Ga0070709_10043427 Ga0070709_100434272 229
971 3300005435 Ga0070714_100015258 Ga0070714_1000152582 229
972 3300005436 Ga0070713_100015624 Ga0070713_1000156243 229
973 3300005436 Ga0070713_100021655 Ga0070713_1000216552 229
974 3300005438 Ga0070701_10149864 Ga0070701_101498642 229
975 3300005439 Ga0070711_100010786 Ga0070711_1000107864 229
976 3300005439 Ga0070711_100249430 Ga0070711_1002494302 229
977 3300005439 Ga0070711_100734650 Ga0070711_1007346501 229
978 3300005440 Ga0070705_100006646 Ga0070705_1000066465 229
979 3300005440 Ga0070705_100297485 Ga0070705_1002974851 229
980 3300005444 Ga0070694_100034731 Ga0070694_1000347315 229
981 3300005445 Ga0070708_100127807 Ga0070708_1001278071 229
982 3300005455 Ga0070663_100292739 Ga0070663_1002927392 229
983 3300005456 Ga0070678_100005373 Ga0070678_1000053735 229
984 3300005457 Ga0070662_100042912 Ga0070662_1000429122 229
985 3300005459 Ga0068867_100092347 Ga0068867_1000923473 229
986 3300005466 Ga0070685_10000757 Ga0070685_1000075718 229
987 3300005467 Ga0070706_100032692 Ga0070706_1000326923 229
988 3300005468 Ga0070707_100009718 Ga0070707_1000097184 229
989 3300005471 Ga0070698_100262156 Ga0070698_1002621562 229
990 3300005518 Ga0070699_100149670 Ga0070699_1001496702 229
991 3300005530 Ga0070679_100062237 Ga0070679_1000622373 229
992 3300005535 Ga0070684_100588050 Ga0070684_1005880502 229
993 3300005536 Ga0070697_100079450 Ga0070697_1000794502 229
994 3300005539 Ga0068853_100121727 Ga0068853_1001217272 229
995 3300005539 Ga0068853_100821306 Ga0068853_1008213061 229
996 3300005544 Ga0070686_100017705 Ga0070686_1000177052 229
997 3300005545 Ga0070695_100246441 Ga0070695_1002464412 229
998 3300005545 Ga0070695_100353331 Ga0070695_1003533312 229
999 3300005546 Ga0070696_100008925 Ga0070696_1000089254 229
1000 3300005546 Ga0070696_100037988 Ga0070696_1000379882 229
1001 3300005546 Ga0070696_100414815 Ga0070696_1004148152 229
1002 3300005547 Ga0070693_100003520 Ga0070693_1000035204 229
1003 3300005549 Ga0070704_100038893 Ga0070704_1000388933 229
1004 3300005563 Ga0068855_100683773 Ga0068855_1006837731 229
1005 3300005578 Ga0068854_100010139 Ga0068854_1000101394 229
1006 3300005614 Ga0068856_100064342 Ga0068856_1000643422 229
1007 3300005615 Ga0070702_100017659 Ga0070702_1000176593 229
1008 3300005615 Ga0070702_100095730 Ga0070702_1000957303 229
1009 3300005616 Ga0068852_100035275 Ga0068852_1000352754 229
1010 3300005617 Ga0068859_100020089 Ga0068859_1000200895 229
1011 3300005618 Ga0068864_100018479 Ga0068864_1000184793 229
1012 3300005618 Ga0068864_100069752 Ga0068864_1000697522 229
1013 3300005718 Ga0068866_10073302 Ga0068866_100733022 229
1014 3300005834 Ga0068851_10031457 Ga0068851_100314573 229
1015 3300005842 Ga0068858_100085995 Ga0068858_1000859952 229
1016 3300005843 Ga0068860_100047745 Ga0068860_1000477453 229
1017 3300005843 Ga0068860_100180597 Ga0068860_1001805973 229
1018 3300005843 Ga0068860_100302283 Ga0068860_1003022832 229
1019 3300006163 Ga0070715_10004690 Ga0070715_100046905 229
1020 3300006173 Ga0070716_100062376 Ga0070716_1000623762 229
1021 3300006175 Ga0070712_100004028 Ga0070712_1000040282 229
1022 3300006237 Ga0097621_100246439 Ga0097621_1002464392 229
1023 3300006358 Ga0068871_100149719 Ga0068871_1001497193 229
1024 3300006844 Ga0075428_100001468 Ga0075428_10000146823 229
1025 3300006852 Ga0075433_10000871 Ga0075433_1000087114 229
1026 3300006852 Ga0075433_10534841 Ga0075433_105348412 229
1027 3300006871 Ga0075434_100000018 Ga0075434_1000000189 229
1028 3300006880 Ga0075429_100000889 Ga0075429_10000088913 229
1029 3300006914 Ga0075436_100003281 Ga0075436_1000032815 229
1030 3300006914 Ga0075436_100116995 Ga0075436_1001169952 229
1031 3300006914 Ga0075436_100122689 Ga0075436_1001226892 229
1032 3300006914 Ga0075436_100138160 Ga0075436_1001381602 229
1033 3300006931 Ga0097620_100020089 Ga0097620_1000200895 229
1034 3300007076 Ga0075435_100000388 Ga0075435_10000038826 229
1035 3300007788 Ga0099795_10149391 Ga0099795_101493911 229
1036 3300009093 Ga0105240_10173430 Ga0105240_101734302 229
1037 3300009094 Ga0111539_10122610 Ga0111539_101226102 229
1038 3300009094 Ga0111539_10806671 Ga0111539_108066711 229
1039 3300009098 Ga0105245_10044022 Ga0105245_100440223 229
1040 3300009098 Ga0105245_10044546 Ga0105245_100445463 229
1041 3300009101 Ga0105247_10041596 Ga0105247_100415964 229
1042 3300009147 Ga0114129_10000210 Ga0114129_1000021058 229
1043 3300009174 Ga0105241_10050855 Ga0105241_100508553 229
1044 3300009174 Ga0105241_10051776 Ga0105241_100517762 229
1045 3300009176 Ga0105242_10019762 Ga0105242_100197623 229
1046 3300009545 Ga0105237_10050960 Ga0105237_100509602 229
1047 3300009551 Ga0105238_10080283 Ga0105238_100802833 229
1048 3300010375 Ga0105239_11075465 Ga0105239_110754651 229
1049 3300011119 Ga0105246_10011859 Ga0105246_100118595 229
1050 3300011119 Ga0105246_10123489 Ga0105246_101234892 229
1051 3300013100 Ga0157373_10133706 Ga0157373_101337062 229
1052 3300013102 Ga0157371_10565771 Ga0157371_105657711 229
1053 3300013104 Ga0157370_10058227 Ga0157370_100582272 229
1054 3300013296 Ga0157374_10004613 Ga0157374_100046134 229
1055 3300013297 Ga0157378_10172565 Ga0157378_101725653 229
1056 3300013297 Ga0157378_10357118 Ga0157378_103571182 229
1057 3300013306 Ga0163162_10059521 Ga0163162_100595213 229
1058 3300013307 Ga0157372_10746479 Ga0157372_107464792 229
1059 3300013308 Ga0157375_10020148 Ga0157375_100201484 229
1060 3300014745 Ga0157377_10159371 Ga0157377_101593712 229
1061 3300014968 Ga0157379_10010030 Ga0157379_100100304 229
1062 3300014969 Ga0157376_10110755 Ga0157376_101107552 229
1063 3300014969 Ga0157376_10180138 Ga0157376_101801383 229
1064 3300025321 Ga0207656_10037508 Ga0207656_100375082 229
1065 3300025899 Ga0207642_10036870 Ga0207642_100368703 229
1066 3300025903 Ga0207680_10036014 Ga0207680_100360142 229
1067 3300025903 Ga0207680_10057463 Ga0207680_100574632 229
1068 3300025907 Ga0207645_10054366 Ga0207645_100543663 229
1069 3300025911 Ga0207654_10134928 Ga0207654_101349282 229
1070 3300025912 Ga0207707_10032338 Ga0207707_100323382 229
1071 3300025912 Ga0207707_10033200 Ga0207707_100332002 229
1072 3300025913 Ga0207695_10067015 Ga0207695_100670152 229
1073 3300025914 Ga0207671_10071784 Ga0207671_100717842 229
1074 3300025915 Ga0207693_10003531 Ga0207693_100035317 229
1075 3300025916 Ga0207663_10032209 Ga0207663_100322094 229
1076 3300025918 Ga0207662_10010427 Ga0207662_100104274 229
1077 3300025919 Ga0207657_10012356 Ga0207657_100123568 229
1078 3300025922 Ga0207646_10301237 Ga0207646_103012371 229
1079 3300025927 Ga0207687_10008163 Ga0207687_100081636 229
1080 3300025927 Ga0207687_10037040 Ga0207687_100370403 229
1081 3300025927 Ga0207687_10089219 Ga0207687_100892192 229
1082 3300025928 Ga0207700_10015267 Ga0207700_100152674 229
1083 3300025928 Ga0207700_10049118 Ga0207700_100491182 229
1084 3300025929 Ga0207664_10008388 Ga0207664_100083883 229
1085 3300025931 Ga0207644_10016789 Ga0207644_100167893 229
1086 3300025933 Ga0207706_10002930 Ga0207706_1000293014 229
1087 3300025933 Ga0207706_10059021 Ga0207706_100590212 229
1088 3300025934 Ga0207686_10001096 Ga0207686_100010969 229
1089 3300025938 Ga0207704_10128677 Ga0207704_101286773 229
1090 3300025939 Ga0207665_10015112 Ga0207665_100151125 229
1091 3300025939 Ga0207665_10086143 Ga0207665_100861432 229
1092 3300025941 Ga0207711_10000688 Ga0207711_100006888 229
1093 3300025941 Ga0207711_10617365 Ga0207711_106173652 229
1094 3300025942 Ga0207689_10029095 Ga0207689_100290953 229
1095 3300025945 Ga0207679_10239651 Ga0207679_102396512 229
1096 3300025960 Ga0207651_10086390 Ga0207651_100863902 229
1097 3300026023 Ga0207677_10000775 Ga0207677_1000077518 229
1098 3300026023 Ga0207677_10209548 Ga0207677_102095482 229
1099 3300026035 Ga0207703_10004520 Ga0207703_1000452011 229
1100 3300026067 Ga0207678_10128401 Ga0207678_101284012 229
1101 3300026088 Ga0207641_10002392 Ga0207641_1000239218 229
1102 3300026089 Ga0207648_10062316 Ga0207648_100623163 229
1103 3300026095 Ga0207676_10001352 Ga0207676_1000135218 229
1104 3300026116 Ga0207674_10004526 Ga0207674_1000452614 229
1105 3300026121 Ga0207683_10006508 Ga0207683_100065086 229
1106 3300026142 Ga0207698_10033741 Ga0207698_100337413 229
1107 3300026142 Ga0207698_10051925 Ga0207698_100519253 229
1108 3300027671 Ga0209588_1021082 Ga0209588_10210822 229
1109 3300027907 Ga0207428_10038564 Ga0207428_100385643 229
1110 3300028381 Ga0268264_10041101 Ga0268264_100411013 229
1111 3300028381 Ga0268264_10238297 Ga0268264_102382972 229
1112 3300028381 Ga0268264_10273312 Ga0268264_102733123 229
1113 3300031238 Ga0265332_10000026 Ga0265332_10000026117 229
1114 3300031507 Ga0307509_10000032 Ga0307509_100000325 229
1115 3300031665 Ga0316575_10135516 Ga0316575_101355161 229
1116 3300034817 Ga0373948_0008529 Ga0373948_0008529_267_959 229
1117 3300034819 Ga0373958_0021374 Ga0373958_0021374_149_841 229
1118 3300034820 Ga0373959_0020677 Ga0373959_0020677_25_717 229
1119 3300035083 Ga0373926_0009025 Ga0373926_0009025_2320_3012 229
1120 3300035084 Ga0373928_0058650 Ga0373928_0058650_46_738 229
1121 3300035086 Ga0373934_0004837 Ga0373934_0004837_1603_2310 229
1122 3300035088 Ga0373940_0005594 Ga0373940_0005594_357_1049 229
1123 3300035090 Ga0373949_0004416 Ga0373949_0004416_2109_2801 229
1124 3300035111 Ga0373923_0002018 Ga0373923_0002018_2153_2845 229
1125 3300035112 Ga0373932_0011119 Ga0373932_0011119_346_1038 229
1126 3300035113 Ga0373936_0001453 Ga0373936_0001453_1094_1786 229
1127 3300035113 Ga0373936_0010226 Ga0373936_0010226_2155_2847 229
1128 3300035116 Ga0373945_0036473 Ga0373945_0036473_696_1388 229
1129 3300035116 Ga0373945_0137949 Ga0373945_0137949_95_802 229
1130 3300035117 Ga0373953_0000903 Ga0373953_0000903_210_902 229
1131 3300035117 Ga0373953_0025925 Ga0373953_0025925_1069_1776 229
1132 3300035118 Ga0373954_0005584 Ga0373954_0005584_346_1038 229
1133 3300035118 Ga0373954_0005824 Ga0373954_0005824_3603_4310 229
1134 3300035119 Ga0373956_0004475 Ga0373956_0004475_2452_3144 229
1135 3300035119 Ga0373956_0007480 Ga0373956_0007480_1550_2257 229
1136 3300035120 Ga0373957_0002023 Ga0373957_0002023_2528_3220 229
1137 3300035120 Ga0373957_0048223 Ga0373957_0048223_573_1280 229
1138 3300035121 Ga0373960_0006621 Ga0373960_0006621_521_1213 229
1139 3300035170 Ga0373943_0019792 Ga0373943_0019792_1539_2231 229
1140 3300035170 Ga0373943_0103010 Ga0373943_0103010_103_810 229
1141 3300035171 Ga0373946_0011080 Ga0373946_0011080_1532_2239 229
1142 3300035171 Ga0373946_0018878 Ga0373946_0018878_1609_2301 229
1143 3300035171 Ga0373946_0020782 Ga0373946_0020782_1753_2445 229
1144 3300035171 Ga0373946_0041308 Ga0373946_0041308_195_902 229
1145 3300035171 Ga0373946_0234383 Ga0373946_0234383_53_763 229
1146 3300035172 Ga0373955_0013227 Ga0373955_0013227_1811_2518 229
1147 3300035172 Ga0373955_0171956 Ga0373955_0171956_110_802 229
1148 3300035241 Ga0373961_0012522 Ga0373961_0012522_171_863 229
1149 3300035242 Ga0373962_0017639 Ga0373962_0017639_101_793 229
1150 3300035410 Ga0373924_0007221 Ga0373924_0007221_1018_1710 229
1151 3300035410 Ga0373924_0153155 Ga0373924_0153155_174_866 229
1152 3300035410 Ga0373924_0237255 Ga0373924_0237255_38_748 229
1153 3300035691 Ga0373931_0002886 Ga0373931_0002886_4055_4747 229
1154 3300035691 Ga0373931_0174908 Ga0373931_0174908_468_1175 229
1155 3300035691 Ga0373931_0412391 Ga0373931_0412391_152_844 229
1156 3300035692 Ga0373935_0046917 Ga0373935_0046917_626_1336 229
1157 3300035692 Ga0373935_0070021 Ga0373935_0070021_707_1399 229
1158 3300035695 Ga0373927_0032778 Ga0373927_0032778_2618_3325 229
1159 3300035724 Ga0373933_0009336 Ga0373933_0009336_1724_2416 229
1160 3300035724 Ga0373933_0094003 Ga0373933_0094003_1126_1833 229
1161 3300036401 Ga0373937_0161364 Ga0373937_0161364_268_975 229
1162 3300036401 Ga0373937_0246019 Ga0373937_0246019_427_1119 229
1163 3300037068 Ga0373925_0066661 Ga0373925_0066661_1835_2545 229
1164 3300037068 Ga0373925_0125509 Ga0373925_0125509_1175_1867 229
1165 3300042876 Ga0451577_0001121 Ga0451577_0001121_10671_11363 229
1166 3300042876 Ga0451577_0014840 Ga0451577_0014840_3342_4034 229
1167 3300042876 Ga0451577_0154576 Ga0451577_0154576_638_1330 229
1168 3300042876 Ga0451577_0373441 Ga0451577_0373441_296_988 229
1169 3300044712 Ga0453684_0000014 Ga0453684_0000014_200553_201245 229
1170 3300044712 Ga0453684_0000384 Ga0453684_0000384_36650_37342 229
1171 3300044712 Ga0453684_0005850 Ga0453684_0005850_1747_2439 229
1172 3300044712 Ga0453684_0621111 Ga0453684_0621111_219_911 229
1173 3300045051 Ga0451576_0001489 Ga0451576_0001489_10694_11386 229
1174 3300045051 Ga0451576_0001917 Ga0451576_0001917_17352_18044 229
1175 3300045051 Ga0451576_0026585 Ga0451576_0026585_816_1508 229
1176 3300046454 Ga0495592_0038863 Ga0495592_0038863_1845_2537 229
1177 3300046455 Ga0495603_0101929 Ga0495603_0101929_229_936 229
1178 3300046459 Ga0495629_0040760 Ga0495629_0040760_1621_2328 229
1179 3300046461 Ga0495641_0019394 Ga0495641_0019394_479_1171 229
1180 3300046462 Ga0495651_0062133 Ga0495651_0062133_444_1136 229
1181 3300046462 Ga0495651_0133499 Ga0495651_0133499_727_1434 229
1182 3300046463 Ga0495653_0003974 Ga0495653_0003974_2385_3077 229
1183 3300046472 Ga0495580_0006337 Ga0495580_0006337_533_1315 229
1184 3300046472 Ga0495580_0010515 Ga0495580_0010515_4089_4781 229
1185 3300046472 Ga0495580_0032194 Ga0495580_0032194_1566_2273 229
1186 3300046473 Ga0495582_0028356 Ga0495582_0028356_2173_2880 229
1187 3300046475 Ga0495639_0006486 Ga0495639_0006486_3108_3890 229
1188 3300046475 Ga0495639_0010935 Ga0495639_0010935_1689_2396 229
1189 3300046476 Ga0495662_0010730 Ga0495662_0010730_190_882 229
1190 3300046476 Ga0495662_0014755 Ga0495662_0014755_857_1564 229
1191 3300046477 Ga0495664_0303661 Ga0495664_0303661_119_826 229
1192 3300046499 Ga0495594_0064404 Ga0495594_0064404_1139_1846 229
1193 3300046499 Ga0495594_0106773 Ga0495594_0106773_658_1350 229
1194 3300046511 Ga0495608_0033940 Ga0495608_0033940_97_789 229
1195 3300046514 Ga0495618_0017788 Ga0495618_0017788_2434_3126 229
1196 3300046516 Ga0495628_0010395 Ga0495628_0010395_480_1172 229
1197 3300046517 Ga0495630_0001438 Ga0495630_0001438_4105_4797 229
1198 3300046517 Ga0495630_0097034 Ga0495630_0097034_672_1379 229
1199 3300046517 Ga0495630_0338875 Ga0495630_0338875_73_855 229
1200 3300046526 Ga0495666_0004083 Ga0495666_0004083_3189_3881 229
1201 3300046526 Ga0495666_0209026 Ga0495666_0209026_162_854 229
1202 3300046529 Ga0495652_0064181 Ga0495652_0064181_765_1457 229
1203 3300046529 Ga0495652_0095264 Ga0495652_0095264_1040_1747 229
1204 3300046531 Ga0495665_0010248 Ga0495665_0010248_2220_2927 229
1205 3300046531 Ga0495665_0103460 Ga0495665_0103460_437_1219 229
1206 3300046533 Ga0495640_0003286 Ga0495640_0003286_4921_5613 229
1207 3300046535 Ga0495586_0011555 Ga0495586_0011555_3389_4081 229
1208 3300046535 Ga0495586_0076877 Ga0495586_0076877_800_1582 229
1209 3300046536 Ga0495587_0004752 Ga0495587_0004752_5689_6381 229
1210 3300046537 Ga0495598_0002132 Ga0495598_0002132_257_949 229
1211 3300046539 Ga0495621_0055528 Ga0495621_0055528_328_1035 229
1212 3300046543 Ga0495645_0053649 Ga0495645_0053649_1627_2319 229
1213 3300046559 Ga0495667_0029969 Ga0495667_0029969_1348_2040 229
1214 3300046615 Ga0495656_0044338 Ga0495656_0044338_1090_1782 229
1215 3300046642 Ga0495634_0014214 Ga0495634_0014214_616_1308 229
1216 3300046642 Ga0495634_0138371 Ga0495634_0138371_521_1228 229
1217 3300046663 Ga0495635_0101440 Ga0495635_0101440_983_1675 229
1218 3300046663 Ga0495635_0149563 Ga0495635_0149563_174_881 229
1219 3300046664 Ga0495659_0023134 Ga0495659_0023134_1043_1750 229
1220 3300046675 Ga0495657_0007778 Ga0495657_0007778_154_846 229
1221 3300046678 Ga0495599_0071391 Ga0495599_0071391_338_1030 229
1222 3300046678 Ga0495599_0126995 Ga0495599_0126995_616_1308 229
1223 3300046681 Ga0495647_0000256 Ga0495647_0000256_9916_10671 229
1224 3300046681 Ga0495647_0000484 Ga0495647_0000484_7228_7920 229
1225 3300046681 Ga0495647_0002242 Ga0495647_0002242_5021_5728 229
1226 3300046683 Ga0495658_0008012 Ga0495658_0008012_3909_4601 229
1227 3300046683 Ga0495658_0015462 Ga0495658_0015462_1707_2414 229
1228 3300046684 Ga0495669_0147383 Ga0495669_0147383_149_856 229
1229 3300046684 Ga0495669_0237410 Ga0495669_0237410_35_727 229
1230 3300046689 Ga0495613_0012641 Ga0495613_0012641_2237_2944 229
1231 3300046690 Ga0495624_0071671 Ga0495624_0071671_806_1561 229
1232 3300046809 Ga0495600_0004598 Ga0495600_0004598_4386_5078 229
1233 3300046809 Ga0495600_0062630 Ga0495600_0062630_1052_1759 229
1234 3300047315 Ga0495581_0014229 Ga0495581_0014229_3869_4576 229
1235 3300047315 Ga0495581_0030581 Ga0495581_0030581_2118_2900 229
1236 3300047317 Ga0495604_0299989 Ga0495604_0299989_121_828 229
1237 3300047319 Ga0495674_0022190 Ga0495674_0022190_296_988 229
1238 3300047322 Ga0495680_0263945 Ga0495680_0263945_195_902 229
1239 3300047444 Ga0495675_0021453 Ga0495675_0021453_2283_2975 229
1240 3300047471 Ga0495684_0015253 Ga0495684_0015253_1438_2130 229
1241 3300047471 Ga0495684_0043873 Ga0495684_0043873_1869_2576 229
1242 3300047673 Ga0495593_0040491 Ga0495593_0040491_1279_1986 229
1243 3300048089 Ga0495614_0031094 Ga0495614_0031094_1026_1733 229
1244 3300048903 Ga0496100_0067735 Ga0496100_0067735_653_1360 229
1245 3300048905 Ga0496102_0043950 Ga0496102_0043950_1623_2330 229
1246 3300048907 Ga0496104_0000879 Ga0496104_0000879_1536_2243 229
1247 3300048908 Ga0496105_0052828 Ga0496105_0052828_1843_2550 229
1248 3300048910 Ga0496107_0180968 Ga0496107_0180968_732_1439 229
1249 3300048913 Ga0496110_0160827 Ga0496110_0160827_678_1385 229
1250 3300048917 Ga0496114_0122570 Ga0496114_0122570_342_1049 229
1251 3300048918 Ga0496115_0022229 Ga0496115_0022229_3807_4514 229
1252 3300049572 Ga0501036_0092700 Ga0501036_0092700_1130_1975 229
1253 3300049573 Ga0501037_0050426 Ga0501037_0050426_1338_2183 229
1254 3300049574 Ga0501038_0384800 Ga0501038_0384800_207_899 229
1255 3300049579 Ga0501043_0162657 Ga0501043_0162657_168_1013 229
1256 3300049580 Ga0501046_0127401 Ga0501046_0127401_370_1215 229
1257 3300049582 Ga0501048_0102312 Ga0501048_0102312_960_1805 229
1258 3300049587 Ga0501071_0007325 Ga0501071_0007325_2335_3180 229
1259 3300049588 Ga0501072_0038882 Ga0501072_0038882_1865_2710 229
1260 3300049590 Ga0501074_0143982 Ga0501074_0143982_256_1101 229
1261 3300049591 Ga0501075_0001427 Ga0501075_0001427_13921_14766 229
1262 3300049592 Ga0501076_0000262 Ga0501076_0000262_13456_14301 229
1263 3300049592 Ga0501076_0034318 Ga0501076_0034318_59_751 229
1264 3300049593 Ga0501077_0022436 Ga0501077_0022436_383_1228 229
1265 3300049741 Ga0501079_0002649 Ga0501079_0002649_724_1569 229
1266 3300049824 Ga0501045_0065439 Ga0501045_0065439_870_1715 229
1267 3300050507 nmdc:mga05p37_3367_c1 nmdc:mga05p37_3367_c1_5295_5987 229
1268 3300050508 nmdc:mga09592_646_c1 nmdc:mga09592_646_c1_9400_10092 229
1269 3300050510 nmdc:mga06r32_452637_c1 nmdc:mga06r32_452637_c1_197_889 229
1270 3300050510 nmdc:mga06r32_587827_c1 nmdc:mga06r32_587827_c1_161_853 229
1271 3300050511 nmdc:mga08y16_1209_c1 nmdc:mga08y16_1209_c1_16645_17337 229
1272 3300050511 nmdc:mga08y16_127694_c1 nmdc:mga08y16_127694_c1_571_1281 229
1273 3300050512 nmdc:mga0n895_161_c1 nmdc:mga0n895_161_c1_9001_9711 229
1274 3300050513 nmdc:mga0rr50_60252_c1 nmdc:mga0rr50_60252_c1_301_1008 229
1275 3300050513 nmdc:mga0rr50_632462_c1 nmdc:mga0rr50_632462_c1_58_750 229
1276 3300050514 nmdc:mga08x19_105973_c1 nmdc:mga08x19_105973_c1_930_1622 229
1277 3300050514 nmdc:mga08x19_123570_c1 nmdc:mga08x19_123570_c1_439_1134 229
1278 3300050514 nmdc:mga08x19_141156_c1 nmdc:mga08x19_141156_c1_901_1593 229
1279 3300050514 nmdc:mga08x19_2181_c1 nmdc:mga08x19_2181_c1_9624_10334 229
1280 3300050515 nmdc:mga0a205_935_c1 nmdc:mga0a205_935_c1_14309_15019 229
1281 3300053077 Ga0495601_0006915 Ga0495601_0006915_4007_4699 229
1282 3300053077 Ga0495601_0227931 Ga0495601_0227931_467_1174 229
1283 3300053078 Ga0495612_0079538 Ga0495612_0079538_14_724 229
1284 3300053084 Ga0495595_0000798 Ga0495595_0000798_2961_3653 229
1285 3300053085 Ga0495619_0006963 Ga0495619_0006963_3389_4081 229
1286 3300053085 Ga0495619_0012391 Ga0495619_0012391_688_1395 229
1287 3300054114 Ga0501084_0017847 Ga0501084_0017847_245_1090 229
1288 3300060353 Ga0501082_0029980 Ga0501082_0029980_2672_3517 229
1289 3300061734 Ga0530510_0004784 Ga0530510_0004784_6840_7685 229
1290 iso_pu_bacteria 2501025501 2501075122 229
1291 iso_pu_bacteria 2501025502 2501082568 229
1292 iso_pu_bacteria 2501025504 2501408482 229
1293 iso_pu_bacteria 2508501125 2509128433 229
1294 iso_pu_bacteria 2510065045 2510251724 229
1295 iso_pu_bacteria 2510917013 2511086097 229
1296 iso_pu_bacteria 2510917014 2511096216 229
1297 iso_pu_bacteria 2510917015 2511103061 229
1298 iso_pu_bacteria 2512047030 2512345309 229
1299 iso_pu_bacteria 2513237082 2513557530 229
1300 iso_pu_bacteria 2513237083 2513564371 229
1301 iso_pu_bacteria 2513237151 2513961529 229
1302 iso_pu_bacteria 2513237166 2514051015 229
1303 iso_pu_bacteria 2515154122 2515684399 229
1304 iso_pu_bacteria 2515154123 2515691213 229
1305 iso_pu_bacteria 2515154189 2516024478 229
1306 iso_pu_bacteria 2526164713 2527075757 229
1307 iso_pu_bacteria 2562617112 2563059151 229
1308 iso_pu_bacteria 2582581311 2585292814 229
1309 iso_pu_bacteria 2599185239 2599738306 229
1310 iso_pu_bacteria 2599185240 2599742334 229
1311 iso_pu_bacteria 2599185355 2600204452 229
1312 iso_pu_bacteria 2600255067 2600810739 229
1313 iso_pu_bacteria 2675903129 2676741437 229
1314 iso_pu_bacteria 2711768613 2713479922 229
1315 iso_pu_bacteria 2718217991 2719640835 229
1316 iso_pu_bacteria 2721755763 2723876869 229
1317 iso_pu_bacteria 2738541296 2738818918 229
1318 iso_pu_bacteria 2738541298 2738830926 229
1319 iso_pu_bacteria 2738541306 2738872453 229
1320 iso_pu_bacteria 2738543002 2739184083 229
1321 iso_pu_bacteria 2738543008 2739219053 229
1322 iso_pu_bacteria 2744054900 2746088095 229
1323 iso_pu_bacteria 2744054901 2746095150 229
1324 iso_pu_bacteria 2751185846 2753569810 229
1325 iso_pu_bacteria 2791355137 2792834080 229
1326 iso_pu_bacteria 2808606384 2808970284 229
1327 iso_pu_bacteria 2808606390 2809004870 229
1328 iso_pu_bacteria 2808606391 2809011990 229
1329 iso_pu_bacteria 2816332253 2817260626 229
1330 iso_pu_bacteria 2816332256 2817278266 229
1331 iso_pu_bacteria 2816332286 2817452499 229
1332 iso_pu_bacteria 2818991450 2819623647 229
1333 iso_pu_bacteria 2818991452 2819633130 229
1334 iso_pu_bacteria 2842324504 2842325176 229
1335 iso_pu_bacteria 2842348783 2842349455 229
1336 iso_pu_bacteria 2842454564 2842459808 229
1337 iso_pu_bacteria 2856287931 2856292690 229
1338 iso_pu_bacteria 2857357740 2857360924 229
1339 iso_pu_bacteria 2863421361 2863427480 229
1340 iso_pu_bacteria 2870068957 2870071931 229
1341 iso_pu_bacteria 2883087390 2883087948 229
1342 iso_pu_bacteria 2885270888 2885271172 229
1343 iso_pu_bacteria 2900634093 2900637898 229
1344 iso_pu_bacteria 2902682994 2902687017 229
1345 iso_pu_bacteria 2904483920 2904487332 229
1346 iso_pu_bacteria 2904564687 2904566298 229
1347 iso_pu_bacteria 2904571731 2904573342 229
1348 iso_pu_bacteria 2904615490 2904623468 229
1349 iso_pu_bacteria 2919527303 2919528635 229
1350 iso_pu_bacteria 2928108538 2928110766 229
1351 iso_pu_bacteria 2928135762 2928137676 229
1352 iso_pu_bacteria 2928157003 2928159288 229
1353 iso_pu_bacteria 2928163908 2928164652 229
1354 iso_pu_bacteria 2928170801 2928176585 229
1355 iso_pu_bacteria 2928503688 2928509564 229
1356 iso_pu_bacteria 2928536128 2928538080 229
1357 iso_pu_bacteria 2945934425 2945937596 229
1358 iso_pu_bacteria 2981990288 2981993711 229
1359 iso_pu_bacteria 2990703756 2990705686 229
1360 iso_pu_bacteria 641736151 642426306 229
1361 iso_pu_bacteria 641736154 642414984 229
1362 iso_pu_bacteria 642555112 642592661 229
1363 iso_pu_bacteria 642555113 642622417 229
1364 iso_pu_bacteria 8003955200 8003955751 229
1365 iso_pu_bacteria 8018845410 8018850618 229
1366 iso_pu_bacteria 8020807995 8020809431 229
1367 iso_pu_bacteria 8020938398 8020944528 229
1368 iso_pu_bacteria 8020945358 8020947004 229
1369 iso_pu_bacteria 8020953355 8020960033 229
1370 iso_pu_bacteria 8021120328 8021123031 229
1371 iso_pu_bacteria 8039098773 8039104149 229
1372 iso_pu_bacteria 8040167225 8040172569 229
1373 iso_pu_bacteria 8040173305 8040175137 229
1374 iso_pu_bacteria 8055266321 8055266883 229
1375 iso_pu_bacteria 8055301274 8055301800 229
1376 3300003187 JGI25151J46595_10000170 JGI25151J46595_1000017030 230
1377 3300003763 Ga0055529_1001572 Ga0055529_10015727 230
1378 3300005330 Ga0070690_100093800 Ga0070690_1000938004 230
1379 3300005439 Ga0070711_100348624 Ga0070711_1003486242 230
1380 3300005547 Ga0070693_100086299 Ga0070693_1000862992 230
1381 3300005614 Ga0068856_100127434 Ga0068856_1001274342 230
1382 3300006051 Ga0075364_10000753 Ga0075364_1000075314 230
1383 3300006237 Ga0097621_100152614 Ga0097621_1001526142 230
1384 3300006358 Ga0068871_100016020 Ga0068871_1000160202 230
1385 3300006881 Ga0068865_100281207 Ga0068865_1002812072 230
1386 3300007076 Ga0075435_100264267 Ga0075435_1002642672 230
1387 3300007265 Ga0099794_10159760 Ga0099794_101597602 230
1388 3300009545 Ga0105237_10090750 Ga0105237_100907502 230
1389 3300025228 Ga0209672_103202 Ga0209672_1032023 230
1390 3300025272 Ga0209455_1000477 Ga0209455_100047718 230
1391 3300025294 Ga0209025_1000071 Ga0209025_100007139 230
1392 3300025298 Ga0209050_1002083 Ga0209050_100208313 230
1393 3300025914 Ga0207671_10082706 Ga0207671_100827062 230
1394 3300025916 Ga0207663_10292972 Ga0207663_102929721 230
1395 3300025938 Ga0207704_10548321 Ga0207704_105483211 230
1396 3300025938 Ga0207704_10586562 Ga0207704_105865621 230
1397 3300026041 Ga0207639_10012498 Ga0207639_100124983 230
1398 3300027312 Ga0209371_1006254 Ga0209371_10062543 230
1399 3300030500 Ga0268256_1006273 Ga0268256_10062733 230
1400 3300031238 Ga0265332_10009446 Ga0265332_100094463 230
1401 3300031251 Ga0265327_10124508 Ga0265327_101245081 230
1402 3300031344 Ga0265316_10055646 Ga0265316_100556464 230
1403 3300031711 Ga0265314_10319595 Ga0265314_103195951 230
1404 3300031911 Ga0307412_10000103 Ga0307412_1000010343 230
1405 3300035121 Ga0373960_0027464 Ga0373960_0027464_461_1186 230
1406 3300035241 Ga0373961_0031074 Ga0373961_0031074_208_933 230
1407 3300035241 Ga0373961_0031516 Ga0373961_0031516_521_1222 230
1408 3300035692 Ga0373935_0189842 Ga0373935_0189842_673_1371 230
1409 3300035724 Ga0373933_0235857 Ga0373933_0235857_235_933 230
1410 3300042001 Ga0439441_001742 Ga0439441_001742_787_1506 230
1411 3300042876 Ga0451577_0011404 Ga0451577_0011404_1167_1889 230
1412 3300042876 Ga0451577_0025893 Ga0451577_0025893_694_1392 230
1413 3300042876 Ga0451577_0041062 Ga0451577_0041062_3180_3878 230
1414 3300042876 Ga0451577_0555208 Ga0451577_0555208_223_921 230
1415 3300044712 Ga0453684_0000158 Ga0453684_0000158_266633_267331 230
1416 3300044712 Ga0453684_0029770 Ga0453684_0029770_819_1517 230
1417 3300044712 Ga0453684_0294987 Ga0453684_0294987_328_1026 230
1418 3300044712 Ga0453684_0355326 Ga0453684_0355326_769_1476 230
1419 3300045051 Ga0451576_0006384 Ga0451576_0006384_3675_4373 230
1420 3300045051 Ga0451576_0019515 Ga0451576_0019515_5986_6684 230
1421 3300045051 Ga0451576_0105464 Ga0451576_0105464_1135_1833 230
1422 3300045051 Ga0451576_0211066 Ga0451576_0211066_425_1123 230
1423 3300045051 Ga0451576_0266791 Ga0451576_0266791_349_1047 230
1424 3300046529 Ga0495652_0012115 Ga0495652_0012115_703_1431 230
1425 3300046543 Ga0495645_0000044 Ga0495645_0000044_16560_17288 230
1426 3300046678 Ga0495599_0002539 Ga0495599_0002539_617_1345 230
1427 3300048919 Ga0496116_0243782 Ga0496116_0243782_41_739 230
1428 3300048920 Ga0496117_0030785 Ga0496117_0030785_91_789 230
1429 3300048920 Ga0496117_0036371 Ga0496117_0036371_1829_2527 230
1430 3300048921 Ga0496118_0003850 Ga0496118_0003850_16218_16916 230
1431 3300048921 Ga0496118_0023620 Ga0496118_0023620_3826_4524 230
1432 3300048922 Ga0496119_0032254 Ga0496119_0032254_375_1073 230
1433 3300048924 Ga0496121_0000628 Ga0496121_0000628_36827_37525 230
1434 3300048924 Ga0496121_0027993 Ga0496121_0027993_1687_2400 230
1435 3300048924 Ga0496121_0354264 Ga0496121_0354264_267_965 230
1436 3300048925 Ga0496122_0000497 Ga0496122_0000497_72750_73448 230
1437 3300048926 Ga0496123_0000345 Ga0496123_0000345_15090_15788 230
1438 3300048926 Ga0496123_0136458 Ga0496123_0136458_135_833 230
1439 3300048927 Ga0496124_0000007 Ga0496124_0000007_380911_381609 230
1440 3300048928 Ga0496125_0000166 Ga0496125_0000166_8619_9317 230
1441 3300048928 Ga0496125_0008814 Ga0496125_0008814_6131_6829 230
1442 3300048928 Ga0496125_0025846 Ga0496125_0025846_3905_4603 230
1443 3300048929 Ga0496126_0024834 Ga0496126_0024834_4916_5614 230
1444 3300048929 Ga0496126_0101671 Ga0496126_0101671_844_1542 230
1445 3300049568 Ga0501031_0037452 Ga0501031_0037452_690_1385 230
1446 3300049569 Ga0501032_0004367 Ga0501032_0004367_9059_9754 230
1447 3300049569 Ga0501032_0180829 Ga0501032_0180829_334_1047 230
1448 3300049570 Ga0501033_0002713 Ga0501033_0002713_9111_9806 230
1449 3300049570 Ga0501033_0020221 Ga0501033_0020221_2405_3118 230
1450 3300049571 Ga0501034_0004039 Ga0501034_0004039_11151_11846 230
1451 3300049571 Ga0501034_0066184 Ga0501034_0066184_999_1694 230
1452 3300049571 Ga0501034_0088738 Ga0501034_0088738_1084_1797 230
1453 3300049571 Ga0501034_0168138 Ga0501034_0168138_1125_1820 230
1454 3300049571 Ga0501034_0623936 Ga0501034_0623936_231_926 230
1455 3300049572 Ga0501036_0000051 Ga0501036_0000051_60280_60975 230
1456 3300049573 Ga0501037_0001916 Ga0501037_0001916_5012_5707 230
1457 3300049573 Ga0501037_0049401 Ga0501037_0049401_489_1184 230
1458 3300049573 Ga0501037_0172690 Ga0501037_0172690_231_926 230
1459 3300049574 Ga0501038_0001036 Ga0501038_0001036_18614_19309 230
1460 3300049574 Ga0501038_0295796 Ga0501038_0295796_104_883 230
1461 3300049575 Ga0501039_0006235 Ga0501039_0006235_5627_6406 230
1462 3300049575 Ga0501039_0247053 Ga0501039_0247053_102_797 230
1463 3300049575 Ga0501039_0589942 Ga0501039_0589942_62_838 230
1464 3300049576 Ga0501040_0040872 Ga0501040_0040872_477_1256 230
1465 3300049577 Ga0501041_0003229 Ga0501041_0003229_2213_2992 230
1466 3300049577 Ga0501041_0121027 Ga0501041_0121027_230_1006 230
1467 3300049578 Ga0501042_0009603 Ga0501042_0009603_4457_5236 230
1468 3300049579 Ga0501043_0002694 Ga0501043_0002694_4207_4902 230
1469 3300049579 Ga0501043_0059752 Ga0501043_0059752_174_887 230
1470 3300049579 Ga0501043_0067301 Ga0501043_0067301_176_955 230
1471 3300049579 Ga0501043_0323044 Ga0501043_0323044_471_1166 230
1472 3300049580 Ga0501046_0000415 Ga0501046_0000415_8585_9280 230
1473 3300049580 Ga0501046_0045991 Ga0501046_0045991_1467_2246 230
1474 3300049580 Ga0501046_0213245 Ga0501046_0213245_499_1194 230
1475 3300049581 Ga0501047_0001463 Ga0501047_0001463_22095_22808 230
1476 3300049581 Ga0501047_0001927 Ga0501047_0001927_5162_5857 230
1477 3300049587 Ga0501071_0080409 Ga0501071_0080409_76_855 230
1478 3300049588 Ga0501072_0113027 Ga0501072_0113027_1067_1843 230
1479 3300049588 Ga0501072_0172224 Ga0501072_0172224_488_1267 230
1480 3300049591 Ga0501075_0002610 Ga0501075_0002610_2533_3312 230
1481 3300049592 Ga0501076_0002023 Ga0501076_0002023_7182_7961 230
1482 3300049592 Ga0501076_0129293 Ga0501076_0129293_568_1344 230
1483 3300049593 Ga0501077_0004208 Ga0501077_0004208_5646_6425 230
1484 3300049741 Ga0501079_0003739 Ga0501079_0003739_2469_3248 230
1485 3300049742 Ga0501080_0005936 Ga0501080_0005936_9354_10130 230
1486 3300049742 Ga0501080_0015698 Ga0501080_0015698_4095_4874 230
1487 3300049743 Ga0501081_0006560 Ga0501081_0006560_1065_1844 230
1488 3300049822 Ga0501035_0001342 Ga0501035_0001342_16250_16945 230
1489 3300049822 Ga0501035_0015188 Ga0501035_0015188_3566_4276 230
1490 3300049822 Ga0501035_0018455 Ga0501035_0018455_5409_6188 230
1491 3300049822 Ga0501035_0025887 Ga0501035_0025887_112_825 230
1492 3300049822 Ga0501035_0037238 Ga0501035_0037238_3321_4019 230
1493 3300049822 Ga0501035_0086910 Ga0501035_0086910_1792_2490 230
1494 3300049823 Ga0501044_0000726 Ga0501044_0000726_24422_25120 230
1495 3300049823 Ga0501044_0002429 Ga0501044_0002429_8974_9669 230
1496 3300049823 Ga0501044_0016400 Ga0501044_0016400_2911_3624 230
1497 3300049823 Ga0501044_0055408 Ga0501044_0055408_3257_3952 230
1498 3300049824 Ga0501045_0036974 Ga0501045_0036974_1810_2589 230
1499 3300050491 nmdc:mga00v17_80027_c1 nmdc:mga00v17_80027_c1_798_1496 230
1500 3300050491 nmdc:mga00v17_800_c1 nmdc:mga00v17_800_c1_15315_16013 230
1501 3300050493 nmdc:mga0k408_1140_c2 nmdc:mga0k408_1140_c2_5251_5958 230
1502 3300053161 Ga0500634_0050209 Ga0500634_0050209_952_1665 230
1503 3300054114 Ga0501084_0253784 Ga0501084_0253784_556_1335 230
1504 3300060353 Ga0501082_0001122 Ga0501082_0001122_3147_3926 230
1505 iso_pu_bacteria 2513237150 2513956405 231
1506 iso_pu_bacteria 2513237165 2514041505 231
1507 iso_pu_bacteria 2519103095 2519458431 231
1508 iso_pu_bacteria 2834641062 2834645037 231
1509 iso_pu_bacteria 2858688981 2858695224 231
1510 iso_pu_bacteria 2901300506 2901304674 231
1511 iso_pu_bacteria 2904434214 2904436861 231
1512 iso_pu_bacteria 644736347 644748285 231
1513 iso_pu_bacteria 8003400568 8003401423 231
1514 3300001979 JGI24740J21852_10001895 JGI24740J21852_100018953 233
1515 3300001989 JGI24739J22299_10030828 JGI24739J22299_100308283 233
1516 3300001989 JGI24739J22299_10037392 JGI24739J22299_100373922 233
1517 3300001990 JGI24737J22298_10026376 JGI24737J22298_100263761 233
1518 3300002067 JGI24735J21928_10000738 JGI24735J21928_100007389 233
1519 3300002067 JGI24735J21928_10000807 JGI24735J21928_100008075 233
1520 3300002067 JGI24735J21928_10000854 JGI24735J21928_100008547 233
1521 3300002067 JGI24735J21928_10003967 JGI24735J21928_100039674 233
1522 3300002067 JGI24735J21928_10017420 JGI24735J21928_100174202 233
1523 3300002075 JGI24738J21930_10002891 JGI24738J21930_100028912 233
1524 3300002075 JGI24738J21930_10003158 JGI24738J21930_100031586 233
1525 3300002075 JGI24738J21930_10010689 JGI24738J21930_100106892 233
1526 3300002705 JGI25156J39149_1000948 JGI25156J39149_10009484 233
1527 3300002705 JGI25156J39149_1001464 JGI25156J39149_10014644 233
1528 3300002705 JGI25156J39149_1001497 JGI25156J39149_10014974 233
1529 3300002705 JGI25156J39149_1028384 JGI25156J39149_10283841 233
1530 3300003214 JGI25165J46597_1000966 JGI25165J46597_100096614 233
1531 3300003316 rootH1_10024447 rootH1_100244472 233
1532 3300003354 JGI25160J50197_1000082 JGI25160J50197_100008298 233
1533 3300003479 Ga0006556J51387_1021740 Ga0006556J51387_10217406 233
1534 3300003756 Ga0055533_1000093 Ga0055533_10000939 233
1535 3300003756 Ga0055533_1002259 Ga0055533_10022592 233
1536 3300003758 Ga0055532_1000039 Ga0055532_1000039128 233
1537 3300003760 Ga0055527_1000024 Ga0055527_1000024128 233
1538 3300003760 Ga0055527_1002371 Ga0055527_10023711 233
1539 3300003760 Ga0055527_1004686 Ga0055527_10046861 233
1540 3300003760 Ga0055527_1004802 Ga0055527_10048021 233
1541 3300003761 Ga0055535_1000028 Ga0055535_1000028128 233
1542 3300003761 Ga0055535_1004699 Ga0055535_10046991 233
1543 3300003761 Ga0055535_1004754 Ga0055535_10047541 233
1544 3300003762 Ga0055542_1000047 Ga0055542_100004758 233
1545 3300003762 Ga0055542_1004774 Ga0055542_10047741 233
1546 3300003762 Ga0055542_1008253 Ga0055542_10082532 233
1547 3300003763 Ga0055529_1000054 Ga0055529_1000054128 233
1548 3300003763 Ga0055529_1001431 Ga0055529_10014314 233
1549 3300003790 Ga0055528_1002698 Ga0055528_10026984 233
1550 3300003841 Ga0055541_1009628 Ga0055541_10096281 233
1551 3300003856 Ga0058692_1014395 Ga0058692_10143952 233
1552 3300005262 Ga0065165_1008398 Ga0065165_10083982 233
1553 3300005327 Ga0070658_10031366 Ga0070658_100313661 233
1554 3300005327 Ga0070658_10535762 Ga0070658_105357622 233
1555 3300005335 Ga0070666_10323229 Ga0070666_103232292 233
1556 3300005339 Ga0070660_100000004 Ga0070660_10000000419 233
1557 3300005339 Ga0070660_100000911 Ga0070660_10000091114 233
1558 3300005344 Ga0070661_100048988 Ga0070661_1000489882 233
1559 3300005354 Ga0070675_100154067 Ga0070675_1001540672 233
1560 3300005355 Ga0070671_100938375 Ga0070671_1009383751 233
1561 3300005366 Ga0070659_100000023 Ga0070659_1000000233 233
1562 3300005366 Ga0070659_100041302 Ga0070659_1000413024 233
1563 3300005367 Ga0070667_100187790 Ga0070667_1001877902 233
1564 3300005455 Ga0070663_100001557 Ga0070663_1000015579 233
1565 3300005455 Ga0070663_100098249 Ga0070663_1000982493 233
1566 3300005455 Ga0070663_100415188 Ga0070663_1004151881 233
1567 3300005456 Ga0070678_100690538 Ga0070678_1006905381 233
1568 3300005530 Ga0070679_100734481 Ga0070679_1007344811 233
1569 3300005548 Ga0070665_100242480 Ga0070665_1002424802 233
1570 3300005563 Ga0068855_100002387 Ga0068855_1000023877 233
1571 3300005563 Ga0068855_100018465 Ga0068855_1000184655 233
1572 3300005577 Ga0068857_100825642 Ga0068857_1008256421 233
1573 3300005616 Ga0068852_100064785 Ga0068852_1000647854 233
1574 3300009011 Ga0105251_10000186 Ga0105251_1000018648 233
1575 3300009011 Ga0105251_10011338 Ga0105251_100113383 233
1576 3300009011 Ga0105251_10130988 Ga0105251_101309881 233
1577 3300009092 Ga0105250_10005986 Ga0105250_100059864 233
1578 3300009093 Ga0105240_10003819 Ga0105240_1000381927 233
1579 3300009093 Ga0105240_10005824 Ga0105240_100058246 233
1580 3300009093 Ga0105240_10109151 Ga0105240_101091512 233
1581 3300009093 Ga0105240_10148516 Ga0105240_101485162 233
1582 3300009101 Ga0105247_10218031 Ga0105247_102180312 233
1583 3300009174 Ga0105241_10095695 Ga0105241_100956952 233
1584 3300009174 Ga0105241_10289368 Ga0105241_102893682 233
1585 3300009177 Ga0105248_10176403 Ga0105248_101764032 233
1586 3300009177 Ga0105248_10191981 Ga0105248_101919813 233
1587 3300009545 Ga0105237_10036836 Ga0105237_100368363 233
1588 3300009551 Ga0105238_10006191 Ga0105238_1000619110 233
1589 3300009551 Ga0105238_10141313 Ga0105238_101413132 233
1590 3300010375 Ga0105239_10001448 Ga0105239_1000144826 233
1591 3300010375 Ga0105239_10008327 Ga0105239_100083276 233
1592 3300013100 Ga0157373_10010740 Ga0157373_100107404 233
1593 3300013102 Ga0157371_10007831 Ga0157371_100078316 233
1594 3300013104 Ga0157370_10001020 Ga0157370_1000102010 233
1595 3300013104 Ga0157370_10001871 Ga0157370_1000187116 233
1596 3300013105 Ga0157369_10000630 Ga0157369_100006309 233
1597 3300013105 Ga0157369_10002244 Ga0157369_100022447 233
1598 3300013105 Ga0157369_10003025 Ga0157369_100030253 233
1599 3300013105 Ga0157369_10053318 Ga0157369_100533182 233
1600 3300013105 Ga0157369_10086548 Ga0157369_100865483 233
1601 3300013296 Ga0157374_10000290 Ga0157374_1000029021 233
1602 3300013296 Ga0157374_10066580 Ga0157374_100665803 233
1603 3300013306 Ga0163162_10001332 Ga0163162_100013329 233
1604 3300013307 Ga0157372_10154511 Ga0157372_101545113 233
1605 3300013308 Ga0157375_10029988 Ga0157375_100299882 233
1606 3300015261 Ga0182006_1071558 Ga0182006_10715582 233
1607 3300015262 Ga0182007_10011697 Ga0182007_100116972 233
1608 3300016635 Ga0183361_10036 Ga0183361_100364 233
1609 3300020070 Ga0206356_11370595 Ga0206356_113705954 233
1610 3300020080 Ga0206350_11630003 Ga0206350_116300031 233
1611 3300022467 Ga0224712_10000026 Ga0224712_100000269 233
1612 3300025225 Ga0209566_100726 Ga0209566_1007266 233
1613 3300025226 Ga0209674_100013 Ga0209674_100013164 233
1614 3300025226 Ga0209674_100242 Ga0209674_10024210 233
1615 3300025226 Ga0209674_103147 Ga0209674_1031474 233
1616 3300025228 Ga0209672_100010 Ga0209672_100010208 233
1617 3300025228 Ga0209672_100019 Ga0209672_100019142 233
1618 3300025228 Ga0209672_100065 Ga0209672_100065175 233
1619 3300025228 Ga0209672_100465 Ga0209672_1004654 233
1620 3300025229 Ga0209147_100006 Ga0209147_100006208 233
1621 3300025229 Ga0209147_100026 Ga0209147_100026142 233
1622 3300025229 Ga0209147_100044 Ga0209147_10004496 233
1623 3300025229 Ga0209147_100124 Ga0209147_100124121 233
1624 3300025231 Ga0207427_101311 Ga0207427_10131110 233
1625 3300025242 Ga0209258_100010 Ga0209258_100010208 233
1626 3300025242 Ga0209258_100031 Ga0209258_100031175 233
1627 3300025242 Ga0209258_100079 Ga0209258_10007994 233
1628 3300025254 Ga0209148_1000018 Ga0209148_1000018208 233
1629 3300025254 Ga0209148_1000027 Ga0209148_1000027175 233
1630 3300025254 Ga0209148_1003072 Ga0209148_10030723 233
1631 3300025256 Ga0209759_1000148 Ga0209759_10001489 233
1632 3300025256 Ga0209759_1000151 Ga0209759_100015155 233
1633 3300025256 Ga0209759_1000307 Ga0209759_100030710 233
1634 3300025256 Ga0209759_1001923 Ga0209759_10019239 233
1635 3300025256 Ga0209759_1004000 Ga0209759_10040005 233
1636 3300025256 Ga0209759_1015406 Ga0209759_10154061 233
1637 3300025261 Ga0209233_1000135 Ga0209233_100013564 233
1638 3300025272 Ga0209455_1000015 Ga0209455_1000015208 233
1639 3300025272 Ga0209455_1000058 Ga0209455_1000058133 233
1640 3300025272 Ga0209455_1006336 Ga0209455_10063363 233
1641 3300025273 Ga0209673_1000059 Ga0209673_1000059113 233
1642 3300025284 Ga0209130_1016603 Ga0209130_10166031 233
1643 3300025291 Ga0209675_1038064 Ga0209675_10380642 233
1644 3300025295 Ga0209564_1008533 Ga0209564_10085333 233
1645 3300025295 Ga0209564_1021228 Ga0209564_10212282 233
1646 3300025302 Ga0207426_1000240 Ga0207426_10002402 233
1647 3300025302 Ga0207426_1002741 Ga0207426_10027412 233
1648 3300025711 Ga0207696_1050351 Ga0207696_10503512 233
1649 3300025735 Ga0207713_1000546 Ga0207713_100054624 233
1650 3300025735 Ga0207713_1002150 Ga0207713_10021508 233
1651 3300025903 Ga0207680_10092728 Ga0207680_100927282 233
1652 3300025904 Ga0207647_10000460 Ga0207647_1000046014 233
1653 3300025904 Ga0207647_10003851 Ga0207647_100038516 233
1654 3300025904 Ga0207647_10007271 Ga0207647_100072715 233
1655 3300025904 Ga0207647_10017307 Ga0207647_100173075 233
1656 3300025904 Ga0207647_10027299 Ga0207647_100272991 233
1657 3300025904 Ga0207647_10216678 Ga0207647_102166782 233
1658 3300025909 Ga0207705_10000796 Ga0207705_1000079617 233
1659 3300025909 Ga0207705_10168691 Ga0207705_101686912 233
1660 3300025909 Ga0207705_10365804 Ga0207705_103658041 233
1661 3300025911 Ga0207654_10233030 Ga0207654_102330301 233
1662 3300025913 Ga0207695_10002683 Ga0207695_1000268319 233
1663 3300025913 Ga0207695_10002847 Ga0207695_100028473 233
1664 3300025913 Ga0207695_10004748 Ga0207695_100047482 233
1665 3300025914 Ga0207671_10023562 Ga0207671_100235622 233
1666 3300025919 Ga0207657_10000001 Ga0207657_10000001136 233
1667 3300025919 Ga0207657_10000198 Ga0207657_1000019839 233
1668 3300025921 Ga0207652_10618029 Ga0207652_106180292 233
1669 3300025924 Ga0207694_10027632 Ga0207694_100276322 233
1670 3300025924 Ga0207694_10083620 Ga0207694_100836202 233
1671 3300025931 Ga0207644_10907859 Ga0207644_109078591 233
1672 3300025932 Ga0207690_10000029 Ga0207690_100000299 233
1673 3300025932 Ga0207690_10026664 Ga0207690_100266642 233
1674 3300025941 Ga0207711_10047632 Ga0207711_100476323 233
1675 3300025941 Ga0207711_10155483 Ga0207711_101554832 233
1676 3300025949 Ga0207667_10000954 Ga0207667_1000095416 233
1677 3300025949 Ga0207667_10007209 Ga0207667_100072095 233
1678 3300025949 Ga0207667_10060273 Ga0207667_100602732 233
1679 3300026067 Ga0207678_10001065 Ga0207678_100010653 233
1680 3300026067 Ga0207678_10128717 Ga0207678_101287172 233
1681 3300026067 Ga0207678_10154233 Ga0207678_101542332 233
1682 3300026067 Ga0207678_10384440 Ga0207678_103844402 233
1683 3300026067 Ga0207678_10414708 Ga0207678_104147082 233
1684 3300026116 Ga0207674_10785754 Ga0207674_107857542 233
1685 3300026121 Ga0207683_10227567 Ga0207683_102275671 233
1686 3300027312 Ga0209371_1000243 Ga0209371_10002436 233
1687 3300028379 Ga0268266_10060329 Ga0268266_100603292 233
1688 3300028379 Ga0268266_10806272 Ga0268266_108062721 233
1689 3300028800 Ga0265338_10000104 Ga0265338_10000104102 233
1690 3300028800 Ga0265338_10025908 Ga0265338_100259083 233
1691 3300030500 Ga0268256_1000986 Ga0268256_10009866 233
1692 3300031548 Ga0307408_100002538 Ga0307408_10000253811 233
1693 3300031731 Ga0307405_10038265 Ga0307405_100382654 233
1694 3300031911 Ga0307412_10000008 Ga0307412_10000008274 233
1695 3300031911 Ga0307412_10010116 Ga0307412_100101164 233
1696 3300032005 Ga0307411_10145654 Ga0307411_101456543 233
1697 3300037312 Ga0395899_0000029 Ga0395899_0000029_194867_195568 233
1698 3300037312 Ga0395899_0003212 Ga0395899_0003212_7160_7861 233
1699 3300037312 Ga0395899_0009516 Ga0395899_0009516_2268_2969 233
1700 3300037418 Ga0395900_0000085 Ga0395900_0000085_133804_134505 233
1701 3300037418 Ga0395900_0011615 Ga0395900_0011615_6220_6921 233
1702 3300037418 Ga0395900_0054694 Ga0395900_0054694_686_1387 233
1703 3300037418 Ga0395900_0059337 Ga0395900_0059337_180_881 233
1704 3300037466 Ga0395898_0000086 Ga0395898_0000086_133804_134505 233
1705 3300037466 Ga0395898_0009653 Ga0395898_0009653_4838_5539 233
1706 3300037466 Ga0395898_0023240 Ga0395898_0023240_3007_3708 233
1707 3300037466 Ga0395898_0209147 Ga0395898_0209147_621_1322 233
1708 3300037471 Ga0395905_0000098 Ga0395905_0000098_6314_7015 233
1709 3300037471 Ga0395905_0006036 Ga0395905_0006036_5428_6129 233
1710 3300038443 Ga0395901_0000003 Ga0395901_0000003_24031_24732 233
1711 3300038443 Ga0395901_0000426 Ga0395901_0000426_15165_15866 233
1712 3300038443 Ga0395901_0004109 Ga0395901_0004109_7214_7915 233
1713 3300039437 Ga0436365_0198629 Ga0436365_0198629_364_1065 233
1714 3300039447 Ga0436361_1001960 Ga0436361_1001960_907_1608 233
1715 3300042005 Ga0439448_0005071 Ga0439448_0005071_2457_3158 233
1716 3300044656 Ga0466969_0002241 Ga0466969_0002241_49_750 233
1717 3300044656 Ga0466969_0022973 Ga0466969_0022973_2425_3126 233
1718 3300044656 Ga0466969_0053311 Ga0466969_0053311_1257_1958 233
1719 3300044658 Ga0466972_0092674 Ga0466972_0092674_587_1288 233
1720 3300044659 Ga0466973_0062346 Ga0466973_0062346_129_830 233
1721 3300044666 Ga0466977_0000941 Ga0466977_0000941_1018_1719 233
1722 3300044683 Ga0466965_0000039 Ga0466965_0000039_31006_31707 233
1723 3300044683 Ga0466965_0189794 Ga0466965_0189794_359_1060 233
1724 3300044684 Ga0466966_0000005 Ga0466966_0000005_22062_22763 233
1725 3300044684 Ga0466966_0004841 Ga0466966_0004841_5274_5975 233
1726 3300044684 Ga0466966_0019191 Ga0466966_0019191_3382_4083 233
1727 3300044684 Ga0466966_0026026 Ga0466966_0026026_3093_3794 233
1728 3300044693 Ga0466961_0000027 Ga0466961_0000027_78725_79426 233
1729 3300044693 Ga0466961_0000582 Ga0466961_0000582_6336_7037 233
1730 3300044693 Ga0466961_0012185 Ga0466961_0012185_2683_3384 233
1731 3300044693 Ga0466961_0038395 Ga0466961_0038395_1327_2028 233
1732 3300044693 Ga0466961_0058677 Ga0466961_0058677_1704_2405 233
1733 3300044694 Ga0466963_0000523 Ga0466963_0000523_10433_11134 233
1734 3300044694 Ga0466963_0008655 Ga0466963_0008655_3686_4387 233
1735 3300044694 Ga0466963_0023485 Ga0466963_0023485_544_1245 233
1736 3300044706 Ga0466964_0012388 Ga0466964_0012388_1289_1990 233
1737 3300044719 Ga0466971_0000524 Ga0466971_0000524_14182_14883 233
1738 3300044719 Ga0466971_0002893 Ga0466971_0002893_6463_7164 233
1739 3300044719 Ga0466971_0016100 Ga0466971_0016100_78_779 233
1740 3300044735 Ga0466968_0016893 Ga0466968_0016893_962_1663 233
1741 3300044735 Ga0466968_0033612 Ga0466968_0033612_1149_1850 233
1742 3300044765 Ga0466970_0001517 Ga0466970_0001517_3695_4396 233
1743 3300044765 Ga0466970_0201310 Ga0466970_0201310_64_765 233
1744 3300044842 Ga0466957_0004027 Ga0466957_0004027_5290_5991 233
1745 3300044842 Ga0466957_0004351 Ga0466957_0004351_4473_5174 233
1746 3300044842 Ga0466957_0012097 Ga0466957_0012097_1836_2537 233
1747 3300044842 Ga0466957_0074278 Ga0466957_0074278_920_1621 233
1748 3300044842 Ga0466957_0259608 Ga0466957_0259608_62_763 233
1749 3300045049 Ga0466959_0003412 Ga0466959_0003412_1179_1880 233
1750 3300045049 Ga0466959_0004303 Ga0466959_0004303_1926_2627 233
1751 3300045049 Ga0466959_0020155 Ga0466959_0020155_3873_4574 233
1752 3300045836 Ga0466958_0004150 Ga0466958_0004150_5466_6167 233
1753 3300045836 Ga0466958_0018581 Ga0466958_0018581_665_1366 233
1754 3300045836 Ga0466958_0030911 Ga0466958_0030911_2296_2997 233
1755 3300045836 Ga0466958_0073084 Ga0466958_0073084_1080_1781 233
1756 3300045976 Ga0466967_1233104 Ga0466967_1233104_30_731 233
1757 3300046454 Ga0495592_0011203 Ga0495592_0011203_1586_2287 233
1758 3300046454 Ga0495592_0025523 Ga0495592_0025523_501_1202 233
1759 3300046454 Ga0495592_0034619 Ga0495592_0034619_2214_2915 233
1760 3300046455 Ga0495603_0004576 Ga0495603_0004576_4155_4856 233
1761 3300046455 Ga0495603_0027437 Ga0495603_0027437_877_1578 233
1762 3300046455 Ga0495603_0030300 Ga0495603_0030300_979_1680 233
1763 3300046457 Ga0495590_0001202 Ga0495590_0001202_5250_5951 233
1764 3300046457 Ga0495590_0010158 Ga0495590_0010158_443_1144 233
1765 3300046458 Ga0495591_001903 Ga0495591_001903_3823_4524 233
1766 3300046458 Ga0495591_034331 Ga0495591_034331_56_757 233
1767 3300046459 Ga0495629_0000141 Ga0495629_0000141_35658_36359 233
1768 3300046459 Ga0495629_0000228 Ga0495629_0000228_15544_16245 233
1769 3300046459 Ga0495629_0005940 Ga0495629_0005940_2685_3386 233
1770 3300046459 Ga0495629_0008513 Ga0495629_0008513_5300_6001 233
1771 3300046459 Ga0495629_0019418 Ga0495629_0019418_2950_3651 233
1772 3300046459 Ga0495629_0192970 Ga0495629_0192970_321_1022 233
1773 3300046460 Ga0495638_0011649 Ga0495638_0011649_710_1411 233
1774 3300046461 Ga0495641_0027355 Ga0495641_0027355_2017_2718 233
1775 3300046461 Ga0495641_0042270 Ga0495641_0042270_767_1468 233
1776 3300046462 Ga0495651_0012880 Ga0495651_0012880_4297_4998 233
1777 3300046463 Ga0495653_0004897 Ga0495653_0004897_5012_5713 233
1778 3300046463 Ga0495653_0011983 Ga0495653_0011983_3730_4431 233
1779 3300046471 Ga0495650_0005333 Ga0495650_0005333_2056_2757 233
1780 3300046471 Ga0495650_0032907 Ga0495650_0032907_1563_2264 233
1781 3300046471 Ga0495650_0098137 Ga0495650_0098137_231_932 233
1782 3300046472 Ga0495580_0003817 Ga0495580_0003817_7180_7881 233
1783 3300046472 Ga0495580_0010739 Ga0495580_0010739_2907_3608 233
1784 3300046472 Ga0495580_0024583 Ga0495580_0024583_3228_3929 233
1785 3300046472 Ga0495580_0025641 Ga0495580_0025641_1151_1852 233
1786 3300046472 Ga0495580_0028012 Ga0495580_0028012_2997_3698 233
1787 3300046472 Ga0495580_0069347 Ga0495580_0069347_217_918 233
1788 3300046473 Ga0495582_0002843 Ga0495582_0002843_1321_2022 233
1789 3300046473 Ga0495582_0005733 Ga0495582_0005733_4344_5045 233
1790 3300046474 Ga0495605_0015392 Ga0495605_0015392_868_1569 233
1791 3300046474 Ga0495605_0040473 Ga0495605_0040473_502_1203 233
1792 3300046474 Ga0495605_0051672 Ga0495605_0051672_88_789 233
1793 3300046474 Ga0495605_0061733 Ga0495605_0061733_968_1669 233
1794 3300046475 Ga0495639_0100689 Ga0495639_0100689_194_895 233
1795 3300046476 Ga0495662_0024507 Ga0495662_0024507_1279_1980 233
1796 3300046477 Ga0495664_0034488 Ga0495664_0034488_2007_2708 233
1797 3300046477 Ga0495664_0055476 Ga0495664_0055476_984_1685 233
1798 3300046477 Ga0495664_0074522 Ga0495664_0074522_1285_1986 233
1799 3300046491 Ga0495584_0092691 Ga0495584_0092691_701_1402 233
1800 3300046499 Ga0495594_0116636 Ga0495594_0116636_763_1464 233
1801 3300046500 Ga0495596_0004055 Ga0495596_0004055_3205_3906 233
1802 3300046500 Ga0495596_0009658 Ga0495596_0009658_1055_1756 233
1803 3300046501 Ga0495607_0055820 Ga0495607_0055820_983_1684 233
1804 3300046506 Ga0495583_0009863 Ga0495583_0009863_2313_3014 233
1805 3300046506 Ga0495583_0035092 Ga0495583_0035092_1193_1894 233
1806 3300046507 Ga0495606_0008837 Ga0495606_0008837_2971_3672 233
1807 3300046507 Ga0495606_0015624 Ga0495606_0015624_83_784 233
1808 3300046507 Ga0495606_0020785 Ga0495606_0020785_3138_3839 233
1809 3300046507 Ga0495606_0091312 Ga0495606_0091312_44_745 233
1810 3300046511 Ga0495608_0016142 Ga0495608_0016142_890_1591 233
1811 3300046511 Ga0495608_0017692 Ga0495608_0017692_1026_1727 233
1812 3300046512 Ga0495610_0017811 Ga0495610_0017811_1335_2036 233
1813 3300046513 Ga0495616_0033297 Ga0495616_0033297_1642_2343 233
1814 3300046513 Ga0495616_0075512 Ga0495616_0075512_472_1173 233
1815 3300046514 Ga0495618_0001157 Ga0495618_0001157_1273_1974 233
1816 3300046514 Ga0495618_0003759 Ga0495618_0003759_5904_6605 233
1817 3300046514 Ga0495618_0012604 Ga0495618_0012604_1108_1809 233
1818 3300046515 Ga0495620_0004133 Ga0495620_0004133_7176_7877 233
1819 3300046516 Ga0495628_0013621 Ga0495628_0013621_5414_6115 233
1820 3300046516 Ga0495628_0019082 Ga0495628_0019082_751_1452 233
1821 3300046516 Ga0495628_0028937 Ga0495628_0028937_2907_3608 233
1822 3300046516 Ga0495628_0159366 Ga0495628_0159366_367_1068 233
1823 3300046516 Ga0495628_0173237 Ga0495628_0173237_369_1070 233
1824 3300046517 Ga0495630_0007815 Ga0495630_0007815_1187_1888 233
1825 3300046517 Ga0495630_0011320 Ga0495630_0011320_3966_4667 233
1826 3300046517 Ga0495630_0016836 Ga0495630_0016836_3710_4411 233
1827 3300046517 Ga0495630_0023021 Ga0495630_0023021_722_1423 233
1828 3300046517 Ga0495630_0272143 Ga0495630_0272143_375_1076 233
1829 3300046517 Ga0495630_0404241 Ga0495630_0404241_141_842 233
1830 3300046518 Ga0495631_0122373 Ga0495631_0122373_331_1032 233
1831 3300046523 Ga0495644_0069818 Ga0495644_0069818_537_1238 233
1832 3300046524 Ga0495648_0054793 Ga0495648_0054793_1230_1931 233
1833 3300046524 Ga0495648_0070966 Ga0495648_0070966_1094_1795 233
1834 3300046526 Ga0495666_0005010 Ga0495666_0005010_5137_5838 233
1835 3300046526 Ga0495666_0012680 Ga0495666_0012680_1141_1842 233
1836 3300046526 Ga0495666_0022716 Ga0495666_0022716_404_1105 233
1837 3300046526 Ga0495666_0023140 Ga0495666_0023140_1274_1975 233
1838 3300046528 Ga0495642_0018490 Ga0495642_0018490_1857_2558 233
1839 3300046529 Ga0495652_0022203 Ga0495652_0022203_3766_4467 233
1840 3300046529 Ga0495652_0037728 Ga0495652_0037728_1062_1763 233
1841 3300046529 Ga0495652_0249967 Ga0495652_0249967_476_1177 233
1842 3300046529 Ga0495652_0451205 Ga0495652_0451205_172_873 233
1843 3300046531 Ga0495665_0002495 Ga0495665_0002495_4272_4973 233
1844 3300046531 Ga0495665_0008243 Ga0495665_0008243_4046_4747 233
1845 3300046531 Ga0495665_0013091 Ga0495665_0013091_3248_3949 233
1846 3300046531 Ga0495665_0051084 Ga0495665_0051084_273_974 233
1847 3300046533 Ga0495640_0002798 Ga0495640_0002798_8186_8887 233
1848 3300046533 Ga0495640_0013424 Ga0495640_0013424_3112_3813 233
1849 3300046533 Ga0495640_0027731 Ga0495640_0027731_2357_3058 233
1850 3300046535 Ga0495586_0007563 Ga0495586_0007563_1697_2398 233
1851 3300046535 Ga0495586_0069065 Ga0495586_0069065_370_1071 233
1852 3300046535 Ga0495586_0072914 Ga0495586_0072914_737_1438 233
1853 3300046536 Ga0495587_0005516 Ga0495587_0005516_1643_2344 233
1854 3300046536 Ga0495587_0010266 Ga0495587_0010266_4233_4934 233
1855 3300046542 Ga0495597_0098174 Ga0495597_0098174_321_1022 233
1856 3300046543 Ga0495645_0013228 Ga0495645_0013228_403_1104 233
1857 3300046543 Ga0495645_0014282 Ga0495645_0014282_3727_4428 233
1858 3300046543 Ga0495645_0072345 Ga0495645_0072345_219_920 233
1859 3300046543 Ga0495645_0185481 Ga0495645_0185481_266_967 233
1860 3300046557 Ga0495622_0000552 Ga0495622_0000552_7162_7863 233
1861 3300046642 Ga0495634_0005463 Ga0495634_0005463_7404_8105 233
1862 3300046642 Ga0495634_0030822 Ga0495634_0030822_2243_2944 233
1863 3300046642 Ga0495634_0067067 Ga0495634_0067067_1541_2242 233
1864 3300046648 Ga0495611_0016681 Ga0495611_0016681_261_962 233
1865 3300046648 Ga0495611_0033058 Ga0495611_0033058_491_1192 233
1866 3300046660 Ga0495625_0241827 Ga0495625_0241827_58_759 233
1867 3300046663 Ga0495635_0012660 Ga0495635_0012660_2870_3571 233
1868 3300046663 Ga0495635_0041757 Ga0495635_0041757_1225_1926 233
1869 3300046663 Ga0495635_0092457 Ga0495635_0092457_548_1249 233
1870 3300046665 Ga0495661_0019169 Ga0495661_0019169_1760_2461 233
1871 3300046665 Ga0495661_0040681 Ga0495661_0040681_1139_1840 233
1872 3300046674 Ga0495588_0050504 Ga0495588_0050504_1163_1864 233
1873 3300046678 Ga0495599_0024745 Ga0495599_0024745_2401_3102 233
1874 3300046678 Ga0495599_0035091 Ga0495599_0035091_1306_2007 233
1875 3300046678 Ga0495599_0037199 Ga0495599_0037199_857_1558 233
1876 3300046679 Ga0495623_0005996 Ga0495623_0005996_6836_7537 233
1877 3300046679 Ga0495623_0016127 Ga0495623_0016127_2034_2735 233
1878 3300046679 Ga0495623_0016195 Ga0495623_0016195_2952_3653 233
1879 3300046679 Ga0495623_0175068 Ga0495623_0175068_213_914 233
1880 3300046680 Ga0495646_0018589 Ga0495646_0018589_3331_4032 233
1881 3300046680 Ga0495646_0022305 Ga0495646_0022305_3192_3893 233
1882 3300046680 Ga0495646_0041112 Ga0495646_0041112_644_1345 233
1883 3300046680 Ga0495646_0041581 Ga0495646_0041581_954_1655 233
1884 3300046680 Ga0495646_0074597 Ga0495646_0074597_256_957 233
1885 3300046684 Ga0495669_0084225 Ga0495669_0084225_122_823 233
1886 3300046684 Ga0495669_0097412 Ga0495669_0097412_479_1180 233
1887 3300046689 Ga0495613_0011949 Ga0495613_0011949_2426_3127 233
1888 3300046689 Ga0495613_0056442 Ga0495613_0056442_2138_2839 233
1889 3300046690 Ga0495624_0009989 Ga0495624_0009989_3545_4246 233
1890 3300046690 Ga0495624_0013046 Ga0495624_0013046_1268_1969 233
1891 3300046690 Ga0495624_0028337 Ga0495624_0028337_367_1068 233
1892 3300046690 Ga0495624_0062349 Ga0495624_0062349_594_1295 233
1893 3300046690 Ga0495624_0102295 Ga0495624_0102295_497_1198 233
1894 3300046690 Ga0495624_0159680 Ga0495624_0159680_256_957 233
1895 3300046692 Ga0495671_0006420 Ga0495671_0006420_1464_2165 233
1896 3300046694 Ga0495649_0004442 Ga0495649_0004442_3525_4226 233
1897 3300046694 Ga0495649_0009961 Ga0495649_0009961_4326_5027 233
1898 3300046794 Ga0495589_0001760 Ga0495589_0001760_1274_1975 233
1899 3300046794 Ga0495589_0007195 Ga0495589_0007195_3785_4486 233
1900 3300046794 Ga0495589_0029749 Ga0495589_0029749_2030_2731 233
1901 3300046794 Ga0495589_0035521 Ga0495589_0035521_240_941 233
1902 3300046809 Ga0495600_0009373 Ga0495600_0009373_4511_5212 233
1903 3300046809 Ga0495600_0030832 Ga0495600_0030832_1669_2370 233
1904 3300047315 Ga0495581_0001249 Ga0495581_0001249_1020_1721 233
1905 3300047315 Ga0495581_0008056 Ga0495581_0008056_1068_1769 233
1906 3300047317 Ga0495604_0003591 Ga0495604_0003591_4035_4736 233
1907 3300047317 Ga0495604_0010202 Ga0495604_0010202_3361_4062 233
1908 3300047317 Ga0495604_0037503 Ga0495604_0037503_497_1198 233
1909 3300047317 Ga0495604_0037860 Ga0495604_0037860_2482_3183 233
1910 3300047317 Ga0495604_0083275 Ga0495604_0083275_271_972 233
1911 3300047317 Ga0495604_0190682 Ga0495604_0190682_350_1051 233
1912 3300047319 Ga0495674_0018384 Ga0495674_0018384_1785_2486 233
1913 3300047319 Ga0495674_0045121 Ga0495674_0045121_2579_3280 233
1914 3300047319 Ga0495674_0061355 Ga0495674_0061355_1500_2201 233
1915 3300047319 Ga0495674_0064871 Ga0495674_0064871_1062_1763 233
1916 3300047319 Ga0495674_0182592 Ga0495674_0182592_99_800 233
1917 3300047319 Ga0495674_0289600 Ga0495674_0289600_594_1295 233
1918 3300047320 Ga0495672_0046029 Ga0495672_0046029_1520_2221 233
1919 3300047321 Ga0495676_0036569 Ga0495676_0036569_1774_2475 233
1920 3300047321 Ga0495676_0054502 Ga0495676_0054502_1785_2486 233
1921 3300047321 Ga0495676_0064335 Ga0495676_0064335_989_1690 233
1922 3300047321 Ga0495676_0140651 Ga0495676_0140651_723_1424 233
1923 3300047321 Ga0495676_0245766 Ga0495676_0245766_454_1155 233
1924 3300047322 Ga0495680_0010859 Ga0495680_0010859_6168_6869 233
1925 3300047322 Ga0495680_0074116 Ga0495680_0074116_566_1267 233
1926 3300047323 Ga0495683_0002673 Ga0495683_0002673_3933_4634 233
1927 3300047323 Ga0495683_0003991 Ga0495683_0003991_750_1451 233
1928 3300047323 Ga0495683_0005333 Ga0495683_0005333_5692_6393 233
1929 3300047323 Ga0495683_0010164 Ga0495683_0010164_2110_2811 233
1930 3300047323 Ga0495683_0025102 Ga0495683_0025102_1112_1813 233
1931 3300047323 Ga0495683_0036927 Ga0495683_0036927_1085_1786 233
1932 3300047443 Ga0495687_000025 Ga0495687_000025_169830_170531 233
1933 3300047443 Ga0495687_017086 Ga0495687_017086_1919_2620 233
1934 3300047443 Ga0495687_039733 Ga0495687_039733_53_754 233
1935 3300047443 Ga0495687_080396 Ga0495687_080396_17_718 233
1936 3300047444 Ga0495675_0004812 Ga0495675_0004812_566_1267 233
1937 3300047444 Ga0495675_0007596 Ga0495675_0007596_4732_5433 233
1938 3300047444 Ga0495675_0026320 Ga0495675_0026320_1250_1951 233
1939 3300047444 Ga0495675_0292786 Ga0495675_0292786_126_827 233
1940 3300047446 Ga0495679_000067 Ga0495679_000067_90642_91343 233
1941 3300047446 Ga0495679_000771 Ga0495679_000771_9146_9847 233
1942 3300047446 Ga0495679_002362 Ga0495679_002362_2097_2798 233
1943 3300047469 Ga0495673_0013569 Ga0495673_0013569_2441_3142 233
1944 3300047469 Ga0495673_0019111 Ga0495673_0019111_1138_1839 233
1945 3300047469 Ga0495673_0037915 Ga0495673_0037915_216_917 233
1946 3300047470 Ga0495681_0107746 Ga0495681_0107746_269_970 233
1947 3300047472 Ga0495686_0052646 Ga0495686_0052646_780_1481 233
1948 3300047472 Ga0495686_0077930 Ga0495686_0077930_493_1194 233
1949 3300047472 Ga0495686_0170468 Ga0495686_0170468_44_745 233
1950 3300047673 Ga0495593_0004737 Ga0495593_0004737_2213_2914 233
1951 3300047673 Ga0495593_0028607 Ga0495593_0028607_1306_2007 233
1952 3300047673 Ga0495593_0029262 Ga0495593_0029262_1408_2109 233
1953 3300047673 Ga0495593_0030834 Ga0495593_0030834_1665_2366 233
1954 3300047673 Ga0495593_0049655 Ga0495593_0049655_842_1543 233
1955 3300047673 Ga0495593_0125356 Ga0495593_0125356_543_1244 233
1956 3300048088 Ga0495602_0010219 Ga0495602_0010219_5924_6625 233
1957 3300048088 Ga0495602_0015846 Ga0495602_0015846_5647_6348 233
1958 3300048088 Ga0495602_0044170 Ga0495602_0044170_3118_3819 233
1959 3300048088 Ga0495602_0046712 Ga0495602_0046712_1041_1742 233
1960 3300048088 Ga0495602_0096464 Ga0495602_0096464_306_1007 233
1961 3300048088 Ga0495602_0125167 Ga0495602_0125167_991_1692 233
1962 3300048089 Ga0495614_0000156 Ga0495614_0000156_9333_10034 233
1963 3300048089 Ga0495614_0030182 Ga0495614_0030182_594_1295 233
1964 3300048089 Ga0495614_0055428 Ga0495614_0055428_400_1101 233
1965 3300048091 Ga0495626_0028084 Ga0495626_0028084_1788_2489 233
1966 3300048903 Ga0496100_0000308 Ga0496100_0000308_22007_22708 233
1967 3300048903 Ga0496100_0005703 Ga0496100_0005703_3935_4636 233
1968 3300048903 Ga0496100_0057768 Ga0496100_0057768_302_1003 233
1969 3300048904 Ga0496101_0004864 Ga0496101_0004864_6000_6701 233
1970 3300048904 Ga0496101_0012056 Ga0496101_0012056_3299_4000 233
1971 3300048904 Ga0496101_0057893 Ga0496101_0057893_912_1613 233
1972 3300048904 Ga0496101_0139009 Ga0496101_0139009_51_752 233
1973 3300048905 Ga0496102_0001201 Ga0496102_0001201_16569_17270 233
1974 3300048905 Ga0496102_0004856 Ga0496102_0004856_4116_4817 233
1975 3300048905 Ga0496102_0036876 Ga0496102_0036876_2052_2753 233
1976 3300048905 Ga0496102_0097975 Ga0496102_0097975_575_1276 233
1977 3300048905 Ga0496102_0392616 Ga0496102_0392616_464_1165 233
1978 3300048905 Ga0496102_0770178 Ga0496102_0770178_30_731 233
1979 3300048906 Ga0496103_0001564 Ga0496103_0001564_10297_10998 233
1980 3300048906 Ga0496103_0003665 Ga0496103_0003665_6679_7380 233
1981 3300048906 Ga0496103_0040362 Ga0496103_0040362_336_1037 233
1982 3300048906 Ga0496103_0312239 Ga0496103_0312239_290_991 233
1983 3300048907 Ga0496104_0021588 Ga0496104_0021588_3258_3959 233
1984 3300048908 Ga0496105_0025937 Ga0496105_0025937_946_1647 233
1985 3300048909 Ga0496106_0000019 Ga0496106_0000019_2865_3566 233
1986 3300048909 Ga0496106_0186367 Ga0496106_0186367_527_1228 233
1987 3300048910 Ga0496107_0027163 Ga0496107_0027163_1147_1848 233
1988 3300048911 Ga0496108_0376051 Ga0496108_0376051_10_711 233
1989 3300048912 Ga0496109_0242241 Ga0496109_0242241_331_1032 233
1990 3300048913 Ga0496110_0006222 Ga0496110_0006222_1312_2013 233
1991 3300048915 Ga0496112_0067336 Ga0496112_0067336_586_1287 233
1992 3300048915 Ga0496112_0083191 Ga0496112_0083191_1432_2133 233
1993 3300048916 Ga0496113_0048286 Ga0496113_0048286_1563_2264 233
1994 3300048917 Ga0496114_0038555 Ga0496114_0038555_1174_1875 233
1995 3300048918 Ga0496115_0103194 Ga0496115_0103194_907_1608 233
1996 3300048919 Ga0496116_0038766 Ga0496116_0038766_1352_2053 233
1997 3300048920 Ga0496117_0000537 Ga0496117_0000537_39510_40211 233
1998 3300048920 Ga0496117_0001148 Ga0496117_0001148_8951_9652 233
1999 3300048920 Ga0496117_0006421 Ga0496117_0006421_5644_6345 233
2000 3300048920 Ga0496117_0019222 Ga0496117_0019222_3914_4615 233
2001 3300048920 Ga0496117_0057904 Ga0496117_0057904_349_1050 233
2002 3300048921 Ga0496118_0003723 Ga0496118_0003723_4888_5589 233
2003 3300048921 Ga0496118_0005022 Ga0496118_0005022_11322_12023 233
2004 3300048921 Ga0496118_0008675 Ga0496118_0008675_9065_9766 233
2005 3300048921 Ga0496118_0009315 Ga0496118_0009315_7255_7956 233
2006 3300048921 Ga0496118_0032814 Ga0496118_0032814_1818_2519 233
2007 3300048921 Ga0496118_0147261 Ga0496118_0147261_176_877 233
2008 3300048922 Ga0496119_0040771 Ga0496119_0040771_822_1523 233
2009 3300048923 Ga0496120_0065176 Ga0496120_0065176_1072_1773 233
2010 3300048923 Ga0496120_0122037 Ga0496120_0122037_141_842 233
2011 3300048924 Ga0496121_0000280 Ga0496121_0000280_69496_70197 233
2012 3300048924 Ga0496121_0000503 Ga0496121_0000503_2042_2743 233
2013 3300048924 Ga0496121_0007639 Ga0496121_0007639_11325_12026 233
2014 3300048924 Ga0496121_0034462 Ga0496121_0034462_1822_2523 233
2015 3300048924 Ga0496121_0207010 Ga0496121_0207010_549_1250 233
2016 3300048925 Ga0496122_0004718 Ga0496122_0004718_11622_12323 233
2017 3300048926 Ga0496123_0015978 Ga0496123_0015978_1336_2037 233
2018 3300048927 Ga0496124_0007738 Ga0496124_0007738_8836_9537 233
2019 3300048928 Ga0496125_0002885 Ga0496125_0002885_19554_20255 233
2020 3300048928 Ga0496125_0204527 Ga0496125_0204527_383_1084 233
2021 3300048929 Ga0496126_0000034 Ga0496126_0000034_200693_201394 233
2022 3300048929 Ga0496126_0000609 Ga0496126_0000609_65729_66430 233
2023 3300048929 Ga0496126_0001858 Ga0496126_0001858_13230_13931 233
2024 3300048929 Ga0496126_0003147 Ga0496126_0003147_17632_18333 233
2025 3300049459 Ga0495678_011771 Ga0495678_011771_1237_1938 233
2026 3300049459 Ga0495678_040795 Ga0495678_040795_867_1568 233
2027 3300049460 Ga0495682_0027369 Ga0495682_0027369_434_1135 233
2028 3300049460 Ga0495682_0073234 Ga0495682_0073234_443_1144 233
2029 3300061719 Ga0466962_0002089 Ga0466962_0002089_4347_5048 233
2030 3300061719 Ga0466962_0010650 Ga0466962_0010650_989_1690 233
2031 3300061719 Ga0466962_0022902 Ga0466962_0022902_1780_2481 233
2032 3300061719 Ga0466962_0026306 Ga0466962_0026306_138_839 233
2033 iso_pu_bacteria 2596583598 2597031982 233
2034 iso_pu_bacteria 2599185178 2599444101 233
2035 iso_pu_bacteria 2885266251 2885269867 233
2036 iso_pu_bacteria 2900577576 2900579362 233
2037 iso_pu_bacteria 2928058823 2928062324 233
2038 3300046516 Ga0495628_0046223 Ga0495628_0046223_1687_2394 234
2039 3300046529 Ga0495652_0440431 Ga0495652_0440431_119_826 234
2040 3300047319 Ga0495674_0004635 Ga0495674_0004635_4711_5421 234
2041 3300047320 Ga0495672_0062553 Ga0495672_0062553_1392_2102 234
2042 3300047472 Ga0495686_0000032 Ga0495686_0000032_211595_212302 234
2043 3300048929 Ga0496126_0057016 Ga0496126_0057016_1567_2310 234
2044 3300048929 Ga0496126_0263540 Ga0496126_0263540_61_771 234
2045 3300003187 JGI25151J46595_10002448 JGI25151J46595_1000244810 235
2046 3300003187 JGI25151J46595_10011528 JGI25151J46595_100115283 235
2047 3300003187 JGI25151J46595_10022770 JGI25151J46595_100227701 235
2048 3300003771 Ga0055526_1006956 Ga0055526_10069563 235
2049 3300003771 Ga0055526_1007454 Ga0055526_10074543 235
2050 3300003771 Ga0055526_1017826 Ga0055526_10178263 235
2051 3300003773 Ga0055537_1006032 Ga0055537_10060323 235
2052 3300003775 Ga0055524_1001323 Ga0055524_100132312 235
2053 3300003781 Ga0055536_1000108 Ga0055536_100010845 235
2054 3300003784 Ga0055534_1000543 Ga0055534_10005433 235
2055 3300003784 Ga0055534_1001109 Ga0055534_100110910 235
2056 3300006948 Ga0099826_10000029 Ga0099826_1000002991 235
2057 3300025263 Ga0209565_1000252 Ga0209565_10002529 235
2058 3300025263 Ga0209565_1001414 Ga0209565_10014144 235
2059 3300025273 Ga0209673_1042713 Ga0209673_10427132 235
2060 3300025284 Ga0209130_1029262 Ga0209130_10292621 235
2061 3300025291 Ga0209675_1000229 Ga0209675_100022942 235
2062 3300025291 Ga0209675_1000667 Ga0209675_10006679 235
2063 3300025291 Ga0209675_1003353 Ga0209675_10033532 235
2064 3300025292 Ga0209676_1000012 Ga0209676_1000012169 235
2065 3300025294 Ga0209025_1000214 Ga0209025_100021490 235
2066 3300025294 Ga0209025_1000341 Ga0209025_1000341103 235
2067 3300025294 Ga0209025_1000820 Ga0209025_100082044 235
2068 3300025294 Ga0209025_1000963 Ga0209025_100096325 235
2069 3300025294 Ga0209025_1036220 Ga0209025_10362202 235
2070 3300025295 Ga0209564_1000907 Ga0209564_10009076 235
2071 3300025295 Ga0209564_1001183 Ga0209564_100118324 235
2072 3300025295 Ga0209564_1001880 Ga0209564_100188022 235
2073 3300025297 Ga0209758_1002660 Ga0209758_100266014 235
2074 3300025299 Ga0209256_1001006 Ga0209256_100100619 235
2075 3300025299 Ga0209256_1002106 Ga0209256_10021067 235
2076 3300025303 Ga0209051_1006632 Ga0209051_10066324 235
2077 3300025303 Ga0209051_1026625 Ga0209051_10266252 235
2078 3300025735 Ga0207713_1025373 Ga0207713_10253733 235
2079 3300027666 Ga0209282_1000045 Ga0209282_100004599 235
2080 3300046474 Ga0495605_0007499 Ga0495605_0007499_4070_4777 235
2081 3300046500 Ga0495596_0001569 Ga0495596_0001569_7693_8400 235
2082 3300046501 Ga0495607_0087397 Ga0495607_0087397_170_877 235
2083 3300046512 Ga0495610_0002004 Ga0495610_0002004_1097_1804 235
2084 3300046513 Ga0495616_0008065 Ga0495616_0008065_4110_4817 235
2085 3300046538 Ga0495609_0007106 Ga0495609_0007106_2757_3464 235
2086 3300046691 Ga0495670_0111544 Ga0495670_0111544_138_845 235
2087 3300046692 Ga0495671_0007835 Ga0495671_0007835_4309_5016 235
2088 3300047317 Ga0495604_0202842 Ga0495604_0202842_139_846 235
2089 3300047320 Ga0495672_0037026 Ga0495672_0037026_2103_2810 235
2090 3300048915 Ga0496112_0389659 Ga0496112_0389659_499_1206 235
2091 3300048919 Ga0496116_0002151 Ga0496116_0002151_240_947 235
2092 3300048919 Ga0496116_0023999 Ga0496116_0023999_1716_2423 235
2093 3300048925 Ga0496122_0005900 Ga0496122_0005900_973_1680 235
2094 3300048926 Ga0496123_0028879 Ga0496123_0028879_2187_2894 235
2095 3300049571 Ga0501034_0000781 Ga0501034_0000781_14186_14893 235
2096 3300001915 JGI24741J21665_1000285 JGI24741J21665_10002859 237
2097 3300001979 JGI24740J21852_10000252 JGI24740J21852_100002526 237
2098 3300001979 JGI24740J21852_10000398 JGI24740J21852_1000039815 237
2099 3300002705 JGI25156J39149_1008830 JGI25156J39149_10088302 237
2100 3300002705 JGI25156J39149_1023578 JGI25156J39149_10235781 237
2101 3300002738 JGI25154J39366_1000136 JGI25154J39366_10001363 237
2102 3300003479 Ga0006556J51387_1013307 Ga0006556J51387_10133076 237
2103 3300003565 Ga0006560J51390_1028492 Ga0006560J51390_10284922 237
2104 3300003752 Ga0055539_1000061 Ga0055539_100006182 237
2105 3300003756 Ga0055533_1006879 Ga0055533_10068792 237
2106 3300003758 Ga0055532_1000042 Ga0055532_100004267 237
2107 3300003759 Ga0055525_1001197 Ga0055525_10011976 237
2108 3300003760 Ga0055527_1000169 Ga0055527_10001696 237
2109 3300003761 Ga0055535_1000031 Ga0055535_1000031135 237
2110 3300003762 Ga0055542_1001101 Ga0055542_100110112 237
2111 3300003763 Ga0055529_1000075 Ga0055529_100007589 237
2112 3300003763 Ga0055529_1000098 Ga0055529_100009813 237
2113 3300003841 Ga0055541_1000186 Ga0055541_100018614 237
2114 3300003841 Ga0055541_1003030 Ga0055541_10030303 237
2115 3300005344 Ga0070661_100003578 Ga0070661_1000035786 237
2116 3300005366 Ga0070659_100002349 Ga0070659_1000023496 237
2117 3300005455 Ga0070663_100000086 Ga0070663_1000000866 237
2118 3300005564 Ga0070664_100000210 Ga0070664_1000002106 237
2119 3300005577 Ga0068857_100024223 Ga0068857_1000242234 237
2120 3300005578 Ga0068854_100000176 Ga0068854_10000017632 237
2121 3300005614 Ga0068856_100000539 Ga0068856_1000005396 237
2122 3300005616 Ga0068852_100323127 Ga0068852_1003231272 237
2123 3300009093 Ga0105240_10071108 Ga0105240_100711082 237
2124 3300009978 Ga0105148_102784 Ga0105148_1027842 237
2125 3300013100 Ga0157373_10016530 Ga0157373_100165303 237
2126 3300013102 Ga0157371_10001623 Ga0157371_100016237 237
2127 3300013104 Ga0157370_10000766 Ga0157370_1000076614 237
2128 3300013105 Ga0157369_10004121 Ga0157369_1000412114 237
2129 3300013307 Ga0157372_10004320 Ga0157372_100043207 237
2130 3300014497 Ga0182008_10076418 Ga0182008_100764183 237
2131 3300015261 Ga0182006_1003514 Ga0182006_10035146 237
2132 3300015262 Ga0182007_10007176 Ga0182007_100071765 237
2133 3300015265 Ga0182005_1067115 Ga0182005_10671152 237
2134 3300020076 Ga0206355_1446151 Ga0206355_14461514 237
2135 3300020077 Ga0206351_10992658 Ga0206351_109926584 237
2136 3300020610 Ga0154015_1153690 Ga0154015_115369019 237
2137 3300025224 Ga0209784_100003 Ga0209784_1000031318 237
2138 3300025224 Ga0209784_100603 Ga0209784_1006036 237
2139 3300025225 Ga0209566_100002 Ga0209566_1000022272 237
2140 3300025225 Ga0209566_100330 Ga0209566_10033031 237
2141 3300025225 Ga0209566_100783 Ga0209566_10078314 237
2142 3300025226 Ga0209674_100094 Ga0209674_10009489 237
2143 3300025226 Ga0209674_100160 Ga0209674_10016014 237
2144 3300025228 Ga0209672_100096 Ga0209672_10009657 237
2145 3300025229 Ga0209147_100002 Ga0209147_1000021003 237
2146 3300025230 Ga0209563_100004 Ga0209563_1000041689 237
2147 3300025230 Ga0209563_103092 Ga0209563_1030922 237
2148 3300025242 Ga0209258_100002 Ga0209258_1000021003 237
2149 3300025246 Ga0209646_1000019 Ga0209646_1000019208 237
2150 3300025250 Ga0209026_1001786 Ga0209026_10017867 237
2151 3300025253 Ga0209677_100071 Ga0209677_10007159 237
2152 3300025253 Ga0209677_104410 Ga0209677_1044104 237
2153 3300025254 Ga0209148_1000118 Ga0209148_1000118109 237
2154 3300025256 Ga0209759_1004512 Ga0209759_10045122 237
2155 3300025256 Ga0209759_1006777 Ga0209759_10067773 237
2156 3300025272 Ga0209455_1000009 Ga0209455_1000009884 237
2157 3300025913 Ga0207695_10008005 Ga0207695_1000800515 237
2158 3300025920 Ga0207649_10003201 Ga0207649_100032013 237
2159 3300025932 Ga0207690_10004494 Ga0207690_100044943 237
2160 3300025945 Ga0207679_10000240 Ga0207679_1000024033 237
2161 3300025981 Ga0207640_10000049 Ga0207640_1000004982 237
2162 3300026067 Ga0207678_10000353 Ga0207678_1000035332 237
2163 3300026078 Ga0207702_10000550 Ga0207702_1000055032 237
2164 3300026116 Ga0207674_10001491 Ga0207674_1000149117 237
2165 3300026142 Ga0207698_10195093 Ga0207698_101950932 237
2166 3300037312 Ga0395899_0099474 Ga0395899_0099474_730_1443 237
2167 3300037418 Ga0395900_0034380 Ga0395900_0034380_3208_3921 237
2168 3300044658 Ga0466972_0000217 Ga0466972_0000217_973_1686 237
2169 3300044693 Ga0466961_0000078 Ga0466961_0000078_58113_58826 237
2170 3300059505 Ga0587083_0070640 Ga0587083_0070640_18_740 237
2171 3300059641 Ga0587068_019477 Ga0587068_019477_322_1035 237
2172 3300059643 Ga0587072_000141 Ga0587072_000141_1435_2148 237
2173 3300061719 Ga0466962_0045035 Ga0466962_0045035_141_854 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

29

141

0.96

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

179

255

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zes-assembly2.cif.gz_B bef3- activated phob receiver domain 0.9808 4 121
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9757 4 122
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.9749 3 120
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9734 4 122
1mav-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 6.0 in complex with mn2+ 0.9718 3 120
ID Description Score Start End Superfamily
af_P38684_4_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9703 5 88 3.40.50.2300
2iynC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9698 4 121 3.40.50.2300
af_P0AFJ5_1_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.966 1 84 3.40.50.2300
1m5uA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9653 3 120 3.40.50.2300
af_P23836_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9653 4 84 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2V2MZ71-F1-model_v4 Hybrid sensor histidine kinase/response regulator 0.9863 1 121 GO:0000155
AF-A0A532V2V2-F1-model_v4 Response regulatory domain-containing protein 0.9861 2 121 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A1Q4R490-F1-model_v4 Diguanylate cyclase response regulator 0.9845 3 121 GO:0000160
GO:0005886
GO:0043709
GO:0052621
GO:1902201
AF-A0A6P0TXN5-F1-model_v4 Response regulator 0.984 3 121 GO:0000160
AF-A0A7V0T8T9-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9839 2 121 GO:0000155

Feature Viewer

pLDDT pTM Quality
90.72 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map