F496512

General Info

Members Datasets Scaffolds Average Seq Length
2176 831 1899 383

Family's Representative Sequence

Representative Sequence 3300025231|Ga0207427_100042|Ga0207427_100042108
Length 448
Sequence VEGASTIAVDFAARFAGVQQDALEFFLAKFISASSYSPAELPRRNRPASATSVPEPADWITVDLYEYQARDLFEQYGVPVLPGIVADTPEEVRAAAEKLGGVVVVKAQVKVGGRGKAGGVKVAKNPDEAEEAAKAILGLDIKGHIVRRVMVAGGARIAKEFYFSVLLDRANRSYLSLTSVEGGMEIEQLAVEKPEALARIEVDPITGVDAAKAAEIAKAAGFPDDLADKVADVFVKLYEVYKGEDATLVEVNPLVLTEEGDIIALDGKVTLDENAGFRHPNHEALEDKAAADPLEAKAKASDLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHKGVKPANFLDIGGGASAAVMAAGLDVILNDPQVKSVFVNVFGGITACDAVANGIVKALEILGDEANKPLVVRLDGNNVDEGRRILTEAAHPLVTLALTMDEGADKAAELAAK

Samples

Sample ID Description Type Environment
1 2517572101 Frankia sp. DC12 Isolate Nodule
2 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
3 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
4 2547132424 Nocardia nova SH22a Isolate Unclassified
5 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
6 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
7 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
8 2558860280 Kutzneria sp. 744 Isolate Unclassified
9 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
10 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
11 2582580736 Prauserella sp. Am3 Isolate Unclassified
12 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
13 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
14 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
15 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
16 2619618881 Frankia sp. ACN1ag Isolate Unclassified
17 2619619003 Frankia sp. CpI1-P Isolate Nodule
18 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
19 2626541554 Frankia sp. AvcI.1 Isolate Nodule
20 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
21 2643221546 Microbacterium sp. Root53 Isolate Unclassified
22 2643221549 Agromyces sp. Root1464 Isolate Unclassified
23 2643221553 Microbacterium sp. Root553 Isolate Unclassified
24 2643221566 Microbacterium sp. Root166 Isolate Unclassified
25 2643221572 Leifsonia sp. Root60 Isolate Unclassified
26 2643221575 Microbacterium sp. Root61 Isolate Unclassified
27 2643221597 Microbacterium sp. Root180 Isolate Unclassified
28 2643221613 Oerskovia sp. Root22 Isolate Unclassified
29 2643221616 Leifsonia sp. Root227 Isolate Unclassified
30 2643221619 Agromyces sp. Root81 Isolate Unclassified
31 2643221630 Microbacterium sp. Root322 Isolate Unclassified
32 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
33 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
34 2643221649 Leifsonia sp. Root4 Isolate Unclassified
35 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
36 2643221679 Angustibacter sp. Root456 Isolate Unclassified
37 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
38 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
39 2643221692 Nocardia sp. Root136 Isolate Unclassified
40 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
41 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
42 2643221711 Terrabacter sp. Root85 Isolate Unclassified
43 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
44 2643221721 Oerskovia sp. Root918 Isolate Unclassified
45 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
46 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
47 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
48 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
49 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
50 2671180195 Frankia sp. CcI49 Isolate Nodule
51 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
52 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
53 2687453737 Frankia sp. BMG5.36 Isolate Nodule
54 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
55 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
56 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
57 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
58 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
59 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
60 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
61 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
62 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
63 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
64 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
65 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
66 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
67 2739367653 Kocuria sp. OV113 Isolate Unclassified
68 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
69 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
70 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
71 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
72 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
73 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
74 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
75 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
76 2773857759 Microbacterium sp. 1294 Isolate Unclassified
77 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
78 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
79 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
80 2773857922 Frankia sp. CcI49 Isolate Nodule
81 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
82 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
83 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
84 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
85 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
86 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
87 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
88 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
89 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
90 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
91 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
92 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
93 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
94 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
95 2808606372 Agromyces sp. 23-23 Isolate Unclassified
96 2808606394 Promicromonospora sp. C35 Isolate Unclassified
97 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
98 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
99 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
100 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
101 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
102 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
103 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
104 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
105 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
106 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
107 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
108 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
109 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
110 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
111 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
112 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
113 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
114 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
115 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
116 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
117 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
118 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
119 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
120 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
121 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
122 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
123 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
124 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
125 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
126 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
127 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
128 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
129 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
130 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
131 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
132 2857727296 Kocuria sp. R-72562 Isolate Unclassified
133 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
134 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
135 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
136 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
137 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
138 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
139 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
140 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
141 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
142 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
143 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
144 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
145 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
146 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
147 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
148 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
149 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
150 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
151 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
152 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
153 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
154 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
155 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
156 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
157 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
158 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
159 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
160 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
161 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
162 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
163 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
164 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
165 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
166 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
167 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
168 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
169 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
170 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
171 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
172 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
173 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
174 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
175 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
176 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
177 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
178 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
179 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
180 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
181 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
182 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
183 2919069694 Microbacterium sp. 1154 Isolate Unclassified
184 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
185 2919395869 Microbacterium resistens 2980 Isolate Unclassified
186 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
187 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
188 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
189 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
190 2920879853 Kocuria salina CV6 Isolate Unclassified
191 2922554459 Rhodococcus sp. 66b Isolate Unclassified
192 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
193 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
194 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
195 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
196 2928153084 Leifsonia sp. 563 Isolate Unclassified
197 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
198 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
199 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
200 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
201 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
202 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
203 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
204 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
205 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
206 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
207 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
208 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
209 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
210 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
211 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
212 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
213 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
214 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
215 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
216 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
217 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
218 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
219 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
220 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
221 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
222 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
223 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
224 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
225 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
226 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
227 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
228 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
229 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
230 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
231 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
232 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
233 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
234 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
235 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
236 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
237 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
238 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
239 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
240 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
241 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
242 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
243 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
244 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
245 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
246 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
247 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
248 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
249 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
250 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
251 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
252 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
253 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
254 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
255 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
256 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
257 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
258 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
259 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
260 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
261 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
262 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
263 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
264 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
265 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
266 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
267 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
268 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
269 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
270 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
271 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
272 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
273 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
274 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
275 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
276 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
277 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
278 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
279 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
280 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
281 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
282 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
283 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
284 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
285 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
286 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
287 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
288 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
289 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
290 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
291 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
292 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
293 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
294 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
295 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
296 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
297 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
298 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
299 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
300 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
301 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
302 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
303 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
304 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
305 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
306 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
307 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
308 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
309 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
310 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
311 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
312 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
313 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
314 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
315 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
316 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
317 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
318 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
319 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
320 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
321 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
322 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
323 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
324 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
325 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
326 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
327 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
328 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
329 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
330 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
331 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
332 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
333 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
334 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
335 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
336 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
337 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
338 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
339 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
340 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
341 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
342 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
343 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
344 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
345 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
346 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
347 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
348 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
349 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
350 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
351 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
352 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
353 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
354 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
355 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
356 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
357 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
358 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
359 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
360 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
361 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
362 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
363 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
364 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
365 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
366 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
367 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
368 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
369 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
370 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
371 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
372 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
373 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
374 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
375 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
376 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
377 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
378 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
379 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
380 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
381 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
382 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
383 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
384 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
385 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
386 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
387 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
388 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
389 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
390 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
391 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
392 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
393 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
394 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
395 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
396 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
397 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
398 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
399 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
400 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
401 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
402 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
403 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
404 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
405 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
406 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
407 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
408 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
409 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
410 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
411 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
412 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
413 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
414 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
415 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
416 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
457 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
458 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
460 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
461 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
463 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
464 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
465 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
466 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
467 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
468 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
469 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
470 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
471 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
472 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
474 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
475 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
476 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
477 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
478 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
479 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
480 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
481 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
482 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
483 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
484 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
485 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
486 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
487 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
488 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
489 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
490 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
491 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
492 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
493 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
494 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
495 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
496 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
497 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
498 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
499 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
500 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
501 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
502 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
503 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
504 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
505 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
506 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
507 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
508 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
509 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
510 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
511 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
512 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
513 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
514 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
515 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
516 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
517 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
518 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
519 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
520 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
521 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
522 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
523 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
524 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
525 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
526 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
527 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
528 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
529 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
530 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
531 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
532 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
533 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
534 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
535 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
536 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
537 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
538 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
539 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
540 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
541 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
542 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
543 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
544 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
545 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
546 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
547 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
548 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
549 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
550 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
551 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
552 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
553 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
554 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
555 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
556 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
557 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
558 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
559 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
560 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
561 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
562 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
563 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
564 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
565 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
566 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
567 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
568 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
569 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
570 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
571 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
572 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
573 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
574 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
575 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
576 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
577 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
578 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
579 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
580 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
581 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
582 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
583 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
584 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
585 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
586 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
587 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
588 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
589 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
590 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
591 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
592 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
593 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
594 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
595 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
596 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
597 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
598 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
599 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
600 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
601 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
602 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
603 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
604 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
605 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
606 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
607 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
608 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
609 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
610 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
611 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
612 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
613 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
614 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
615 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
616 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
617 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
618 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
619 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
620 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
621 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
622 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
623 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
624 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
625 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
626 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
627 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
628 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
629 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
630 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
631 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
632 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
633 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
634 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
635 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
636 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
637 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
638 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
639 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
640 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
641 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
642 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
643 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
644 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
645 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
646 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
647 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
648 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
649 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
650 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
651 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
652 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
653 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
654 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
655 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
656 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
657 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
658 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
659 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
660 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
661 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
662 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
663 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
664 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
665 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
666 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
667 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
668 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
669 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
670 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
671 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
672 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
673 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
674 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
675 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
676 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
677 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
678 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
679 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
680 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
681 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
682 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
683 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
684 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
685 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
686 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
687 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
688 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
689 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
690 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
691 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
692 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
693 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
694 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
695 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
696 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
697 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
698 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
699 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
700 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
701 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
702 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
703 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
704 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
705 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
706 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
707 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
708 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
709 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
710 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
711 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
712 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
713 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
714 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
715 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
716 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
717 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
718 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
719 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
720 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
721 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
722 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
723 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
724 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
725 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
726 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
727 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
728 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
729 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
730 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
731 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
732 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
733 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
734 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
735 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
736 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
737 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
738 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
739 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
740 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
741 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
742 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
743 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
744 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
745 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
746 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
747 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
748 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
749 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
750 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
751 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
752 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
753 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
754 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
755 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
756 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
757 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
758 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
759 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
760 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
761 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
762 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
763 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
764 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
765 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
766 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
767 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
768 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
769 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
770 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
771 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
772 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
773 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
774 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
775 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
776 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
777 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
778 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
779 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
780 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
781 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
782 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
783 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
784 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
785 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
786 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
787 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
788 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
789 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
790 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
791 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
792 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
793 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
794 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
795 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
796 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
797 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
798 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
799 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
800 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
801 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
802 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
803 8002784119 Frankia sp. AgB1.9 Isolate Nodule
804 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
805 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
806 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
807 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
808 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
809 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
810 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
811 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
812 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
813 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
814 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
815 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
816 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
817 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
818 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
819 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
820 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
821 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
822 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
823 8054920844 Frankia tisae Agncl-8 Isolate Nodule
824 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
825 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
826 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
827 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
828 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
829 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
830 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
831 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.29
Metatranscriptomes 1.98
Isolates 12.73

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 6.8
Nodule 0.64
Rhizoplane 7.9
Rhizosphere 70.4
Stem 0
Stem Tuber 0.09
Unclassified 13.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1002745 3300000549 Bacteria 2421
2 LJQas_1002873 3300000549 Bacteria 2346
3 JGI24746J21847_1001377 3300001977 Bacteria 3876
4 JGI24740J21852_10002318 3300001979 Bacteria 8656
5 JGI24740J21852_10013880 3300001979 Bacteria 2990
6 JGI24737J22298_10016258 3300001990 Bacteria 2402
7 JGI24737J22298_10025699 3300001990 Bacteria 1861
8 JGI24735J21928_10005710 3300002067 Bacteria 4113
9 JGI24735J21928_10006707 3300002067 Bacteria 3779
10 JGI24738J21930_10011645 3300002075 Bacteria 1931
11 JGI24744J21845_10006576 3300002077 Bacteria 2410
12 JGI25162J39368_1004740 3300002737 Bacteria 2998
13 JGI25154J39366_1001298 3300002738 Bacteria 9277
14 JGI25164J39214_1001137 3300002772 Bacteria 7544
15 JGI25152J39213_1000379 3300002773 Bacteria 27322
16 JGI25151J46595_10038948 3300003187 Bacteria 1762
17 JGI25406J46586_10002406 3300003203 Bacteria 8846
18 JGI25165J46597_1000061 3300003214 Bacteria 208362
19 JGI25407J50210_10004858 3300003373 Bacteria 3281
20 Ga0006562J51391_1003827 3300003578 Bacteria 12434
21 Ga0006562J51391_1026496 3300003578 Bacteria 3190
22 Ga0006562J51391_1028453 3300003578 Bacteria 7090
23 Ga0006562J51391_1032082 3300003578 Bacteria 2253
24 Ga0055539_1000005 3300003752 Bacteria 609598
25 Ga0055533_1000001 3300003756 Bacteria 1863437
26 Ga0055525_1000291 3300003759 Bacteria 45088
27 Ga0055527_1000017 3300003760 Bacteria 242362
28 Ga0055542_1000044 3300003762 Bacteria 206982
29 Ga0055542_1005133 3300003762 Bacteria 3017
30 Ga0055529_1000279 3300003763 Bacteria 60946
31 Ga0055540_1000022 3300003792 Bacteria 201257
32 Ga0055540_1007503 3300003792 Bacteria 4100
33 Ga0055540_1017813 3300003792 Bacteria 1968
34 Ga0055541_1000625 3300003841 Bacteria 9362
35 JGI25405J52794_10000005 3300003911 Archaea 32830
36 Ga0065714_10099404 3300005288 Bacteria 1681
37 Ga0065704_10073835 3300005289 Bacteria 6749
38 Ga0070658_10000394 3300005327 Bacteria 37936
39 Ga0070658_10000448 3300005327 Bacteria 35674
40 Ga0070676_10180578 3300005328 Bacteria 1372
41 Ga0070683_100008624 3300005329 Bacteria 8662
42 Ga0070683_100029105 3300005329 Bacteria 4998
43 Ga0070683_100032968 3300005329 Bacteria 4720
44 Ga0070683_100034639 3300005329 Bacteria 4613
45 Ga0070683_100054846 3300005329 Bacteria 3696
46 Ga0070683_100061592 3300005329 Bacteria 3489
47 Ga0070683_100078600 3300005329 Bacteria 3087
48 Ga0070677_10078333 3300005333 Bacteria 1408
49 Ga0068869_100034322 3300005334 Bacteria 3588
50 Ga0070666_10144317 3300005335 Bacteria 1659
51 Ga0070682_100006780 3300005337 Bacteria 6426
52 Ga0070682_100014519 3300005337 Bacteria 4553
53 Ga0070682_100016045 3300005337 Bacteria 4350
54 Ga0070682_100041420 3300005337 Bacteria 2838
55 Ga0068868_100005688 3300005338 Bacteria 8777
56 Ga0068868_100005768 3300005338 Bacteria 8720
57 Ga0068868_100024841 3300005338 Bacteria 4549
58 Ga0068868_100054112 3300005338 Bacteria 3162
59 Ga0068868_100259251 3300005338 Bacteria 1465
60 Ga0070660_100018405 3300005339 Bacteria 5105
61 Ga0070660_100028725 3300005339 Bacteria 4163
62 Ga0070660_100031568 3300005339 Bacteria 3980
63 Ga0070660_100035294 3300005339 Bacteria 3784
64 Ga0070660_100078401 3300005339 Bacteria 2590
65 Ga0070660_100086430 3300005339 Bacteria 2467
66 Ga0070660_100097095 3300005339 Bacteria 2331
67 Ga0070691_10106531 3300005341 Bacteria 1398
68 Ga0070687_100008987 3300005343 Bacteria 4258
69 Ga0070661_100075188 3300005344 Bacteria 2488
70 Ga0070692_10020367 3300005345 Bacteria 3216
71 Ga0070668_100004760 3300005347 Bacteria 10070
72 Ga0070668_100004776 3300005347 Bacteria 10049
73 Ga0070668_100005919 3300005347 Bacteria 9060
74 Ga0070669_100000820 3300005353 Bacteria 22620
75 Ga0070669_100031283 3300005353 Bacteria 3845
76 Ga0070669_100057358 3300005353 Bacteria 2857
77 Ga0070669_100120181 3300005353 Bacteria 2003
78 Ga0070675_100071687 3300005354 Bacteria 2875
79 Ga0070675_100094331 3300005354 Bacteria 2511
80 Ga0070675_100162207 3300005354 Bacteria 1923
81 Ga0070671_100000413 3300005355 Bacteria 29605
82 Ga0070671_100016620 3300005355 Bacteria 5948
83 Ga0070671_100138032 3300005355 Bacteria 2056
84 Ga0070671_100199550 3300005355 Bacteria 1696
85 Ga0070671_100237954 3300005355 Bacteria 1545
86 Ga0070674_100020814 3300005356 Bacteria 4200
87 Ga0070674_100065570 3300005356 Bacteria 2549
88 Ga0070674_100139963 3300005356 Bacteria 1815
89 Ga0070688_100020289 3300005365 Bacteria 3862
90 Ga0070659_100001798 3300005366 Bacteria 15428
91 Ga0070659_100005058 3300005366 Bacteria 9455
92 Ga0070659_100007670 3300005366 Bacteria 7847
93 Ga0070659_100028072 3300005366 Bacteria 4343
94 Ga0070659_100071106 3300005366 Bacteria 2766
95 Ga0070659_100091466 3300005366 Bacteria 2439
96 Ga0070659_100182920 3300005366 Bacteria 1721
97 Ga0070667_100000605 3300005367 Bacteria 34996
98 Ga0070667_100000674 3300005367 Bacteria 33136
99 Ga0070667_100001634 3300005367 Bacteria 20056
100 Ga0070667_100010065 3300005367 Bacteria 7832
101 Ga0070667_100023104 3300005367 Bacteria 5158
102 Ga0070709_10012741 3300005434 Bacteria 4711
103 Ga0070709_10024755 3300005434 Bacteria 3537
104 Ga0070714_100046967 3300005435 Bacteria 3665
105 Ga0070714_100051731 3300005435 Bacteria 3503
106 Ga0070714_100065288 3300005435 Bacteria 3134
107 Ga0070714_100066546 3300005435 Bacteria 3105
108 Ga0070714_100160700 3300005435 Bacteria 2032
109 Ga0070714_100164208 3300005435 Bacteria 2011
110 Ga0070714_100207909 3300005435 Bacteria 1793
111 Ga0070713_100003424 3300005436 Bacteria 10477
112 Ga0070713_100049495 3300005436 Bacteria 3467
113 Ga0070710_10001407 3300005437 Bacteria 11356
114 Ga0070710_10016635 3300005437 Bacteria 3747
115 Ga0070701_10003564 3300005438 Bacteria 6181
116 Ga0070711_100006432 3300005439 Bacteria 7085
117 Ga0070711_100043841 3300005439 Bacteria 3032
118 Ga0070700_100000049 3300005441 Bacteria 89497
119 Ga0070700_100017266 3300005441 Bacteria 4122
120 Ga0070700_100026697 3300005441 Bacteria 3414
121 Ga0070700_100034233 3300005441 Bacteria 3067
122 Ga0070700_100196840 3300005441 Bacteria 1413
123 Ga0070694_100014338 3300005444 Bacteria 4960
124 Ga0070663_100047102 3300005455 Bacteria 3053
125 Ga0070663_100059261 3300005455 Bacteria 2752
126 Ga0070663_100126923 3300005455 Bacteria 1933
127 Ga0070678_100001296 3300005456 Bacteria 13268
128 Ga0070678_100031232 3300005456 Bacteria 3671
129 Ga0070678_100177184 3300005456 Bacteria 1742
130 Ga0070678_100185230 3300005456 Bacteria 1708
131 Ga0070662_100014959 3300005457 Bacteria 5188
132 Ga0070681_10009503 3300005458 Bacteria 9573
133 Ga0070681_10310482 3300005458 Bacteria 1486
134 Ga0068867_100002347 3300005459 Bacteria 13325
135 Ga0068867_100044172 3300005459 Bacteria 3264
136 Ga0070685_10043877 3300005466 Bacteria 2558
137 Ga0070706_100006459 3300005467 Bacteria 11069
138 Ga0070706_100012286 3300005467 Bacteria 7935
139 Ga0070706_100064391 3300005467 Bacteria 3389
140 Ga0070707_100006726 3300005468 Bacteria 10657
141 Ga0070707_100011559 3300005468 Bacteria 8234
142 Ga0070707_100019191 3300005468 Bacteria 6441
143 Ga0070707_100091207 3300005468 Bacteria 2950
144 Ga0070707_100188369 3300005468 Bacteria 2011
145 Ga0070698_100007659 3300005471 Bacteria 11684
146 Ga0070698_100012160 3300005471 Bacteria 9118
147 Ga0070698_100018135 3300005471 Bacteria 7408
148 Ga0070698_100117481 3300005471 Bacteria 2622
149 Ga0070679_100011185 3300005530 Bacteria 8551
150 Ga0070679_100157345 3300005530 Bacteria 2247
151 Ga0070679_100195083 3300005530 Bacteria 1993
152 Ga0070679_100388985 3300005530 Bacteria 1341
153 Ga0070684_100008109 3300005535 Bacteria 8198
154 Ga0070684_100010114 3300005535 Bacteria 7460
155 Ga0070684_100010640 3300005535 Bacteria 7295
156 Ga0070684_100056129 3300005535 Bacteria 3436
157 Ga0070684_100071021 3300005535 Bacteria 3064
158 Ga0068853_100003640 3300005539 Bacteria 11814
159 Ga0068853_100017372 3300005539 Bacteria 5941
160 Ga0068853_100022417 3300005539 Bacteria 5274
161 Ga0068853_100029542 3300005539 Bacteria 4622
162 Ga0068853_100062708 3300005539 Bacteria 3218
163 Ga0068853_100089100 3300005539 Bacteria 2710
164 Ga0070672_100011247 3300005543 Bacteria 6241
165 Ga0070672_100044260 3300005543 Bacteria 3437
166 Ga0070672_100060413 3300005543 Bacteria 2984
167 Ga0070686_100044352 3300005544 Bacteria 2795
168 Ga0070695_100016540 3300005545 Bacteria 4465
169 Ga0070696_100001265 3300005546 Bacteria 16421
170 Ga0070665_100000450 3300005548 Bacteria 59867
171 Ga0070665_100003803 3300005548 Bacteria 15980
172 Ga0070665_100004177 3300005548 Bacteria 15190
173 Ga0070665_100029488 3300005548 Bacteria 5522
174 Ga0070665_100042334 3300005548 Bacteria 4577
175 Ga0070665_100128311 3300005548 Bacteria 2539
176 Ga0070665_100287046 3300005548 Bacteria 1648
177 Ga0070704_100000144 3300005549 Bacteria 26925
178 Ga0070704_100027059 3300005549 Bacteria 3797
179 Ga0070704_100041179 3300005549 Archaea 3186
180 Ga0070704_100070886 3300005549 Bacteria 2530
181 Ga0068855_100026886 3300005563 Bacteria 6884
182 Ga0068855_100034488 3300005563 Bacteria 6035
183 Ga0068855_100046784 3300005563 Bacteria 5113
184 Ga0068855_100066766 3300005563 Bacteria 4193
185 Ga0068855_100081308 3300005563 Bacteria 3756
186 Ga0068855_100090254 3300005563 Bacteria 3537
187 Ga0068855_100163748 3300005563 Bacteria 2522
188 Ga0068857_100005690 3300005577 Bacteria 10655
189 Ga0068857_100035843 3300005577 Bacteria 4395
190 Ga0068857_100266979 3300005577 Bacteria 1572
191 Ga0068854_100003304 3300005578 Bacteria 10052
192 Ga0068854_100140557 3300005578 Bacteria 1852
193 Ga0068856_100022435 3300005614 Bacteria 6138
194 Ga0068856_100025251 3300005614 Bacteria 5790
195 Ga0068856_100026637 3300005614 Bacteria 5637
196 Ga0068856_100046003 3300005614 Bacteria 4298
197 Ga0068856_100048666 3300005614 Bacteria 4178
198 Ga0068856_100092229 3300005614 Bacteria 3014
199 Ga0068856_100230588 3300005614 Bacteria 1867
200 Ga0070702_100007562 3300005615 Bacteria 5205
201 Ga0070702_100021808 3300005615 Bacteria 3377
202 Ga0070702_100022733 3300005615 Bacteria 3321
203 Ga0068852_100006651 3300005616 Bacteria 8377
204 Ga0068852_100031767 3300005616 Bacteria 4363
205 Ga0068852_100032864 3300005616 Bacteria 4301
206 Ga0068852_100042387 3300005616 Bacteria 3853
207 Ga0068852_100058986 3300005616 Bacteria 3327
208 Ga0068852_100219404 3300005616 Bacteria 1808
209 Ga0068859_100001784 3300005617 Bacteria 21903
210 Ga0068859_100002254 3300005617 Bacteria 19564
211 Ga0068859_100012347 3300005617 Bacteria 8592
212 Ga0068859_100144251 3300005617 Bacteria 2455
213 Ga0068864_100025782 3300005618 Bacteria 4956
214 Ga0068864_100075408 3300005618 Bacteria 2945
215 Ga0068866_10000517 3300005718 Bacteria 17836
216 Ga0068866_10041100 3300005718 Bacteria 2293
217 Ga0068866_10058969 3300005718 Bacteria 1984
218 Ga0068861_100001353 3300005719 Bacteria 15407
219 Ga0068861_100055079 3300005719 Bacteria 3031
220 Ga0068861_100132503 3300005719 Bacteria 2024
221 Ga0068851_10000022 3300005834 Bacteria 129607
222 Ga0068870_10006332 3300005840 Bacteria 5213
223 Ga0068863_100003048 3300005841 Bacteria 16555
224 Ga0068863_100035553 3300005841 Bacteria 4745
225 Ga0068858_100000016 3300005842 Bacteria 193130
226 Ga0068858_100000179 3300005842 Bacteria 66961
227 Ga0068858_100005465 3300005842 Bacteria 12444
228 Ga0068858_100012390 3300005842 Bacteria 8040
229 Ga0068858_100081802 3300005842 Bacteria 3002
230 Ga0068860_100000087 3300005843 Bacteria 158242
231 Ga0068860_100000154 3300005843 Bacteria 111793
232 Ga0068860_100017715 3300005843 Bacteria 6938
233 Ga0068860_100170998 3300005843 Bacteria 2099
234 Ga0068862_100000190 3300005844 Bacteria 67924
235 Ga0068862_100000312 3300005844 Bacteria 53263
236 Ga0068862_100004977 3300005844 Bacteria 11184
237 Ga0081455_10000082 3300005937 Bacteria 103704
238 Ga0081455_10010276 3300005937 Bacteria 9517
239 Ga0081455_10079007 3300005937 Bacteria 2702
240 Ga0081455_10098153 3300005937 Bacteria 2359
241 Ga0081455_10121819 3300005937 Bacteria 2054
242 Ga0081538_10001382 3300005981 Bacteria 24879
243 Ga0081538_10001794 3300005981 Bacteria 21673
244 Ga0081540_1003861 3300005983 Bacteria 11697
245 Ga0081540_1004047 3300005983 Bacteria 11355
246 Ga0081539_10000467 3300005985 Bacteria 85390
247 Ga0081539_10027400 3300005985 Bacteria 3610
248 Ga0081539_10072469 3300005985 Bacteria 1841
249 Ga0070717_10007764 3300006028 Bacteria 7983
250 Ga0070717_10081630 3300006028 Bacteria 2715
251 Ga0075365_10002456 3300006038 Bacteria 9101
252 Ga0075365_10028961 3300006038 Bacteria 3535
253 Ga0075365_10033360 3300006038 Bacteria 3316
254 Ga0075365_10034198 3300006038 Bacteria 3281
255 Ga0075365_10058458 3300006038 Bacteria 2567
256 Ga0075365_10065175 3300006038 Bacteria 2441
257 Ga0075363_100000201 3300006048 Bacteria 16359
258 Ga0075363_100003979 3300006048 Bacteria 6389
259 Ga0075363_100009777 3300006048 Bacteria 4520
260 Ga0075363_100065368 3300006048 Bacteria 1966
261 Ga0075363_100067724 3300006048 Bacteria 1935
262 Ga0075364_10000723 3300006051 Bacteria 17264
263 Ga0075364_10003104 3300006051 Bacteria 9396
264 Ga0075364_10010199 3300006051 Bacteria 5665
265 Ga0075364_10024783 3300006051 Bacteria 3812
266 Ga0075364_10034632 3300006051 Bacteria 3259
267 Ga0075364_10037917 3300006051 Bacteria 3122
268 Ga0075364_10126099 3300006051 Bacteria 1716
269 Ga0075364_10133480 3300006051 Bacteria 1667
270 Ga0070715_10001150 3300006163 Bacteria 7570
271 Ga0070715_10055444 3300006163 Bacteria 1720
272 Ga0070716_100007290 3300006173 Bacteria 5440
273 Ga0070712_100002802 3300006175 Bacteria 10778
274 Ga0070712_100012929 3300006175 Bacteria 5318
275 Ga0070712_100032414 3300006175 Bacteria 3529
276 Ga0070712_100036549 3300006175 Bacteria 3343
277 Ga0070712_100117682 3300006175 Bacteria 1995
278 Ga0075362_10029281 3300006177 Bacteria 2372
279 Ga0075367_10031724 3300006178 Bacteria 3036
280 Ga0075367_10032134 3300006178 Bacteria 3017
281 Ga0075367_10177514 3300006178 Bacteria 1327
282 Ga0075369_10002730 3300006186 Bacteria 6330
283 Ga0075369_10004308 3300006186 Bacteria 5244
284 Ga0075369_10004998 3300006186 Bacteria 4935
285 Ga0075369_10005608 3300006186 Bacteria 4699
286 Ga0075369_10085197 3300006186 Bacteria 1405
287 Ga0097621_100151492 3300006237 Bacteria 1989
288 Ga0075370_10044515 3300006353 Bacteria 2509
289 Ga0075370_10061384 3300006353 Bacteria 2141
290 Ga0075370_10074977 3300006353 Bacteria 1939
291 Ga0075428_100005250 3300006844 Bacteria 14401
292 Ga0075428_100031735 3300006844 Bacteria 5835
293 Ga0075430_100000294 3300006846 Bacteria 35128
294 Ga0075430_100062808 3300006846 Bacteria 3119
295 Ga0075431_100062538 3300006847 Bacteria 3841
296 Ga0075431_100075899 3300006847 Bacteria 3468
297 Ga0075431_100360363 3300006847 Bacteria 1461
298 Ga0075433_10122858 3300006852 Unclassified 2306
299 Ga0075433_10300617 3300006852 Bacteria 1421
300 Ga0075434_100007636 3300006871 Archaea 10007
301 Ga0075429_100023377 3300006880 Bacteria 5364
302 Ga0075429_100070519 3300006880 Bacteria 3043
303 Ga0068865_100002468 3300006881 Bacteria 10946
304 Ga0068865_100044021 3300006881 Bacteria 3053
305 Ga0068865_100066192 3300006881 Bacteria 2548
306 Ga0068865_100278411 3300006881 Bacteria 1331
307 Ga0097620_100000049 3300006931 Bacteria 137619
308 Ga0097620_100001784 3300006931 Bacteria 21903
309 Ga0097620_100002254 3300006931 Bacteria 19564
310 Ga0097620_100012347 3300006931 Bacteria 8592
311 Ga0097620_100144244 3300006931 Bacteria 2455
312 Ga0075435_100011202 3300007076 Bacteria 6581
313 Ga0099794_10000314 3300007265 Bacteria 16524
314 Ga0105244_10033017 3300009036 Bacteria 2733
315 Ga0105244_10033778 3300009036 Bacteria 2695
316 Ga0105244_10112258 3300009036 Bacteria 1325
317 Ga0105240_10005015 3300009093 Bacteria 19863
318 Ga0105240_10051407 3300009093 Bacteria 5185
319 Ga0105240_10085563 3300009093 Bacteria 3863
320 Ga0105240_10313825 3300009093 Bacteria 1789
321 Ga0111539_10094250 3300009094 Bacteria 3517
322 Ga0105245_10004537 3300009098 Bacteria 12260
323 Ga0105245_10006332 3300009098 Bacteria 10414
324 Ga0105245_10025093 3300009098 Bacteria 5241
325 Ga0105245_10111351 3300009098 Bacteria 2546
326 Ga0105245_10126199 3300009098 Bacteria 2396
327 Ga0105245_10149353 3300009098 Bacteria 2208
328 Ga0105247_10000159 3300009101 Bacteria 66013
329 Ga0105247_10000376 3300009101 Bacteria 37966
330 Ga0105247_10004231 3300009101 Bacteria 9201
331 Ga0105247_10043655 3300009101 Bacteria 2747
332 Ga0114129_10025993 3300009147 Bacteria 8290
333 Ga0114129_10043021 3300009147 Bacteria 6357
334 Ga0114129_10063215 3300009147 Bacteria 5170
335 Ga0105243_10012483 3300009148 Bacteria 6424
336 Ga0105243_10029324 3300009148 Bacteria 4230
337 Ga0105243_10069791 3300009148 Bacteria 2835
338 Ga0105243_10201321 3300009148 Bacteria 1746
339 Ga0105241_10007128 3300009174 Bacteria 8229
340 Ga0105241_10023785 3300009174 Bacteria 4546
341 Ga0105242_10000880 3300009176 Bacteria 23297
342 Ga0105242_10018500 3300009176 Bacteria 5448
343 Ga0105242_10135002 3300009176 Bacteria 2134
344 Ga0105242_10196341 3300009176 Bacteria 1790
345 Ga0105248_10000050 3300009177 Bacteria 152667
346 Ga0105248_10015100 3300009177 Bacteria 8506
347 Ga0105248_10058631 3300009177 Bacteria 4324
348 Ga0105248_10071820 3300009177 Bacteria 3889
349 Ga0105248_10085325 3300009177 Bacteria 3553
350 Ga0105248_10093820 3300009177 Bacteria 3380
351 Ga0105248_10102045 3300009177 Bacteria 3233
352 Ga0105248_10139647 3300009177 Bacteria 2733
353 Ga0105237_10000302 3300009545 Bacteria 68290
354 Ga0105237_10001065 3300009545 Bacteria 36852
355 Ga0105237_10004166 3300009545 Bacteria 16835
356 Ga0105237_10005434 3300009545 Bacteria 14389
357 Ga0105237_10035167 3300009545 Bacteria 5071
358 Ga0105237_10059928 3300009545 Bacteria 3808
359 Ga0105237_10139560 3300009545 Bacteria 2418
360 Ga0105237_10140579 3300009545 Bacteria 2408
361 Ga0105238_10026434 3300009551 Bacteria 5918
362 Ga0105238_10053225 3300009551 Bacteria 4068
363 Ga0105238_10133069 3300009551 Bacteria 2465
364 Ga0105249_10000042 3300009553 Bacteria 195242
365 Ga0105249_10010531 3300009553 Bacteria 8123
366 Ga0105249_10048212 3300009553 Bacteria 3884
367 Ga0105249_10082403 3300009553 Bacteria 2993
368 Ga0105249_10128286 3300009553 Bacteria 2418
369 Ga0105249_10172445 3300009553 Bacteria 2099
370 Ga0105249_10267898 3300009553 Bacteria 1700
371 Ga0105239_10004010 3300010375 Bacteria 17835
372 Ga0105239_10012785 3300010375 Bacteria 9339
373 Ga0105239_10100347 3300010375 Bacteria 3202
374 Ga0105246_10003745 3300011119 Bacteria 9219
375 Ga0105246_10073964 3300011119 Bacteria 2407
376 Ga0105246_10094175 3300011119 Bacteria 2166
377 Ga0105246_10096186 3300011119 Bacteria 2146
378 Ga0105246_10130680 3300011119 Bacteria 1875
379 Ga0157373_10035357 3300013100 Bacteria 3587
380 Ga0157371_10041403 3300013102 Bacteria 3287
381 Ga0157371_10066105 3300013102 Bacteria 2561
382 Ga0157371_10069843 3300013102 Bacteria 2487
383 Ga0157370_10002163 3300013104 Bacteria 23996
384 Ga0157370_10007445 3300013104 Bacteria 11901
385 Ga0157370_10027650 3300013104 Bacteria 5591
386 Ga0157370_10034752 3300013104 Bacteria 4904
387 Ga0157370_10046918 3300013104 Bacteria 4141
388 Ga0157370_10293017 3300013104 Bacteria 1503
389 Ga0157369_10000230 3300013105 Bacteria 77399
390 Ga0157369_10002312 3300013105 Bacteria 22937
391 Ga0157369_10010811 3300013105 Bacteria 10392
392 Ga0157369_10012349 3300013105 Bacteria 9697
393 Ga0157369_10014343 3300013105 Bacteria 8948
394 Ga0157369_10022758 3300013105 Bacteria 6988
395 Ga0157369_10067879 3300013105 Bacteria 3832
396 Ga0157369_10132655 3300013105 Bacteria 2639
397 Ga0157369_10149419 3300013105 Bacteria 2469
398 Ga0157369_10199267 3300013105 Bacteria 2102
399 Ga0171462_1001 3300013250 Bacteria 1135406
400 Ga0157374_10011242 3300013296 Bacteria 7742
401 Ga0157374_10041552 3300013296 Bacteria 4238
402 Ga0157378_10003787 3300013297 Bacteria 13406
403 Ga0157378_10033544 3300013297 Bacteria 4540
404 Ga0157378_10085185 3300013297 Bacteria 2863
405 Ga0163162_10029817 3300013306 Bacteria 5401
406 Ga0163162_10046065 3300013306 Bacteria 4371
407 Ga0163162_10084959 3300013306 Bacteria 3241
408 Ga0163162_10195861 3300013306 Bacteria 2149
409 Ga0157372_10001405 3300013307 Bacteria 25975
410 Ga0157372_10022392 3300013307 Bacteria 6836
411 Ga0157372_10069659 3300013307 Bacteria 3956
412 Ga0157372_10079284 3300013307 Bacteria 3713
413 Ga0157372_10088253 3300013307 Bacteria 3521
414 Ga0157372_10092930 3300013307 Bacteria 3432
415 Ga0157372_10222180 3300013307 Bacteria 2189
416 Ga0157375_10013718 3300013308 Bacteria 7223
417 Ga0157375_10016612 3300013308 Bacteria 6618
418 Ga0157375_10076311 3300013308 Bacteria 3378
419 Ga0157375_10087739 3300013308 Bacteria 3164
420 Ga0157375_10102159 3300013308 Bacteria 2952
421 Ga0157375_10236263 3300013308 Bacteria 1987
422 Ga0163163_10004486 3300014325 Bacteria 11910
423 Ga0163163_10056964 3300014325 Bacteria 3864
424 Ga0163163_10072366 3300014325 Bacteria 3436
425 Ga0163163_10104359 3300014325 Bacteria 2860
426 Ga0163163_10235044 3300014325 Bacteria 1882
427 Ga0163163_10342163 3300014325 Bacteria 1551
428 Ga0157380_10192700 3300014326 Bacteria 1801
429 Ga0157377_10024809 3300014745 Bacteria 3191
430 Ga0157379_10002686 3300014968 Bacteria 14987
431 Ga0157379_10004386 3300014968 Bacteria 12078
432 Ga0157379_10008257 3300014968 Bacteria 9047
433 Ga0157379_10016792 3300014968 Bacteria 6442
434 Ga0157379_10051898 3300014968 Bacteria 3661
435 Ga0157379_10219592 3300014968 Bacteria 1722
436 Ga0163161_10010839 3300017792 Bacteria 6319
437 Ga0163161_10031311 3300017792 Bacteria 3789
438 Ga0163161_10039383 3300017792 Bacteria 3393
439 Ga0163161_10116809 3300017792 Bacteria 2000
440 Ga0197907_10127029 3300020069 Bacteria 2971
441 Ga0197907_10587311 3300020069 Bacteria 1293
442 Ga0206356_10558971 3300020070 Bacteria 1253
443 Ga0206351_10127684 3300020077 Bacteria 1806
444 Ga0206351_10456609 3300020077 Bacteria 1899
445 Ga0206350_10025198 3300020080 Bacteria 1647
446 Ga0206350_11148788 3300020080 Bacteria 1296
447 Ga0206354_11217485 3300020081 Bacteria 4008
448 Ga0206354_11437303 3300020081 Bacteria 1245
449 Ga0206353_11101538 3300020082 Bacteria 2505
450 Ga0213875_10011668 3300021388 Bacteria 4364
451 Ga0213871_10015809 3300021441 Bacteria 1810
452 Ga0224712_10010230 3300022467 Bacteria 2862
453 Ga0224712_10020419 3300022467 Bacteria 2249
454 Ga0224712_10023129 3300022467 Bacteria 2153
455 Ga0224712_10042451 3300022467 Bacteria 1723
456 Ga0224572_1006386 3300024225 Bacteria 2132
457 Ga0209566_100053 3300025225 Bacteria 224436
458 Ga0209674_100001 3300025226 Bacteria 4013750
459 Ga0209672_100039 3300025228 Bacteria 283064
460 Ga0209147_100507 3300025229 Bacteria 22670
461 Ga0209563_100001 3300025230 Bacteria 4013775
462 Ga0207427_100042 3300025231 Bacteria 254170
463 Ga0209437_100369 3300025233 Bacteria 47150
464 Ga0207425_1009908 3300025245 Bacteria 2343
465 Ga0209646_1000088 3300025246 Bacteria 192345
466 Ga0209677_100001 3300025253 Bacteria 4013787
467 Ga0209677_100448 3300025253 Bacteria 23936
468 Ga0209148_1000004 3300025254 Bacteria 1844481
469 Ga0209148_1002289 3300025254 Bacteria 6896
470 Ga0209148_1010632 3300025254 Bacteria 1737
471 Ga0209129_1000109 3300025258 Bacteria 153068
472 Ga0209233_1000001 3300025261 Bacteria 2992747
473 Ga0209455_1000117 3300025272 Bacteria 176940
474 Ga0209455_1001874 3300025272 Bacteria 8783
475 Ga0209673_1017529 3300025273 Bacteria 2638
476 Ga0209025_1000984 3300025294 Bacteria 42427
477 Ga0209051_1000033 3300025303 Bacteria 380540
478 Ga0209051_1000633 3300025303 Bacteria 40448
479 Ga0209051_1002844 3300025303 Bacteria 11927
480 Ga0209051_1015719 3300025303 Bacteria 3467
481 Ga0209051_1029411 3300025303 Bacteria 2151
482 Ga0207697_10077557 3300025315 Bacteria 1397
483 Ga0207656_10000005 3300025321 Bacteria 490514
484 Ga0207655_1021163 3300025728 Bacteria 3312
485 Ga0207655_1025368 3300025728 Bacteria 2880
486 Ga0207655_1062958 3300025728 Bacteria 1424
487 Ga0207713_1034408 3300025735 Bacteria 2201
488 Ga0207682_10005955 3300025893 Bacteria 4932
489 Ga0207692_10026792 3300025898 Bacteria 2707
490 Ga0207642_10000166 3300025899 Bacteria 18838
491 Ga0207642_10067166 3300025899 Bacteria 1691
492 Ga0207642_10085016 3300025899 Bacteria 1547
493 Ga0207710_10000017 3300025900 Bacteria 370962
494 Ga0207710_10000019 3300025900 Bacteria 339682
495 Ga0207710_10000173 3300025900 Bacteria 66353
496 Ga0207688_10008958 3300025901 Bacteria 5447
497 Ga0207688_10114156 3300025901 Bacteria 1571
498 Ga0207647_10009465 3300025904 Bacteria 6921
499 Ga0207647_10023826 3300025904 Bacteria 4043
500 Ga0207647_10027988 3300025904 Bacteria 3669
501 Ga0207647_10046699 3300025904 Bacteria 2697
502 Ga0207685_10000910 3300025905 Bacteria 5637
503 Ga0207685_10056806 3300025905 Bacteria 1533
504 Ga0207645_10029223 3300025907 Bacteria 3554
505 Ga0207643_10065259 3300025908 Bacteria 2085
506 Ga0207705_10000001 3300025909 Bacteria 2061880
507 Ga0207705_10054377 3300025909 Bacteria 2885
508 Ga0207705_10063392 3300025909 Bacteria 2670
509 Ga0207705_10150677 3300025909 Bacteria 1743
510 Ga0207684_10012433 3300025910 Bacteria 7405
511 Ga0207654_10000001 3300025911 Bacteria 1816198
512 Ga0207707_10008370 3300025912 Bacteria 8976
513 Ga0207707_10008629 3300025912 Bacteria 8841
514 Ga0207707_10142229 3300025912 Bacteria 2098
515 Ga0207695_10004239 3300025913 Bacteria 19705
516 Ga0207695_10011642 3300025913 Bacteria 10631
517 Ga0207671_10000016 3300025914 Bacteria 435413
518 Ga0207671_10002478 3300025914 Bacteria 19723
519 Ga0207671_10018148 3300025914 Bacteria 5406
520 Ga0207671_10097567 3300025914 Bacteria 2222
521 Ga0207671_10126529 3300025914 Bacteria 1958
522 Ga0207693_10000366 3300025915 Bacteria 41351
523 Ga0207693_10000550 3300025915 Bacteria 33865
524 Ga0207693_10004959 3300025915 Bacteria 11185
525 Ga0207693_10005203 3300025915 Bacteria 10890
526 Ga0207693_10015176 3300025915 Bacteria 6182
527 Ga0207693_10019113 3300025915 Bacteria 5453
528 Ga0207693_10127422 3300025915 Bacteria 2001
529 Ga0207693_10227148 3300025915 Bacteria 1466
530 Ga0207663_10019629 3300025916 Bacteria 3813
531 Ga0207660_10017090 3300025917 Bacteria 4814
532 Ga0207660_10111176 3300025917 Bacteria 2062
533 Ga0207660_10200760 3300025917 Bacteria 1557
534 Ga0207662_10014650 3300025918 Bacteria 4402
535 Ga0207657_10005602 3300025919 Bacteria 13110
536 Ga0207657_10010726 3300025919 Bacteria 9124
537 Ga0207657_10012581 3300025919 Bacteria 8341
538 Ga0207657_10035747 3300025919 Bacteria 4452
539 Ga0207657_10041968 3300025919 Bacteria 4040
540 Ga0207657_10068982 3300025919 Bacteria 3002
541 Ga0207657_10080923 3300025919 Bacteria 2729
542 Ga0207657_10090348 3300025919 Bacteria 2556
543 Ga0207652_10006710 3300025921 Bacteria 9274
544 Ga0207652_10033838 3300025921 Bacteria 4305
545 Ga0207652_10205567 3300025921 Bacteria 1772
546 Ga0207652_10208365 3300025921 Bacteria 1760
547 Ga0207652_10230134 3300025921 Bacteria 1671
548 Ga0207646_10000477 3300025922 Bacteria 53501
549 Ga0207646_10000516 3300025922 Bacteria 51539
550 Ga0207646_10000701 3300025922 Bacteria 43458
551 Ga0207646_10004516 3300025922 Bacteria 15070
552 Ga0207646_10005407 3300025922 Bacteria 13435
553 Ga0207646_10006235 3300025922 Bacteria 12393
554 Ga0207646_10032861 3300025922 Bacteria 4693
555 Ga0207646_10302369 3300025922 Bacteria 1445
556 Ga0207681_10003622 3300025923 Bacteria 9604
557 Ga0207681_10012735 3300025923 Bacteria 5195
558 Ga0207681_10124519 3300025923 Bacteria 1895
559 Ga0207694_10000057 3300025924 Bacteria 146441
560 Ga0207694_10011213 3300025924 Bacteria 6767
561 Ga0207650_10050965 3300025925 Bacteria 3062
562 Ga0207650_10090769 3300025925 Bacteria 2333
563 Ga0207650_10278000 3300025925 Bacteria 1362
564 Ga0207650_10339941 3300025925 Bacteria 1233
565 Ga0207659_10071749 3300025926 Bacteria 2529
566 Ga0207659_10102824 3300025926 Bacteria 2157
567 Ga0207687_10001986 3300025927 Bacteria 14051
568 Ga0207687_10002057 3300025927 Bacteria 13776
569 Ga0207687_10006572 3300025927 Bacteria 7670
570 Ga0207687_10028962 3300025927 Bacteria 3722
571 Ga0207687_10051744 3300025927 Bacteria 2864
572 Ga0207687_10057739 3300025927 Bacteria 2728
573 Ga0207687_10111857 3300025927 Bacteria 2028
574 Ga0207700_10028709 3300025928 Bacteria 3916
575 Ga0207700_10040797 3300025928 Bacteria 3390
576 Ga0207700_10126325 3300025928 Bacteria 2081
577 Ga0207664_10011215 3300025929 Bacteria 6354
578 Ga0207664_10017974 3300025929 Bacteria 5195
579 Ga0207664_10031585 3300025929 Bacteria 4053
580 Ga0207664_10056316 3300025929 Bacteria 3122
581 Ga0207664_10109584 3300025929 Bacteria 2294
582 Ga0207664_10124094 3300025929 Bacteria 2166
583 Ga0207664_10217091 3300025929 Bacteria 1657
584 Ga0207644_10000533 3300025931 Bacteria 24656
585 Ga0207644_10156728 3300025931 Bacteria 1766
586 Ga0207690_10023284 3300025932 Bacteria 3864
587 Ga0207690_10043003 3300025932 Bacteria 2971
588 Ga0207690_10046233 3300025932 Bacteria 2882
589 Ga0207706_10004090 3300025933 Bacteria 13781
590 Ga0207706_10023329 3300025933 Bacteria 5557
591 Ga0207706_10098926 3300025933 Bacteria 2566
592 Ga0207686_10013657 3300025934 Bacteria 4498
593 Ga0207686_10039601 3300025934 Bacteria 2860
594 Ga0207686_10163127 3300025934 Bacteria 1564
595 Ga0207709_10003392 3300025935 Bacteria 9517
596 Ga0207709_10013839 3300025935 Bacteria 4454
597 Ga0207709_10030200 3300025935 Bacteria 3151
598 Ga0207709_10041889 3300025935 Bacteria 2751
599 Ga0207709_10086590 3300025935 Bacteria 2034
600 Ga0207709_10090833 3300025935 Bacteria 1996
601 Ga0207709_10102032 3300025935 Bacteria 1899
602 Ga0207709_10120608 3300025935 Bacteria 1770
603 Ga0207709_10206581 3300025935 Bacteria 1406
604 Ga0207670_10045463 3300025936 Bacteria 2911
605 Ga0207669_10000321 3300025937 Bacteria 21927
606 Ga0207669_10051938 3300025937 Bacteria 2459
607 Ga0207669_10091373 3300025937 Bacteria 1983
608 Ga0207669_10093143 3300025937 Bacteria 1968
609 Ga0207669_10135214 3300025937 Bacteria 1701
610 Ga0207669_10135649 3300025937 Bacteria 1699
611 Ga0207704_10043537 3300025938 Bacteria 2652
612 Ga0207704_10074438 3300025938 Bacteria 2167
613 Ga0207665_10018374 3300025939 Bacteria 4595
614 Ga0207665_10042074 3300025939 Bacteria 3053
615 Ga0207691_10004828 3300025940 Bacteria 13038
616 Ga0207691_10019669 3300025940 Bacteria 6387
617 Ga0207691_10020522 3300025940 Bacteria 6247
618 Ga0207691_10145476 3300025940 Bacteria 2087
619 Ga0207711_10000988 3300025941 Bacteria 27253
620 Ga0207711_10005023 3300025941 Bacteria 11222
621 Ga0207711_10032150 3300025941 Bacteria 4436
622 Ga0207711_10053676 3300025941 Bacteria 3456
623 Ga0207711_10094465 3300025941 Bacteria 2635
624 Ga0207711_10100070 3300025941 Bacteria 2564
625 Ga0207711_10180181 3300025941 Bacteria 1921
626 Ga0207689_10050492 3300025942 Bacteria 3429
627 Ga0207661_10000257 3300025944 Bacteria 34367
628 Ga0207661_10011892 3300025944 Bacteria 6320
629 Ga0207661_10029811 3300025944 Bacteria 4194
630 Ga0207661_10039576 3300025944 Bacteria 3701
631 Ga0207661_10063407 3300025944 Bacteria 2993
632 Ga0207679_10297567 3300025945 Bacteria 1390
633 Ga0207667_10005061 3300025949 Bacteria 16105
634 Ga0207667_10020001 3300025949 Bacteria 7457
635 Ga0207667_10027633 3300025949 Bacteria 6172
636 Ga0207667_10045682 3300025949 Bacteria 4638
637 Ga0207667_10047897 3300025949 Bacteria 4521
638 Ga0207667_10083612 3300025949 Bacteria 3305
639 Ga0207667_10084614 3300025949 Bacteria 3283
640 Ga0207667_10129403 3300025949 Bacteria 2600
641 Ga0207667_10154487 3300025949 Bacteria 2361
642 Ga0207667_10182780 3300025949 Bacteria 2153
643 Ga0207667_10193446 3300025949 Bacteria 2087
644 Ga0207651_10192083 3300025960 Bacteria 1629
645 Ga0207712_10000010 3300025961 Bacteria 455972
646 Ga0207712_10012828 3300025961 Bacteria 5359
647 Ga0207712_10044673 3300025961 Bacteria 3063
648 Ga0207712_10074694 3300025961 Bacteria 2448
649 Ga0207712_10077306 3300025961 Bacteria 2412
650 Ga0207712_10177215 3300025961 Bacteria 1671
651 Ga0207668_10009380 3300025972 Bacteria 5862
652 Ga0207668_10025670 3300025972 Bacteria 3815
653 Ga0207668_10069477 3300025972 Bacteria 2508
654 Ga0207668_10079801 3300025972 Bacteria 2368
655 Ga0207668_10141430 3300025972 Bacteria 1851
656 Ga0207640_10272808 3300025981 Bacteria 1324
657 Ga0207658_10000278 3300025986 Bacteria 53527
658 Ga0207658_10070698 3300025986 Bacteria 2641
659 Ga0207658_10193554 3300025986 Bacteria 1693
660 Ga0207677_10046959 3300026023 Bacteria 2895
661 Ga0207677_10071358 3300026023 Bacteria 2451
662 Ga0207677_10082134 3300026023 Bacteria 2315
663 Ga0207703_10000013 3300026035 Bacteria 305126
664 Ga0207703_10000345 3300026035 Bacteria 49953
665 Ga0207703_10008645 3300026035 Bacteria 8035
666 Ga0207703_10011120 3300026035 Bacteria 7008
667 Ga0207703_10076268 3300026035 Bacteria 2780
668 Ga0207639_10016458 3300026041 Bacteria 5233
669 Ga0207639_10022472 3300026041 Bacteria 4543
670 Ga0207639_10035803 3300026041 Bacteria 3674
671 Ga0207639_10094180 3300026041 Bacteria 2404
672 Ga0207639_10152400 3300026041 Bacteria 1938
673 Ga0207678_10000229 3300026067 Bacteria 49946
674 Ga0207678_10019579 3300026067 Bacteria 5949
675 Ga0207678_10023067 3300026067 Bacteria 5446
676 Ga0207678_10029378 3300026067 Bacteria 4797
677 Ga0207678_10053285 3300026067 Bacteria 3487
678 Ga0207678_10084801 3300026067 Bacteria 2709
679 Ga0207678_10140891 3300026067 Bacteria 2058
680 Ga0207678_10203261 3300026067 Bacteria 1694
681 Ga0207678_10219045 3300026067 Bacteria 1629
682 Ga0207708_10000029 3300026075 Bacteria 161861
683 Ga0207708_10047044 3300026075 Bacteria 3286
684 Ga0207708_10067474 3300026075 Bacteria 2736
685 Ga0207708_10091878 3300026075 Bacteria 2341
686 Ga0207708_10226059 3300026075 Bacteria 1501
687 Ga0207702_10022503 3300026078 Bacteria 5225
688 Ga0207702_10032719 3300026078 Bacteria 4339
689 Ga0207702_10074804 3300026078 Bacteria 2924
690 Ga0207702_10094243 3300026078 Bacteria 2628
691 Ga0207702_10160339 3300026078 Bacteria 2054
692 Ga0207702_10215120 3300026078 Bacteria 1788
693 Ga0207702_10221456 3300026078 Bacteria 1763
694 Ga0207702_10236734 3300026078 Bacteria 1709
695 Ga0207641_10000784 3300026088 Bacteria 33944
696 Ga0207641_10001715 3300026088 Bacteria 21243
697 Ga0207641_10003875 3300026088 Bacteria 13095
698 Ga0207641_10169662 3300026088 Bacteria 1990
699 Ga0207648_10001482 3300026089 Bacteria 25825
700 Ga0207648_10017928 3300026089 Bacteria 6421
701 Ga0207648_10051302 3300026089 Bacteria 3605
702 Ga0207676_10208626 3300026095 Bacteria 1732
703 Ga0207674_10006801 3300026116 Bacteria 13418
704 Ga0207674_10009792 3300026116 Bacteria 10916
705 Ga0207674_10064434 3300026116 Bacteria 3696
706 Ga0207674_10127782 3300026116 Bacteria 2506
707 Ga0207674_10134200 3300026116 Bacteria 2438
708 Ga0207675_100003809 3300026118 Bacteria 14698
709 Ga0207675_100062849 3300026118 Bacteria 3469
710 Ga0207675_100127813 3300026118 Bacteria 2408
711 Ga0207675_100142217 3300026118 Bacteria 2280
712 Ga0207675_100174383 3300026118 Bacteria 2057
713 Ga0207683_10001283 3300026121 Bacteria 22741
714 Ga0207683_10003164 3300026121 Bacteria 14369
715 Ga0207683_10066126 3300026121 Bacteria 3188
716 Ga0207683_10186624 3300026121 Bacteria 1881
717 Ga0207683_10377498 3300026121 Bacteria 1303
718 Ga0207698_10062658 3300026142 Bacteria 2905
719 Ga0207698_10108734 3300026142 Bacteria 2318
720 Ga0207698_10157060 3300026142 Bacteria 1983
721 Ga0207698_10173142 3300026142 Bacteria 1903
722 Ga0207698_10217215 3300026142 Bacteria 1725
723 Ga0207698_10275758 3300026142 Bacteria 1553
724 Ga0207428_10010654 3300027907 Bacteria 8202
725 Ga0268266_10001660 3300028379 Bacteria 25696
726 Ga0268266_10004579 3300028379 Bacteria 13206
727 Ga0268266_10006280 3300028379 Bacteria 10903
728 Ga0268266_10012115 3300028379 Bacteria 7464
729 Ga0268266_10016431 3300028379 Bacteria 6326
730 Ga0268266_10044774 3300028379 Bacteria 3783
731 Ga0268266_10065440 3300028379 Bacteria 3143
732 Ga0268265_10000014 3300028380 Bacteria 330186
733 Ga0268265_10000041 3300028380 Bacteria 189918
734 Ga0268265_10043944 3300028380 Bacteria 3324
735 Ga0268265_10186334 3300028380 Bacteria 1788
736 Ga0268264_10000150 3300028381 Bacteria 158263
737 Ga0268264_10000210 3300028381 Bacteria 118222
738 Ga0268264_10000498 3300028381 Bacteria 51440
739 Ga0268264_10001010 3300028381 Bacteria 28549
740 Ga0268264_10491113 3300028381 Bacteria 1196
741 Ga0265337_1000861 3300028556 Bacteria 15952
742 Ga0265326_10001260 3300028558 Bacteria 9015
743 Ga0265319_1000828 3300028563 Bacteria 19683
744 Ga0265334_10000237 3300028573 Bacteria 31781
745 Ga0265318_10008654 3300028577 Bacteria 4513
746 Ga0265323_10005269 3300028653 Bacteria 5495
747 Ga0265322_10010118 3300028654 Bacteria 2734
748 Ga0265336_10002720 3300028666 Bacteria 7155
749 Ga0307515_10022361 3300028794 Bacteria 11146
750 Ga0307515_10037313 3300028794 Bacteria 7819
751 Ga0307515_10175114 3300028794 Bacteria 2119
752 Ga0265338_10000376 3300028800 Bacteria 79928
753 Ga0265338_10001480 3300028800 Bacteria 38067
754 Ga0265338_10015126 3300028800 Bacteria 8512
755 Ga0265324_10008950 3300029957 Bacteria 3939
756 Ga0307512_10004160 3300030522 Bacteria 16050
757 Ga0316177_1181774 3300030731 Bacteria 1669
758 Ga0316176_1121577 3300030732 Bacteria 2280
759 Ga0316176_1187053 3300030732 Bacteria 1347
760 Ga0314311_1118439 3300030733 Bacteria 5825
761 Ga0314311_1132449 3300030733 Bacteria 2662
762 Ga0316181_1233539 3300030744 Bacteria 1738
763 Ga0265332_10002532 3300031238 Bacteria 9274
764 Ga0265320_10000532 3300031240 Bacteria 29415
765 Ga0265340_10004583 3300031247 Bacteria 7694
766 Ga0265339_10030866 3300031249 Bacteria 3033
767 Ga0265331_10042159 3300031250 Bacteria 2215
768 Ga0265327_10003399 3300031251 Bacteria 15275
769 Ga0265316_10006104 3300031344 Bacteria 11560
770 Ga0265316_10050856 3300031344 Bacteria 3258
771 Ga0307513_10004729 3300031456 Bacteria 18102
772 Ga0307513_10006259 3300031456 Bacteria 15592
773 Ga0307513_10016777 3300031456 Bacteria 8812
774 Ga0307513_10202081 3300031456 Bacteria 1827
775 Ga0307408_100171077 3300031548 Bacteria 1734
776 Ga0307408_100191933 3300031548 Bacteria 1646
777 Ga0307408_100246721 3300031548 Bacteria 1470
778 Ga0307408_100281850 3300031548 Bacteria 1384
779 Ga0265313_10006611 3300031595 Bacteria 8146
780 Ga0307508_10135401 3300031616 Bacteria 2067
781 Ga0307514_10002631 3300031649 Bacteria 18347
782 Ga0307514_10011079 3300031649 Bacteria 7511
783 Ga0316575_10001074 3300031665 Bacteria 8520
784 Ga0316579_10006667 3300031691 Bacteria 4722
785 Ga0316579_10006821 3300031691 Bacteria 4679
786 Ga0316579_10039363 3300031691 Unclassified 2190
787 Ga0265314_10016241 3300031711 Bacteria 5890
788 Ga0265342_10022810 3300031712 Bacteria 3973
789 Ga0316576_10001380 3300031727 Bacteria 12959
790 Ga0316576_10003072 3300031727 Bacteria 9720
791 Ga0316576_10017375 3300031727 Bacteria 4885
792 Ga0316576_10040477 3300031727 Bacteria 3350
793 Ga0316576_10112338 3300031727 Bacteria 2043
794 Ga0316578_10002012 3300031728 Bacteria 8648
795 Ga0316578_10003078 3300031728 Bacteria 7531
796 Ga0316578_10017612 3300031728 Bacteria 3892
797 Ga0307405_10034091 3300031731 Bacteria 3026
798 Ga0307405_10039590 3300031731 Bacteria 2850
799 Ga0307405_10058979 3300031731 Bacteria 2417
800 Ga0307405_10164076 3300031731 Bacteria 1577
801 Ga0307405_10196397 3300031731 Bacteria 1461
802 Ga0316577_10023806 3300031733 Bacteria 3399
803 Ga0316577_10026975 3300031733 Bacteria 3201
804 Ga0307413_10039726 3300031824 Bacteria 2739
805 Ga0307413_10117076 3300031824 Bacteria 1796
806 Ga0307518_10000445 3300031838 Bacteria 31568
807 Ga0307518_10001456 3300031838 Bacteria 17573
808 Ga0307410_10005711 3300031852 Bacteria 6627
809 Ga0307410_10007860 3300031852 Bacteria 5872
810 Ga0307410_10059763 3300031852 Bacteria 2603
811 Ga0307410_10099559 3300031852 Bacteria 2081
812 Ga0307410_10161920 3300031852 Bacteria 1677
813 Ga0307410_10172421 3300031852 Bacteria 1631
814 Ga0307406_10000520 3300031901 Bacteria 22113
815 Ga0307406_10002180 3300031901 Bacteria 10659
816 Ga0307406_10007260 3300031901 Bacteria 6137
817 Ga0307406_10046164 3300031901 Bacteria 2740
818 Ga0307406_10069841 3300031901 Bacteria 2298
819 Ga0307406_10075032 3300031901 Bacteria 2229
820 Ga0307406_10082055 3300031901 Bacteria 2146
821 Ga0307406_10109972 3300031901 Bacteria 1895
822 Ga0307407_10037797 3300031903 Bacteria 2670
823 Ga0307407_10080214 3300031903 Bacteria 1971
824 Ga0307412_10010775 3300031911 Bacteria 5275
825 Ga0307412_10078687 3300031911 Bacteria 2272
826 Ga0307412_10109312 3300031911 Bacteria 1971
827 Ga0307409_100002130 3300031995 Bacteria 10199
828 Ga0307409_100002984 3300031995 Bacteria 9018
829 Ga0307409_100010167 3300031995 Bacteria 5831
830 Ga0307409_100021286 3300031995 Bacteria 4442
831 Ga0307409_100035071 3300031995 Bacteria 3672
832 Ga0307409_100075439 3300031995 Bacteria 2700
833 Ga0307409_100151170 3300031995 Bacteria 2016
834 Ga0307409_100168606 3300031995 Bacteria 1924
835 Ga0307416_100098400 3300032002 Bacteria 2537
836 Ga0307416_100100882 3300032002 Bacteria 2512
837 Ga0307416_100103395 3300032002 Bacteria 2487
838 Ga0307416_100121442 3300032002 Bacteria 2329
839 Ga0307416_100140122 3300032002 Bacteria 2196
840 Ga0307416_100176682 3300032002 Bacteria 1996
841 Ga0307416_100180815 3300032002 Bacteria 1976
842 Ga0307416_100495966 3300032002 Bacteria 1284
843 Ga0307414_10018011 3300032004 Bacteria 4335
844 Ga0307414_10023359 3300032004 Bacteria 3921
845 Ga0307414_10032644 3300032004 Bacteria 3431
846 Ga0307414_10040079 3300032004 Bacteria 3161
847 Ga0307414_10062940 3300032004 Bacteria 2635
848 Ga0307414_10086547 3300032004 Bacteria 2313
849 Ga0307414_10173992 3300032004 Bacteria 1724
850 Ga0307411_10043938 3300032005 Bacteria 2862
851 Ga0307411_10082429 3300032005 Bacteria 2218
852 Ga0307415_100002009 3300032126 Bacteria 10023
853 Ga0307415_100046464 3300032126 Bacteria 2917
854 Ga0307415_100064299 3300032126 Bacteria 2552
855 Ga0307415_100113327 3300032126 Bacteria 2016
856 Ga0316583_10020853 3300032133 Bacteria 2349
857 Ga0316585_10006425 3300032137 Bacteria 3361
858 Ga0316585_10012405 3300032137 Bacteria 2524
859 Ga0316585_10034867 3300032137 Bacteria 1592
860 Ga0316580_10004313 3300032139 Bacteria 4118
861 Ga0307507_10014085 3300033179 Bacteria 9590
862 Ga0307507_10045062 3300033179 Bacteria 4346
863 Ga0307507_10045348 3300033179 Bacteria 4326
864 Ga0307510_10037636 3300033180 Bacteria 5365
865 Ga0373926_0000004 3300035083 Bacteria 40904
866 Ga0373926_0003287 3300035083 Bacteria 5194
867 Ga0373926_0005331 3300035083 Bacteria 4233
868 Ga0373934_0004066 3300035086 Bacteria 5389
869 Ga0373934_0005307 3300035086 Bacteria 4766
870 Ga0373944_0000024 3300035089 Bacteria 26949
871 Ga0373944_0002808 3300035089 Bacteria 4455
872 Ga0373923_0009922 3300035111 Bacteria 3449
873 Ga0373936_0000240 3300035113 Bacteria 18113
874 Ga0373936_0000251 3300035113 Bacteria 17775
875 Ga0373936_0048159 3300035113 Bacteria 1720
876 Ga0373939_0026080 3300035114 Bacteria 1644
877 Ga0373945_0000140 3300035116 Bacteria 18218
878 Ga0373953_0033415 3300035117 Bacteria 2012
879 Ga0373954_0008715 3300035118 Bacteria 4458
880 Ga0373956_0002606 3300035119 Bacteria 7312
881 Ga0373956_0011366 3300035119 Bacteria 3666
882 Ga0373957_0031735 3300035120 Bacteria 1942
883 Ga0373943_0001314 3300035170 Bacteria 11168
884 Ga0373943_0007804 3300035170 Bacteria 4805
885 Ga0373946_0000089 3300035171 Bacteria 25208
886 Ga0373946_0000252 3300035171 Bacteria 16973
887 Ga0373946_0043766 3300035171 Bacteria 1846
888 Ga0373955_0004750 3300035172 Bacteria 6044
889 Ga0373955_0071397 3300035172 Bacteria 1942
890 Ga0373955_0120938 3300035172 Bacteria 1522
891 Ga0373942_0007025 3300035207 Bacteria 2602
892 Ga0316574_0000415 3300035398 Bacteria 16875
893 Ga0316574_0012915 3300035398 Bacteria 4789
894 Ga0316574_0025924 3300035398 Bacteria 3523
895 Ga0316574_0033681 3300035398 Bacteria 3118
896 Ga0316574_0136805 3300035398 Bacteria 1577
897 Ga0373924_0023755 3300035410 Bacteria 2409
898 Ga0373924_0039200 3300035410 Bacteria 1935
899 Ga0373931_0009909 3300035691 Bacteria 4565
900 Ga0373931_0017982 3300035691 Bacteria 3507
901 Ga0373935_0000586 3300035692 Bacteria 18964
902 Ga0373935_0000834 3300035692 Bacteria 16581
903 Ga0373935_0012962 3300035692 Bacteria 5024
904 Ga0373935_0064795 3300035692 Bacteria 2343
905 Ga0373927_0001993 3300035695 Bacteria 15054
906 Ga0373927_0001996 3300035695 Bacteria 15042
907 Ga0373927_0049873 3300035695 Bacteria 2706
908 Ga0373933_0020579 3300035724 Bacteria 3741
909 Ga0373933_0066690 3300035724 Bacteria 2181
910 Ga0373947_0000007 3300035725 Bacteria 192259
911 Ga0373947_0007154 3300035725 Bacteria 6469
912 Ga0373947_0007697 3300035725 Bacteria 6225
913 Ga0373937_0013695 3300036401 Bacteria 7144
914 Ga0373937_0206334 3300036401 Bacteria 1848
915 Ga0316582_0078006 3300036647 Bacteria 2157
916 Ga0316584_0000383 3300036712 Bacteria 22877
917 Ga0316584_0058602 3300036712 Bacteria 2883
918 Ga0316584_0082555 3300036712 Bacteria 2407
919 Ga0316584_0116975 3300036712 Bacteria 1993
920 Ga0373925_0000004 3300037068 Bacteria 361597
921 Ga0373925_0003736 3300037068 Bacteria 11690
922 Ga0373925_0012813 3300037068 Bacteria 6074
923 Ga0395899_0008790 3300037312 Bacteria 7771
924 Ga0395899_0015761 3300037312 Bacteria 5763
925 Ga0395899_0039667 3300037312 Bacteria 3523
926 Ga0395899_0070232 3300037312 Bacteria 2563
927 Ga0395899_0071152 3300037312 Bacteria 2545
928 Ga0395899_0123009 3300037312 Bacteria 1857
929 Ga0395900_0015052 3300037418 Bacteria 7884
930 Ga0395900_0035372 3300037418 Bacteria 5144
931 Ga0395900_0040502 3300037418 Bacteria 4801
932 Ga0395900_0074598 3300037418 Bacteria 3487
933 Ga0395900_0101893 3300037418 Bacteria 2949
934 Ga0395900_0112660 3300037418 Bacteria 2793
935 Ga0395900_0137294 3300037418 Bacteria 2505
936 Ga0395900_0140005 3300037418 Bacteria 2478
937 Ga0395900_0243208 3300037418 Bacteria 1804
938 Ga0395898_0000381 3300037466 Bacteria 97274
939 Ga0395898_0005576 3300037466 Bacteria 13569
940 Ga0395898_0011069 3300037466 Bacteria 9393
941 Ga0395898_0080616 3300037466 Bacteria 3139
942 Ga0395898_0115294 3300037466 Bacteria 2574
943 Ga0395905_0039073 3300037471 Bacteria 4452
944 Ga0395905_0056411 3300037471 Bacteria 3675
945 Ga0436364_0010700 3300037853 Bacteria 115369
946 Ga0436364_0048623 3300037853 Bacteria 9076
947 Ga0436364_1071680 3300037853 Bacteria 1719
948 Ga0436364_1508399 3300037853 Bacteria 1852
949 Ga0395901_0050485 3300038443 Bacteria 4321
950 Ga0395901_0064601 3300038443 Bacteria 3810
951 Ga0395901_0066733 3300038443 Bacteria 3747
952 Ga0395901_0076931 3300038443 Bacteria 3482
953 Ga0395901_0124894 3300038443 Bacteria 2704
954 Ga0395901_0133959 3300038443 Bacteria 2604
955 Ga0395901_0222281 3300038443 Bacteria 1974
956 Ga0395901_0257884 3300038443 Bacteria 1815
957 Ga0436365_1474856 3300039437 Bacteria 28836
958 Ga0436365_1712156 3300039437 Bacteria 11498
959 Ga0436360_0167640 3300039438 Bacteria 2739
960 Ga0436361_0615022 3300039447 Bacteria 7070
961 Ga0436362_0365102 3300039453 Bacteria 4965
962 Ga0439438_012377 3300041405 Bacteria 2617
963 Ga0439438_025400 3300041405 Bacteria 1615
964 Ga0439461_0000541 3300041410 Bacteria 5469
965 Ga0439461_0001042 3300041410 Bacteria 4185
966 Ga0439461_0006688 3300041410 Bacteria 2015
967 Ga0439461_0010106 3300041410 Bacteria 1727
968 Ga0439466_0001530 3300041411 Bacteria 9040
969 Ga0439466_0006330 3300041411 Bacteria 4506
970 Ga0439466_0008648 3300041411 Bacteria 3836
971 Ga0439466_0009136 3300041411 Bacteria 3715
972 Ga0439465_0003293 3300041413 Bacteria 5275
973 Ga0439465_0047901 3300041413 Bacteria 1394
974 Ga0439431_0000277 3300041997 Bacteria 10573
975 Ga0439431_0009936 3300041997 Bacteria 2155
976 Ga0439431_0013210 3300041997 Bacteria 1903
977 Ga0439431_0016012 3300041997 Bacteria 1751
978 Ga0439433_0000286 3300041999 Bacteria 8654
979 Ga0439433_0000832 3300041999 Bacteria 6098
980 Ga0439442_001243 3300042002 Bacteria 5059
981 Ga0439442_026371 3300042002 Bacteria 1209
982 Ga0439445_0000717 3300042004 Bacteria 6918
983 Ga0439448_0013319 3300042005 Bacteria 2469
984 Ga0439449_0001566 3300042007 Bacteria 8965
985 Ga0439449_0002451 3300042007 Bacteria 7252
986 Ga0439449_0014860 3300042007 Bacteria 2926
987 Ga0439451_004531 3300042009 Bacteria 2827
988 Ga0439452_005887 3300042010 Bacteria 3896
989 Ga0439454_002842 3300042011 Bacteria 1870
990 Ga0439457_000878 3300042014 Bacteria 9076
991 Ga0439457_002559 3300042014 Bacteria 5154
992 Ga0439462_0017634 3300042015 Bacteria 1849
993 Ga0450919_000123 3300042121 Bacteria 7838
994 Ga0450920_006112 3300042122 Bacteria 2156
995 Ga0439446_0008839 3300042156 Bacteria 2685
996 Ga0450908_002157 3300042184 Bacteria 3855
997 Ga0450909_001471 3300042185 Bacteria 3287
998 Ga0439434_0001620 3300042435 Bacteria 6500
999 Ga0439434_0002886 3300042435 Bacteria 5015
1000 Ga0439460_0003464 3300042461 Archaea 3819
1001 Ga0450918_003166 3300042531 Bacteria 3067
1002 Ga0466969_0014150 3300044656 Bacteria 4196
1003 Ga0466969_0015497 3300044656 Bacteria 3995
1004 Ga0466972_0002008 3300044658 Bacteria 9968
1005 Ga0466972_0003353 3300044658 Bacteria 7937
1006 Ga0466972_0006242 3300044658 Bacteria 5986
1007 Ga0466972_0008483 3300044658 Bacteria 5154
1008 Ga0466972_0016501 3300044658 Bacteria 3692
1009 Ga0466972_0024952 3300044658 Bacteria 2966
1010 Ga0466972_0025150 3300044658 Bacteria 2953
1011 Ga0466972_0031016 3300044658 Bacteria 2631
1012 Ga0466972_0095998 3300044658 Bacteria 1404
1013 Ga0466965_0003901 3300044683 Bacteria 6596
1014 Ga0466965_0005424 3300044683 Bacteria 5746
1015 Ga0466965_0016410 3300044683 Bacteria 3525
1016 Ga0466965_0025571 3300044683 Bacteria 2857
1017 Ga0466965_0028877 3300044683 Bacteria 2696
1018 Ga0466965_0031824 3300044683 Bacteria 2574
1019 Ga0466965_0033743 3300044683 Bacteria 2502
1020 Ga0466965_0047425 3300044683 Bacteria 2127
1021 Ga0466965_0056670 3300044683 Bacteria 1952
1022 Ga0466965_0066948 3300044683 Bacteria 1802
1023 Ga0466965_0068084 3300044683 Bacteria 1787
1024 Ga0466966_0002623 3300044684 Bacteria 11780
1025 Ga0466966_0030855 3300044684 Bacteria 3477
1026 Ga0466966_0037815 3300044684 Bacteria 3110
1027 Ga0466966_0138687 3300044684 Bacteria 1487
1028 Ga0466961_0031408 3300044693 Bacteria 3414
1029 Ga0466961_0032806 3300044693 Bacteria 3336
1030 Ga0466961_0038494 3300044693 Bacteria 3067
1031 Ga0466961_0067481 3300044693 Bacteria 2272
1032 Ga0466961_0087585 3300044693 Bacteria 1967
1033 Ga0466961_0093599 3300044693 Bacteria 1896
1034 Ga0466961_0119605 3300044693 Bacteria 1654
1035 Ga0466961_0209194 3300044693 Bacteria 1205
1036 Ga0466963_0002223 3300044694 Bacteria 10749
1037 Ga0466963_0004617 3300044694 Bacteria 8028
1038 Ga0466963_0009504 3300044694 Bacteria 5856
1039 Ga0466963_0030660 3300044694 Bacteria 3472
1040 Ga0466963_0053339 3300044694 Bacteria 2685
1041 Ga0466963_0076175 3300044694 Bacteria 2265
1042 Ga0466963_0079949 3300044694 Bacteria 2212
1043 Ga0466963_0204422 3300044694 Bacteria 1381
1044 Ga0466963_0222462 3300044694 Bacteria 1322
1045 Ga0466964_0025463 3300044706 Bacteria 2310
1046 Ga0466964_0027290 3300044706 Bacteria 2242
1047 Ga0466964_0051855 3300044706 Bacteria 1685
1048 Ga0466964_0095766 3300044706 Bacteria 1300
1049 Ga0466971_0004615 3300044719 Bacteria 5949
1050 Ga0466971_0044965 3300044719 Bacteria 1983
1051 Ga0466971_0062121 3300044719 Bacteria 1690
1052 Ga0466968_0007642 3300044735 Bacteria 4117
1053 Ga0466968_0019763 3300044735 Bacteria 2714
1054 Ga0466968_0051487 3300044735 Bacteria 1759
1055 Ga0466970_0000093 3300044765 Bacteria 37847
1056 Ga0466970_0004325 3300044765 Bacteria 6989
1057 Ga0466970_0005681 3300044765 Bacteria 6195
1058 Ga0466970_0006545 3300044765 Bacteria 5822
1059 Ga0466970_0010125 3300044765 Bacteria 4777
1060 Ga0466970_0013655 3300044765 Bacteria 4167
1061 Ga0466970_0020060 3300044765 Bacteria 3469
1062 Ga0466970_0034709 3300044765 Bacteria 2671
1063 Ga0466970_0051568 3300044765 Bacteria 2196
1064 Ga0466970_0052244 3300044765 Bacteria 2181
1065 Ga0466970_0054498 3300044765 Bacteria 2135
1066 Ga0466970_0100357 3300044765 Bacteria 1576
1067 Ga0466957_0003409 3300044842 Bacteria 8725
1068 Ga0466957_0027743 3300044842 Bacteria 3366
1069 Ga0466957_0036044 3300044842 Bacteria 2971
1070 Ga0466957_0050466 3300044842 Bacteria 2532
1071 Ga0466957_0075158 3300044842 Bacteria 2096
1072 Ga0466957_0111467 3300044842 Bacteria 1735
1073 Ga0466960_0002117 3300044901 Bacteria 7395
1074 Ga0466960_0002276 3300044901 Bacteria 7183
1075 Ga0466960_0004115 3300044901 Bacteria 5656
1076 Ga0466960_0009803 3300044901 Bacteria 3960
1077 Ga0466960_0009870 3300044901 Bacteria 3947
1078 Ga0466960_0010324 3300044901 Bacteria 3875
1079 Ga0466960_0021256 3300044901 Bacteria 2886
1080 Ga0466960_0028067 3300044901 Bacteria 2573
1081 Ga0466960_0037032 3300044901 Bacteria 2287
1082 Ga0466959_0001664 3300045049 Bacteria 13767
1083 Ga0466959_0003675 3300045049 Bacteria 10116
1084 Ga0466959_0006267 3300045049 Bacteria 8217
1085 Ga0466959_0016450 3300045049 Bacteria 5405
1086 Ga0466959_0019389 3300045049 Bacteria 5002
1087 Ga0466959_0032967 3300045049 Bacteria 3833
1088 Ga0466959_0059074 3300045049 Bacteria 2793
1089 Ga0466959_0067718 3300045049 Bacteria 2588
1090 Ga0466958_0001497 3300045836 Bacteria 11166
1091 Ga0466958_0005259 3300045836 Bacteria 6936
1092 Ga0466958_0018627 3300045836 Bacteria 4032
1093 Ga0466958_0034064 3300045836 Bacteria 3037
1094 Ga0466958_0034141 3300045836 Bacteria 3033
1095 Ga0466958_0056887 3300045836 Bacteria 2377
1096 Ga0466958_0135562 3300045836 Bacteria 1548
1097 Ga0466967_0005159 3300045976 Bacteria 8986
1098 Ga0466967_0005915 3300045976 Bacteria 8574
1099 Ga0466967_0013641 3300045976 Bacteria 6290
1100 Ga0466967_0026874 3300045976 Bacteria 4777
1101 Ga0466967_0029449 3300045976 Bacteria 4595
1102 Ga0466967_0030435 3300045976 Bacteria 4530
1103 Ga0466967_0031939 3300045976 Bacteria 4440
1104 Ga0466967_0037879 3300045976 Bacteria 4131
1105 Ga0466967_0050474 3300045976 Bacteria 3643
1106 Ga0466967_0062509 3300045976 Bacteria 3305
1107 Ga0466967_0064440 3300045976 Bacteria 3259
1108 Ga0466967_0073397 3300045976 Bacteria 3070
1109 Ga0466967_0084129 3300045976 Bacteria 2878
1110 Ga0466967_0089613 3300045976 Bacteria 2793
1111 Ga0466967_0119981 3300045976 Bacteria 2428
1112 Ga0466967_0124268 3300045976 Bacteria 2388
1113 Ga0466967_0143959 3300045976 Bacteria 2222
1114 Ga0466967_0163864 3300045976 Bacteria 2088
1115 Ga0466967_0257291 3300045976 Bacteria 1669
1116 Ga0466967_0273131 3300045976 Bacteria 1620
1117 Ga0495627_001142 3300046453 Bacteria 17148
1118 Ga0495592_0038444 3300046454 Bacteria 3601
1119 Ga0495603_0000513 3300046455 Bacteria 21575
1120 Ga0495603_0005295 3300046455 Bacteria 7690
1121 Ga0495603_0008346 3300046455 Bacteria 6262
1122 Ga0495603_0051227 3300046455 Bacteria 2453
1123 Ga0495603_0096202 3300046455 Bacteria 1730
1124 Ga0495590_0000413 3300046457 Bacteria 21560
1125 Ga0495629_0007624 3300046459 Bacteria 7968
1126 Ga0495629_0021240 3300046459 Bacteria 4633
1127 Ga0495629_0022859 3300046459 Bacteria 4455
1128 Ga0495638_0014114 3300046460 Bacteria 5410
1129 Ga0495638_0029044 3300046460 Bacteria 3566
1130 Ga0495638_0078942 3300046460 Bacteria 2002
1131 Ga0495641_0006042 3300046461 Bacteria 7967
1132 Ga0495641_0022516 3300046461 Bacteria 3151
1133 Ga0495651_0017310 3300046462 Bacteria 5583
1134 Ga0495653_0060532 3300046463 Bacteria 2868
1135 Ga0495653_0073595 3300046463 Bacteria 2549
1136 Ga0495653_0103440 3300046463 Bacteria 2059
1137 Ga0495650_0000130 3300046471 Bacteria 175669
1138 Ga0495650_0084504 3300046471 Bacteria 1218
1139 Ga0495580_0016410 3300046472 Bacteria 5557
1140 Ga0495580_0021278 3300046472 Bacteria 4786
1141 Ga0495582_0000875 3300046473 Bacteria 16684
1142 Ga0495582_0019590 3300046473 Bacteria 3701
1143 Ga0495582_0050291 3300046473 Bacteria 2297
1144 Ga0495639_0004796 3300046475 Bacteria 5815
1145 Ga0495662_0000821 3300046476 Bacteria 15101
1146 Ga0495662_0018450 3300046476 Bacteria 3377
1147 Ga0495662_0076855 3300046476 Bacteria 1621
1148 Ga0495664_0001916 3300046477 Bacteria 11072
1149 Ga0495664_0004512 3300046477 Bacteria 7615
1150 Ga0495594_0003942 3300046499 Bacteria 7636
1151 Ga0495594_0003955 3300046499 Bacteria 7627
1152 Ga0495608_0028759 3300046511 Bacteria 3777
1153 Ga0495608_0044556 3300046511 Bacteria 2960
1154 Ga0495618_0007805 3300046514 Bacteria 6477
1155 Ga0495618_0073876 3300046514 Bacteria 2171
1156 Ga0495630_0001272 3300046517 Bacteria 17379
1157 Ga0495630_0009755 3300046517 Bacteria 6908
1158 Ga0495630_0137601 3300046517 Bacteria 1856
1159 Ga0495630_0196151 3300046517 Bacteria 1540
1160 Ga0495643_0077189 3300046522 Bacteria 1741
1161 Ga0495644_0013017 3300046523 Bacteria 3197
1162 Ga0495648_0002340 3300046524 Bacteria 17589
1163 Ga0495648_0014540 3300046524 Bacteria 5756
1164 Ga0495663_0021342 3300046525 Bacteria 1865
1165 Ga0495663_0045978 3300046525 Bacteria 1340
1166 Ga0495666_0000235 3300046526 Bacteria 23700
1167 Ga0495666_0041008 3300046526 Bacteria 2243
1168 Ga0495642_0048447 3300046528 Bacteria 1743
1169 Ga0495652_0013787 3300046529 Bacteria 7272
1170 Ga0495654_0057629 3300046530 Bacteria 1876
1171 Ga0495665_0000915 3300046531 Bacteria 15550
1172 Ga0495665_0008383 3300046531 Bacteria 5607
1173 Ga0495640_0001181 3300046533 Bacteria 20480
1174 Ga0495640_0029616 3300046533 Bacteria 3928
1175 Ga0495640_0076097 3300046533 Bacteria 2240
1176 Ga0495586_0000409 3300046535 Bacteria 26099
1177 Ga0495586_0011384 3300046535 Bacteria 4731
1178 Ga0495587_0018456 3300046536 Bacteria 4326
1179 Ga0495587_0036249 3300046536 Bacteria 2967
1180 Ga0495598_0032263 3300046537 Bacteria 1479
1181 Ga0495645_0063671 3300046543 Bacteria 2669
1182 Ga0495667_0000837 3300046559 Bacteria 19854
1183 Ga0495667_0006229 3300046559 Bacteria 8086
1184 Ga0495667_0031962 3300046559 Bacteria 3529
1185 Ga0495656_0071703 3300046615 Bacteria 1540
1186 Ga0495668_0000505 3300046616 Bacteria 48713
1187 Ga0495634_0003288 3300046642 Bacteria 13028
1188 Ga0495634_0046259 3300046642 Bacteria 2938
1189 Ga0495634_0051142 3300046642 Bacteria 2773
1190 Ga0495611_0028770 3300046648 Bacteria 2435
1191 Ga0495635_0000906 3300046663 Bacteria 19421
1192 Ga0495635_0001201 3300046663 Bacteria 17274
1193 Ga0495635_0006925 3300046663 Bacteria 7918
1194 Ga0495635_0055240 3300046663 Bacteria 2735
1195 Ga0495659_0008125 3300046664 Bacteria 3335
1196 Ga0495661_0054323 3300046665 Bacteria 2405
1197 Ga0495588_0000268 3300046674 Bacteria 40423
1198 Ga0495588_0010400 3300046674 Bacteria 4328
1199 Ga0495588_0011453 3300046674 Bacteria 4164
1200 Ga0495588_0017198 3300046674 Bacteria 3506
1201 Ga0495588_0027537 3300046674 Bacteria 2840
1202 Ga0495588_0129165 3300046674 Bacteria 1333
1203 Ga0495657_0013583 3300046675 Bacteria 6003
1204 Ga0495657_0015029 3300046675 Bacteria 5677
1205 Ga0495599_0007443 3300046678 Bacteria 6641
1206 Ga0495623_0063776 3300046679 Bacteria 2306
1207 Ga0495646_0037868 3300046680 Bacteria 2981
1208 Ga0495647_0047038 3300046681 Bacteria 1664
1209 Ga0495658_0000153 3300046683 Bacteria 38350
1210 Ga0495658_0018789 3300046683 Bacteria 3600
1211 Ga0495658_0049811 3300046683 Bacteria 2367
1212 Ga0495658_0064346 3300046683 Bacteria 2113
1213 Ga0495669_0047978 3300046684 Bacteria 1909
1214 Ga0495613_0001237 3300046689 Bacteria 19529
1215 Ga0495613_0038133 3300046689 Bacteria 3562
1216 Ga0495613_0077661 3300046689 Bacteria 2415
1217 Ga0495613_0230058 3300046689 Bacteria 1299
1218 Ga0495624_0000364 3300046690 Bacteria 36044
1219 Ga0495624_0002578 3300046690 Bacteria 13698
1220 Ga0495670_0044085 3300046691 Bacteria 2227
1221 Ga0495581_0000789 3300047315 Bacteria 16798
1222 Ga0495581_0045150 3300047315 Bacteria 2547
1223 Ga0495581_0053428 3300047315 Bacteria 2333
1224 Ga0495581_0078280 3300047315 Bacteria 1913
1225 Ga0495581_0079686 3300047315 Bacteria 1895
1226 Ga0495604_0034564 3300047317 Bacteria 3998
1227 Ga0495604_0088785 3300047317 Bacteria 2299
1228 Ga0495604_0131629 3300047317 Bacteria 1797
1229 Ga0495604_0178944 3300047317 Bacteria 1485
1230 Ga0495636_0013480 3300047318 Bacteria 3245
1231 Ga0495674_0000640 3300047319 Bacteria 32750
1232 Ga0495674_0009189 3300047319 Bacteria 9392
1233 Ga0495674_0034201 3300047319 Bacteria 4597
1234 Ga0495674_0043532 3300047319 Bacteria 3996
1235 Ga0495672_0002784 3300047320 Bacteria 15622
1236 Ga0495672_0011138 3300047320 Bacteria 6362
1237 Ga0495672_0086173 3300047320 Bacteria 1738
1238 Ga0495676_0015473 3300047321 Bacteria 6791
1239 Ga0495676_0019442 3300047321 Bacteria 5973
1240 Ga0495676_0019639 3300047321 Bacteria 5941
1241 Ga0495676_0098413 3300047321 Bacteria 2170
1242 Ga0495680_0004541 3300047322 Bacteria 13263
1243 Ga0495680_0012084 3300047322 Bacteria 7617
1244 Ga0495680_0110904 3300047322 Bacteria 2033
1245 Ga0495683_0001180 3300047323 Bacteria 17826
1246 Ga0495677_0042011 3300047445 Bacteria 1674
1247 Ga0495673_0045644 3300047469 Bacteria 1946
1248 Ga0495684_0008105 3300047471 Bacteria 8121
1249 Ga0495684_0034970 3300047471 Bacteria 3854
1250 Ga0495684_0049619 3300047471 Bacteria 3206
1251 Ga0495686_0008844 3300047472 Bacteria 7332
1252 Ga0495686_0058772 3300047472 Bacteria 2396
1253 Ga0495593_0003161 3300047673 Bacteria 9884
1254 Ga0495593_0109889 3300047673 Bacteria 1408
1255 Ga0495602_0054850 3300048088 Bacteria 3515
1256 Ga0495602_0131483 3300048088 Bacteria 1995
1257 Ga0495614_0000110 3300048089 Bacteria 27971
1258 Ga0495614_0000222 3300048089 Bacteria 22134
1259 Ga0495615_0018625 3300048090 Bacteria 1531
1260 Ga0496100_0000097 3300048903 Bacteria 50092
1261 Ga0496100_0001715 3300048903 Bacteria 10911
1262 Ga0496100_0002885 3300048903 Bacteria 8817
1263 Ga0496100_0007957 3300048903 Bacteria 5888
1264 Ga0496100_0021361 3300048903 Bacteria 3896
1265 Ga0496100_0182178 3300048903 Bacteria 1519
1266 Ga0496101_0000032 3300048904 Bacteria 186783
1267 Ga0496101_0000178 3300048904 Bacteria 50994
1268 Ga0496101_0002214 3300048904 Bacteria 11871
1269 Ga0496101_0002271 3300048904 Bacteria 11737
1270 Ga0496101_0015250 3300048904 Bacteria 5173
1271 Ga0496101_0016940 3300048904 Bacteria 4933
1272 Ga0496101_0019798 3300048904 Bacteria 4601
1273 Ga0496101_0022334 3300048904 Bacteria 4354
1274 Ga0496101_0033514 3300048904 Bacteria 3623
1275 Ga0496101_0071443 3300048904 Bacteria 2544
1276 Ga0496101_0127472 3300048904 Bacteria 1930
1277 Ga0496102_0000011 3300048905 Bacteria 321716
1278 Ga0496102_0000235 3300048905 Bacteria 72616
1279 Ga0496102_0000236 3300048905 Bacteria 72601
1280 Ga0496102_0002707 3300048905 Bacteria 15075
1281 Ga0496102_0004544 3300048905 Bacteria 11734
1282 Ga0496102_0007433 3300048905 Bacteria 9359
1283 Ga0496102_0024381 3300048905 Bacteria 5378
1284 Ga0496102_0028244 3300048905 Bacteria 5009
1285 Ga0496102_0042950 3300048905 Bacteria 4097
1286 Ga0496102_0057352 3300048905 Bacteria 3556
1287 Ga0496102_0067913 3300048905 Bacteria 3270
1288 Ga0496102_0071661 3300048905 Bacteria 3182
1289 Ga0496102_0077190 3300048905 Bacteria 3065
1290 Ga0496102_0079158 3300048905 Bacteria 3026
1291 Ga0496102_0107025 3300048905 Bacteria 2603
1292 Ga0496102_0129236 3300048905 Bacteria 2363
1293 Ga0496102_0131604 3300048905 Bacteria 2342
1294 Ga0496102_0268364 3300048905 Bacteria 1609
1295 Ga0496102_0300459 3300048905 Bacteria 1513
1296 Ga0496102_0346132 3300048905 Bacteria 1399
1297 Ga0496103_0000032 3300048906 Bacteria 201453
1298 Ga0496103_0000185 3300048906 Bacteria 62838
1299 Ga0496103_0000460 3300048906 Bacteria 34689
1300 Ga0496103_0000624 3300048906 Bacteria 27194
1301 Ga0496103_0001651 3300048906 Bacteria 14614
1302 Ga0496103_0007239 3300048906 Bacteria 6614
1303 Ga0496103_0008384 3300048906 Bacteria 6141
1304 Ga0496103_0071566 3300048906 Bacteria 2170
1305 Ga0496103_0071855 3300048906 Bacteria 2166
1306 Ga0496103_0102378 3300048906 Bacteria 1813
1307 Ga0496103_0146301 3300048906 Bacteria 1512
1308 Ga0496103_0158986 3300048906 Bacteria 1449
1309 Ga0496104_0003431 3300048907 Bacteria 13673
1310 Ga0496104_0004891 3300048907 Bacteria 11682
1311 Ga0496104_0031350 3300048907 Bacteria 4943
1312 Ga0496104_0068187 3300048907 Bacteria 3380
1313 Ga0496104_0072889 3300048907 Bacteria 3266
1314 Ga0496104_0075539 3300048907 Bacteria 3209
1315 Ga0496104_0089024 3300048907 Bacteria 2949
1316 Ga0496104_0092303 3300048907 Bacteria 2895
1317 Ga0496104_0135208 3300048907 Bacteria 2368
1318 Ga0496104_0140953 3300048907 Bacteria 2316
1319 Ga0496104_0170360 3300048907 Bacteria 2088
1320 Ga0496104_0434350 3300048907 Bacteria 1225
1321 Ga0496105_0004208 3300048908 Bacteria 10809
1322 Ga0496105_0004455 3300048908 Bacteria 10546
1323 Ga0496105_0009001 3300048908 Bacteria 7788
1324 Ga0496105_0014439 3300048908 Bacteria 6287
1325 Ga0496105_0018442 3300048908 Bacteria 5609
1326 Ga0496105_0020815 3300048908 Bacteria 5304
1327 Ga0496105_0036703 3300048908 Bacteria 4038
1328 Ga0496105_0105827 3300048908 Bacteria 2322
1329 Ga0496105_0157242 3300048908 Bacteria 1866
1330 Ga0496105_0227897 3300048908 Bacteria 1515
1331 Ga0496105_0233856 3300048908 Bacteria 1493
1332 Ga0496106_0000417 3300048909 Bacteria 30205
1333 Ga0496106_0000768 3300048909 Bacteria 23207
1334 Ga0496106_0039704 3300048909 Bacteria 3525
1335 Ga0496106_0054231 3300048909 Bacteria 3029
1336 Ga0496106_0072794 3300048909 Bacteria 2628
1337 Ga0496106_0077479 3300048909 Bacteria 2549
1338 Ga0496106_0115837 3300048909 Bacteria 2090
1339 Ga0496106_0120446 3300048909 Bacteria 2051
1340 Ga0496106_0160339 3300048909 Bacteria 1779
1341 Ga0496106_0202541 3300048909 Bacteria 1580
1342 Ga0496106_0305993 3300048909 Bacteria 1275
1343 Ga0496107_0001611 3300048910 Bacteria 14062
1344 Ga0496107_0002827 3300048910 Bacteria 11456
1345 Ga0496107_0022212 3300048910 Bacteria 4483
1346 Ga0496107_0027443 3300048910 Bacteria 4043
1347 Ga0496107_0030297 3300048910 Bacteria 3856
1348 Ga0496107_0114477 3300048910 Bacteria 1984
1349 Ga0496108_0001698 3300048911 Bacteria 17460
1350 Ga0496108_0015334 3300048911 Bacteria 6252
1351 Ga0496108_0020224 3300048911 Bacteria 5470
1352 Ga0496108_0026361 3300048911 Bacteria 4794
1353 Ga0496108_0039938 3300048911 Bacteria 3911
1354 Ga0496108_0043103 3300048911 Bacteria 3769
1355 Ga0496108_0064850 3300048911 Bacteria 3078
1356 Ga0496108_0075778 3300048911 Bacteria 2843
1357 Ga0496108_0088604 3300048911 Bacteria 2630
1358 Ga0496108_0113673 3300048911 Bacteria 2317
1359 Ga0496108_0313142 3300048911 Bacteria 1368
1360 Ga0496108_0362172 3300048911 Bacteria 1266
1361 Ga0496109_0000305 3300048912 Bacteria 46298
1362 Ga0496109_0005372 3300048912 Bacteria 10708
1363 Ga0496109_0011265 3300048912 Bacteria 7680
1364 Ga0496109_0013718 3300048912 Bacteria 7039
1365 Ga0496109_0014775 3300048912 Bacteria 6793
1366 Ga0496109_0023643 3300048912 Bacteria 5455
1367 Ga0496109_0041162 3300048912 Bacteria 4187
1368 Ga0496109_0045826 3300048912 Bacteria 3970
1369 Ga0496109_0071036 3300048912 Bacteria 3195
1370 Ga0496109_0091869 3300048912 Bacteria 2807
1371 Ga0496109_0221244 3300048912 Bacteria 1780
1372 Ga0496109_0226132 3300048912 Bacteria 1760
1373 Ga0496110_0002915 3300048913 Bacteria 12950
1374 Ga0496110_0006568 3300048913 Bacteria 9234
1375 Ga0496110_0023163 3300048913 Bacteria 5281
1376 Ga0496110_0023479 3300048913 Bacteria 5246
1377 Ga0496110_0049961 3300048913 Bacteria 3671
1378 Ga0496110_0068720 3300048913 Bacteria 3136
1379 Ga0496110_0112705 3300048913 Bacteria 2445
1380 Ga0496110_0112870 3300048913 Bacteria 2443
1381 Ga0496110_0113775 3300048913 Bacteria 2434
1382 Ga0496110_0134866 3300048913 Bacteria 2230
1383 Ga0496110_0185899 3300048913 Bacteria 1887
1384 Ga0496111_0005153 3300048914 Bacteria 8333
1385 Ga0496111_0016859 3300048914 Bacteria 5041
1386 Ga0496111_0047481 3300048914 Bacteria 3092
1387 Ga0496111_0063129 3300048914 Bacteria 2686
1388 Ga0496111_0090424 3300048914 Bacteria 2242
1389 Ga0496111_0160860 3300048914 Bacteria 1667
1390 Ga0496111_0186655 3300048914 Bacteria 1541
1391 Ga0496112_0013235 3300048915 Bacteria 7612
1392 Ga0496112_0038767 3300048915 Bacteria 4655
1393 Ga0496112_0063842 3300048915 Bacteria 3633
1394 Ga0496112_0070088 3300048915 Bacteria 3464
1395 Ga0496112_0099862 3300048915 Bacteria 2872
1396 Ga0496112_0113579 3300048915 Bacteria 2679
1397 Ga0496112_0320244 3300048915 Bacteria 1495
1398 Ga0496113_0004384 3300048916 Bacteria 8659
1399 Ga0496113_0032886 3300048916 Bacteria 3771
1400 Ga0496113_0048809 3300048916 Bacteria 3150
1401 Ga0496113_0117004 3300048916 Bacteria 2080
1402 Ga0496113_0145554 3300048916 Bacteria 1866
1403 Ga0496113_0160149 3300048916 Bacteria 1779
1404 Ga0496113_0161097 3300048916 Bacteria 1774
1405 Ga0496113_0176928 3300048916 Bacteria 1691
1406 Ga0496113_0242173 3300048916 Bacteria 1439
1407 Ga0496113_0293049 3300048916 Bacteria 1302
1408 Ga0496114_0000856 3300048917 Bacteria 22807
1409 Ga0496114_0002897 3300048917 Bacteria 13141
1410 Ga0496114_0003794 3300048917 Bacteria 11647
1411 Ga0496114_0004945 3300048917 Bacteria 10389
1412 Ga0496114_0005170 3300048917 Bacteria 10183
1413 Ga0496114_0008988 3300048917 Bacteria 7922
1414 Ga0496114_0010173 3300048917 Bacteria 7483
1415 Ga0496114_0010762 3300048917 Bacteria 7282
1416 Ga0496114_0024643 3300048917 Bacteria 4911
1417 Ga0496114_0026758 3300048917 Bacteria 4724
1418 Ga0496114_0159077 3300048917 Bacteria 1963
1419 Ga0496114_0207769 3300048917 Bacteria 1716
1420 Ga0496114_0266356 3300048917 Bacteria 1509
1421 Ga0496114_0296868 3300048917 Bacteria 1426
1422 Ga0496115_0008488 3300048918 Bacteria 7599
1423 Ga0496115_0011413 3300048918 Bacteria 6660
1424 Ga0496115_0012370 3300048918 Bacteria 6419
1425 Ga0496115_0014232 3300048918 Bacteria 6020
1426 Ga0496115_0024138 3300048918 Bacteria 4724
1427 Ga0496115_0025689 3300048918 Bacteria 4589
1428 Ga0496115_0030427 3300048918 Bacteria 4247
1429 Ga0496115_0107161 3300048918 Bacteria 2294
1430 Ga0496115_0109880 3300048918 Bacteria 2264
1431 Ga0496116_0000072 3300048919 Bacteria 238158
1432 Ga0496116_0000192 3300048919 Bacteria 122270
1433 Ga0496116_0000340 3300048919 Bacteria 74829
1434 Ga0496116_0004507 3300048919 Bacteria 13256
1435 Ga0496116_0006124 3300048919 Bacteria 11002
1436 Ga0496116_0040697 3300048919 Bacteria 3197
1437 Ga0496116_0044629 3300048919 Bacteria 3009
1438 Ga0496116_0077370 3300048919 Bacteria 2079
1439 Ga0496117_0000039 3300048920 Bacteria 322143
1440 Ga0496117_0000273 3300048920 Bacteria 96400
1441 Ga0496117_0000387 3300048920 Bacteria 75589
1442 Ga0496117_0000603 3300048920 Bacteria 58910
1443 Ga0496117_0001092 3300048920 Bacteria 41000
1444 Ga0496117_0001118 3300048920 Bacteria 40433
1445 Ga0496117_0003783 3300048920 Bacteria 17282
1446 Ga0496117_0011201 3300048920 Bacteria 8052
1447 Ga0496117_0026526 3300048920 Bacteria 4532
1448 Ga0496117_0029438 3300048920 Bacteria 4233
1449 Ga0496117_0082135 3300048920 Bacteria 2112
1450 Ga0496117_0104653 3300048920 Bacteria 1780
1451 Ga0496118_0000035 3300048921 Bacteria 322143
1452 Ga0496118_0000096 3300048921 Bacteria 163988
1453 Ga0496118_0000455 3300048921 Bacteria 67720
1454 Ga0496118_0000610 3300048921 Bacteria 58893
1455 Ga0496118_0005126 3300048921 Bacteria 15052
1456 Ga0496118_0006081 3300048921 Bacteria 13430
1457 Ga0496118_0012779 3300048921 Bacteria 8017
1458 Ga0496118_0013007 3300048921 Bacteria 7918
1459 Ga0496118_0042972 3300048921 Bacteria 3558
1460 Ga0496118_0056178 3300048921 Bacteria 2962
1461 Ga0496118_0089622 3300048921 Bacteria 2123
1462 Ga0496119_0000035 3300048922 Bacteria 217007
1463 Ga0496119_0000340 3300048922 Bacteria 65290
1464 Ga0496119_0000437 3300048922 Bacteria 57106
1465 Ga0496119_0000617 3300048922 Bacteria 48028
1466 Ga0496119_0002053 3300048922 Bacteria 22784
1467 Ga0496119_0006039 3300048922 Bacteria 11361
1468 Ga0496119_0007359 3300048922 Bacteria 9945
1469 Ga0496119_0009886 3300048922 Bacteria 8103
1470 Ga0496119_0013009 3300048922 Bacteria 6683
1471 Ga0496119_0014900 3300048922 Bacteria 6044
1472 Ga0496119_0015958 3300048922 Bacteria 5746
1473 Ga0496119_0032105 3300048922 Bacteria 3506
1474 Ga0496119_0032848 3300048922 Bacteria 3453
1475 Ga0496119_0037248 3300048922 Bacteria 3163
1476 Ga0496119_0050977 3300048922 Bacteria 2547
1477 Ga0496119_0085588 3300048922 Bacteria 1804
1478 Ga0496120_0000079 3300048923 Bacteria 160413
1479 Ga0496120_0000372 3300048923 Bacteria 72951
1480 Ga0496120_0001715 3300048923 Bacteria 25001
1481 Ga0496120_0002620 3300048923 Bacteria 17825
1482 Ga0496120_0008527 3300048923 Bacteria 7426
1483 Ga0496120_0011616 3300048923 Bacteria 6043
1484 Ga0496120_0019430 3300048923 Bacteria 4346
1485 Ga0496120_0095399 3300048923 Bacteria 1581
1486 Ga0496121_0000004 3300048924 Bacteria 1139011
1487 Ga0496121_0000015 3300048924 Bacteria 571958
1488 Ga0496121_0000546 3300048924 Bacteria 71177
1489 Ga0496121_0002237 3300048924 Bacteria 30165
1490 Ga0496121_0004937 3300048924 Bacteria 17498
1491 Ga0496121_0013057 3300048924 Bacteria 8969
1492 Ga0496121_0022488 3300048924 Bacteria 6118
1493 Ga0496121_0037750 3300048924 Bacteria 4286
1494 Ga0496121_0066703 3300048924 Bacteria 2920
1495 Ga0496122_0000020 3300048925 Bacteria 401675
1496 Ga0496122_0000795 3300048925 Bacteria 60495
1497 Ga0496122_0001425 3300048925 Bacteria 38734
1498 Ga0496122_0004303 3300048925 Bacteria 17836
1499 Ga0496122_0015517 3300048925 Bacteria 7275
1500 Ga0496122_0016794 3300048925 Bacteria 6895
1501 Ga0496122_0017673 3300048925 Bacteria 6649
1502 Ga0496122_0028074 3300048925 Bacteria 4789
1503 Ga0496122_0045039 3300048925 Bacteria 3433
1504 Ga0496122_0105451 3300048925 Bacteria 1869
1505 Ga0496122_0143312 3300048925 Bacteria 1490
1506 Ga0496123_0000003 3300048926 Bacteria 866556
1507 Ga0496123_0000951 3300048926 Bacteria 45055
1508 Ga0496123_0007387 3300048926 Bacteria 10379
1509 Ga0496123_0011837 3300048926 Bacteria 7506
1510 Ga0496123_0015631 3300048926 Bacteria 6212
1511 Ga0496123_0022138 3300048926 Bacteria 4909
1512 Ga0496123_0025167 3300048926 Bacteria 4496
1513 Ga0496124_0000012 3300048927 Bacteria 512581
1514 Ga0496124_0000135 3300048927 Bacteria 152458
1515 Ga0496124_0002749 3300048927 Bacteria 22432
1516 Ga0496124_0008894 3300048927 Bacteria 10415
1517 Ga0496124_0009299 3300048927 Bacteria 10131
1518 Ga0496124_0035580 3300048927 Bacteria 4355
1519 Ga0496124_0043473 3300048927 Bacteria 3862
1520 Ga0496124_0090835 3300048927 Bacteria 2489
1521 Ga0496124_0107082 3300048927 Bacteria 2256
1522 Ga0496124_0144633 3300048927 Bacteria 1872
1523 Ga0496125_0000003 3300048928 Bacteria 1189767
1524 Ga0496125_0000128 3300048928 Bacteria 163865
1525 Ga0496125_0000209 3300048928 Bacteria 122267
1526 Ga0496125_0000859 3300048928 Bacteria 48719
1527 Ga0496125_0002332 3300048928 Bacteria 24952
1528 Ga0496125_0002425 3300048928 Bacteria 24246
1529 Ga0496125_0016465 3300048928 Bacteria 7097
1530 Ga0496125_0024752 3300048928 Bacteria 5513
1531 Ga0496125_0034370 3300048928 Bacteria 4469
1532 Ga0496125_0055163 3300048928 Bacteria 3240
1533 Ga0496125_0058704 3300048928 Bacteria 3106
1534 Ga0496125_0061796 3300048928 Bacteria 3001
1535 Ga0496125_0103900 3300048928 Bacteria 2083
1536 Ga0496126_0000001 3300048929 Bacteria 1139011
1537 Ga0496126_0000123 3300048929 Bacteria 182726
1538 Ga0496126_0000246 3300048929 Bacteria 116854
1539 Ga0496126_0000547 3300048929 Bacteria 72557
1540 Ga0496126_0004322 3300048929 Bacteria 17045
1541 Ga0496126_0005415 3300048929 Bacteria 14563
1542 Ga0496126_0005422 3300048929 Bacteria 14550
1543 Ga0496126_0006761 3300048929 Bacteria 12730
1544 Ga0496126_0009000 3300048929 Bacteria 10683
1545 Ga0496126_0033062 3300048929 Bacteria 4867
1546 Ga0496126_0033726 3300048929 Bacteria 4815
1547 Ga0496126_0035255 3300048929 Bacteria 4691
1548 Ga0496126_0035799 3300048929 Bacteria 4647
1549 Ga0496126_0058035 3300048929 Bacteria 3490
1550 Ga0496126_0061064 3300048929 Bacteria 3387
1551 Ga0496126_0068695 3300048929 Bacteria 3163
1552 Ga0496126_0084657 3300048929 Bacteria 2796
1553 Ga0496126_0088878 3300048929 Bacteria 2720
1554 Ga0496126_0090950 3300048929 Bacteria 2684
1555 Ga0496126_0098562 3300048929 Bacteria 2560
1556 Ga0496126_0121614 3300048929 Bacteria 2263
1557 Ga0496126_0246344 3300048929 Bacteria 1491
1558 Ga0501309_003333 3300049129 Bacteria 1814
1559 Ga0501305_008308 3300049161 Bacteria 1340
1560 Ga0501307_005589 3300049162 Bacteria 1330
1561 Ga0501311_006846 3300049527 Bacteria 1297
1562 Ga0501312_001617 3300049528 Bacteria 2258
1563 Ga0501313_005060 3300049529 Bacteria 1379
1564 Ga0501315_005844 3300049531 Bacteria 1348
1565 Ga0501315_006619 3300049531 Bacteria 1295
1566 Ga0501316_000498 3300049532 Bacteria 2738
1567 Ga0501318_005390 3300049534 Bacteria 1267
1568 Ga0501321_003486 3300049537 Bacteria 1443
1569 Ga0501321_004061 3300049537 Bacteria 1379
1570 Ga0501323_004697 3300049539 Bacteria 1458
1571 Ga0501324_002466 3300049540 Bacteria 1340
1572 Ga0501325_001168 3300049541 Bacteria 1547
1573 Ga0501335_000889 3300049551 Bacteria 2129
1574 Ga0501031_0000870 3300049568 Bacteria 18185
1575 Ga0501031_0007030 3300049568 Bacteria 7346
1576 Ga0501031_0010393 3300049568 Bacteria 6062
1577 Ga0501031_0012245 3300049568 Archaea 5591
1578 Ga0501031_0045672 3300049568 Bacteria 2858
1579 Ga0501031_0089772 3300049568 Bacteria 2004
1580 Ga0501031_0090382 3300049568 Bacteria 1997
1581 Ga0501032_0001154 3300049569 Bacteria 21164
1582 Ga0501032_0001277 3300049569 Bacteria 20179
1583 Ga0501032_0002711 3300049569 Bacteria 13809
1584 Ga0501032_0008178 3300049569 Bacteria 7627
1585 Ga0501032_0033588 3300049569 Bacteria 3514
1586 Ga0501032_0071221 3300049569 Bacteria 2317
1587 Ga0501032_0102712 3300049569 Bacteria 1894
1588 Ga0501033_0003100 3300049570 Bacteria 13804
1589 Ga0501033_0007412 3300049570 Bacteria 8544
1590 Ga0501033_0044237 3300049570 Bacteria 3315
1591 Ga0501033_0060294 3300049570 Bacteria 2800
1592 Ga0501033_0060590 3300049570 Bacteria 2791
1593 Ga0501033_0070028 3300049570 Archaea 2577
1594 Ga0501034_0000112 3300049571 Bacteria 150146
1595 Ga0501034_0000672 3300049571 Bacteria 51948
1596 Ga0501034_0008588 3300049571 Bacteria 10780
1597 Ga0501034_0013440 3300049571 Bacteria 8425
1598 Ga0501034_0017156 3300049571 Bacteria 7429
1599 Ga0501034_0023234 3300049571 Bacteria 6318
1600 Ga0501034_0025497 3300049571 Bacteria 6020
1601 Ga0501034_0034048 3300049571 Bacteria 5165
1602 Ga0501034_0046877 3300049571 Bacteria 4366
1603 Ga0501034_0076870 3300049571 Bacteria 3345
1604 Ga0501034_0114513 3300049571 Bacteria 2685
1605 Ga0501034_0142301 3300049571 Bacteria 2377
1606 Ga0501036_0002900 3300049572 Bacteria 13613
1607 Ga0501036_0004295 3300049572 Archaea 11515
1608 Ga0501036_0013420 3300049572 Bacteria 6808
1609 Ga0501036_0016775 3300049572 Bacteria 6118
1610 Ga0501036_0325757 3300049572 Bacteria 1283
1611 Ga0501037_0000110 3300049573 Bacteria 77484
1612 Ga0501037_0004426 3300049573 Bacteria 10203
1613 Ga0501037_0006221 3300049573 Archaea 8730
1614 Ga0501037_0010166 3300049573 Bacteria 6904
1615 Ga0501037_0012462 3300049573 Bacteria 6263
1616 Ga0501037_0056202 3300049573 Bacteria 2875
1617 Ga0501037_0082702 3300049573 Bacteria 2326
1618 Ga0501037_0176832 3300049573 Bacteria 1515
1619 Ga0501038_0003260 3300049574 Bacteria 15140
1620 Ga0501038_0010528 3300049574 Bacteria 8459
1621 Ga0501038_0014550 3300049574 Bacteria 7170
1622 Ga0501038_0024701 3300049574 Bacteria 5358
1623 Ga0501038_0032164 3300049574 Bacteria 4630
1624 Ga0501038_0051802 3300049574 Bacteria 3540
1625 Ga0501038_0190298 3300049574 Bacteria 1651
1626 Ga0501039_0000736 3300049575 Bacteria 23619
1627 Ga0501039_0000850 3300049575 Bacteria 22060
1628 Ga0501039_0001189 3300049575 Archaea 19065
1629 Ga0501039_0009621 3300049575 Bacteria 7368
1630 Ga0501039_0016611 3300049575 Bacteria 5638
1631 Ga0501039_0026165 3300049575 Bacteria 4484
1632 Ga0501039_0047333 3300049575 Bacteria 3324
1633 Ga0501039_0053386 3300049575 Bacteria 3127
1634 Ga0501040_0000341 3300049576 Archaea 27311
1635 Ga0501040_0000580 3300049576 Bacteria 22270
1636 Ga0501040_0003562 3300049576 Bacteria 10068
1637 Ga0501040_0006598 3300049576 Bacteria 7532
1638 Ga0501041_0000246 3300049577 Bacteria 25337
1639 Ga0501041_0009959 3300049577 Archaea 5600
1640 Ga0501041_0030224 3300049577 Bacteria 3270
1641 Ga0501041_0071012 3300049577 Bacteria 2138
1642 Ga0501041_0087092 3300049577 Bacteria 1927
1643 Ga0501042_0000686 3300049578 Bacteria 18336
1644 Ga0501042_0005870 3300049578 Bacteria 7935
1645 Ga0501042_0006117 3300049578 Archaea 7799
1646 Ga0501042_0015173 3300049578 Bacteria 5270
1647 Ga0501042_0021443 3300049578 Bacteria 4503
1648 Ga0501042_0092887 3300049578 Bacteria 2166
1649 Ga0501043_0001848 3300049579 Bacteria 18132
1650 Ga0501043_0013658 3300049579 Archaea 6356
1651 Ga0501043_0017486 3300049579 Bacteria 5621
1652 Ga0501043_0028591 3300049579 Bacteria 4377
1653 Ga0501043_0071980 3300049579 Bacteria 2715
1654 Ga0501043_0112879 3300049579 Bacteria 2134
1655 Ga0501043_0156350 3300049579 Bacteria 1783
1656 Ga0501043_0192190 3300049579 Bacteria 1587
1657 Ga0501043_0218664 3300049579 Bacteria 1474
1658 Ga0501046_0002303 3300049580 Archaea 17997
1659 Ga0501046_0003132 3300049580 Bacteria 15274
1660 Ga0501046_0006458 3300049580 Bacteria 10372
1661 Ga0501046_0016573 3300049580 Bacteria 6165
1662 Ga0501046_0068395 3300049580 Bacteria 2764
1663 Ga0501047_0000033 3300049581 Bacteria 206961
1664 Ga0501047_0000405 3300049581 Bacteria 48286
1665 Ga0501047_0001186 3300049581 Bacteria 25810
1666 Ga0501047_0004112 3300049581 Bacteria 13691
1667 Ga0501047_0011253 3300049581 Bacteria 8468
1668 Ga0501047_0030469 3300049581 Bacteria 5201
1669 Ga0501047_0038344 3300049581 Bacteria 4637
1670 Ga0501047_0058872 3300049581 Bacteria 3710
1671 Ga0501047_0077238 3300049581 Bacteria 3204
1672 Ga0501047_0229502 3300049581 Bacteria 1710
1673 Ga0501047_0274480 3300049581 Bacteria 1531
1674 Ga0501048_0000216 3300049582 Bacteria 37819
1675 Ga0501048_0001561 3300049582 Bacteria 17399
1676 Ga0501048_0004301 3300049582 Bacteria 10858
1677 Ga0501048_0006150 3300049582 Bacteria 9138
1678 Ga0501048_0006447 3300049582 Archaea 8920
1679 Ga0501048_0016662 3300049582 Bacteria 5418
1680 Ga0501067_0000725 3300049583 Bacteria 17733
1681 Ga0501067_0078387 3300049583 Bacteria 1831
1682 Ga0501068_0081071 3300049584 Bacteria 1992
1683 Ga0501069_0028354 3300049585 Bacteria 3069
1684 Ga0501069_0062124 3300049585 Bacteria 2086
1685 Ga0501069_0080869 3300049585 Bacteria 1830
1686 Ga0501069_0099180 3300049585 Bacteria 1653
1687 Ga0501070_0000165 3300049586 Bacteria 60736
1688 Ga0501070_0000181 3300049586 Bacteria 59005
1689 Ga0501070_0002694 3300049586 Bacteria 15506
1690 Ga0501070_0004105 3300049586 Bacteria 12522
1691 Ga0501070_0005678 3300049586 Bacteria 10639
1692 Ga0501070_0010602 3300049586 Bacteria 7789
1693 Ga0501070_0015185 3300049586 Bacteria 6482
1694 Ga0501070_0028759 3300049586 Bacteria 4660
1695 Ga0501070_0033327 3300049586 Bacteria 4310
1696 Ga0501070_0049412 3300049586 Bacteria 3493
1697 Ga0501070_0066146 3300049586 Bacteria 2993
1698 Ga0501070_0095561 3300049586 Bacteria 2459
1699 Ga0501070_0147320 3300049586 Bacteria 1943
1700 Ga0501071_0000275 3300049587 Bacteria 24403
1701 Ga0501071_0000327 3300049587 Bacteria 22895
1702 Ga0501071_0001195 3300049587 Archaea 14657
1703 Ga0501071_0015881 3300049587 Bacteria 5171
1704 Ga0501071_0044267 3300049587 Bacteria 3192
1705 Ga0501071_0063337 3300049587 Bacteria 2681
1706 Ga0501071_0123285 3300049587 Bacteria 1922
1707 Ga0501072_0000093 3300049588 Archaea 65665
1708 Ga0501072_0007441 3300049588 Bacteria 8305
1709 Ga0501072_0063803 3300049588 Bacteria 2906
1710 Ga0501073_0000030 3300049589 Bacteria 115949
1711 Ga0501073_0004926 3300049589 Bacteria 10021
1712 Ga0501073_0019857 3300049589 Bacteria 4848
1713 Ga0501073_0072187 3300049589 Bacteria 2404
1714 Ga0501074_0010064 3300049590 Bacteria 6865
1715 Ga0501074_0025535 3300049590 Archaea 4289
1716 Ga0501074_0025561 3300049590 Bacteria 4286
1717 Ga0501074_0034463 3300049590 Bacteria 3669
1718 Ga0501075_0001636 3300049591 Archaea 14713
1719 Ga0501075_0009734 3300049591 Bacteria 6735
1720 Ga0501075_0045189 3300049591 Bacteria 3305
1721 Ga0501075_0065901 3300049591 Bacteria 2732
1722 Ga0501076_0000260 3300049592 Bacteria 32510
1723 Ga0501076_0000392 3300049592 Archaea 27398
1724 Ga0501076_0013969 3300049592 Bacteria 6032
1725 Ga0501076_0048562 3300049592 Bacteria 3354
1726 Ga0501076_0075672 3300049592 Bacteria 2699
1727 Ga0501077_0000085 3300049593 Bacteria 46998
1728 Ga0501077_0009209 3300049593 Bacteria 6131
1729 Ga0501077_0110649 3300049593 Bacteria 1740
1730 Ga0501243_007284 3300049675 Bacteria 1690
1731 Ga0501079_0000790 3300049741 Archaea 21566
1732 Ga0501079_0001021 3300049741 Bacteria 19441
1733 Ga0501079_0074759 3300049741 Bacteria 2620
1734 Ga0501080_0000023 3300049742 Bacteria 90345
1735 Ga0501080_0005898 3300049742 Bacteria 10973
1736 Ga0501080_0020356 3300049742 Archaea 6140
1737 Ga0501080_0057567 3300049742 Bacteria 3619
1738 Ga0501080_0119618 3300049742 Bacteria 2442
1739 Ga0501080_0203250 3300049742 Bacteria 1818
1740 Ga0501081_0001553 3300049743 Archaea 14136
1741 Ga0501081_0015758 3300049743 Bacteria 4990
1742 Ga0501081_0023093 3300049743 Bacteria 4167
1743 Ga0501081_0029959 3300049743 Bacteria 3680
1744 Ga0501081_0041679 3300049743 Bacteria 3145
1745 Ga0501081_0183740 3300049743 Bacteria 1513
1746 Ga0501083_0000059 3300049744 Bacteria 78374
1747 Ga0501083_0027619 3300049744 Bacteria 3914
1748 Ga0501083_0124905 3300049744 Bacteria 1687
1749 Ga0501035_0000283 3300049822 Bacteria 60218
1750 Ga0501035_0005074 3300049822 Bacteria 12481
1751 Ga0501035_0030333 3300049822 Bacteria 4930
1752 Ga0501035_0038995 3300049822 Bacteria 4301
1753 Ga0501035_0042452 3300049822 Bacteria 4102
1754 Ga0501035_0054167 3300049822 Bacteria 3584
1755 Ga0501035_0063799 3300049822 Bacteria 3275
1756 Ga0501035_0173821 3300049822 Bacteria 1859
1757 Ga0501044_0004205 3300049823 Bacteria 16172
1758 Ga0501044_0005678 3300049823 Bacteria 13833
1759 Ga0501044_0011532 3300049823 Bacteria 9575
1760 Ga0501044_0017369 3300049823 Bacteria 7717
1761 Ga0501044_0076371 3300049823 Bacteria 3400
1762 Ga0501044_0151656 3300049823 Bacteria 2299
1763 Ga0501044_0205585 3300049823 Bacteria 1926
1764 Ga0501045_0000549 3300049824 Archaea 23515
1765 Ga0501045_0000716 3300049824 Bacteria 21100
1766 Ga0501045_0001190 3300049824 Bacteria 17312
1767 Ga0501045_0001314 3300049824 Bacteria 16480
1768 Ga0501045_0003432 3300049824 Bacteria 10841
1769 Ga0501045_0110489 3300049824 Bacteria 2038
1770 nmdc:mga03n38_15428_c1 3300050490 Bacteria 2950
1771 nmdc:mga03n38_32338_c1 3300050490 Bacteria 2215
1772 nmdc:mga03n38_70302_c1 3300050490 Bacteria 1618
1773 nmdc:mga00v17_11230_c1 3300050491 Bacteria 4919
1774 nmdc:mga00v17_177516_c1 3300050491 Bacteria 1374
1775 nmdc:mga00v17_200666_c1 3300050491 Bacteria 1289
1776 nmdc:mga00v17_23683_c1 3300050491 Bacteria 3554
1777 nmdc:mga00v17_26072_c1 3300050491 Bacteria 3402
1778 nmdc:mga00v17_50444_c1 3300050491 Bacteria 2529
1779 nmdc:mga00v17_51330_c1 3300050491 Bacteria 2508
1780 nmdc:mga00v17_56777_c1 3300050491 Bacteria 2394
1781 nmdc:mga00v17_6346_c1 3300050491 Bacteria 6269
1782 nmdc:mga00v17_70360_c1 3300050491 Bacteria 2167
1783 nmdc:mga00v17_7056_c1 3300050491 Bacteria 5982
1784 nmdc:mga00v17_7209_c1 3300050491 Bacteria 5923
1785 nmdc:mga0yw44_100736_c1 3300050492 Bacteria 1840
1786 nmdc:mga0yw44_103064_c1 3300050492 Bacteria 1820
1787 nmdc:mga0yw44_10630_c1 3300050492 Bacteria 4712
1788 nmdc:mga0yw44_12125_c1 3300050492 Bacteria 4481
1789 nmdc:mga0yw44_13350_c1 3300050492 Bacteria 4322
1790 nmdc:mga0yw44_229144_c1 3300050492 Bacteria 1233
1791 nmdc:mga0yw44_27067_c1 3300050492 Bacteria 3281
1792 nmdc:mga0yw44_58784_c1 3300050492 Bacteria 2350
1793 nmdc:mga06z11_145195_c1 3300050494 Bacteria 1344
1794 nmdc:mga07m45_1183_c1 3300050496 Bacteria 9017
1795 nmdc:mga07m45_14273_c1 3300050496 Bacteria 4228
1796 nmdc:mga07m45_62313_c1 3300050496 Bacteria 2113
1797 nmdc:mga07m45_68468_c1 3300050496 Bacteria 2018
1798 nmdc:mga05p37_130627_c1 3300050507 Bacteria 3082
1799 nmdc:mga05p37_147133_c1 3300050507 Bacteria 2883
1800 nmdc:mga05p37_59368_c1 3300050507 Bacteria 4710
1801 nmdc:mga0qj67_16520_c1 3300050509 Bacteria 5600
1802 nmdc:mga0qj67_199461_c1 3300050509 Bacteria 1626
1803 nmdc:mga0qj67_314_c1 3300050509 Bacteria 33600
1804 nmdc:mga0qj67_55011_c1 3300050509 Bacteria 3152
1805 nmdc:mga06r32_66862_c1 3300050510 Bacteria 3469
1806 nmdc:mga06r32_83948_c1 3300050510 Bacteria 3103
1807 nmdc:mga08y16_124196_c1 3300050511 Bacteria 2685
1808 nmdc:mga08y16_407028_c1 3300050511 Bacteria 1392
1809 nmdc:mga0n895_280587_c1 3300050512 Bacteria 1689
1810 nmdc:mga0n895_58260_c1 3300050512 Bacteria 3808
1811 nmdc:mga0rr50_116155_c1 3300050513 Bacteria 2124
1812 nmdc:mga0rr50_54532_c1 3300050513 Unclassified 2979
1813 nmdc:mga0a205_30295_c1 3300050515 Archaea 5179
1814 nmdc:mga0a205_3708_c1 3300050515 Bacteria 13671
1815 nmdc:mga0a205_50884_c1 3300050515 Bacteria 3999
1816 nmdc:mga0sz30_1040_c1 3300050516 Bacteria 9983
1817 nmdc:mga0sz30_1824_c2 3300050516 Bacteria 6986
1818 nmdc:mga0sz30_30283_c1 3300050516 Bacteria 2235
1819 nmdc:mga0sz30_34239_c1 3300050516 Bacteria 2113
1820 nmdc:mga0sz30_50583_c1 3300050516 Bacteria 1762
1821 Ga0495601_0032272 3300053077 Bacteria 3259
1822 Ga0500610_0003294 3300053079 Bacteria 6163
1823 Ga0500635_0000091 3300053080 Bacteria 55565
1824 Ga0500635_0018314 3300053080 Bacteria 2111
1825 Ga0495655_0001696 3300053083 Bacteria 3409
1826 Ga0495619_0000621 3300053085 Bacteria 23466
1827 Ga0495619_0022031 3300053085 Bacteria 4073
1828 Ga0495619_0036805 3300053085 Bacteria 3188
1829 Ga0495619_0072197 3300053085 Bacteria 2311
1830 Ga0495619_0152235 3300053085 Bacteria 1595
1831 Ga0495619_0169713 3300053085 Bacteria 1508
1832 Ga0500643_000086 3300053087 Bacteria 97106
1833 Ga0500643_001082 3300053087 Bacteria 16404
1834 Ga0500643_001466 3300053087 Bacteria 13548
1835 Ga0500646_0019346 3300053090 Bacteria 1802
1836 Ga0500651_0022307 3300053093 Bacteria 3954
1837 Ga0500641_0000526 3300053096 Bacteria 13777
1838 Ga0500556_0000115 3300053104 Bacteria 69837
1839 Ga0500556_0000496 3300053104 Bacteria 27297
1840 Ga0500556_0000626 3300053104 Bacteria 22358
1841 Ga0500562_010403 3300053108 Bacteria 2358
1842 Ga0500593_000731 3300053117 Bacteria 12438
1843 Ga0500642_0036336 3300053130 Bacteria 2099
1844 Ga0500652_000545 3300053131 Bacteria 13158
1845 Ga0500559_0001016 3300053136 Bacteria 17245
1846 Ga0500559_0001057 3300053136 Bacteria 16725
1847 Ga0500559_0009421 3300053136 Bacteria 4227
1848 Ga0500559_0024306 3300053136 Bacteria 2577
1849 Ga0500568_0000038 3300053139 Bacteria 134267
1850 Ga0500568_0000117 3300053139 Bacteria 71510
1851 Ga0500568_0001800 3300053139 Bacteria 13198
1852 Ga0500568_0004560 3300053139 Bacteria 7384
1853 Ga0500568_0017055 3300053139 Bacteria 3213
1854 Ga0500568_0040363 3300053139 Bacteria 1879
1855 Ga0500573_0000014 3300053140 Bacteria 193353
1856 Ga0500573_0000476 3300053140 Bacteria 17264
1857 Ga0500573_0015888 3300053140 Bacteria 4270
1858 Ga0500573_0018692 3300053140 Bacteria 3955
1859 Ga0500573_0018791 3300053140 Bacteria 3947
1860 Ga0500573_0029841 3300053140 Bacteria 3144
1861 Ga0500573_0039403 3300053140 Bacteria 2729
1862 Ga0500577_0001332 3300053142 Bacteria 6319
1863 Ga0500590_006984 3300053148 Bacteria 5541
1864 Ga0500600_0055938 3300053149 Bacteria 2220
1865 Ga0500616_0000027 3300053153 Bacteria 441053
1866 Ga0500616_0000115 3300053153 Bacteria 147212
1867 Ga0500616_0000117 3300053153 Bacteria 145655
1868 Ga0500616_0001308 3300053153 Bacteria 24623
1869 Ga0500616_0001664 3300053153 Bacteria 20508
1870 Ga0500616_0002288 3300053153 Bacteria 16223
1871 Ga0500620_000082 3300053155 Bacteria 18227
1872 Ga0500645_013215 3300053730 Bacteria 2655
1873 Ga0501084_0003669 3300054114 Bacteria 12458
1874 Ga0501084_0006148 3300054114 Bacteria 9871
1875 Ga0501084_0056074 3300054114 Bacteria 3297
1876 Ga0501084_0144759 3300054114 Bacteria 2002
1877 Ga0587084_001354 3300059477 Bacteria 2303
1878 Ga0587066_011832 3300059490 Bacteria 1288
1879 Ga0587077_002512 3300059493 Bacteria 2185
1880 Ga0587083_0013367 3300059505 Bacteria 1397
1881 Ga0587083_0019955 3300059505 Bacteria 1229
1882 Ga0587086_005976 3300059507 Bacteria 1339
1883 Ga0587090_000423 3300059510 Bacteria 3467
1884 Ga0587101_001172 3300059623 Bacteria 2174
1885 Ga0587128_008890 3300059630 Bacteria 1310
1886 Ga0501082_0004627 3300060353 Bacteria 12011
1887 Ga0501082_0009908 3300060353 Archaea 8213
1888 Ga0501082_0208433 3300060353 Bacteria 1701
1889 Ga0466962_0003043 3300061719 Bacteria 7996
1890 Ga0466962_0039612 3300061719 Bacteria 2256
1891 Ga0466962_0058962 3300061719 Bacteria 1832
1892 Ga0466962_0074207 3300061719 Bacteria 1625
1893 Ga0466962_0077614 3300061719 Bacteria 1588
1894 Ga0530510_0000536 3300061734 Bacteria 24331
1895 Ga0530510_0001061 3300061734 Archaea 18241
1896 Ga0530510_0017997 3300061734 Bacteria 5008
1897 Ga0530510_0046250 3300061734 Bacteria 3144
1898 Ga0530510_0122356 3300061734 Bacteria 1911
1899 Ga0530510_0151936 3300061734 Bacteria 1710

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025922 Ga0207646_10000477 Ga0207646_1000047726 308
2 3300005468 Ga0070707_100091207 Ga0070707_1000912073 321
3 3300025922 Ga0207646_10032861 Ga0207646_100328615 321
4 3300005468 Ga0070707_100188369 Ga0070707_1001883692 325
5 3300048908 Ga0496105_0020815 Ga0496105_0020815_1345_2343 326
6 3300048909 Ga0496106_0039704 Ga0496106_0039704_11_1009 326
7 3300006852 Ga0075433_10300617 Ga0075433_103006172 328
8 3300025922 Ga0207646_10302369 Ga0207646_103023691 328
9 3300048916 Ga0496113_0293049 Ga0496113_0293049_231_1268 330
10 3300025910 Ga0207684_10012433 Ga0207684_100124332 337
11 3300025922 Ga0207646_10005407 Ga0207646_1000540713 337
12 3300035086 Ga0373934_0004066 Ga0373934_0004066_3985_5184 337
13 3300050507 nmdc:mga05p37_130627_c1 nmdc:mga05p37_130627_c1_767_1912 338
14 3300005468 Ga0070707_100006726 Ga0070707_1000067261 339
15 3300005468 Ga0070707_100019191 Ga0070707_1000191915 339
16 3300005471 Ga0070698_100007659 Ga0070698_1000076595 339
17 3300025922 Ga0207646_10000516 Ga0207646_1000051652 339
18 3300025922 Ga0207646_10000701 Ga0207646_1000070140 339
19 3300050515 nmdc:mga0a205_3708_c1 nmdc:mga0a205_3708_c1_1283_2476 339
20 3300006852 Ga0075433_10122858 Ga0075433_101228582 341
21 3300006871 Ga0075434_100007636 Ga0075434_1000076366 341
22 3300007076 Ga0075435_100011202 Ga0075435_1000112027 341
23 3300050513 nmdc:mga0rr50_54532_c1 nmdc:mga0rr50_54532_c1_345_1472 341
24 3300050515 nmdc:mga0a205_30295_c1 nmdc:mga0a205_30295_c1_2658_3785 341
25 3300005549 Ga0070704_100041179 Ga0070704_1000411792 343
26 3300045976 Ga0466967_0037879 Ga0466967_0037879_2741_3919 344
27 3300031727 Ga0316576_10003072 Ga0316576_100030721 345
28 3300031728 Ga0316578_10003078 Ga0316578_100030784 345
29 3300035398 Ga0316574_0000415 Ga0316574_0000415_13798_14976 345
30 3300036712 Ga0316584_0082555 Ga0316584_0082555_924_2102 345
31 3300013105 Ga0157369_10199267 Ga0157369_101992672 346
32 3300047317 Ga0495604_0178944 Ga0495604_0178944_70_1269 346
33 3300005435 Ga0070714_100160700 Ga0070714_1001607002 347
34 3300046525 Ga0495663_0045978 Ga0495663_0045978_37_1182 347
35 3300053149 Ga0500600_0055938 Ga0500600_0055938_299_1486 347
36 3300048905 Ga0496102_0004544 Ga0496102_0004544_1913_3082 348
37 3300048905 Ga0496102_0268364 Ga0496102_0268364_118_1323 348
38 3300048906 Ga0496103_0102378 Ga0496103_0102378_152_1321 348
39 3300048919 Ga0496116_0044629 Ga0496116_0044629_1571_2701 348
40 3300049572 Ga0501036_0013420 Ga0501036_0013420_1641_2825 348
41 3300049574 Ga0501038_0032164 Ga0501038_0032164_356_1540 348
42 3300049575 Ga0501039_0026165 Ga0501039_0026165_1003_2187 348
43 3300049576 Ga0501040_0003562 Ga0501040_0003562_4337_5521 348
44 3300049578 Ga0501042_0021443 Ga0501042_0021443_2756_3940 348
45 3300049584 Ga0501068_0081071 Ga0501068_0081071_154_1338 348
46 3300049587 Ga0501071_0063337 Ga0501071_0063337_68_1252 348
47 3300049592 Ga0501076_0048562 Ga0501076_0048562_1593_2777 348
48 3300049824 Ga0501045_0003432 Ga0501045_0003432_1052_2236 348
49 3300061734 Ga0530510_0046250 Ga0530510_0046250_1209_2393 348
50 3300003203 JGI25406J46586_10002406 JGI25406J46586_100024064 349
51 3300005436 Ga0070713_100049495 Ga0070713_1000494953 349
52 3300005985 Ga0081539_10000467 Ga0081539_1000046772 349
53 3300006028 Ga0070717_10007764 Ga0070717_100077644 349
54 3300025904 Ga0207647_10009465 Ga0207647_100094655 349
55 3300025928 Ga0207700_10040797 Ga0207700_100407972 349
56 3300031838 Ga0307518_10001456 Ga0307518_100014564 349
57 3300035113 Ga0373936_0048159 Ga0373936_0048159_207_1406 349
58 3300035118 Ga0373954_0008715 Ga0373954_0008715_1728_2927 349
59 3300035119 Ga0373956_0011366 Ga0373956_0011366_1593_2792 349
60 3300035172 Ga0373955_0004750 Ga0373955_0004750_2819_4018 349
61 3300035410 Ga0373924_0023755 Ga0373924_0023755_859_2058 349
62 3300035692 Ga0373935_0064795 Ga0373935_0064795_950_2149 349
63 3300035724 Ga0373933_0066690 Ga0373933_0066690_839_2038 349
64 3300046454 Ga0495592_0038444 Ga0495592_0038444_1239_2438 349
65 3300046462 Ga0495651_0017310 Ga0495651_0017310_731_1930 349
66 3300046463 Ga0495653_0103440 Ga0495653_0103440_809_2008 349
67 3300046476 Ga0495662_0076855 Ga0495662_0076855_260_1459 349
68 3300046477 Ga0495664_0004512 Ga0495664_0004512_5849_7048 349
69 3300046511 Ga0495608_0028759 Ga0495608_0028759_1675_2874 349
70 3300046514 Ga0495618_0007805 Ga0495618_0007805_4487_5686 349
71 3300046517 Ga0495630_0196151 Ga0495630_0196151_233_1432 349
72 3300046533 Ga0495640_0029616 Ga0495640_0029616_533_1732 349
73 3300046536 Ga0495587_0036249 Ga0495587_0036249_1045_2244 349
74 3300046543 Ga0495645_0063671 Ga0495645_0063671_1410_2609 349
75 3300046559 Ga0495667_0006229 Ga0495667_0006229_6691_7890 349
76 3300046642 Ga0495634_0046259 Ga0495634_0046259_321_1520 349
77 3300046663 Ga0495635_0055240 Ga0495635_0055240_632_1831 349
78 3300046675 Ga0495657_0013583 Ga0495657_0013583_3942_5141 349
79 3300046678 Ga0495599_0007443 Ga0495599_0007443_903_2102 349
80 3300046680 Ga0495646_0037868 Ga0495646_0037868_915_2114 349
81 3300046689 Ga0495613_0038133 Ga0495613_0038133_1215_2414 349
82 3300047317 Ga0495604_0034564 Ga0495604_0034564_2069_3268 349
83 3300047319 Ga0495674_0034201 Ga0495674_0034201_1098_2297 349
84 3300047471 Ga0495684_0034970 Ga0495684_0034970_1991_3190 349
85 3300048088 Ga0495602_0131483 Ga0495602_0131483_354_1553 349
86 3300048928 Ga0496125_0002332 Ga0496125_0002332_16773_17939 349
87 3300053077 Ga0495601_0032272 Ga0495601_0032272_1625_2824 349
88 3300005983 Ga0081540_1004047 Ga0081540_10040474 350
89 3300053085 Ga0495619_0169713 Ga0495619_0169713_222_1412 350
90 3300005539 Ga0068853_100017372 Ga0068853_1000173722 351
91 3300045049 Ga0466959_0059074 Ga0466959_0059074_65_1234 351
92 3300046471 Ga0495650_0000130 Ga0495650_0000130_2831_3994 351
93 3300048921 Ga0496118_0042972 Ga0496118_0042972_1681_2949 351
94 3300048922 Ga0496119_0000437 Ga0496119_0000437_55769_56980 351
95 3300048923 Ga0496120_0001715 Ga0496120_0001715_23641_24852 351
96 3300049568 Ga0501031_0045672 Ga0501031_0045672_231_1394 351
97 3300049569 Ga0501032_0033588 Ga0501032_0033588_341_1513 351
98 3300049579 Ga0501043_0028591 Ga0501043_0028591_572_1744 351
99 3300049581 Ga0501047_0011253 Ga0501047_0011253_5814_6986 351
100 3300049582 Ga0501048_0000216 Ga0501048_0000216_16298_17470 351
101 3300049586 Ga0501070_0066146 Ga0501070_0066146_117_1280 351
102 3300049822 Ga0501035_0038995 Ga0501035_0038995_1631_2803 351
103 3300050512 nmdc:mga0n895_280587_c1 nmdc:mga0n895_280587_c1_456_1601 351
104 3300005467 Ga0070706_100006459 Ga0070706_1000064596 352
105 3300013296 Ga0157374_10041552 Ga0157374_100415522 352
106 3300045976 Ga0466967_0257291 Ga0466967_0257291_105_1280 352
107 3300048907 Ga0496104_0031350 Ga0496104_0031350_1024_2169 352
108 3300048913 Ga0496110_0112705 Ga0496110_0112705_1281_2426 352
109 3300005355 Ga0070671_100237954 Ga0070671_1002379542 353
110 3300005435 Ga0070714_100066546 Ga0070714_1000665462 353
111 3300009147 Ga0114129_10025993 Ga0114129_100259935 353
112 3300025901 Ga0207688_10114156 Ga0207688_101141561 353
113 3300025904 Ga0207647_10027988 Ga0207647_100279884 353
114 3300025929 Ga0207664_10017974 Ga0207664_100179742 353
115 3300030732 Ga0316176_1121577 Ga0316176_11215772 353
116 3300030733 Ga0314311_1132449 Ga0314311_11324492 353
117 3300044656 Ga0466969_0015497 Ga0466969_0015497_2175_3353 353
118 3300044693 Ga0466961_0067481 Ga0466961_0067481_504_1682 353
119 3300048909 Ga0496106_0202541 Ga0496106_0202541_367_1521 353
120 3300048929 Ga0496126_0061064 Ga0496126_0061064_482_1669 353
121 3300050507 nmdc:mga05p37_147133_c1 nmdc:mga05p37_147133_c1_684_1829 353
122 3300053085 Ga0495619_0072197 Ga0495619_0072197_971_2155 353
123 3300003911 JGI25405J52794_10000005 JGI25405J52794_100000054 354
124 3300030731 Ga0316177_1181774 Ga0316177_11817742 354
125 3300030732 Ga0316176_1187053 Ga0316176_11870532 354
126 3300030733 Ga0314311_1118439 Ga0314311_11184393 354
127 3300032002 Ga0307416_100140122 Ga0307416_1001401222 354
128 3300033179 Ga0307507_10045062 Ga0307507_100450622 354
129 3300042461 Ga0439460_0003464 Ga0439460_0003464_2451_3581 354
130 3300044658 Ga0466972_0016501 Ga0466972_0016501_686_1792 354
131 3300044683 Ga0466965_0003901 Ga0466965_0003901_4000_5106 354
132 3300046455 Ga0495603_0051227 Ga0495603_0051227_448_1581 354
133 3300046459 Ga0495629_0021240 Ga0495629_0021240_1393_2526 354
134 3300046499 Ga0495594_0003955 Ga0495594_0003955_941_2074 354
135 3300046674 Ga0495588_0010400 Ga0495588_0010400_1399_2532 354
136 3300048903 Ga0496100_0182178 Ga0496100_0182178_404_1504 354
137 3300048907 Ga0496104_0135208 Ga0496104_0135208_17_1117 354
138 3300048929 Ga0496126_0035799 Ga0496126_0035799_2158_3366 354
139 3300049568 Ga0501031_0012245 Ga0501031_0012245_1668_2798 354
140 3300049570 Ga0501033_0070028 Ga0501033_0070028_186_1316 354
141 3300049572 Ga0501036_0004295 Ga0501036_0004295_7955_9085 354
142 3300049573 Ga0501037_0006221 Ga0501037_0006221_4869_5999 354
143 3300049575 Ga0501039_0001189 Ga0501039_0001189_14824_15954 354
144 3300049576 Ga0501040_0000341 Ga0501040_0000341_7367_8497 354
145 3300049577 Ga0501041_0009959 Ga0501041_0009959_2332_3462 354
146 3300049578 Ga0501042_0006117 Ga0501042_0006117_4064_5194 354
147 3300049579 Ga0501043_0013658 Ga0501043_0013658_2153_3283 354
148 3300049580 Ga0501046_0002303 Ga0501046_0002303_6109_7239 354
149 3300049582 Ga0501048_0006447 Ga0501048_0006447_6392_7522 354
150 3300049587 Ga0501071_0001195 Ga0501071_0001195_11568_12698 354
151 3300049588 Ga0501072_0000093 Ga0501072_0000093_62133_63263 354
152 3300049590 Ga0501074_0025535 Ga0501074_0025535_1871_3001 354
153 3300049591 Ga0501075_0001636 Ga0501075_0001636_7307_8437 354
154 3300049592 Ga0501076_0000392 Ga0501076_0000392_21748_22878 354
155 3300049593 Ga0501077_0000085 Ga0501077_0000085_32820_33950 354
156 3300049741 Ga0501079_0000790 Ga0501079_0000790_3122_4252 354
157 3300049742 Ga0501080_0020356 Ga0501080_0020356_4169_5299 354
158 3300049743 Ga0501081_0001553 Ga0501081_0001553_2546_3676 354
159 3300049824 Ga0501045_0000549 Ga0501045_0000549_21452_22582 354
160 3300060353 Ga0501082_0009908 Ga0501082_0009908_934_2064 354
161 3300061734 Ga0530510_0001061 Ga0530510_0001061_13681_14811 354
162 3300005439 Ga0070711_100043841 Ga0070711_1000438412 355
163 3300006163 Ga0070715_10001150 Ga0070715_100011502 355
164 3300025915 Ga0207693_10000366 Ga0207693_1000036631 355
165 3300025915 Ga0207693_10227148 Ga0207693_102271481 355
166 3300025933 Ga0207706_10098926 Ga0207706_100989262 355
167 3300035089 Ga0373944_0000024 Ga0373944_0000024_17302_18441 355
168 3300035113 Ga0373936_0000240 Ga0373936_0000240_2336_3475 355
169 3300035170 Ga0373943_0007804 Ga0373943_0007804_3386_4525 355
170 3300035171 Ga0373946_0000252 Ga0373946_0000252_7384_8523 355
171 3300035410 Ga0373924_0039200 Ga0373924_0039200_365_1504 355
172 3300035692 Ga0373935_0012962 Ga0373935_0012962_2659_3798 355
173 3300035695 Ga0373927_0001996 Ga0373927_0001996_5517_6656 355
174 3300035725 Ga0373947_0007154 Ga0373947_0007154_5050_6189 355
175 3300037068 Ga0373925_0003736 Ga0373925_0003736_8021_9160 355
176 3300046455 Ga0495603_0005295 Ga0495603_0005295_986_2125 355
177 3300046459 Ga0495629_0007624 Ga0495629_0007624_6421_7560 355
178 3300046461 Ga0495641_0006042 Ga0495641_0006042_6421_7560 355
179 3300046463 Ga0495653_0073595 Ga0495653_0073595_1166_2305 355
180 3300046472 Ga0495580_0016410 Ga0495580_0016410_3216_4355 355
181 3300046473 Ga0495582_0000875 Ga0495582_0000875_4090_5229 355
182 3300046475 Ga0495639_0004796 Ga0495639_0004796_3473_4612 355
183 3300046476 Ga0495662_0000821 Ga0495662_0000821_7747_8886 355
184 3300046499 Ga0495594_0003942 Ga0495594_0003942_1217_2356 355
185 3300046517 Ga0495630_0001272 Ga0495630_0001272_5165_6304 355
186 3300046526 Ga0495666_0000235 Ga0495666_0000235_7618_8757 355
187 3300046531 Ga0495665_0000915 Ga0495665_0000915_5197_6336 355
188 3300046533 Ga0495640_0001181 Ga0495640_0001181_13932_15071 355
189 3300046535 Ga0495586_0000409 Ga0495586_0000409_14284_15423 355
190 3300046642 Ga0495634_0003288 Ga0495634_0003288_686_1825 355
191 3300046663 Ga0495635_0001201 Ga0495635_0001201_4053_5192 355
192 3300046674 Ga0495588_0000268 Ga0495588_0000268_33798_34937 355
193 3300046674 Ga0495588_0129165 Ga0495588_0129165_153_1292 355
194 3300046683 Ga0495658_0000153 Ga0495658_0000153_3385_4524 355
195 3300046689 Ga0495613_0001237 Ga0495613_0001237_3984_5123 355
196 3300046690 Ga0495624_0002578 Ga0495624_0002578_3473_4612 355
197 3300047315 Ga0495581_0000789 Ga0495581_0000789_12274_13413 355
198 3300047319 Ga0495674_0000640 Ga0495674_0000640_19327_20466 355
199 3300047321 Ga0495676_0019442 Ga0495676_0019442_3473_4612 355
200 3300047321 Ga0495676_0098413 Ga0495676_0098413_819_1958 355
201 3300047471 Ga0495684_0049619 Ga0495684_0049619_293_1432 355
202 3300047673 Ga0495593_0003161 Ga0495593_0003161_200_1339 355
203 3300048089 Ga0495614_0000222 Ga0495614_0000222_7893_9032 355
204 3300048907 Ga0496104_0068187 Ga0496104_0068187_2103_3272 355
205 3300053085 Ga0495619_0000621 Ga0495619_0000621_14157_15296 355
206 3300005435 Ga0070714_100164208 Ga0070714_1001642083 356
207 3300020080 Ga0206350_11148788 Ga0206350_111487881 356
208 3300041997 Ga0439431_0009936 Ga0439431_0009936_226_1413 356
209 3300044694 Ga0466963_0222462 Ga0466963_0222462_10_1182 356
210 3300046457 Ga0495590_0000413 Ga0495590_0000413_2904_4079 356
211 3300048928 Ga0496125_0000209 Ga0496125_0000209_28560_29726 356
212 3300049578 Ga0501042_0005870 Ga0501042_0005870_622_1785 356
213 3300049578 Ga0501042_0015173 Ga0501042_0015173_4048_5214 356
214 3300049579 Ga0501043_0112879 Ga0501043_0112879_688_1851 356
215 3300049589 Ga0501073_0019857 Ga0501073_0019857_307_1473 356
216 3300049744 Ga0501083_0000059 Ga0501083_0000059_20457_21620 356
217 3300049744 Ga0501083_0027619 Ga0501083_0027619_871_2034 356
218 3300053139 Ga0500568_0004560 Ga0500568_0004560_5335_6513 356
219 3300053139 Ga0500568_0017055 Ga0500568_0017055_731_1894 356
220 3300053139 Ga0500568_0040363 Ga0500568_0040363_455_1618 356
221 3300053153 Ga0500616_0000117 Ga0500616_0000117_29885_31048 356
222 iso_pu_bacteria 2870622029 2870622255 356
223 3300001990 JGI24737J22298_10025699 JGI24737J22298_100256992 357
224 3300005334 Ga0068869_100034322 Ga0068869_1000343223 357
225 3300005338 Ga0068868_100024841 Ga0068868_1000248413 357
226 3300005353 Ga0070669_100031283 Ga0070669_1000312833 357
227 3300005355 Ga0070671_100016620 Ga0070671_1000166203 357
228 3300005366 Ga0070659_100007670 Ga0070659_1000076704 357
229 3300005441 Ga0070700_100034233 Ga0070700_1000342333 357
230 3300005444 Ga0070694_100014338 Ga0070694_1000143384 357
231 3300005456 Ga0070678_100031232 Ga0070678_1000312323 357
232 3300005457 Ga0070662_100014959 Ga0070662_1000149592 357
233 3300005539 Ga0068853_100062708 Ga0068853_1000627083 357
234 3300005545 Ga0070695_100016540 Ga0070695_1000165403 357
235 3300005549 Ga0070704_100070886 Ga0070704_1000708862 357
236 3300005563 Ga0068855_100046784 Ga0068855_1000467843 357
237 3300005614 Ga0068856_100026637 Ga0068856_1000266374 357
238 3300005615 Ga0070702_100021808 Ga0070702_1000218083 357
239 3300005616 Ga0068852_100058986 Ga0068852_1000589864 357
240 3300005616 Ga0068852_100219404 Ga0068852_1002194042 357
241 3300006847 Ga0075431_100360363 Ga0075431_1003603632 357
242 3300009176 Ga0105242_10196341 Ga0105242_101963412 357
243 3300009545 Ga0105237_10059928 Ga0105237_100599284 357
244 3300009553 Ga0105249_10010531 Ga0105249_100105313 357
245 3300013306 Ga0163162_10029817 Ga0163162_100298173 357
246 3300013307 Ga0157372_10092930 Ga0157372_100929303 357
247 3300017792 Ga0163161_10010839 Ga0163161_100108394 357
248 3300025898 Ga0207692_10026792 Ga0207692_100267922 357
249 3300025915 Ga0207693_10015176 Ga0207693_100151763 357
250 3300025919 Ga0207657_10012581 Ga0207657_100125817 357
251 3300025929 Ga0207664_10124094 Ga0207664_101240942 357
252 3300025933 Ga0207706_10004090 Ga0207706_100040904 357
253 3300025934 Ga0207686_10039601 Ga0207686_100396013 357
254 3300025935 Ga0207709_10102032 Ga0207709_101020322 357
255 3300025949 Ga0207667_10045682 Ga0207667_100456822 357
256 3300025961 Ga0207712_10074694 Ga0207712_100746942 357
257 3300026088 Ga0207641_10169662 Ga0207641_101696622 357
258 3300026121 Ga0207683_10003164 Ga0207683_1000316410 357
259 3300026142 Ga0207698_10108734 Ga0207698_101087342 357
260 3300035114 Ga0373939_0026080 Ga0373939_0026080_385_1554 357
261 3300035207 Ga0373942_0007025 Ga0373942_0007025_865_2034 357
262 3300044765 Ga0466970_0100357 Ga0466970_0100357_31_1200 357
263 3300044901 Ga0466960_0021256 Ga0466960_0021256_553_1722 357
264 3300045976 Ga0466967_0084129 Ga0466967_0084129_593_1771 357
265 3300048911 Ga0496108_0020224 Ga0496108_0020224_3863_5032 357
266 3300048912 Ga0496109_0014775 Ga0496109_0014775_1896_3065 357
267 3300048915 Ga0496112_0113579 Ga0496112_0113579_697_1866 357
268 3300049570 Ga0501033_0003100 Ga0501033_0003100_4878_6044 357
269 3300049571 Ga0501034_0046877 Ga0501034_0046877_2187_3353 357
270 3300049571 Ga0501034_0142301 Ga0501034_0142301_841_2007 357
271 3300049572 Ga0501036_0325757 Ga0501036_0325757_71_1237 357
272 3300049575 Ga0501039_0053386 Ga0501039_0053386_730_1896 357
273 3300049579 Ga0501043_0071980 Ga0501043_0071980_845_2011 357
274 3300049579 Ga0501043_0218664 Ga0501043_0218664_208_1374 357
275 3300049580 Ga0501046_0068395 Ga0501046_0068395_1239_2405 357
276 3300049581 Ga0501047_0077238 Ga0501047_0077238_160_1326 357
277 3300049581 Ga0501047_0274480 Ga0501047_0274480_295_1461 357
278 3300049582 Ga0501048_0004301 Ga0501048_0004301_1425_2591 357
279 3300049586 Ga0501070_0010602 Ga0501070_0010602_2772_3938 357
280 3300049589 Ga0501073_0072187 Ga0501073_0072187_789_1955 357
281 3300049742 Ga0501080_0000023 Ga0501080_0000023_63374_64540 357
282 3300049822 Ga0501035_0173821 Ga0501035_0173821_23_1189 357
283 3300049823 Ga0501044_0151656 Ga0501044_0151656_1063_2229 357
284 3300050512 nmdc:mga0n895_58260_c1 nmdc:mga0n895_58260_c1_1277_2446 357
285 3300050515 nmdc:mga0a205_50884_c1 nmdc:mga0a205_50884_c1_1856_3025 357
286 3300053136 Ga0500559_0009421 Ga0500559_0009421_1559_2722 357
287 3300054114 Ga0501084_0144759 Ga0501084_0144759_456_1622 357
288 3300003578 Ga0006562J51391_1028453 Ga0006562J51391_10284534 358
289 3300005467 Ga0070706_100012286 Ga0070706_1000122867 358
290 3300005468 Ga0070707_100011559 Ga0070707_1000115594 358
291 3300005471 Ga0070698_100018135 Ga0070698_1000181355 358
292 3300005563 Ga0068855_100034488 Ga0068855_1000344885 358
293 3300005937 Ga0081455_10079007 Ga0081455_100790072 358
294 3300007265 Ga0099794_10000314 Ga0099794_100003143 358
295 3300009174 Ga0105241_10023785 Ga0105241_100237855 358
296 3300009545 Ga0105237_10139560 Ga0105237_101395602 358
297 3300020077 Ga0206351_10456609 Ga0206351_104566092 358
298 3300025909 Ga0207705_10150677 Ga0207705_101506772 358
299 3300025914 Ga0207671_10018148 Ga0207671_100181484 358
300 3300025922 Ga0207646_10004516 Ga0207646_100045167 358
301 3300025949 Ga0207667_10020001 Ga0207667_100200014 358
302 3300025949 Ga0207667_10084614 Ga0207667_100846142 358
303 3300044658 Ga0466972_0002008 Ga0466972_0002008_4999_6168 358
304 3300044706 Ga0466964_0027290 Ga0466964_0027290_755_1924 358
305 3300048927 Ga0496124_0107082 Ga0496124_0107082_260_1426 358
306 3300049571 Ga0501034_0023234 Ga0501034_0023234_1316_2485 358
307 3300049581 Ga0501047_0038344 Ga0501047_0038344_2704_3867 358
308 3300049581 Ga0501047_0229502 Ga0501047_0229502_30_1199 358
309 3300049583 Ga0501067_0078387 Ga0501067_0078387_590_1759 358
310 3300049586 Ga0501070_0147320 Ga0501070_0147320_570_1733 358
311 3300049743 Ga0501081_0041679 Ga0501081_0041679_130_1239 358
312 3300049743 Ga0501081_0183740 Ga0501081_0183740_252_1361 358
313 3300049823 Ga0501044_0076371 Ga0501044_0076371_209_1372 358
314 3300050509 nmdc:mga0qj67_199461_c1 nmdc:mga0qj67_199461_c1_301_1500 358
315 3300053140 Ga0500573_0018692 Ga0500573_0018692_1657_2820 358
316 3300005356 Ga0070674_100139963 Ga0070674_1001399632 359
317 3300005434 Ga0070709_10012741 Ga0070709_100127412 359
318 3300005548 Ga0070665_100287046 Ga0070665_1002870461 359
319 3300005718 Ga0068866_10058969 Ga0068866_100589692 359
320 3300006038 Ga0075365_10002456 Ga0075365_100024562 359
321 3300006237 Ga0097621_100151492 Ga0097621_1001514922 359
322 3300009101 Ga0105247_10043655 Ga0105247_100436553 359
323 3300009148 Ga0105243_10029324 Ga0105243_100293244 359
324 3300009176 Ga0105242_10018500 Ga0105242_100185002 359
325 3300013297 Ga0157378_10033544 Ga0157378_100335442 359
326 3300013308 Ga0157375_10016612 Ga0157375_100166126 359
327 3300025899 Ga0207642_10067166 Ga0207642_100671662 359
328 3300025919 Ga0207657_10068982 Ga0207657_100689822 359
329 3300025925 Ga0207650_10339941 Ga0207650_103399411 359
330 3300025934 Ga0207686_10163127 Ga0207686_101631272 359
331 3300025935 Ga0207709_10013839 Ga0207709_100138392 359
332 3300025937 Ga0207669_10135649 Ga0207669_101356492 359
333 3300026023 Ga0207677_10082134 Ga0207677_100821342 359
334 3300026089 Ga0207648_10051302 Ga0207648_100513021 359
335 3300028379 Ga0268266_10065440 Ga0268266_100654403 359
336 3300028800 Ga0265338_10000376 Ga0265338_1000037629 359
337 3300031852 Ga0307410_10172421 Ga0307410_101724211 359
338 3300035695 Ga0373927_0049873 Ga0373927_0049873_843_2021 359
339 3300044683 Ga0466965_0033743 Ga0466965_0033743_362_1525 359
340 3300044684 Ga0466966_0037815 Ga0466966_0037815_685_1854 359
341 3300044901 Ga0466960_0037032 Ga0466960_0037032_718_1881 359
342 3300048904 Ga0496101_0071443 Ga0496101_0071443_783_1925 359
343 3300048910 Ga0496107_0030297 Ga0496107_0030297_393_1535 359
344 3300048912 Ga0496109_0045826 Ga0496109_0045826_2289_3431 359
345 3300048913 Ga0496110_0002915 Ga0496110_0002915_2614_3756 359
346 3300048917 Ga0496114_0026758 Ga0496114_0026758_1516_2658 359
347 3300048921 Ga0496118_0005126 Ga0496118_0005126_5647_6810 359
348 3300049162 Ga0501307_005589 Ga0501307_005589_128_1291 359
349 3300049528 Ga0501312_001617 Ga0501312_001617_141_1304 359
350 3300049531 Ga0501315_005844 Ga0501315_005844_43_1206 359
351 3300049534 Ga0501318_005390 Ga0501318_005390_62_1225 359
352 3300049537 Ga0501321_003486 Ga0501321_003486_43_1206 359
353 3300049568 Ga0501031_0089772 Ga0501031_0089772_617_1792 359
354 3300049589 Ga0501073_0000030 Ga0501073_0000030_36120_37295 359
355 3300049823 Ga0501044_0205585 Ga0501044_0205585_232_1401 359
356 3300053153 Ga0500616_0001664 Ga0500616_0001664_17805_18986 359
357 iso_pu_bacteria 2558860280 2559430722 359
358 3300005289 Ga0065704_10073835 Ga0065704_100738357 360
359 3300005435 Ga0070714_100051731 Ga0070714_1000517312 360
360 3300005456 Ga0070678_100177184 Ga0070678_1001771842 360
361 3300014325 Ga0163163_10235044 Ga0163163_102350442 360
362 3300025926 Ga0207659_10102824 Ga0207659_101028242 360
363 3300041405 Ga0439438_025400 Ga0439438_025400_344_1498 360
364 3300041413 Ga0439465_0047901 Ga0439465_0047901_224_1378 360
365 3300041997 Ga0439431_0016012 Ga0439431_0016012_479_1633 360
366 3300048907 Ga0496104_0140953 Ga0496104_0140953_934_2112 360
367 3300048911 Ga0496108_0043103 Ga0496108_0043103_1941_3119 360
368 3300048912 Ga0496109_0011265 Ga0496109_0011265_6040_7218 360
369 3300048913 Ga0496110_0023479 Ga0496110_0023479_476_1654 360
370 3300048921 Ga0496118_0013007 Ga0496118_0013007_726_1844 360
371 3300049571 Ga0501034_0114513 Ga0501034_0114513_431_1600 360
372 3300053140 Ga0500573_0000476 Ga0500573_0000476_7294_8409 360
373 3300053142 Ga0500577_0001332 Ga0500577_0001332_359_1474 360
374 iso_pu_bacteria 2895427314 2895428178 360
375 3300013104 Ga0157370_10293017 Ga0157370_102930172 361
376 3300013105 Ga0157369_10132655 Ga0157369_101326552 361
377 3300021441 Ga0213871_10015809 Ga0213871_100158092 361
378 3300026067 Ga0207678_10219045 Ga0207678_102190452 361
379 3300026121 Ga0207683_10377498 Ga0207683_103774981 361
380 3300039438 Ga0436360_0167640 Ga0436360_0167640_354_1517 361
381 3300039447 Ga0436361_0615022 Ga0436361_0615022_2989_4152 361
382 3300039453 Ga0436362_0365102 Ga0436362_0365102_1000_2163 361
383 3300048928 Ga0496125_0103900 Ga0496125_0103900_52_1215 361
384 iso_pu_bacteria 2791355406 2793982994 361
385 iso_pu_bacteria 8033684223 8033684397 361
386 iso_pu_bacteria 8047893842 8047895175 361
387 iso_pu_bacteria 8048127548 8048136500 361
388 iso_pu_bacteria 8048356638 8048363777 361
389 iso_pu_bacteria 8048369669 8048372201 361
390 iso_pu_bacteria 8048379754 8048381135 361
391 3300005329 Ga0070683_100029105 Ga0070683_1000291052 362
392 3300005535 Ga0070684_100056129 Ga0070684_1000561292 362
393 3300026075 Ga0207708_10091878 Ga0207708_100918782 362
394 3300028794 Ga0307515_10175114 Ga0307515_101751142 362
395 3300031456 Ga0307513_10004729 Ga0307513_100047298 362
396 3300037418 Ga0395900_0035372 Ga0395900_0035372_108_1271 362
397 3300041410 Ga0439461_0010106 Ga0439461_0010106_14_1189 362
398 iso_pu_bacteria 2582581312 2585298246 362
399 3300005288 Ga0065714_10099404 Ga0065714_100994042 363
400 3300005347 Ga0070668_100005919 Ga0070668_1000059197 363
401 3300005455 Ga0070663_100047102 Ga0070663_1000471022 363
402 3300006051 Ga0075364_10126099 Ga0075364_101260991 363
403 3300013105 Ga0157369_10067879 Ga0157369_100678793 363
404 3300022467 Ga0224712_10010230 Ga0224712_100102301 363
405 3300025904 Ga0207647_10046699 Ga0207647_100466992 363
406 3300025917 Ga0207660_10200760 Ga0207660_102007601 363
407 3300025972 Ga0207668_10025670 Ga0207668_100256703 363
408 3300026067 Ga0207678_10084801 Ga0207678_100848013 363
409 3300026116 Ga0207674_10134200 Ga0207674_101342002 363
410 3300028794 Ga0307515_10037313 Ga0307515_100373132 363
411 3300031616 Ga0307508_10135401 Ga0307508_101354011 363
412 3300031731 Ga0307405_10039590 Ga0307405_100395902 363
413 3300031901 Ga0307406_10000520 Ga0307406_100005202 363
414 3300031901 Ga0307406_10069841 Ga0307406_100698412 363
415 3300031903 Ga0307407_10037797 Ga0307407_100377972 363
416 3300031911 Ga0307412_10078687 Ga0307412_100786871 363
417 3300031995 Ga0307409_100010167 Ga0307409_1000101676 363
418 3300032002 Ga0307416_100103395 Ga0307416_1001033953 363
419 3300032004 Ga0307414_10032644 Ga0307414_100326442 363
420 3300032004 Ga0307414_10086547 Ga0307414_100865472 363
421 3300032005 Ga0307411_10043938 Ga0307411_100439381 363
422 3300032126 Ga0307415_100064299 Ga0307415_1000642992 363
423 3300045976 Ga0466967_0062509 Ga0466967_0062509_824_1978 363
424 3300048922 Ga0496119_0015958 Ga0496119_0015958_4054_5232 363
425 3300048925 Ga0496122_0001425 Ga0496122_0001425_27866_29044 363
426 3300048925 Ga0496122_0105451 Ga0496122_0105451_325_1494 363
427 3300048928 Ga0496125_0000128 Ga0496125_0000128_158977_160155 363
428 3300049568 Ga0501031_0090382 Ga0501031_0090382_687_1841 363
429 3300049571 Ga0501034_0008588 Ga0501034_0008588_1692_2861 363
430 3300049675 Ga0501243_007284 Ga0501243_007284_160_1314 363
431 3300050492 nmdc:mga0yw44_12125_c1 nmdc:mga0yw44_12125_c1_738_1901 363
432 3300061734 Ga0530510_0151936 Ga0530510_0151936_42_1196 363
433 3300003792 Ga0055540_1017813 Ga0055540_10178132 364
434 3300005329 Ga0070683_100008624 Ga0070683_1000086245 364
435 3300005329 Ga0070683_100054846 Ga0070683_1000548464 364
436 3300005339 Ga0070660_100086430 Ga0070660_1000864301 364
437 3300005341 Ga0070691_10106531 Ga0070691_101065311 364
438 3300005458 Ga0070681_10310482 Ga0070681_103104821 364
439 3300005535 Ga0070684_100010114 Ga0070684_1000101142 364
440 3300005548 Ga0070665_100029488 Ga0070665_1000294885 364
441 3300005841 Ga0068863_100035553 Ga0068863_1000355534 364
442 3300005842 Ga0068858_100012390 Ga0068858_1000123905 364
443 3300005843 Ga0068860_100000154 Ga0068860_10000015490 364
444 3300006051 Ga0075364_10133480 Ga0075364_101334802 364
445 3300009098 Ga0105245_10004537 Ga0105245_100045378 364
446 3300009148 Ga0105243_10201321 Ga0105243_102013211 364
447 3300009553 Ga0105249_10267898 Ga0105249_102678982 364
448 3300013105 Ga0157369_10022758 Ga0157369_100227581 364
449 3300020082 Ga0206353_11101538 Ga0206353_111015382 364
450 3300022467 Ga0224712_10023129 Ga0224712_100231291 364
451 3300025273 Ga0209673_1017529 Ga0209673_10175293 364
452 3300025303 Ga0209051_1015719 Ga0209051_10157193 364
453 3300025912 Ga0207707_10142229 Ga0207707_101422292 364
454 3300025919 Ga0207657_10090348 Ga0207657_100903482 364
455 3300025927 Ga0207687_10001986 Ga0207687_100019866 364
456 3300025929 Ga0207664_10056316 Ga0207664_100563163 364
457 3300025961 Ga0207712_10177215 Ga0207712_101772152 364
458 3300026035 Ga0207703_10008645 Ga0207703_100086455 364
459 3300026067 Ga0207678_10000229 Ga0207678_1000022948 364
460 3300026067 Ga0207678_10053285 Ga0207678_100532852 364
461 3300026078 Ga0207702_10221456 Ga0207702_102214562 364
462 3300026088 Ga0207641_10001715 Ga0207641_1000171516 364
463 3300026116 Ga0207674_10064434 Ga0207674_100644344 364
464 3300028379 Ga0268266_10001660 Ga0268266_1000166018 364
465 3300028381 Ga0268264_10000210 Ga0268264_1000021094 364
466 3300044694 Ga0466963_0030660 Ga0466963_0030660_1090_2259 364
467 3300044901 Ga0466960_0010324 Ga0466960_0010324_805_1962 364
468 3300045049 Ga0466959_0067718 Ga0466959_0067718_702_1853 364
469 3300045976 Ga0466967_0005159 Ga0466967_0005159_6186_7355 364
470 3300046460 Ga0495638_0014114 Ga0495638_0014114_3162_4325 364
471 3300048917 Ga0496114_0005170 Ga0496114_0005170_3251_4411 364
472 3300048918 Ga0496115_0008488 Ga0496115_0008488_3948_5108 364
473 3300048918 Ga0496115_0107161 Ga0496115_0107161_284_1471 364
474 3300048920 Ga0496117_0082135 Ga0496117_0082135_462_1625 364
475 3300048929 Ga0496126_0004322 Ga0496126_0004322_5279_6442 364
476 3300048929 Ga0496126_0088878 Ga0496126_0088878_289_1476 364
477 3300049822 Ga0501035_0030333 Ga0501035_0030333_157_1320 364
478 3300050491 nmdc:mga00v17_50444_c1 nmdc:mga00v17_50444_c1_384_1547 364
479 3300050513 nmdc:mga0rr50_116155_c1 nmdc:mga0rr50_116155_c1_904_2094 364
480 3300053079 Ga0500610_0003294 Ga0500610_0003294_230_1393 364
481 3300053080 Ga0500635_0000091 Ga0500635_0000091_42428_43591 364
482 3300053090 Ga0500646_0019346 Ga0500646_0019346_116_1279 364
483 3300053130 Ga0500642_0036336 Ga0500642_0036336_60_1280 364
484 3300053136 Ga0500559_0024306 Ga0500559_0024306_67_1230 364
485 3300005353 Ga0070669_100000820 Ga0070669_10000082013 365
486 3300005367 Ga0070667_100000605 Ga0070667_1000006058 365
487 3300005548 Ga0070665_100004177 Ga0070665_1000041774 365
488 3300005617 Ga0068859_100002254 Ga0068859_1000022545 365
489 3300005841 Ga0068863_100003048 Ga0068863_1000030488 365
490 3300005843 Ga0068860_100000087 Ga0068860_100000087130 365
491 3300005844 Ga0068862_100000190 Ga0068862_10000019036 365
492 3300006931 Ga0097620_100002254 Ga0097620_1000022545 365
493 3300009101 Ga0105247_10000159 Ga0105247_1000015932 365
494 3300009177 Ga0105248_10000050 Ga0105248_10000050121 365
495 3300009553 Ga0105249_10000042 Ga0105249_1000004231 365
496 3300013306 Ga0163162_10195861 Ga0163162_101958613 365
497 3300022467 Ga0224712_10020419 Ga0224712_100204191 365
498 3300025900 Ga0207710_10000173 Ga0207710_1000017333 365
499 3300025923 Ga0207681_10003622 Ga0207681_100036224 365
500 3300025941 Ga0207711_10000988 Ga0207711_1000098823 365
501 3300025961 Ga0207712_10000010 Ga0207712_10000010421 365
502 3300025986 Ga0207658_10000278 Ga0207658_1000027824 365
503 3300026088 Ga0207641_10000784 Ga0207641_1000078412 365
504 3300028379 Ga0268266_10012115 Ga0268266_100121154 365
505 3300028380 Ga0268265_10000014 Ga0268265_1000001431 365
506 3300028381 Ga0268264_10000150 Ga0268264_10000150127 365
507 3300046455 Ga0495603_0000513 Ga0495603_0000513_1177_2310 365
508 3300046648 Ga0495611_0028770 Ga0495611_0028770_933_2066 365
509 3300046683 Ga0495658_0049811 Ga0495658_0049811_71_1237 365
510 3300046689 Ga0495613_0077661 Ga0495613_0077661_1162_2295 365
511 3300047321 Ga0495676_0015473 Ga0495676_0015473_4168_5301 365
512 3300047472 Ga0495686_0008844 Ga0495686_0008844_5652_6815 365
513 3300048089 Ga0495614_0000110 Ga0495614_0000110_19828_20961 365
514 3300048903 Ga0496100_0002885 Ga0496100_0002885_5339_6502 365
515 3300048904 Ga0496101_0000178 Ga0496101_0000178_20820_21983 365
516 3300048904 Ga0496101_0019798 Ga0496101_0019798_26_1192 365
517 3300048905 Ga0496102_0000011 Ga0496102_0000011_282190_283353 365
518 3300048905 Ga0496102_0000235 Ga0496102_0000235_26567_27733 365
519 3300048906 Ga0496103_0000032 Ga0496103_0000032_161899_163062 365
520 3300048906 Ga0496103_0000460 Ga0496103_0000460_30973_32139 365
521 3300048911 Ga0496108_0015334 Ga0496108_0015334_3041_4201 365
522 3300048917 Ga0496114_0024643 Ga0496114_0024643_980_2167 365
523 3300048919 Ga0496116_0000072 Ga0496116_0000072_198604_199767 365
524 3300048919 Ga0496116_0006124 Ga0496116_0006124_1780_2946 365
525 3300048920 Ga0496117_0000039 Ga0496117_0000039_38392_39555 365
526 3300048920 Ga0496117_0001118 Ga0496117_0001118_19795_20961 365
527 3300048921 Ga0496118_0000035 Ga0496118_0000035_282589_283752 365
528 3300048921 Ga0496118_0000455 Ga0496118_0000455_4387_5553 365
529 3300048922 Ga0496119_0000035 Ga0496119_0000035_169525_170688 365
530 3300048922 Ga0496119_0006039 Ga0496119_0006039_8492_9658 365
531 3300048923 Ga0496120_0000079 Ga0496120_0000079_128021_129184 365
532 3300048923 Ga0496120_0095399 Ga0496120_0095399_402_1568 365
533 3300048924 Ga0496121_0000546 Ga0496121_0000546_1488_2651 365
534 3300048924 Ga0496121_0002237 Ga0496121_0002237_6845_8011 365
535 3300048927 Ga0496124_0043473 Ga0496124_0043473_1850_3016 365
536 3300048928 Ga0496125_0024752 Ga0496125_0024752_1668_2834 365
537 3300048929 Ga0496126_0084657 Ga0496126_0084657_886_2052 365
538 3300053131 Ga0500652_000545 Ga0500652_000545_1105_2268 365
539 3300003792 Ga0055540_1007503 Ga0055540_10075033 366
540 3300005337 Ga0070682_100041420 Ga0070682_1000414202 366
541 3300005338 Ga0068868_100005688 Ga0068868_1000056884 366
542 3300005339 Ga0070660_100028725 Ga0070660_1000287252 366
543 3300005344 Ga0070661_100075188 Ga0070661_1000751882 366
544 3300005347 Ga0070668_100004776 Ga0070668_1000047764 366
545 3300005366 Ga0070659_100005058 Ga0070659_1000050587 366
546 3300005435 Ga0070714_100046967 Ga0070714_1000469672 366
547 3300005441 Ga0070700_100196840 Ga0070700_1001968401 366
548 3300005455 Ga0070663_100126923 Ga0070663_1001269232 366
549 3300005466 Ga0070685_10043877 Ga0070685_100438772 366
550 3300005530 Ga0070679_100388985 Ga0070679_1003889851 366
551 3300005539 Ga0068853_100022417 Ga0068853_1000224174 366
552 3300005614 Ga0068856_100048666 Ga0068856_1000486664 366
553 3300005616 Ga0068852_100042387 Ga0068852_1000423872 366
554 3300005617 Ga0068859_100012347 Ga0068859_1000123477 366
555 3300006038 Ga0075365_10033360 Ga0075365_100333603 366
556 3300006038 Ga0075365_10034198 Ga0075365_100341984 366
557 3300006178 Ga0075367_10177514 Ga0075367_101775141 366
558 3300006186 Ga0075369_10002730 Ga0075369_100027304 366
559 3300006186 Ga0075369_10085197 Ga0075369_100851972 366
560 3300006931 Ga0097620_100012347 Ga0097620_1000123476 366
561 3300009093 Ga0105240_10005015 Ga0105240_1000501514 366
562 3300009098 Ga0105245_10126199 Ga0105245_101261992 366
563 3300009545 Ga0105237_10000302 Ga0105237_1000030242 366
564 3300010375 Ga0105239_10004010 Ga0105239_1000401016 366
565 3300014968 Ga0157379_10002686 Ga0157379_100026868 366
566 3300020077 Ga0206351_10127684 Ga0206351_101276841 366
567 3300025254 Ga0209148_1010632 Ga0209148_10106322 366
568 3300025303 Ga0209051_1000633 Ga0209051_10006339 366
569 3300025303 Ga0209051_1002844 Ga0209051_10028442 366
570 3300025909 Ga0207705_10054377 Ga0207705_100543772 366
571 3300025911 Ga0207654_10000001 Ga0207654_10000001922 366
572 3300025913 Ga0207695_10011642 Ga0207695_1001164212 366
573 3300025914 Ga0207671_10002478 Ga0207671_1000247810 366
574 3300025919 Ga0207657_10005602 Ga0207657_1000560212 366
575 3300025927 Ga0207687_10006572 Ga0207687_100065722 366
576 3300025929 Ga0207664_10031585 Ga0207664_100315852 366
577 3300025932 Ga0207690_10023284 Ga0207690_100232842 366
578 3300025949 Ga0207667_10005061 Ga0207667_1000506110 366
579 3300025949 Ga0207667_10129403 Ga0207667_101294033 366
580 3300025972 Ga0207668_10009380 Ga0207668_100093804 366
581 3300026023 Ga0207677_10071358 Ga0207677_100713581 366
582 3300026041 Ga0207639_10016458 Ga0207639_100164584 366
583 3300026067 Ga0207678_10019579 Ga0207678_100195794 366
584 3300026067 Ga0207678_10140891 Ga0207678_101408912 366
585 3300026075 Ga0207708_10226059 Ga0207708_102260592 366
586 3300026078 Ga0207702_10022503 Ga0207702_100225036 366
587 3300031456 Ga0307513_10202081 Ga0307513_102020812 366
588 3300031691 Ga0316579_10039363 Ga0316579_100393632 366
589 3300031731 Ga0307405_10164076 Ga0307405_101640762 366
590 3300033179 Ga0307507_10045348 Ga0307507_100453483 366
591 3300041410 Ga0439461_0000541 Ga0439461_0000541_1857_3020 366
592 3300041411 Ga0439466_0001530 Ga0439466_0001530_5021_6184 366
593 3300041997 Ga0439431_0000277 Ga0439431_0000277_4822_5985 366
594 3300042004 Ga0439445_0000717 Ga0439445_0000717_1141_2304 366
595 3300042435 Ga0439434_0002886 Ga0439434_0002886_2107_3270 366
596 3300045976 Ga0466967_0031939 Ga0466967_0031939_2656_3819 366
597 3300046460 Ga0495638_0029044 Ga0495638_0029044_1484_2647 366
598 3300046524 Ga0495648_0002340 Ga0495648_0002340_7731_8894 366
599 3300046528 Ga0495642_0048447 Ga0495642_0048447_97_1260 366
600 3300047320 Ga0495672_0002784 Ga0495672_0002784_9763_10926 366
601 3300047469 Ga0495673_0045644 Ga0495673_0045644_695_1858 366
602 3300048909 Ga0496106_0120446 Ga0496106_0120446_385_1548 366
603 3300048911 Ga0496108_0026361 Ga0496108_0026361_440_1603 366
604 3300048912 Ga0496109_0005372 Ga0496109_0005372_7386_8549 366
605 3300048913 Ga0496110_0023163 Ga0496110_0023163_833_1996 366
606 3300048915 Ga0496112_0038767 Ga0496112_0038767_1946_3109 366
607 3300048928 Ga0496125_0058704 Ga0496125_0058704_152_1315 366
608 3300048929 Ga0496126_0009000 Ga0496126_0009000_5692_6909 366
609 3300049587 Ga0501071_0123285 Ga0501071_0123285_386_1552 366
610 3300050490 nmdc:mga03n38_15428_c1 nmdc:mga03n38_15428_c1_90_1253 366
611 3300050492 nmdc:mga0yw44_100736_c1 nmdc:mga0yw44_100736_c1_76_1239 366
612 3300050492 nmdc:mga0yw44_27067_c1 nmdc:mga0yw44_27067_c1_1942_3105 366
613 3300050496 nmdc:mga07m45_14273_c1 nmdc:mga07m45_14273_c1_2996_4159 366
614 3300050516 nmdc:mga0sz30_1824_c2 nmdc:mga0sz30_1824_c2_5315_6496 366
615 3300050516 nmdc:mga0sz30_30283_c1 nmdc:mga0sz30_30283_c1_706_1869 366
616 3300050516 nmdc:mga0sz30_50583_c1 nmdc:mga0sz30_50583_c1_556_1719 366
617 3300053080 Ga0500635_0018314 Ga0500635_0018314_259_1422 366
618 3300053087 Ga0500643_001082 Ga0500643_001082_6335_7498 366
619 3300053093 Ga0500651_0022307 Ga0500651_0022307_419_1582 366
620 3300053148 Ga0500590_006984 Ga0500590_006984_3850_5013 366
621 iso_pu_bacteria 8003314358 8003321489 366
622 3300005329 Ga0070683_100078600 Ga0070683_1000786002 367
623 3300005543 Ga0070672_100011247 Ga0070672_1000112476 367
624 3300005618 Ga0068864_100025782 Ga0068864_1000257822 367
625 3300009545 Ga0105237_10005434 Ga0105237_1000543410 367
626 3300011119 Ga0105246_10094175 Ga0105246_100941752 367
627 3300013105 Ga0157369_10012349 Ga0157369_100123498 367
628 3300014325 Ga0163163_10072366 Ga0163163_100723661 367
629 3300020069 Ga0197907_10127029 Ga0197907_101270292 367
630 3300025940 Ga0207691_10020522 Ga0207691_100205226 367
631 3300025941 Ga0207711_10005023 Ga0207711_1000502311 367
632 3300026078 Ga0207702_10236734 Ga0207702_102367342 367
633 3300026142 Ga0207698_10217215 Ga0207698_102172152 367
634 3300031649 Ga0307514_10011079 Ga0307514_100110795 367
635 3300031727 Ga0316576_10001380 Ga0316576_100013803 367
636 3300031733 Ga0316577_10026975 Ga0316577_100269752 367
637 3300032137 Ga0316585_10006425 Ga0316585_100064252 367
638 3300035083 Ga0373926_0000004 Ga0373926_0000004_31746_32885 367
639 3300035398 Ga0316574_0025924 Ga0316574_0025924_1774_3042 367
640 3300037312 Ga0395899_0070232 Ga0395899_0070232_1354_2544 367
641 3300037471 Ga0395905_0056411 Ga0395905_0056411_676_1833 367
642 3300046455 Ga0495603_0008346 Ga0495603_0008346_619_1782 367
643 3300046459 Ga0495629_0022859 Ga0495629_0022859_437_1600 367
644 3300046473 Ga0495582_0050291 Ga0495582_0050291_1046_2209 367
645 3300046526 Ga0495666_0041008 Ga0495666_0041008_1064_2227 367
646 3300046533 Ga0495640_0076097 Ga0495640_0076097_159_1322 367
647 3300046681 Ga0495647_0047038 Ga0495647_0047038_333_1496 367
648 3300047315 Ga0495581_0079686 Ga0495581_0079686_193_1356 367
649 3300047319 Ga0495674_0043532 Ga0495674_0043532_706_1869 367
650 3300048905 Ga0496102_0057352 Ga0496102_0057352_812_1981 367
651 3300048918 Ga0496115_0025689 Ga0496115_0025689_422_1630 367
652 3300053153 Ga0500616_0002288 Ga0500616_0002288_5307_6470 367
653 3300003373 JGI25407J50210_10004858 JGI25407J50210_100048583 368
654 3300003578 Ga0006562J51391_1032082 Ga0006562J51391_10320822 368
655 3300003792 Ga0055540_1000022 Ga0055540_100002236 368
656 3300005339 Ga0070660_100031568 Ga0070660_1000315684 368
657 3300005366 Ga0070659_100001798 Ga0070659_1000017988 368
658 3300005367 Ga0070667_100000674 Ga0070667_10000067417 368
659 3300005435 Ga0070714_100207909 Ga0070714_1002079091 368
660 3300005530 Ga0070679_100011185 Ga0070679_1000111858 368
661 3300005535 Ga0070684_100071021 Ga0070684_1000710213 368
662 3300005539 Ga0068853_100089100 Ga0068853_1000891003 368
663 3300005577 Ga0068857_100005690 Ga0068857_1000056902 368
664 3300005577 Ga0068857_100266979 Ga0068857_1002669792 368
665 3300005614 Ga0068856_100022435 Ga0068856_1000224353 368
666 3300005616 Ga0068852_100006651 Ga0068852_1000066513 368
667 3300005834 Ga0068851_10000022 Ga0068851_10000022107 368
668 3300005981 Ga0081538_10001382 Ga0081538_1000138219 368
669 3300005981 Ga0081538_10001794 Ga0081538_1000179412 368
670 3300009036 Ga0105244_10112258 Ga0105244_101122581 368
671 3300009093 Ga0105240_10051407 Ga0105240_100514075 368
672 3300009545 Ga0105237_10001065 Ga0105237_100010655 368
673 3300009545 Ga0105237_10035167 Ga0105237_100351673 368
674 3300009551 Ga0105238_10133069 Ga0105238_101330692 368
675 3300013104 Ga0157370_10034752 Ga0157370_100347522 368
676 3300013105 Ga0157369_10010811 Ga0157369_100108119 368
677 3300013307 Ga0157372_10079284 Ga0157372_100792842 368
678 3300020081 Ga0206354_11437303 Ga0206354_114373031 368
679 3300022467 Ga0224712_10042451 Ga0224712_100424512 368
680 3300025303 Ga0209051_1000033 Ga0209051_100003336 368
681 3300025321 Ga0207656_10000005 Ga0207656_10000005368 368
682 3300025912 Ga0207707_10008629 Ga0207707_100086293 368
683 3300025914 Ga0207671_10000016 Ga0207671_1000001692 368
684 3300025917 Ga0207660_10017090 Ga0207660_100170903 368
685 3300025919 Ga0207657_10035747 Ga0207657_100357473 368
686 3300025921 Ga0207652_10006710 Ga0207652_100067102 368
687 3300025944 Ga0207661_10000257 Ga0207661_100002579 368
688 3300025945 Ga0207679_10297567 Ga0207679_102975671 368
689 3300026078 Ga0207702_10032719 Ga0207702_100327193 368
690 3300026116 Ga0207674_10006801 Ga0207674_1000680116 368
691 3300026116 Ga0207674_10127782 Ga0207674_101277822 368
692 3300026142 Ga0207698_10173142 Ga0207698_101731422 368
693 3300031731 Ga0307405_10034091 Ga0307405_100340911 368
694 3300031995 Ga0307409_100002984 Ga0307409_1000029842 368
695 3300032002 Ga0307416_100180815 Ga0307416_1001808151 368
696 3300032005 Ga0307411_10082429 Ga0307411_100824292 368
697 3300032126 Ga0307415_100046464 Ga0307415_1000464642 368
698 3300042005 Ga0439448_0013319 Ga0439448_0013319_36_1199 368
699 3300044658 Ga0466972_0008483 Ga0466972_0008483_932_2095 368
700 3300044658 Ga0466972_0024952 Ga0466972_0024952_1629_2792 368
701 3300044683 Ga0466965_0025571 Ga0466965_0025571_846_2009 368
702 3300044683 Ga0466965_0031824 Ga0466965_0031824_869_2032 368
703 3300044735 Ga0466968_0019763 Ga0466968_0019763_1021_2184 368
704 3300044765 Ga0466970_0020060 Ga0466970_0020060_967_2130 368
705 3300044842 Ga0466957_0003409 Ga0466957_0003409_6604_7767 368
706 3300044901 Ga0466960_0009870 Ga0466960_0009870_2184_3347 368
707 3300044901 Ga0466960_0028067 Ga0466960_0028067_514_1677 368
708 3300045049 Ga0466959_0006267 Ga0466959_0006267_5939_7102 368
709 3300045836 Ga0466958_0056887 Ga0466958_0056887_1058_2221 368
710 3300045976 Ga0466967_0026874 Ga0466967_0026874_2650_3813 368
711 3300045976 Ga0466967_0029449 Ga0466967_0029449_2281_3444 368
712 3300046683 Ga0495658_0018789 Ga0495658_0018789_342_1508 368
713 3300048903 Ga0496100_0000097 Ga0496100_0000097_40660_41823 368
714 3300048904 Ga0496101_0000032 Ga0496101_0000032_26783_27946 368
715 3300048905 Ga0496102_0002707 Ga0496102_0002707_6807_7970 368
716 3300048906 Ga0496103_0000624 Ga0496103_0000624_18531_19694 368
717 3300048908 Ga0496105_0227897 Ga0496105_0227897_173_1348 368
718 3300048909 Ga0496106_0000768 Ga0496106_0000768_910_2073 368
719 3300048910 Ga0496107_0002827 Ga0496107_0002827_6021_7184 368
720 3300048911 Ga0496108_0001698 Ga0496108_0001698_1297_2460 368
721 3300048912 Ga0496109_0000305 Ga0496109_0000305_41952_43115 368
722 3300048913 Ga0496110_0006568 Ga0496110_0006568_5154_6317 368
723 3300048914 Ga0496111_0016859 Ga0496111_0016859_2727_3890 368
724 3300048915 Ga0496112_0070088 Ga0496112_0070088_389_1552 368
725 3300048915 Ga0496112_0320244 Ga0496112_0320244_152_1315 368
726 3300048916 Ga0496113_0048809 Ga0496113_0048809_804_1967 368
727 3300048916 Ga0496113_0242173 Ga0496113_0242173_247_1410 368
728 3300048917 Ga0496114_0000856 Ga0496114_0000856_20069_21232 368
729 3300048918 Ga0496115_0014232 Ga0496115_0014232_1512_2675 368
730 3300048919 Ga0496116_0004507 Ga0496116_0004507_4764_5927 368
731 3300048920 Ga0496117_0029438 Ga0496117_0029438_2173_3336 368
732 3300048921 Ga0496118_0012779 Ga0496118_0012779_4473_5636 368
733 3300048922 Ga0496119_0002053 Ga0496119_0002053_16754_17917 368
734 3300048923 Ga0496120_0011616 Ga0496120_0011616_2695_3858 368
735 3300048924 Ga0496121_0000004 Ga0496121_0000004_317508_318671 368
736 3300048925 Ga0496122_0016794 Ga0496122_0016794_5076_6239 368
737 3300048925 Ga0496122_0028074 Ga0496122_0028074_174_1337 368
738 3300048926 Ga0496123_0011837 Ga0496123_0011837_6232_7395 368
739 3300048926 Ga0496123_0022138 Ga0496123_0022138_1930_3093 368
740 3300048927 Ga0496124_0000012 Ga0496124_0000012_42301_43464 368
741 3300048928 Ga0496125_0000003 Ga0496125_0000003_871097_872260 368
742 3300048929 Ga0496126_0000001 Ga0496126_0000001_317508_318671 368
743 3300048929 Ga0496126_0035255 Ga0496126_0035255_1383_2546 368
744 3300049569 Ga0501032_0001154 Ga0501032_0001154_9841_11004 368
745 3300049571 Ga0501034_0013440 Ga0501034_0013440_4112_5275 368
746 3300049572 Ga0501036_0016775 Ga0501036_0016775_815_1978 368
747 3300049573 Ga0501037_0000110 Ga0501037_0000110_3131_4294 368
748 3300049574 Ga0501038_0014550 Ga0501038_0014550_4806_5969 368
749 3300049575 Ga0501039_0000736 Ga0501039_0000736_14220_15383 368
750 3300049579 Ga0501043_0017486 Ga0501043_0017486_399_1562 368
751 3300049586 Ga0501070_0015185 Ga0501070_0015185_2165_3328 368
752 3300049823 Ga0501044_0005678 Ga0501044_0005678_577_1740 368
753 iso_pu_bacteria 2643221961 2645720691 368
754 iso_pu_bacteria 2643221962 2645723710 368
755 3300005329 Ga0070683_100061592 Ga0070683_1000615922 369
756 3300005530 Ga0070679_100195083 Ga0070679_1001950832 369
757 3300005535 Ga0070684_100010640 Ga0070684_1000106407 369
758 3300005985 Ga0081539_10072469 Ga0081539_100724692 369
759 3300006051 Ga0075364_10003104 Ga0075364_100031048 369
760 3300006353 Ga0075370_10074977 Ga0075370_100749771 369
761 3300009545 Ga0105237_10004166 Ga0105237_1000416610 369
762 3300025921 Ga0207652_10230134 Ga0207652_102301342 369
763 3300025944 Ga0207661_10063407 Ga0207661_100634073 369
764 3300026041 Ga0207639_10152400 Ga0207639_101524002 369
765 3300031852 Ga0307410_10099559 Ga0307410_100995592 369
766 3300032002 Ga0307416_100176682 Ga0307416_1001766821 369
767 3300032004 Ga0307414_10040079 Ga0307414_100400792 369
768 3300044765 Ga0466970_0052244 Ga0466970_0052244_865_2034 369
769 3300045836 Ga0466958_0135562 Ga0466958_0135562_365_1537 369
770 3300048906 Ga0496103_0007239 Ga0496103_0007239_4564_5766 369
771 3300048911 Ga0496108_0113673 Ga0496108_0113673_865_2010 369
772 3300048912 Ga0496109_0041162 Ga0496109_0041162_916_2061 369
773 3300049532 Ga0501316_000498 Ga0501316_000498_109_1275 369
774 3300050491 nmdc:mga00v17_7056_c1 nmdc:mga00v17_7056_c1_3829_4992 369
775 3300050496 nmdc:mga07m45_1183_c1 nmdc:mga07m45_1183_c1_7089_8252 369
776 3300050516 nmdc:mga0sz30_34239_c1 nmdc:mga0sz30_34239_c1_346_1509 369
777 3300053139 Ga0500568_0000117 Ga0500568_0000117_8983_10146 369
778 3300061719 Ga0466962_0077614 Ga0466962_0077614_284_1456 369
779 iso_pu_bacteria 2643221697 2644538694 369
780 iso_pu_bacteria 2816332119 2816424357 369
781 iso_pu_bacteria 2917736166 2917736598 369
782 iso_pu_bacteria 2984592036 2984593946 369
783 3300003760 Ga0055527_1000017 Ga0055527_1000017111 370
784 3300003762 Ga0055542_1000044 Ga0055542_1000044111 370
785 3300003763 Ga0055529_1000279 Ga0055529_100027966 370
786 3300005842 Ga0068858_100000016 Ga0068858_10000001636 370
787 3300009093 Ga0105240_10313825 Ga0105240_103138252 370
788 3300009551 Ga0105238_10053225 Ga0105238_100532252 370
789 3300025228 Ga0209672_100039 Ga0209672_100039112 370
790 3300025229 Ga0209147_100507 Ga0209147_10050713 370
791 3300025254 Ga0209148_1000004 Ga0209148_1000004112 370
792 3300025272 Ga0209455_1000117 Ga0209455_1000117121 370
793 3300025924 Ga0207694_10000057 Ga0207694_1000005731 370
794 3300025929 Ga0207664_10011215 Ga0207664_100112155 370
795 3300026035 Ga0207703_10000345 Ga0207703_100003457 370
796 3300026041 Ga0207639_10094180 Ga0207639_100941802 370
797 3300028794 Ga0307515_10022361 Ga0307515_100223614 370
798 3300031911 Ga0307412_10010775 Ga0307412_100107752 370
799 3300042002 Ga0439442_001243 Ga0439442_001243_2641_3810 370
800 3300042007 Ga0439449_0014860 Ga0439449_0014860_720_1889 370
801 3300045976 Ga0466967_0273131 Ga0466967_0273131_339_1484 370
802 3300048904 Ga0496101_0016940 Ga0496101_0016940_1445_2608 370
803 3300048905 Ga0496102_0067913 Ga0496102_0067913_1361_2524 370
804 3300048907 Ga0496104_0072889 Ga0496104_0072889_739_1902 370
805 3300048908 Ga0496105_0036703 Ga0496105_0036703_924_2087 370
806 3300048917 Ga0496114_0010173 Ga0496114_0010173_1266_2429 370
807 3300048924 Ga0496121_0037750 Ga0496121_0037750_2013_3176 370
808 3300048929 Ga0496126_0033062 Ga0496126_0033062_2574_3737 370
809 3300049541 Ga0501325_001168 Ga0501325_001168_49_1215 370
810 3300049585 Ga0501069_0080869 Ga0501069_0080869_189_1364 370
811 3300049742 Ga0501080_0119618 Ga0501080_0119618_455_1630 370
812 3300050491 nmdc:mga00v17_177516_c1 nmdc:mga00v17_177516_c1_112_1278 370
813 3300061734 Ga0530510_0122356 Ga0530510_0122356_92_1240 370
814 iso_pu_bacteria 2585427649 2586060711 370
815 iso_pu_bacteria 8047710418 8047719528 370
816 iso_pu_bacteria 8054609563 8054613903 370
817 iso_pu_bacteria 8055172936 8055177139 370
818 3300005328 Ga0070676_10180578 Ga0070676_101805781 371
819 3300006880 Ga0075429_100023377 Ga0075429_1000233776 371
820 3300013250 Ga0171462_1001 Ga0171462_1001520 371
821 3300031995 Ga0307409_100021286 Ga0307409_1000212865 371
822 3300033180 Ga0307510_10037636 Ga0307510_100376364 371
823 3300036712 Ga0316584_0058602 Ga0316584_0058602_854_2032 371
824 3300048929 Ga0496126_0000123 Ga0496126_0000123_90961_92139 371
825 3300048929 Ga0496126_0246344 Ga0496126_0246344_43_1212 371
826 3300053083 Ga0495655_0001696 Ga0495655_0001696_1727_2890 371
827 iso_pu_bacteria 2773857762 2774394494 371
828 iso_pu_bacteria 2808606439 2809194652 371
829 iso_pu_bacteria 2811994878 2812349393 371
830 iso_pu_bacteria 2870721527 2870730025 371
831 iso_pu_bacteria 2891968417 2891972895 371
832 3300005471 Ga0070698_100012160 Ga0070698_1000121607 372
833 3300005983 Ga0081540_1003861 Ga0081540_10038612 372
834 3300009098 Ga0105245_10149353 Ga0105245_101493532 372
835 3300010375 Ga0105239_10012785 Ga0105239_100127858 372
836 3300011119 Ga0105246_10003745 Ga0105246_100037457 372
837 3300013306 Ga0163162_10084959 Ga0163162_100849593 372
838 3300013308 Ga0157375_10087739 Ga0157375_100877392 372
839 3300031995 Ga0307409_100151170 Ga0307409_1001511702 372
840 3300035083 Ga0373926_0005331 Ga0373926_0005331_1967_3163 372
841 3300035171 Ga0373946_0043766 Ga0373946_0043766_23_1219 372
842 3300035692 Ga0373935_0000834 Ga0373935_0000834_2007_3203 372
843 3300035725 Ga0373947_0000007 Ga0373947_0000007_168939_170135 372
844 3300042009 Ga0439451_004531 Ga0439451_004531_806_1966 372
845 3300042011 Ga0439454_002842 Ga0439454_002842_656_1816 372
846 3300044706 Ga0466964_0095766 Ga0466964_0095766_48_1217 372
847 3300045976 Ga0466967_0163864 Ga0466967_0163864_464_1615 372
848 3300047320 Ga0495672_0086173 Ga0495672_0086173_553_1707 372
849 3300048911 Ga0496108_0039938 Ga0496108_0039938_688_1839 372
850 3300048912 Ga0496109_0091869 Ga0496109_0091869_1588_2739 372
851 3300048913 Ga0496110_0113775 Ga0496110_0113775_1043_2194 372
852 3300048914 Ga0496111_0005153 Ga0496111_0005153_6817_7968 372
853 3300048916 Ga0496113_0161097 Ga0496113_0161097_436_1587 372
854 3300048917 Ga0496114_0159077 Ga0496114_0159077_493_1644 372
855 3300048917 Ga0496114_0207769 Ga0496114_0207769_267_1418 372
856 3300049577 Ga0501041_0087092 Ga0501041_0087092_16_1167 372
857 3300049585 Ga0501069_0062124 Ga0501069_0062124_533_1684 372
858 3300049586 Ga0501070_0002694 Ga0501070_0002694_1105_2256 372
859 3300049586 Ga0501070_0095561 Ga0501070_0095561_797_1954 372
860 3300049588 Ga0501072_0063803 Ga0501072_0063803_435_1586 372
861 3300049590 Ga0501074_0010064 Ga0501074_0010064_1821_2972 372
862 3300049592 Ga0501076_0075672 Ga0501076_0075672_428_1579 372
863 3300049742 Ga0501080_0203250 Ga0501080_0203250_504_1655 372
864 3300049824 Ga0501045_0110489 Ga0501045_0110489_186_1337 372
865 3300050490 nmdc:mga03n38_32338_c1 nmdc:mga03n38_32338_c1_234_1385 372
866 3300050491 nmdc:mga00v17_26072_c1 nmdc:mga00v17_26072_c1_1253_2404 372
867 3300050491 nmdc:mga00v17_70360_c1 nmdc:mga00v17_70360_c1_944_2095 372
868 3300050492 nmdc:mga0yw44_103064_c1 nmdc:mga0yw44_103064_c1_251_1402 372
869 3300050492 nmdc:mga0yw44_10630_c1 nmdc:mga0yw44_10630_c1_1178_2329 372
870 3300050492 nmdc:mga0yw44_229144_c1 nmdc:mga0yw44_229144_c1_64_1215 372
871 3300050496 nmdc:mga07m45_62313_c1 nmdc:mga07m45_62313_c1_922_2073 372
872 iso_pu_bacteria 2523231044 2523386351 372
873 iso_pu_bacteria 2537561592 2537898934 372
874 iso_pu_bacteria 2585428157 2588106890 372
875 iso_pu_bacteria 2622736605 2623497579 372
876 iso_pu_bacteria 2643221542 2643734893 372
877 iso_pu_bacteria 2643221546 2643753811 372
878 iso_pu_bacteria 2643221553 2643783497 372
879 iso_pu_bacteria 2643221566 2643847960 372
880 iso_pu_bacteria 2643221575 2643888300 372
881 iso_pu_bacteria 2643221597 2643994948 372
882 iso_pu_bacteria 2643221616 2644096481 372
883 iso_pu_bacteria 2643221630 2644173053 372
884 iso_pu_bacteria 2643221632 2644182487 372
885 iso_pu_bacteria 2643221635 2644197913 372
886 iso_pu_bacteria 2643221687 2644490564 372
887 iso_pu_bacteria 2643221715 2644637035 372
888 iso_pu_bacteria 2643221724 2644679263 372
889 iso_pu_bacteria 2728369380 2730228766 372
890 iso_pu_bacteria 2738541264 2738668278 372
891 iso_pu_bacteria 2738541272 2738693653 372
892 iso_pu_bacteria 2738541274 2738707253 372
893 iso_pu_bacteria 2738541356 2739147348 372
894 iso_pu_bacteria 2738543027 2739322934 372
895 iso_pu_bacteria 2738543028 2739328568 372
896 iso_pu_bacteria 2747842429 2747952356 372
897 iso_pu_bacteria 2757320536 2758224592 372
898 iso_pu_bacteria 2773857758 2774378720 372
899 iso_pu_bacteria 2773857759 2774383464 372
900 iso_pu_bacteria 2773857763 2774400469 372
901 iso_pu_bacteria 2808606306 2808628640 372
902 iso_pu_bacteria 2808606365 2808875416 372
903 iso_pu_bacteria 2808606368 2808884855 372
904 iso_pu_bacteria 2808606447 2809226661 372
905 iso_pu_bacteria 2811994872 2812322228 372
906 iso_pu_bacteria 2818991318 2819424625 372
907 iso_pu_bacteria 2821268502 2821269177 372
908 iso_pu_bacteria 2833709550 2833710070 372
909 iso_pu_bacteria 2842134933 2842140523 372
910 iso_pu_bacteria 2842888712 2842891200 372
911 iso_pu_bacteria 2844841374 2844843306 372
912 iso_pu_bacteria 2852632344 2852632870 372
913 iso_pu_bacteria 2852643534 2852644411 372
914 iso_pu_bacteria 2852646457 2852646560 372
915 iso_pu_bacteria 2852663356 2852665798 372
916 iso_pu_bacteria 2857720070 2857722722 372
917 iso_pu_bacteria 2857723135 2857724698 372
918 iso_pu_bacteria 2857729791 2857730601 372
919 iso_pu_bacteria 2857733635 2857734473 372
920 iso_pu_bacteria 2870628048 2870629554 372
921 iso_pu_bacteria 2884763398 2884766320 372
922 iso_pu_bacteria 2902792274 2902797594 372
923 iso_pu_bacteria 2902799365 2902799884 372
924 iso_pu_bacteria 2902810491 2902814809 372
925 iso_pu_bacteria 2902837492 2902843209 372
926 iso_pu_bacteria 2904509784 2904510218 372
927 iso_pu_bacteria 2906799679 2906801599 372
928 iso_pu_bacteria 2908678064 2908678567 372
929 iso_pu_bacteria 2919055335 2919058787 372
930 iso_pu_bacteria 2919069694 2919070918 372
931 iso_pu_bacteria 2919395869 2919398565 372
932 iso_pu_bacteria 2919523602 2919525365 372
933 iso_pu_bacteria 2928090899 2928091018 372
934 iso_pu_bacteria 2928121344 2928121405 372
935 iso_pu_bacteria 2928153084 2928153444 372
936 iso_pu_bacteria 2929212328 2929217564 372
937 iso_pu_bacteria 2932398195 2932400412 372
938 iso_pu_bacteria 2932431166 2932432301 372
939 iso_pu_bacteria 2939582691 2939584798 372
940 iso_pu_bacteria 2939657138 2939659378 372
941 iso_pu_bacteria 2939660829 2939662805 372
942 iso_pu_bacteria 2945968032 2945970918 372
943 iso_pu_bacteria 2946033335 2946034661 372
944 iso_pu_bacteria 2946041624 2946043242 372
945 iso_pu_bacteria 2946080515 2946081770 372
946 iso_pu_bacteria 2966921586 2966922640 372
947 iso_pu_bacteria 2974294766 2974298238 372
948 iso_pu_bacteria 2974324384 2974325532 372
949 iso_pu_bacteria 2977228692 2977230464 372
950 iso_pu_bacteria 2977236895 2977239265 372
951 iso_pu_bacteria 2977251589 2977252038 372
952 iso_pu_bacteria 2977264416 2977265706 372
953 iso_pu_bacteria 2984542743 2984542951 372
954 iso_pu_bacteria 2984580707 2984582226 372
955 iso_pu_bacteria 3001889506 3001892118 372
956 iso_pu_bacteria 8004182704 8004183613 372
957 iso_pu_bacteria 8004212874 8004213430 372
958 iso_pu_bacteria 8016254467 8016254894 372
959 iso_pu_bacteria 8045830549 8045832455 372
960 3300000549 LJQas_1002873 LJQas_10028732 373
961 3300002075 JGI24738J21930_10011645 JGI24738J21930_100116452 373
962 3300002077 JGI24744J21845_10006576 JGI24744J21845_100065762 373
963 3300005329 Ga0070683_100034639 Ga0070683_1000346392 373
964 3300005337 Ga0070682_100016045 Ga0070682_1000160453 373
965 3300005343 Ga0070687_100008987 Ga0070687_1000089872 373
966 3300005345 Ga0070692_10020367 Ga0070692_100203672 373
967 3300005354 Ga0070675_100071687 Ga0070675_1000716872 373
968 3300005366 Ga0070659_100028072 Ga0070659_1000280722 373
969 3300005367 Ga0070667_100023104 Ga0070667_1000231045 373
970 3300005438 Ga0070701_10003564 Ga0070701_100035644 373
971 3300005441 Ga0070700_100017266 Ga0070700_1000172663 373
972 3300005459 Ga0068867_100044172 Ga0068867_1000441722 373
973 3300005530 Ga0070679_100157345 Ga0070679_1001573452 373
974 3300005543 Ga0070672_100060413 Ga0070672_1000604132 373
975 3300005544 Ga0070686_100044352 Ga0070686_1000443523 373
976 3300005615 Ga0070702_100022733 Ga0070702_1000227332 373
977 3300005840 Ga0068870_10006332 Ga0068870_100063325 373
978 3300005843 Ga0068860_100170998 Ga0068860_1001709982 373
979 3300005937 Ga0081455_10121819 Ga0081455_101218193 373
980 3300005985 Ga0081539_10027400 Ga0081539_100274003 373
981 3300006881 Ga0068865_100044021 Ga0068865_1000440213 373
982 3300006881 Ga0068865_100278411 Ga0068865_1002784111 373
983 3300009094 Ga0111539_10094250 Ga0111539_100942502 373
984 3300009098 Ga0105245_10025093 Ga0105245_100250933 373
985 3300009148 Ga0105243_10012483 Ga0105243_100124832 373
986 3300009177 Ga0105248_10071820 Ga0105248_100718203 373
987 3300011119 Ga0105246_10130680 Ga0105246_101306802 373
988 3300013307 Ga0157372_10022392 Ga0157372_100223922 373
989 3300014745 Ga0157377_10024809 Ga0157377_100248093 373
990 3300025908 Ga0207643_10065259 Ga0207643_100652592 373
991 3300025915 Ga0207693_10000550 Ga0207693_1000055016 373
992 3300025918 Ga0207662_10014650 Ga0207662_100146502 373
993 3300025927 Ga0207687_10057739 Ga0207687_100577393 373
994 3300025935 Ga0207709_10030200 Ga0207709_100302002 373
995 3300025935 Ga0207709_10120608 Ga0207709_101206082 373
996 3300025936 Ga0207670_10045463 Ga0207670_100454632 373
997 3300025938 Ga0207704_10043537 Ga0207704_100435373 373
998 3300025940 Ga0207691_10019669 Ga0207691_100196695 373
999 3300025944 Ga0207661_10039576 Ga0207661_100395763 373
1000 3300025961 Ga0207712_10077306 Ga0207712_100773062 373
1001 3300026023 Ga0207677_10046959 Ga0207677_100469593 373
1002 3300026075 Ga0207708_10047044 Ga0207708_100470442 373
1003 3300026089 Ga0207648_10017928 Ga0207648_100179284 373
1004 3300026142 Ga0207698_10062658 Ga0207698_100626583 373
1005 3300028380 Ga0268265_10186334 Ga0268265_101863342 373
1006 3300028381 Ga0268264_10491113 Ga0268264_104911131 373
1007 3300038443 Ga0395901_0124894 Ga0395901_0124894_665_1828 373
1008 3300044683 Ga0466965_0016410 Ga0466965_0016410_199_1353 373
1009 3300044694 Ga0466963_0204422 Ga0466963_0204422_137_1294 373
1010 3300044765 Ga0466970_0010125 Ga0466970_0010125_2582_3736 373
1011 3300044901 Ga0466960_0009803 Ga0466960_0009803_2192_3346 373
1012 3300045976 Ga0466967_0143959 Ga0466967_0143959_214_1371 373
1013 3300046455 Ga0495603_0096202 Ga0495603_0096202_168_1370 373
1014 3300046683 Ga0495658_0064346 Ga0495658_0064346_343_1545 373
1015 3300048904 Ga0496101_0033514 Ga0496101_0033514_453_1643 373
1016 3300048905 Ga0496102_0042950 Ga0496102_0042950_764_1918 373
1017 3300048905 Ga0496102_0131604 Ga0496102_0131604_1086_2276 373
1018 3300048907 Ga0496104_0004891 Ga0496104_0004891_2261_3415 373
1019 3300048908 Ga0496105_0004455 Ga0496105_0004455_5061_6215 373
1020 3300048909 Ga0496106_0305993 Ga0496106_0305993_65_1219 373
1021 3300048912 Ga0496109_0013718 Ga0496109_0013718_3336_4490 373
1022 3300048912 Ga0496109_0071036 Ga0496109_0071036_1376_2530 373
1023 3300048913 Ga0496110_0049961 Ga0496110_0049961_1507_2661 373
1024 3300048913 Ga0496110_0185899 Ga0496110_0185899_380_1534 373
1025 3300048917 Ga0496114_0008988 Ga0496114_0008988_3406_4560 373
1026 3300048918 Ga0496115_0024138 Ga0496115_0024138_719_1873 373
1027 3300049527 Ga0501311_006846 Ga0501311_006846_51_1211 373
1028 3300049531 Ga0501315_006619 Ga0501315_006619_106_1263 373
1029 3300049570 Ga0501033_0060294 Ga0501033_0060294_1312_2484 373
1030 3300049571 Ga0501034_0034048 Ga0501034_0034048_3458_4615 373
1031 3300049572 Ga0501036_0002900 Ga0501036_0002900_2391_3563 373
1032 3300049575 Ga0501039_0047333 Ga0501039_0047333_567_1724 373
1033 3300049576 Ga0501040_0006598 Ga0501040_0006598_4742_5914 373
1034 3300049577 Ga0501041_0071012 Ga0501041_0071012_840_2012 373
1035 3300049578 Ga0501042_0092887 Ga0501042_0092887_837_2009 373
1036 3300049583 Ga0501067_0000725 Ga0501067_0000725_13703_14860 373
1037 3300049586 Ga0501070_0033327 Ga0501070_0033327_1371_2528 373
1038 3300049587 Ga0501071_0015881 Ga0501071_0015881_3050_4207 373
1039 3300049587 Ga0501071_0044267 Ga0501071_0044267_1715_2887 373
1040 3300049589 Ga0501073_0004926 Ga0501073_0004926_264_1421 373
1041 3300049590 Ga0501074_0025561 Ga0501074_0025561_351_1523 373
1042 3300049590 Ga0501074_0034463 Ga0501074_0034463_675_1832 373
1043 3300049591 Ga0501075_0045189 Ga0501075_0045189_1716_2888 373
1044 3300049592 Ga0501076_0013969 Ga0501076_0013969_3909_5081 373
1045 3300049741 Ga0501079_0074759 Ga0501079_0074759_848_2020 373
1046 3300049742 Ga0501080_0005898 Ga0501080_0005898_4192_5349 373
1047 3300049824 Ga0501045_0001314 Ga0501045_0001314_325_1497 373
1048 3300050511 nmdc:mga08y16_407028_c1 nmdc:mga08y16_407028_c1_210_1364 373
1049 3300053104 Ga0500556_0000626 Ga0500556_0000626_20138_21298 373
1050 3300053117 Ga0500593_000731 Ga0500593_000731_1892_3052 373
1051 3300054114 Ga0501084_0006148 Ga0501084_0006148_591_1763 373
1052 iso_pu_bacteria 2517572101 2517762602 373
1053 iso_pu_bacteria 2547132424 2548699060 373
1054 iso_pu_bacteria 2551306166 2552110737 373
1055 iso_pu_bacteria 2579778521 2579853624 373
1056 iso_pu_bacteria 2582580736 2583149102 373
1057 iso_pu_bacteria 2619618881 2619853695 373
1058 iso_pu_bacteria 2619619003 2620349911 373
1059 iso_pu_bacteria 2626541554 2626636076 373
1060 iso_pu_bacteria 2643221549 2643768551 373
1061 iso_pu_bacteria 2643221619 2644111922 373
1062 iso_pu_bacteria 2643221679 2644445424 373
1063 iso_pu_bacteria 2643221692 2644513962 373
1064 iso_pu_bacteria 2643221711 2644610849 373
1065 iso_pu_bacteria 2671180195 2671835671 373
1066 iso_pu_bacteria 2675902999 2676199411 373
1067 iso_pu_bacteria 2684623035 2686539208 373
1068 iso_pu_bacteria 2687453737 2689960348 373
1069 iso_pu_bacteria 2721755702 2723641230 373
1070 iso_pu_bacteria 2739367654 2739607519 373
1071 iso_pu_bacteria 2758568522 2760304582 373
1072 iso_pu_bacteria 2773857921 2774843989 373
1073 iso_pu_bacteria 2773857922 2774853827 373
1074 iso_pu_bacteria 2775506925 2776373997 373
1075 iso_pu_bacteria 2784132109 2784472887 373
1076 iso_pu_bacteria 2808606372 2808901109 373
1077 iso_pu_bacteria 2808606394 2809026401 373
1078 iso_pu_bacteria 2811994882 2812375735 373
1079 iso_pu_bacteria 2818991458 2819666956 373
1080 iso_pu_bacteria 2818991462 2819690324 373
1081 iso_pu_bacteria 2818991469 2819728426 373
1082 iso_pu_bacteria 2837268691 2837270575 373
1083 iso_pu_bacteria 2839986021 2839986502 373
1084 iso_pu_bacteria 2848551377 2848551739 373
1085 iso_pu_bacteria 2852677369 2852678639 373
1086 iso_pu_bacteria 2857710386 2857711204 373
1087 iso_pu_bacteria 2863067949 2863070407 373
1088 iso_pu_bacteria 2866552031 2866555467 373
1089 iso_pu_bacteria 2866612099 2866616957 373
1090 iso_pu_bacteria 2891326441 2891331401 373
1091 iso_pu_bacteria 2895880812 2895884540 373
1092 iso_pu_bacteria 2897561785 2897562487 373
1093 iso_pu_bacteria 2899370129 2899376590 373
1094 iso_pu_bacteria 2905926851 2905928636 373
1095 iso_pu_bacteria 2919391150 2919395364 373
1096 iso_pu_bacteria 2919443155 2919445625 373
1097 iso_pu_bacteria 2919713450 2919717016 373
1098 iso_pu_bacteria 2935409751 2935410642 373
1099 iso_pu_bacteria 2945956166 2945957365 373
1100 iso_pu_bacteria 2946003308 2946003385 373
1101 iso_pu_bacteria 2946024296 2946024821 373
1102 iso_pu_bacteria 2995726249 2995728415 373
1103 iso_pu_bacteria 8002784119 8002791552 373
1104 iso_pu_bacteria 8002811521 8002811627 373
1105 iso_pu_bacteria 8054913762 8054917141 373
1106 iso_pu_bacteria 8054920844 8054925340 373
1107 iso_pu_bacteria 8055034563 8055035359 373
1108 iso_pu_bacteria 8055037949 8055038950 373
1109 iso_pu_bacteria 8055157932 8055160668 373
1110 iso_pu_bacteria 8056207758 8056208492 373
1111 3300005338 Ga0068868_100259251 Ga0068868_1002592512 374
1112 3300005614 Ga0068856_100230588 Ga0068856_1002305882 374
1113 3300006048 Ga0075363_100009777 Ga0075363_1000097773 374
1114 3300009176 Ga0105242_10135002 Ga0105242_101350022 374
1115 3300026067 Ga0207678_10029378 Ga0207678_100293782 374
1116 3300031911 Ga0307412_10109312 Ga0307412_101093122 374
1117 3300037853 Ga0436364_1508399 Ga0436364_1508399_482_1708 374
1118 3300044684 Ga0466966_0138687 Ga0466966_0138687_161_1324 374
1119 3300046684 Ga0495669_0047978 Ga0495669_0047978_525_1688 374
1120 3300053087 Ga0500643_001466 Ga0500643_001466_8047_9210 374
1121 3300053096 Ga0500641_0000526 Ga0500641_0000526_9553_10716 374
1122 iso_pu_bacteria 2554235227 2555229498 374
1123 iso_pu_bacteria 2558860112 2558909522 374
1124 iso_pu_bacteria 2558860280 2559428860 374
1125 iso_pu_bacteria 2565956761 2566992174 374
1126 iso_pu_bacteria 2585427649 2586064425 374
1127 iso_pu_bacteria 2585428094 2587863728 374
1128 iso_pu_bacteria 2643221572 2643876373 374
1129 iso_pu_bacteria 2643221613 2644082281 374
1130 iso_pu_bacteria 2643221649 2644277717 374
1131 iso_pu_bacteria 2643221669 2644383428 374
1132 iso_pu_bacteria 2643221690 2644502984 374
1133 iso_pu_bacteria 2643221694 2644525319 374
1134 iso_pu_bacteria 2643221721 2644664619 374
1135 iso_pu_bacteria 2643221722 2644669404 374
1136 iso_pu_bacteria 2654587600 2655031519 374
1137 iso_pu_bacteria 2690315906 2691512796 374
1138 iso_pu_bacteria 2728369276 2729907946 374
1139 iso_pu_bacteria 2738541308 2738888363 374
1140 iso_pu_bacteria 2738543005 2739204214 374
1141 iso_pu_bacteria 2738543011 2739240181 374
1142 iso_pu_bacteria 2739367653 2739604004 374
1143 iso_pu_bacteria 2751185734 2753070050 374
1144 iso_pu_bacteria 2751185788 2753303609 374
1145 iso_pu_bacteria 2758568621 2760621607 374
1146 iso_pu_bacteria 2775506735 2775658485 374
1147 iso_pu_bacteria 2795385472 2795795224 374
1148 iso_pu_bacteria 2799112218 2799184891 374
1149 iso_pu_bacteria 2808606357 2808830074 374
1150 iso_pu_bacteria 2808606360 2808851250 374
1151 iso_pu_bacteria 2808606366 2808876225 374
1152 iso_pu_bacteria 2808606370 2808894329 374
1153 iso_pu_bacteria 2808606371 2808897727 374
1154 iso_pu_bacteria 2808606522 2809586347 374
1155 iso_pu_bacteria 2811994871 2812318150 374
1156 iso_pu_bacteria 2816332139 2816505484 374
1157 iso_pu_bacteria 2816332305 2817509736 374
1158 iso_pu_bacteria 2844849076 2844851758 374
1159 iso_pu_bacteria 2844852863 2844854384 374
1160 iso_pu_bacteria 2857479173 2857479980 374
1161 iso_pu_bacteria 2857632687 2857633458 374
1162 iso_pu_bacteria 2857727296 2857728526 374
1163 iso_pu_bacteria 2857737099 2857739122 374
1164 iso_pu_bacteria 2857740372 2857740823 374
1165 iso_pu_bacteria 2862993130 2862993548 374
1166 iso_pu_bacteria 2870721527 2870727454 374
1167 iso_pu_bacteria 2870782633 2870788726 374
1168 iso_pu_bacteria 2870801768 2870803304 374
1169 iso_pu_bacteria 2870804320 2870805347 374
1170 iso_pu_bacteria 2889300758 2889303335 374
1171 iso_pu_bacteria 2893684298 2893686283 374
1172 iso_pu_bacteria 2895660088 2895660548 374
1173 iso_pu_bacteria 2899359706 2899364506 374
1174 iso_pu_bacteria 2904430863 2904432473 374
1175 iso_pu_bacteria 2904497146 2904501566 374
1176 iso_pu_bacteria 2904501621 2904501743 374
1177 iso_pu_bacteria 2904535858 2904538004 374
1178 iso_pu_bacteria 2904776348 2904778211 374
1179 iso_pu_bacteria 2908674828 2908676203 374
1180 iso_pu_bacteria 2909074476 2909077083 374
1181 iso_pu_bacteria 2915358134 2915364120 374
1182 iso_pu_bacteria 2915768154 2915774800 374
1183 iso_pu_bacteria 2917736166 2917737727 374
1184 iso_pu_bacteria 2919034639 2919035583 374
1185 iso_pu_bacteria 2919039151 2919041778 374
1186 iso_pu_bacteria 2919042368 2919043276 374
1187 iso_pu_bacteria 2919051321 2919054919 374
1188 iso_pu_bacteria 2919059106 2919060242 374
1189 iso_pu_bacteria 2919538618 2919539208 374
1190 iso_pu_bacteria 2920879853 2920883347 374
1191 iso_pu_bacteria 2922554459 2922557187 374
1192 iso_pu_bacteria 2928104781 2928105561 374
1193 iso_pu_bacteria 2928142448 2928145111 374
1194 iso_pu_bacteria 2928500415 2928500921 374
1195 iso_pu_bacteria 2932426870 2932427797 374
1196 iso_pu_bacteria 2933418574 2933418630 374
1197 iso_pu_bacteria 2935890801 2935894132 374
1198 iso_pu_bacteria 2939598168 2939599380 374
1199 iso_pu_bacteria 2939647034 2939650244 374
1200 iso_pu_bacteria 2939674588 2939677662 374
1201 iso_pu_bacteria 2939743619 2939748528 374
1202 iso_pu_bacteria 2945916053 2945920248 374
1203 iso_pu_bacteria 2945920336 2945923894 374
1204 iso_pu_bacteria 2945941187 2945944447 374
1205 iso_pu_bacteria 2946037020 2946040362 374
1206 iso_pu_bacteria 2946059875 2946063965 374
1207 iso_pu_bacteria 2953998280 2954001630 374
1208 iso_pu_bacteria 2956939328 2956941536 374
1209 iso_pu_bacteria 2974302888 2974303796 374
1210 iso_pu_bacteria 2984551494 2984551898 374
1211 iso_pu_bacteria 8003314358 8003323191 374
1212 iso_pu_bacteria 8004021418 8004022465 374
1213 iso_pu_bacteria 8004025490 8004026910 374
1214 iso_pu_bacteria 8047710418 8047717666 374
1215 iso_pu_bacteria 8054107350 8054109686 374
1216 iso_pu_bacteria 8054472261 8054475852 374
1217 iso_pu_bacteria 8056037122 8056039320 374
1218 iso_pu_bacteria 8056579771 8056583315 374
1219 iso_pu_bacteria 8057345674 8057347470 374
1220 3300005329 Ga0070683_100032968 Ga0070683_1000329683 375
1221 3300005337 Ga0070682_100006780 Ga0070682_1000067802 375
1222 3300005339 Ga0070660_100018405 Ga0070660_1000184055 375
1223 3300005354 Ga0070675_100162207 Ga0070675_1001622071 375
1224 3300005535 Ga0070684_100008109 Ga0070684_1000081096 375
1225 3300005548 Ga0070665_100000450 Ga0070665_10000045051 375
1226 3300005614 Ga0068856_100046003 Ga0068856_1000460033 375
1227 3300005842 Ga0068858_100081802 Ga0068858_1000818022 375
1228 3300006038 Ga0075365_10058458 Ga0075365_100584583 375
1229 3300006048 Ga0075363_100067724 Ga0075363_1000677241 375
1230 3300006353 Ga0075370_10061384 Ga0075370_100613842 375
1231 3300009177 Ga0105248_10139647 Ga0105248_101396472 375
1232 3300013307 Ga0157372_10001405 Ga0157372_1000140521 375
1233 3300014325 Ga0163163_10104359 Ga0163163_101043592 375
1234 3300014968 Ga0157379_10051898 Ga0157379_100518983 375
1235 3300025919 Ga0207657_10010726 Ga0207657_100107262 375
1236 3300025929 Ga0207664_10217091 Ga0207664_102170912 375
1237 3300025944 Ga0207661_10011892 Ga0207661_100118924 375
1238 3300025944 Ga0207661_10029811 Ga0207661_100298112 375
1239 3300026035 Ga0207703_10076268 Ga0207703_100762683 375
1240 3300026116 Ga0207674_10009792 Ga0207674_100097925 375
1241 3300028379 Ga0268266_10004579 Ga0268266_100045794 375
1242 3300028381 Ga0268264_10000498 Ga0268264_100004981 375
1243 3300031852 Ga0307410_10059763 Ga0307410_100597633 375
1244 3300032004 Ga0307414_10173992 Ga0307414_101739921 375
1245 3300037466 Ga0395898_0080616 Ga0395898_0080616_245_1405 375
1246 3300038443 Ga0395901_0066733 Ga0395901_0066733_1853_3013 375
1247 3300038443 Ga0395901_0133959 Ga0395901_0133959_303_1469 375
1248 3300044765 Ga0466970_0054498 Ga0466970_0054498_532_1692 375
1249 3300045976 Ga0466967_0013641 Ga0466967_0013641_4133_5299 375
1250 3300048908 Ga0496105_0233856 Ga0496105_0233856_77_1243 375
1251 3300048911 Ga0496108_0064850 Ga0496108_0064850_1484_2662 375
1252 3300048911 Ga0496108_0362172 Ga0496108_0362172_59_1225 375
1253 3300048912 Ga0496109_0226132 Ga0496109_0226132_531_1697 375
1254 3300048914 Ga0496111_0160860 Ga0496111_0160860_236_1414 375
1255 3300001979 JGI24740J21852_10002318 JGI24740J21852_100023185 376
1256 3300001979 JGI24740J21852_10013880 JGI24740J21852_100138802 376
1257 3300001990 JGI24737J22298_10016258 JGI24737J22298_100162582 376
1258 3300002067 JGI24735J21928_10006707 JGI24735J21928_100067071 376
1259 3300002737 JGI25162J39368_1004740 JGI25162J39368_10047402 376
1260 3300002738 JGI25154J39366_1001298 JGI25154J39366_10012986 376
1261 3300002772 JGI25164J39214_1001137 JGI25164J39214_10011374 376
1262 3300003214 JGI25165J46597_1000061 JGI25165J46597_1000061114 376
1263 3300003578 Ga0006562J51391_1003827 Ga0006562J51391_10038278 376
1264 3300003752 Ga0055539_1000005 Ga0055539_1000005550 376
1265 3300003756 Ga0055533_1000001 Ga0055533_10000011619 376
1266 3300003759 Ga0055525_1000291 Ga0055525_100029126 376
1267 3300003841 Ga0055541_1000625 Ga0055541_10006255 376
1268 3300005327 Ga0070658_10000394 Ga0070658_100003949 376
1269 3300005327 Ga0070658_10000448 Ga0070658_1000044814 376
1270 3300005339 Ga0070660_100078401 Ga0070660_1000784012 376
1271 3300005339 Ga0070660_100097095 Ga0070660_1000970952 376
1272 3300005365 Ga0070688_100020289 Ga0070688_1000202892 376
1273 3300005435 Ga0070714_100065288 Ga0070714_1000652881 376
1274 3300005436 Ga0070713_100003424 Ga0070713_1000034246 376
1275 3300005437 Ga0070710_10016635 Ga0070710_100166353 376
1276 3300005563 Ga0068855_100026886 Ga0068855_1000268866 376
1277 3300005563 Ga0068855_100066766 Ga0068855_1000667662 376
1278 3300005563 Ga0068855_100163748 Ga0068855_1001637482 376
1279 3300005577 Ga0068857_100035843 Ga0068857_1000358432 376
1280 3300005614 Ga0068856_100025251 Ga0068856_1000252512 376
1281 3300005616 Ga0068852_100031767 Ga0068852_1000317672 376
1282 3300005618 Ga0068864_100075408 Ga0068864_1000754082 376
1283 3300006038 Ga0075365_10028961 Ga0075365_100289612 376
1284 3300006038 Ga0075365_10065175 Ga0075365_100651752 376
1285 3300006048 Ga0075363_100000201 Ga0075363_1000002011 376
1286 3300006048 Ga0075363_100003979 Ga0075363_1000039793 376
1287 3300006051 Ga0075364_10010199 Ga0075364_100101992 376
1288 3300006051 Ga0075364_10024783 Ga0075364_100247832 376
1289 3300006051 Ga0075364_10037917 Ga0075364_100379173 376
1290 3300006178 Ga0075367_10031724 Ga0075367_100317244 376
1291 3300006178 Ga0075367_10032134 Ga0075367_100321342 376
1292 3300009093 Ga0105240_10085563 Ga0105240_100855635 376
1293 3300013102 Ga0157371_10041403 Ga0157371_100414032 376
1294 3300013102 Ga0157371_10069843 Ga0157371_100698432 376
1295 3300013104 Ga0157370_10002163 Ga0157370_100021632 376
1296 3300013104 Ga0157370_10027650 Ga0157370_100276505 376
1297 3300013104 Ga0157370_10046918 Ga0157370_100469182 376
1298 3300013105 Ga0157369_10002312 Ga0157369_100023122 376
1299 3300013105 Ga0157369_10149419 Ga0157369_101494191 376
1300 3300013306 Ga0163162_10046065 Ga0163162_100460653 376
1301 3300013307 Ga0157372_10069659 Ga0157372_100696592 376
1302 3300013307 Ga0157372_10088253 Ga0157372_100882533 376
1303 3300013307 Ga0157372_10222180 Ga0157372_102221802 376
1304 3300014968 Ga0157379_10008257 Ga0157379_100082577 376
1305 3300020080 Ga0206350_10025198 Ga0206350_100251981 376
1306 3300020081 Ga0206354_11217485 Ga0206354_112174852 376
1307 3300021388 Ga0213875_10011668 Ga0213875_100116682 376
1308 3300025225 Ga0209566_100053 Ga0209566_100053207 376
1309 3300025226 Ga0209674_100001 Ga0209674_1000011621 376
1310 3300025230 Ga0209563_100001 Ga0209563_1000011621 376
1311 3300025231 Ga0207427_100042 Ga0207427_100042108 376
1312 3300025233 Ga0209437_100369 Ga0209437_1003698 376
1313 3300025246 Ga0209646_1000088 Ga0209646_1000088152 376
1314 3300025253 Ga0209677_100001 Ga0209677_1000011621 376
1315 3300025253 Ga0209677_100448 Ga0209677_1004484 376
1316 3300025261 Ga0209233_1000001 Ga0209233_10000011194 376
1317 3300025272 Ga0209455_1001874 Ga0209455_10018744 376
1318 3300025728 Ga0207655_1062958 Ga0207655_10629582 376
1319 3300025909 Ga0207705_10000001 Ga0207705_10000001587 376
1320 3300025909 Ga0207705_10063392 Ga0207705_100633922 376
1321 3300025913 Ga0207695_10004239 Ga0207695_1000423920 376
1322 3300025919 Ga0207657_10041968 Ga0207657_100419684 376
1323 3300025919 Ga0207657_10080923 Ga0207657_100809232 376
1324 3300025921 Ga0207652_10205567 Ga0207652_102055672 376
1325 3300025928 Ga0207700_10126325 Ga0207700_101263252 376
1326 3300025932 Ga0207690_10043003 Ga0207690_100430032 376
1327 3300025935 Ga0207709_10206581 Ga0207709_102065811 376
1328 3300025949 Ga0207667_10027633 Ga0207667_100276333 376
1329 3300025949 Ga0207667_10047897 Ga0207667_100478972 376
1330 3300025949 Ga0207667_10083612 Ga0207667_100836122 376
1331 3300025972 Ga0207668_10141430 Ga0207668_101414302 376
1332 3300025981 Ga0207640_10272808 Ga0207640_102728082 376
1333 3300025986 Ga0207658_10193554 Ga0207658_101935542 376
1334 3300026067 Ga0207678_10023067 Ga0207678_100230675 376
1335 3300026075 Ga0207708_10067474 Ga0207708_100674742 376
1336 3300026078 Ga0207702_10215120 Ga0207702_102151202 376
1337 3300031251 Ga0265327_10003399 Ga0265327_100033993 376
1338 3300031456 Ga0307513_10016777 Ga0307513_100167779 376
1339 3300031548 Ga0307408_100191933 Ga0307408_1001919332 376
1340 3300031548 Ga0307408_100281850 Ga0307408_1002818502 376
1341 3300031649 Ga0307514_10002631 Ga0307514_100026312 376
1342 3300031727 Ga0316576_10112338 Ga0316576_101123382 376
1343 3300031731 Ga0307405_10058979 Ga0307405_100589792 376
1344 3300031852 Ga0307410_10005711 Ga0307410_100057116 376
1345 3300031852 Ga0307410_10161920 Ga0307410_101619202 376
1346 3300031901 Ga0307406_10002180 Ga0307406_100021802 376
1347 3300031901 Ga0307406_10007260 Ga0307406_100072603 376
1348 3300031901 Ga0307406_10046164 Ga0307406_100461642 376
1349 3300031901 Ga0307406_10075032 Ga0307406_100750322 376
1350 3300031901 Ga0307406_10082055 Ga0307406_100820552 376
1351 3300031901 Ga0307406_10109972 Ga0307406_101099722 376
1352 3300031903 Ga0307407_10080214 Ga0307407_100802142 376
1353 3300031995 Ga0307409_100002130 Ga0307409_1000021307 376
1354 3300031995 Ga0307409_100035071 Ga0307409_1000350713 376
1355 3300032002 Ga0307416_100098400 Ga0307416_1000984002 376
1356 3300032002 Ga0307416_100121442 Ga0307416_1001214422 376
1357 3300032004 Ga0307414_10023359 Ga0307414_100233592 376
1358 3300036712 Ga0316584_0116975 Ga0316584_0116975_617_1780 376
1359 3300037312 Ga0395899_0015761 Ga0395899_0015761_1768_2931 376
1360 3300037418 Ga0395900_0015052 Ga0395900_0015052_5228_6397 376
1361 3300037418 Ga0395900_0101893 Ga0395900_0101893_619_1782 376
1362 3300037418 Ga0395900_0137294 Ga0395900_0137294_1092_2267 376
1363 3300037466 Ga0395898_0000381 Ga0395898_0000381_44657_45820 376
1364 3300037466 Ga0395898_0011069 Ga0395898_0011069_1638_2801 376
1365 3300037471 Ga0395905_0039073 Ga0395905_0039073_2530_3693 376
1366 3300037853 Ga0436364_0048623 Ga0436364_0048623_4908_6071 376
1367 3300038443 Ga0395901_0050485 Ga0395901_0050485_2783_3958 376
1368 3300038443 Ga0395901_0076931 Ga0395901_0076931_1274_2437 376
1369 3300038443 Ga0395901_0257884 Ga0395901_0257884_262_1434 376
1370 3300039437 Ga0436365_1474856 Ga0436365_1474856_18358_19521 376
1371 3300039437 Ga0436365_1712156 Ga0436365_1712156_975_2138 376
1372 3300044656 Ga0466969_0014150 Ga0466969_0014150_1744_2925 376
1373 3300044658 Ga0466972_0006242 Ga0466972_0006242_1498_2667 376
1374 3300044658 Ga0466972_0095998 Ga0466972_0095998_100_1263 376
1375 3300044683 Ga0466965_0005424 Ga0466965_0005424_2779_3948 376
1376 3300044683 Ga0466965_0028877 Ga0466965_0028877_583_1746 376
1377 3300044683 Ga0466965_0056670 Ga0466965_0056670_64_1227 376
1378 3300044683 Ga0466965_0066948 Ga0466965_0066948_258_1421 376
1379 3300044683 Ga0466965_0068084 Ga0466965_0068084_408_1574 376
1380 3300044684 Ga0466966_0002623 Ga0466966_0002623_8848_10029 376
1381 3300044684 Ga0466966_0030855 Ga0466966_0030855_1341_2504 376
1382 3300044693 Ga0466961_0031408 Ga0466961_0031408_175_1356 376
1383 3300044693 Ga0466961_0032806 Ga0466961_0032806_737_1900 376
1384 3300044693 Ga0466961_0038494 Ga0466961_0038494_942_2105 376
1385 3300044693 Ga0466961_0119605 Ga0466961_0119605_346_1509 376
1386 3300044694 Ga0466963_0004617 Ga0466963_0004617_1675_2856 376
1387 3300044694 Ga0466963_0076175 Ga0466963_0076175_244_1407 376
1388 3300044694 Ga0466963_0079949 Ga0466963_0079949_433_1596 376
1389 3300044719 Ga0466971_0044965 Ga0466971_0044965_591_1754 376
1390 3300044735 Ga0466968_0007642 Ga0466968_0007642_2595_3776 376
1391 3300044735 Ga0466968_0051487 Ga0466968_0051487_476_1639 376
1392 3300044765 Ga0466970_0000093 Ga0466970_0000093_14996_16162 376
1393 3300044765 Ga0466970_0004325 Ga0466970_0004325_5393_6562 376
1394 3300044765 Ga0466970_0006545 Ga0466970_0006545_435_1616 376
1395 3300044765 Ga0466970_0051568 Ga0466970_0051568_881_2044 376
1396 3300044842 Ga0466957_0027743 Ga0466957_0027743_651_1823 376
1397 3300044842 Ga0466957_0036044 Ga0466957_0036044_1503_2666 376
1398 3300044842 Ga0466957_0050466 Ga0466957_0050466_1122_2291 376
1399 3300044901 Ga0466960_0002117 Ga0466960_0002117_2673_3842 376
1400 3300044901 Ga0466960_0002276 Ga0466960_0002276_5236_6417 376
1401 3300045049 Ga0466959_0001664 Ga0466959_0001664_11171_12334 376
1402 3300045049 Ga0466959_0003675 Ga0466959_0003675_6538_7719 376
1403 3300045049 Ga0466959_0019389 Ga0466959_0019389_2264_3427 376
1404 3300045836 Ga0466958_0005259 Ga0466958_0005259_1976_3157 376
1405 3300045836 Ga0466958_0034064 Ga0466958_0034064_1711_2880 376
1406 3300045836 Ga0466958_0034141 Ga0466958_0034141_1508_2671 376
1407 3300045976 Ga0466967_0030435 Ga0466967_0030435_2969_4132 376
1408 3300045976 Ga0466967_0064440 Ga0466967_0064440_553_1722 376
1409 3300045976 Ga0466967_0124268 Ga0466967_0124268_956_2137 376
1410 3300046453 Ga0495627_001142 Ga0495627_001142_1154_2320 376
1411 3300046461 Ga0495641_0022516 Ga0495641_0022516_97_1293 376
1412 3300046471 Ga0495650_0084504 Ga0495650_0084504_41_1204 376
1413 3300047322 Ga0495680_0110904 Ga0495680_0110904_629_1825 376
1414 3300047472 Ga0495686_0058772 Ga0495686_0058772_1028_2191 376
1415 3300048903 Ga0496100_0001715 Ga0496100_0001715_5449_6618 376
1416 3300048903 Ga0496100_0007957 Ga0496100_0007957_2629_3792 376
1417 3300048903 Ga0496100_0021361 Ga0496100_0021361_685_1848 376
1418 3300048904 Ga0496101_0022334 Ga0496101_0022334_2140_3303 376
1419 3300048905 Ga0496102_0000236 Ga0496102_0000236_17430_18599 376
1420 3300048905 Ga0496102_0129236 Ga0496102_0129236_597_1760 376
1421 3300048906 Ga0496103_0000185 Ga0496103_0000185_56132_57301 376
1422 3300048906 Ga0496103_0071566 Ga0496103_0071566_120_1283 376
1423 3300048906 Ga0496103_0158986 Ga0496103_0158986_228_1391 376
1424 3300048907 Ga0496104_0089024 Ga0496104_0089024_1307_2476 376
1425 3300048907 Ga0496104_0170360 Ga0496104_0170360_434_1597 376
1426 3300048908 Ga0496105_0018442 Ga0496105_0018442_3583_4752 376
1427 3300048909 Ga0496106_0115837 Ga0496106_0115837_396_1559 376
1428 3300048910 Ga0496107_0022212 Ga0496107_0022212_2705_3868 376
1429 3300048910 Ga0496107_0027443 Ga0496107_0027443_2666_3835 376
1430 3300048911 Ga0496108_0075778 Ga0496108_0075778_124_1287 376
1431 3300048911 Ga0496108_0088604 Ga0496108_0088604_462_1625 376
1432 3300048914 Ga0496111_0047481 Ga0496111_0047481_1695_2858 376
1433 3300048914 Ga0496111_0186655 Ga0496111_0186655_90_1259 376
1434 3300048915 Ga0496112_0099862 Ga0496112_0099862_1051_2214 376
1435 3300048916 Ga0496113_0032886 Ga0496113_0032886_2274_3437 376
1436 3300048917 Ga0496114_0010762 Ga0496114_0010762_1105_2268 376
1437 3300048918 Ga0496115_0011413 Ga0496115_0011413_2936_4099 376
1438 3300048919 Ga0496116_0000340 Ga0496116_0000340_56167_57336 376
1439 3300048919 Ga0496116_0040697 Ga0496116_0040697_1327_2493 376
1440 3300048919 Ga0496116_0077370 Ga0496116_0077370_534_1697 376
1441 3300048920 Ga0496117_0000273 Ga0496117_0000273_77908_79074 376
1442 3300048920 Ga0496117_0001092 Ga0496117_0001092_34629_35792 376
1443 3300048920 Ga0496117_0003783 Ga0496117_0003783_5557_6726 376
1444 3300048920 Ga0496117_0011201 Ga0496117_0011201_3073_4236 376
1445 3300048920 Ga0496117_0104653 Ga0496117_0104653_366_1532 376
1446 3300048921 Ga0496118_0000096 Ga0496118_0000096_5571_6740 376
1447 3300048921 Ga0496118_0056178 Ga0496118_0056178_1059_2240 376
1448 3300048921 Ga0496118_0089622 Ga0496118_0089622_389_1555 376
1449 3300048922 Ga0496119_0000340 Ga0496119_0000340_13721_14890 376
1450 3300048922 Ga0496119_0007359 Ga0496119_0007359_6532_7698 376
1451 3300048922 Ga0496119_0013009 Ga0496119_0013009_4551_5714 376
1452 3300048922 Ga0496119_0014900 Ga0496119_0014900_3635_4798 376
1453 3300048922 Ga0496119_0050977 Ga0496119_0050977_511_1674 376
1454 3300048923 Ga0496120_0002620 Ga0496120_0002620_2264_3430 376
1455 3300048923 Ga0496120_0008527 Ga0496120_0008527_5043_6206 376
1456 3300048923 Ga0496120_0019430 Ga0496120_0019430_960_2123 376
1457 3300048924 Ga0496121_0000015 Ga0496121_0000015_173461_174624 376
1458 3300048924 Ga0496121_0022488 Ga0496121_0022488_377_1546 376
1459 3300048925 Ga0496122_0000020 Ga0496122_0000020_189544_190710 376
1460 3300048925 Ga0496122_0000795 Ga0496122_0000795_32441_33622 376
1461 3300048925 Ga0496122_0004303 Ga0496122_0004303_7671_8834 376
1462 3300048925 Ga0496122_0015517 Ga0496122_0015517_4483_5646 376
1463 3300048925 Ga0496122_0017673 Ga0496122_0017673_1832_2998 376
1464 3300048925 Ga0496122_0045039 Ga0496122_0045039_1289_2452 376
1465 3300048926 Ga0496123_0000003 Ga0496123_0000003_404668_405834 376
1466 3300048926 Ga0496123_0000951 Ga0496123_0000951_1046_2227 376
1467 3300048926 Ga0496123_0007387 Ga0496123_0007387_616_1779 376
1468 3300048926 Ga0496123_0015631 Ga0496123_0015631_60_1223 376
1469 3300048926 Ga0496123_0025167 Ga0496123_0025167_1582_2745 376
1470 3300048927 Ga0496124_0002749 Ga0496124_0002749_7385_8566 376
1471 3300048927 Ga0496124_0008894 Ga0496124_0008894_5419_6588 376
1472 3300048927 Ga0496124_0009299 Ga0496124_0009299_975_2138 376
1473 3300048927 Ga0496124_0090835 Ga0496124_0090835_340_1506 376
1474 3300048928 Ga0496125_0002425 Ga0496125_0002425_3760_4926 376
1475 3300048928 Ga0496125_0016465 Ga0496125_0016465_538_1704 376
1476 3300048928 Ga0496125_0034370 Ga0496125_0034370_1638_2807 376
1477 3300048928 Ga0496125_0061796 Ga0496125_0061796_1286_2449 376
1478 3300048929 Ga0496126_0000547 Ga0496126_0000547_17425_18594 376
1479 3300048929 Ga0496126_0005415 Ga0496126_0005415_5911_7077 376
1480 3300048929 Ga0496126_0005422 Ga0496126_0005422_11178_12341 376
1481 3300048929 Ga0496126_0006761 Ga0496126_0006761_930_2093 376
1482 3300048929 Ga0496126_0033726 Ga0496126_0033726_250_1413 376
1483 3300048929 Ga0496126_0058035 Ga0496126_0058035_951_2114 376
1484 3300048929 Ga0496126_0090950 Ga0496126_0090950_575_1741 376
1485 3300048929 Ga0496126_0098562 Ga0496126_0098562_1074_2237 376
1486 3300048929 Ga0496126_0121614 Ga0496126_0121614_375_1541 376
1487 3300049161 Ga0501305_008308 Ga0501305_008308_63_1226 376
1488 3300049537 Ga0501321_004061 Ga0501321_004061_165_1331 376
1489 3300049568 Ga0501031_0007030 Ga0501031_0007030_1677_2846 376
1490 3300049568 Ga0501031_0010393 Ga0501031_0010393_329_1504 376
1491 3300049569 Ga0501032_0001277 Ga0501032_0001277_18035_19204 376
1492 3300049569 Ga0501032_0008178 Ga0501032_0008178_3815_4978 376
1493 3300049569 Ga0501032_0102712 Ga0501032_0102712_444_1619 376
1494 3300049570 Ga0501033_0007412 Ga0501033_0007412_6400_7569 376
1495 3300049571 Ga0501034_0000672 Ga0501034_0000672_10281_11447 376
1496 3300049571 Ga0501034_0025497 Ga0501034_0025497_1560_2726 376
1497 3300049571 Ga0501034_0076870 Ga0501034_0076870_2076_3239 376
1498 3300049573 Ga0501037_0004426 Ga0501037_0004426_6595_7758 376
1499 3300049573 Ga0501037_0010166 Ga0501037_0010166_2090_3253 376
1500 3300049573 Ga0501037_0012462 Ga0501037_0012462_3457_4626 376
1501 3300049573 Ga0501037_0056202 Ga0501037_0056202_418_1593 376
1502 3300049573 Ga0501037_0082702 Ga0501037_0082702_1104_2267 376
1503 3300049574 Ga0501038_0010528 Ga0501038_0010528_6443_7612 376
1504 3300049574 Ga0501038_0024701 Ga0501038_0024701_58_1224 376
1505 3300049574 Ga0501038_0190298 Ga0501038_0190298_11_1177 376
1506 3300049575 Ga0501039_0000850 Ga0501039_0000850_18492_19667 376
1507 3300049575 Ga0501039_0016611 Ga0501039_0016611_1013_2182 376
1508 3300049577 Ga0501041_0030224 Ga0501041_0030224_1117_2292 376
1509 3300049579 Ga0501043_0001848 Ga0501043_0001848_9772_10941 376
1510 3300049579 Ga0501043_0156350 Ga0501043_0156350_305_1480 376
1511 3300049579 Ga0501043_0192190 Ga0501043_0192190_39_1202 376
1512 3300049580 Ga0501046_0003132 Ga0501046_0003132_9644_10813 376
1513 3300049580 Ga0501046_0016573 Ga0501046_0016573_3645_4820 376
1514 3300049581 Ga0501047_0000033 Ga0501047_0000033_7684_8856 376
1515 3300049581 Ga0501047_0000405 Ga0501047_0000405_15401_16564 376
1516 3300049581 Ga0501047_0001186 Ga0501047_0001186_9137_10300 376
1517 3300049581 Ga0501047_0004112 Ga0501047_0004112_2067_3230 376
1518 3300049581 Ga0501047_0058872 Ga0501047_0058872_1016_2185 376
1519 3300049582 Ga0501048_0006150 Ga0501048_0006150_7303_8466 376
1520 3300049582 Ga0501048_0016662 Ga0501048_0016662_125_1294 376
1521 3300049586 Ga0501070_0000165 Ga0501070_0000165_10919_12082 376
1522 3300049586 Ga0501070_0000181 Ga0501070_0000181_1819_2982 376
1523 3300049586 Ga0501070_0004105 Ga0501070_0004105_8952_10115 376
1524 3300049586 Ga0501070_0049412 Ga0501070_0049412_1793_2965 376
1525 3300049591 Ga0501075_0065901 Ga0501075_0065901_747_1922 376
1526 3300049593 Ga0501077_0110649 Ga0501077_0110649_409_1584 376
1527 3300049743 Ga0501081_0023093 Ga0501081_0023093_2584_3759 376
1528 3300049744 Ga0501083_0124905 Ga0501083_0124905_432_1595 376
1529 3300049822 Ga0501035_0000283 Ga0501035_0000283_43527_44690 376
1530 3300049822 Ga0501035_0005074 Ga0501035_0005074_8285_9448 376
1531 3300049822 Ga0501035_0054167 Ga0501035_0054167_1568_2737 376
1532 3300049822 Ga0501035_0063799 Ga0501035_0063799_1148_2311 376
1533 3300049823 Ga0501044_0004205 Ga0501044_0004205_5430_6593 376
1534 3300049823 Ga0501044_0011532 Ga0501044_0011532_2051_3214 376
1535 3300049823 Ga0501044_0017369 Ga0501044_0017369_848_2017 376
1536 3300049824 Ga0501045_0001190 Ga0501045_0001190_13900_15075 376
1537 3300050490 nmdc:mga03n38_70302_c1 nmdc:mga03n38_70302_c1_286_1449 376
1538 3300050491 nmdc:mga00v17_11230_c1 nmdc:mga00v17_11230_c1_606_1772 376
1539 3300050491 nmdc:mga00v17_200666_c1 nmdc:mga00v17_200666_c1_110_1273 376
1540 3300050491 nmdc:mga00v17_23683_c1 nmdc:mga00v17_23683_c1_1357_2520 376
1541 3300050491 nmdc:mga00v17_7209_c1 nmdc:mga00v17_7209_c1_755_1918 376
1542 3300050492 nmdc:mga0yw44_13350_c1 nmdc:mga0yw44_13350_c1_1321_2484 376
1543 3300050492 nmdc:mga0yw44_58784_c1 nmdc:mga0yw44_58784_c1_532_1695 376
1544 3300050511 nmdc:mga08y16_124196_c1 nmdc:mga08y16_124196_c1_907_2076 376
1545 3300053085 Ga0495619_0022031 Ga0495619_0022031_75_1271 376
1546 3300053087 Ga0500643_000086 Ga0500643_000086_60532_61710 376
1547 3300053104 Ga0500556_0000115 Ga0500556_0000115_22096_23259 376
1548 3300053104 Ga0500556_0000496 Ga0500556_0000496_11879_13042 376
1549 3300053108 Ga0500562_010403 Ga0500562_010403_293_1456 376
1550 3300053136 Ga0500559_0001057 Ga0500559_0001057_12018_13181 376
1551 3300053139 Ga0500568_0000038 Ga0500568_0000038_86553_87716 376
1552 3300053140 Ga0500573_0015888 Ga0500573_0015888_944_2107 376
1553 3300053140 Ga0500573_0018791 Ga0500573_0018791_2297_3460 376
1554 3300053140 Ga0500573_0029841 Ga0500573_0029841_1656_2819 376
1555 3300053140 Ga0500573_0039403 Ga0500573_0039403_986_2149 376
1556 3300053155 Ga0500620_000082 Ga0500620_000082_16101_17264 376
1557 3300059477 Ga0587084_001354 Ga0587084_001354_150_1316 376
1558 3300059493 Ga0587077_002512 Ga0587077_002512_64_1230 376
1559 3300059623 Ga0587101_001172 Ga0587101_001172_932_2098 376
1560 3300060353 Ga0501082_0208433 Ga0501082_0208433_382_1563 376
1561 3300061719 Ga0466962_0058962 Ga0466962_0058962_439_1602 376
1562 3300061719 Ga0466962_0074207 Ga0466962_0074207_299_1468 376
1563 3300061734 Ga0530510_0017997 Ga0530510_0017997_771_1946 376
1564 iso_pu_bacteria 2835188231 2835191786 376
1565 iso_pu_bacteria 2966924647 2966926610 376
1566 iso_pu_bacteria 2984576629 2984579777 376
1567 3300002067 JGI24735J21928_10005710 JGI24735J21928_100057102 377
1568 3300003578 Ga0006562J51391_1026496 Ga0006562J51391_10264962 377
1569 3300005434 Ga0070709_10024755 Ga0070709_100247552 377
1570 3300005441 Ga0070700_100000049 Ga0070700_10000004921 377
1571 3300005467 Ga0070706_100064391 Ga0070706_1000643913 377
1572 3300005471 Ga0070698_100117481 Ga0070698_1001174812 377
1573 3300005563 Ga0068855_100090254 Ga0068855_1000902544 377
1574 3300005614 Ga0068856_100092229 Ga0068856_1000922293 377
1575 3300005616 Ga0068852_100032864 Ga0068852_1000328644 377
1576 3300005842 Ga0068858_100000179 Ga0068858_10000017932 377
1577 3300005844 Ga0068862_100000312 Ga0068862_10000031211 377
1578 3300005937 Ga0081455_10010276 Ga0081455_1001027610 377
1579 3300006048 Ga0075363_100065368 Ga0075363_1000653682 377
1580 3300006186 Ga0075369_10004308 Ga0075369_100043082 377
1581 3300006846 Ga0075430_100000294 Ga0075430_10000029413 377
1582 3300006847 Ga0075431_100062538 Ga0075431_1000625385 377
1583 3300006931 Ga0097620_100000049 Ga0097620_10000004961 377
1584 3300009036 Ga0105244_10033778 Ga0105244_100337783 377
1585 3300009101 Ga0105247_10004231 Ga0105247_100042313 377
1586 3300009148 Ga0105243_10069791 Ga0105243_100697912 377
1587 3300009177 Ga0105248_10058631 Ga0105248_100586313 377
1588 3300009545 Ga0105237_10140579 Ga0105237_101405793 377
1589 3300009553 Ga0105249_10128286 Ga0105249_101282862 377
1590 3300013105 Ga0157369_10014343 Ga0157369_100143433 377
1591 3300014325 Ga0163163_10056964 Ga0163163_100569642 377
1592 3300014968 Ga0157379_10016792 Ga0157379_100167924 377
1593 3300014968 Ga0157379_10219592 Ga0157379_102195922 377
1594 3300017792 Ga0163161_10116809 Ga0163161_101168092 377
1595 3300024225 Ga0224572_1006386 Ga0224572_10063862 377
1596 3300025900 Ga0207710_10000017 Ga0207710_10000017176 377
1597 3300025900 Ga0207710_10000019 Ga0207710_10000019152 377
1598 3300025914 Ga0207671_10126529 Ga0207671_101265293 377
1599 3300025915 Ga0207693_10127422 Ga0207693_101274222 377
1600 3300025921 Ga0207652_10208365 Ga0207652_102083651 377
1601 3300025922 Ga0207646_10006235 Ga0207646_100062353 377
1602 3300025925 Ga0207650_10278000 Ga0207650_102780001 377
1603 3300025927 Ga0207687_10051744 Ga0207687_100517442 377
1604 3300025928 Ga0207700_10028709 Ga0207700_100287093 377
1605 3300025929 Ga0207664_10109584 Ga0207664_101095842 377
1606 3300025935 Ga0207709_10086590 Ga0207709_100865901 377
1607 3300025937 Ga0207669_10091373 Ga0207669_100913732 377
1608 3300025941 Ga0207711_10032150 Ga0207711_100321503 377
1609 3300025949 Ga0207667_10154487 Ga0207667_101544872 377
1610 3300025961 Ga0207712_10012828 Ga0207712_100128282 377
1611 3300025961 Ga0207712_10044673 Ga0207712_100446732 377
1612 3300025986 Ga0207658_10070698 Ga0207658_100706982 377
1613 3300026035 Ga0207703_10000013 Ga0207703_10000013177 377
1614 3300026075 Ga0207708_10000029 Ga0207708_1000002986 377
1615 3300026078 Ga0207702_10094243 Ga0207702_100942432 377
1616 3300026078 Ga0207702_10160339 Ga0207702_101603393 377
1617 3300026088 Ga0207641_10003875 Ga0207641_100038758 377
1618 3300026118 Ga0207675_100127813 Ga0207675_1001278132 377
1619 3300026118 Ga0207675_100174383 Ga0207675_1001743831 377
1620 3300026142 Ga0207698_10275758 Ga0207698_102757581 377
1621 3300028380 Ga0268265_10000041 Ga0268265_10000041124 377
1622 3300028556 Ga0265337_1000861 Ga0265337_10008616 377
1623 3300028558 Ga0265326_10001260 Ga0265326_100012608 377
1624 3300028563 Ga0265319_1000828 Ga0265319_10008282 377
1625 3300028573 Ga0265334_10000237 Ga0265334_1000023713 377
1626 3300028577 Ga0265318_10008654 Ga0265318_100086545 377
1627 3300028653 Ga0265323_10005269 Ga0265323_100052695 377
1628 3300028654 Ga0265322_10010118 Ga0265322_100101182 377
1629 3300028666 Ga0265336_10002720 Ga0265336_100027202 377
1630 3300028800 Ga0265338_10001480 Ga0265338_100014803 377
1631 3300028800 Ga0265338_10015126 Ga0265338_100151268 377
1632 3300029957 Ga0265324_10008950 Ga0265324_100089503 377
1633 3300030522 Ga0307512_10004160 Ga0307512_1000416017 377
1634 3300031238 Ga0265332_10002532 Ga0265332_100025322 377
1635 3300031240 Ga0265320_10000532 Ga0265320_1000053220 377
1636 3300031247 Ga0265340_10004583 Ga0265340_100045832 377
1637 3300031249 Ga0265339_10030866 Ga0265339_100308661 377
1638 3300031250 Ga0265331_10042159 Ga0265331_100421592 377
1639 3300031344 Ga0265316_10006104 Ga0265316_100061044 377
1640 3300031344 Ga0265316_10050856 Ga0265316_100508563 377
1641 3300031548 Ga0307408_100246721 Ga0307408_1002467211 377
1642 3300031595 Ga0265313_10006611 Ga0265313_100066113 377
1643 3300031665 Ga0316575_10001074 Ga0316575_100010741 377
1644 3300031691 Ga0316579_10006667 Ga0316579_100066673 377
1645 3300031691 Ga0316579_10006821 Ga0316579_100068214 377
1646 3300031711 Ga0265314_10016241 Ga0265314_100162413 377
1647 3300031712 Ga0265342_10022810 Ga0265342_100228103 377
1648 3300031727 Ga0316576_10017375 Ga0316576_100173753 377
1649 3300031727 Ga0316576_10040477 Ga0316576_100404773 377
1650 3300031728 Ga0316578_10002012 Ga0316578_100020123 377
1651 3300031728 Ga0316578_10017612 Ga0316578_100176122 377
1652 3300031733 Ga0316577_10023806 Ga0316577_100238063 377
1653 3300031824 Ga0307413_10117076 Ga0307413_101170762 377
1654 3300032126 Ga0307415_100113327 Ga0307415_1001133272 377
1655 3300032133 Ga0316583_10020853 Ga0316583_100208531 377
1656 3300032137 Ga0316585_10012405 Ga0316585_100124052 377
1657 3300032137 Ga0316585_10034867 Ga0316585_100348672 377
1658 3300032139 Ga0316580_10004313 Ga0316580_100043133 377
1659 3300035083 Ga0373926_0003287 Ga0373926_0003287_3790_4983 377
1660 3300035086 Ga0373934_0005307 Ga0373934_0005307_2706_3899 377
1661 3300035089 Ga0373944_0002808 Ga0373944_0002808_2879_4072 377
1662 3300035111 Ga0373923_0009922 Ga0373923_0009922_2179_3372 377
1663 3300035113 Ga0373936_0000251 Ga0373936_0000251_7816_9009 377
1664 3300035116 Ga0373945_0000140 Ga0373945_0000140_12788_13981 377
1665 3300035117 Ga0373953_0033415 Ga0373953_0033415_400_1593 377
1666 3300035120 Ga0373957_0031735 Ga0373957_0031735_189_1382 377
1667 3300035170 Ga0373943_0001314 Ga0373943_0001314_6249_7442 377
1668 3300035171 Ga0373946_0000089 Ga0373946_0000089_21881_23074 377
1669 3300035172 Ga0373955_0071397 Ga0373955_0071397_22_1215 377
1670 3300035172 Ga0373955_0120938 Ga0373955_0120938_106_1299 377
1671 3300035398 Ga0316574_0012915 Ga0316574_0012915_1880_3058 377
1672 3300035398 Ga0316574_0033681 Ga0316574_0033681_1505_2683 377
1673 3300035398 Ga0316574_0136805 Ga0316574_0136805_265_1443 377
1674 3300035692 Ga0373935_0000586 Ga0373935_0000586_8377_9570 377
1675 3300035695 Ga0373927_0001993 Ga0373927_0001993_9585_10778 377
1676 3300035724 Ga0373933_0020579 Ga0373933_0020579_1904_3097 377
1677 3300035725 Ga0373947_0007697 Ga0373947_0007697_3795_4988 377
1678 3300036401 Ga0373937_0013695 Ga0373937_0013695_5481_6674 377
1679 3300036647 Ga0316582_0078006 Ga0316582_0078006_939_2117 377
1680 3300036712 Ga0316584_0000383 Ga0316584_0000383_2313_3491 377
1681 3300037068 Ga0373925_0000004 Ga0373925_0000004_353756_354946 377
1682 3300037068 Ga0373925_0012813 Ga0373925_0012813_2056_3249 377
1683 3300037312 Ga0395899_0039667 Ga0395899_0039667_2107_3273 377
1684 3300037418 Ga0395900_0112660 Ga0395900_0112660_18_1184 377
1685 3300037466 Ga0395898_0005576 Ga0395898_0005576_1198_2364 377
1686 3300037853 Ga0436364_1071680 Ga0436364_1071680_277_1464 377
1687 3300042007 Ga0439449_0002451 Ga0439449_0002451_3292_4470 377
1688 3300044658 Ga0466972_0003353 Ga0466972_0003353_3055_4221 377
1689 3300044693 Ga0466961_0087585 Ga0466961_0087585_31_1200 377
1690 3300044693 Ga0466961_0093599 Ga0466961_0093599_373_1539 377
1691 3300044694 Ga0466963_0002223 Ga0466963_0002223_6740_7909 377
1692 3300044694 Ga0466963_0053339 Ga0466963_0053339_497_1666 377
1693 3300044706 Ga0466964_0051855 Ga0466964_0051855_251_1420 377
1694 3300044719 Ga0466971_0004615 Ga0466971_0004615_2710_3879 377
1695 3300044765 Ga0466970_0005681 Ga0466970_0005681_2987_4153 377
1696 3300044842 Ga0466957_0075158 Ga0466957_0075158_704_1873 377
1697 3300045049 Ga0466959_0016450 Ga0466959_0016450_3603_4769 377
1698 3300045049 Ga0466959_0032967 Ga0466959_0032967_847_2016 377
1699 3300045836 Ga0466958_0001497 Ga0466958_0001497_7685_8851 377
1700 3300045836 Ga0466958_0018627 Ga0466958_0018627_2535_3704 377
1701 3300045976 Ga0466967_0005915 Ga0466967_0005915_575_1744 377
1702 3300045976 Ga0466967_0073397 Ga0466967_0073397_1704_2873 377
1703 3300045976 Ga0466967_0089613 Ga0466967_0089613_1088_2257 377
1704 3300045976 Ga0466967_0119981 Ga0466967_0119981_524_1693 377
1705 3300046463 Ga0495653_0060532 Ga0495653_0060532_1020_2219 377
1706 3300046473 Ga0495582_0019590 Ga0495582_0019590_612_1805 377
1707 3300046476 Ga0495662_0018450 Ga0495662_0018450_236_1429 377
1708 3300046477 Ga0495664_0001916 Ga0495664_0001916_6030_7223 377
1709 3300046511 Ga0495608_0044556 Ga0495608_0044556_550_1749 377
1710 3300046514 Ga0495618_0073876 Ga0495618_0073876_701_1894 377
1711 3300046517 Ga0495630_0009755 Ga0495630_0009755_5682_6875 377
1712 3300046523 Ga0495644_0013017 Ga0495644_0013017_1563_2810 377
1713 3300046524 Ga0495648_0014540 Ga0495648_0014540_3587_4753 377
1714 3300046529 Ga0495652_0013787 Ga0495652_0013787_4750_5943 377
1715 3300046559 Ga0495667_0000837 Ga0495667_0000837_15207_16400 377
1716 3300046615 Ga0495656_0071703 Ga0495656_0071703_56_1222 377
1717 3300046642 Ga0495634_0051142 Ga0495634_0051142_616_1809 377
1718 3300046663 Ga0495635_0000906 Ga0495635_0000906_3421_4614 377
1719 3300046663 Ga0495635_0006925 Ga0495635_0006925_5749_6942 377
1720 3300046675 Ga0495657_0015029 Ga0495657_0015029_1010_2203 377
1721 3300046689 Ga0495613_0230058 Ga0495613_0230058_63_1256 377
1722 3300046690 Ga0495624_0000364 Ga0495624_0000364_33441_34634 377
1723 3300046691 Ga0495670_0044085 Ga0495670_0044085_96_1262 377
1724 3300047315 Ga0495581_0078280 Ga0495581_0078280_498_1691 377
1725 3300047317 Ga0495604_0088785 Ga0495604_0088785_700_1893 377
1726 3300047319 Ga0495674_0009189 Ga0495674_0009189_6049_7242 377
1727 3300047321 Ga0495676_0019639 Ga0495676_0019639_3124_4317 377
1728 3300047322 Ga0495680_0004541 Ga0495680_0004541_10186_11379 377
1729 3300047322 Ga0495680_0012084 Ga0495680_0012084_686_1879 377
1730 3300047323 Ga0495683_0001180 Ga0495683_0001180_7959_9125 377
1731 3300047471 Ga0495684_0008105 Ga0495684_0008105_3258_4451 377
1732 3300047673 Ga0495593_0109889 Ga0495593_0109889_177_1370 377
1733 3300048088 Ga0495602_0054850 Ga0495602_0054850_1517_2710 377
1734 3300048904 Ga0496101_0002271 Ga0496101_0002271_7731_8918 377
1735 3300048905 Ga0496102_0028244 Ga0496102_0028244_2064_3251 377
1736 3300048905 Ga0496102_0077190 Ga0496102_0077190_955_2121 377
1737 3300048905 Ga0496102_0079158 Ga0496102_0079158_1013_2212 377
1738 3300048905 Ga0496102_0300459 Ga0496102_0300459_337_1503 377
1739 3300048906 Ga0496103_0071855 Ga0496103_0071855_231_1418 377
1740 3300048907 Ga0496104_0092303 Ga0496104_0092303_1362_2540 377
1741 3300048908 Ga0496105_0009001 Ga0496105_0009001_610_1797 377
1742 3300048908 Ga0496105_0014439 Ga0496105_0014439_4041_5228 377
1743 3300048908 Ga0496105_0105827 Ga0496105_0105827_921_2099 377
1744 3300048909 Ga0496106_0054231 Ga0496106_0054231_1155_2321 377
1745 3300048910 Ga0496107_0114477 Ga0496107_0114477_468_1655 377
1746 3300048911 Ga0496108_0313142 Ga0496108_0313142_17_1186 377
1747 3300048912 Ga0496109_0221244 Ga0496109_0221244_122_1300 377
1748 3300048913 Ga0496110_0112870 Ga0496110_0112870_478_1656 377
1749 3300048914 Ga0496111_0063129 Ga0496111_0063129_1139_2317 377
1750 3300048916 Ga0496113_0117004 Ga0496113_0117004_779_1957 377
1751 3300048916 Ga0496113_0160149 Ga0496113_0160149_515_1681 377
1752 3300048916 Ga0496113_0176928 Ga0496113_0176928_129_1322 377
1753 3300048917 Ga0496114_0003794 Ga0496114_0003794_1232_2431 377
1754 3300048917 Ga0496114_0266356 Ga0496114_0266356_208_1386 377
1755 3300048919 Ga0496116_0000192 Ga0496116_0000192_115673_116839 377
1756 3300048920 Ga0496117_0026526 Ga0496117_0026526_2610_3776 377
1757 3300048921 Ga0496118_0006081 Ga0496118_0006081_6833_7999 377
1758 3300048922 Ga0496119_0000617 Ga0496119_0000617_18579_19745 377
1759 3300048922 Ga0496119_0009886 Ga0496119_0009886_1006_2172 377
1760 3300048922 Ga0496119_0032848 Ga0496119_0032848_842_2029 377
1761 3300048922 Ga0496119_0037248 Ga0496119_0037248_1017_2183 377
1762 3300048923 Ga0496120_0000372 Ga0496120_0000372_1077_2243 377
1763 3300048924 Ga0496121_0013057 Ga0496121_0013057_2326_3492 377
1764 3300048924 Ga0496121_0066703 Ga0496121_0066703_978_2144 377
1765 3300048928 Ga0496125_0000859 Ga0496125_0000859_9513_10697 377
1766 3300048929 Ga0496126_0000246 Ga0496126_0000246_45097_46266 377
1767 3300048929 Ga0496126_0068695 Ga0496126_0068695_1487_2683 377
1768 3300049529 Ga0501313_005060 Ga0501313_005060_40_1206 377
1769 3300049540 Ga0501324_002466 Ga0501324_002466_146_1312 377
1770 3300049551 Ga0501335_000889 Ga0501335_000889_727_1893 377
1771 3300049568 Ga0501031_0000870 Ga0501031_0000870_7547_8731 377
1772 3300049570 Ga0501033_0044237 Ga0501033_0044237_982_2166 377
1773 3300049573 Ga0501037_0176832 Ga0501037_0176832_239_1423 377
1774 3300049574 Ga0501038_0003260 Ga0501038_0003260_7358_8542 377
1775 3300049574 Ga0501038_0051802 Ga0501038_0051802_215_1381 377
1776 3300049576 Ga0501040_0000580 Ga0501040_0000580_6031_7215 377
1777 3300049577 Ga0501041_0000246 Ga0501041_0000246_17514_18698 377
1778 3300049578 Ga0501042_0000686 Ga0501042_0000686_6791_7975 377
1779 3300049580 Ga0501046_0006458 Ga0501046_0006458_698_1882 377
1780 3300049582 Ga0501048_0001561 Ga0501048_0001561_10802_11986 377
1781 3300049585 Ga0501069_0099180 Ga0501069_0099180_150_1316 377
1782 3300049586 Ga0501070_0028759 Ga0501070_0028759_521_1690 377
1783 3300049587 Ga0501071_0000275 Ga0501071_0000275_12022_13206 377
1784 3300049588 Ga0501072_0007441 Ga0501072_0007441_6661_7845 377
1785 3300049591 Ga0501075_0009734 Ga0501075_0009734_1778_2962 377
1786 3300049592 Ga0501076_0000260 Ga0501076_0000260_14370_15554 377
1787 3300049593 Ga0501077_0009209 Ga0501077_0009209_1102_2286 377
1788 3300049741 Ga0501079_0001021 Ga0501079_0001021_10561_11745 377
1789 3300049742 Ga0501080_0057567 Ga0501080_0057567_1708_2892 377
1790 3300049743 Ga0501081_0015758 Ga0501081_0015758_3071_4255 377
1791 3300049743 Ga0501081_0029959 Ga0501081_0029959_1215_2384 377
1792 3300049822 Ga0501035_0042452 Ga0501035_0042452_571_1755 377
1793 3300049824 Ga0501045_0000716 Ga0501045_0000716_7765_8949 377
1794 3300050491 nmdc:mga00v17_51330_c1 nmdc:mga00v17_51330_c1_22_1188 377
1795 3300050494 nmdc:mga06z11_145195_c1 nmdc:mga06z11_145195_c1_168_1334 377
1796 3300050509 nmdc:mga0qj67_314_c1 nmdc:mga0qj67_314_c1_11182_12369 377
1797 3300053085 Ga0495619_0036805 Ga0495619_0036805_686_1870 377
1798 3300053139 Ga0500568_0001800 Ga0500568_0001800_1991_3166 377
1799 3300054114 Ga0501084_0003669 Ga0501084_0003669_10052_11236 377
1800 3300059490 Ga0587066_011832 Ga0587066_011832_97_1263 377
1801 3300059510 Ga0587090_000423 Ga0587090_000423_1219_2385 377
1802 3300059630 Ga0587128_008890 Ga0587128_008890_32_1198 377
1803 3300060353 Ga0501082_0004627 Ga0501082_0004627_9742_10926 377
1804 3300061719 Ga0466962_0003043 Ga0466962_0003043_3351_4517 377
1805 3300061719 Ga0466962_0039612 Ga0466962_0039612_662_1831 377
1806 3300061734 Ga0530510_0000536 Ga0530510_0000536_14526_15710 377
1807 3300001977 JGI24746J21847_1001377 JGI24746J21847_10013773 378
1808 3300002773 JGI25152J39213_1000379 JGI25152J39213_100037911 378
1809 3300003187 JGI25151J46595_10038948 JGI25151J46595_100389482 378
1810 3300003762 Ga0055542_1005133 Ga0055542_10051332 378
1811 3300005333 Ga0070677_10078333 Ga0070677_100783331 378
1812 3300005335 Ga0070666_10144317 Ga0070666_101443171 378
1813 3300005337 Ga0070682_100014519 Ga0070682_1000145193 378
1814 3300005338 Ga0068868_100005768 Ga0068868_1000057683 378
1815 3300005338 Ga0068868_100054112 Ga0068868_1000541122 378
1816 3300005339 Ga0070660_100035294 Ga0070660_1000352944 378
1817 3300005347 Ga0070668_100004760 Ga0070668_1000047605 378
1818 3300005353 Ga0070669_100057358 Ga0070669_1000573582 378
1819 3300005353 Ga0070669_100120181 Ga0070669_1001201812 378
1820 3300005354 Ga0070675_100094331 Ga0070675_1000943312 378
1821 3300005355 Ga0070671_100000413 Ga0070671_1000004132 378
1822 3300005355 Ga0070671_100138032 Ga0070671_1001380322 378
1823 3300005355 Ga0070671_100199550 Ga0070671_1001995502 378
1824 3300005356 Ga0070674_100020814 Ga0070674_1000208143 378
1825 3300005356 Ga0070674_100065570 Ga0070674_1000655703 378
1826 3300005366 Ga0070659_100071106 Ga0070659_1000711062 378
1827 3300005366 Ga0070659_100091466 Ga0070659_1000914662 378
1828 3300005367 Ga0070667_100001634 Ga0070667_10000163415 378
1829 3300005367 Ga0070667_100010065 Ga0070667_1000100656 378
1830 3300005437 Ga0070710_10001407 Ga0070710_100014074 378
1831 3300005439 Ga0070711_100006432 Ga0070711_1000064322 378
1832 3300005441 Ga0070700_100026697 Ga0070700_1000266972 378
1833 3300005455 Ga0070663_100059261 Ga0070663_1000592612 378
1834 3300005456 Ga0070678_100001296 Ga0070678_1000012969 378
1835 3300005456 Ga0070678_100185230 Ga0070678_1001852301 378
1836 3300005458 Ga0070681_10009503 Ga0070681_100095038 378
1837 3300005459 Ga0068867_100002347 Ga0068867_1000023473 378
1838 3300005539 Ga0068853_100003640 Ga0068853_1000036408 378
1839 3300005539 Ga0068853_100029542 Ga0068853_1000295422 378
1840 3300005543 Ga0070672_100044260 Ga0070672_1000442602 378
1841 3300005546 Ga0070696_100001265 Ga0070696_1000012652 378
1842 3300005548 Ga0070665_100003803 Ga0070665_1000038038 378
1843 3300005548 Ga0070665_100042334 Ga0070665_1000423343 378
1844 3300005548 Ga0070665_100128311 Ga0070665_1001283112 378
1845 3300005549 Ga0070704_100000144 Ga0070704_10000014416 378
1846 3300005549 Ga0070704_100027059 Ga0070704_1000270592 378
1847 3300005563 Ga0068855_100081308 Ga0068855_1000813082 378
1848 3300005578 Ga0068854_100003304 Ga0068854_1000033044 378
1849 3300005578 Ga0068854_100140557 Ga0068854_1001405572 378
1850 3300005615 Ga0070702_100007562 Ga0070702_1000075622 378
1851 3300005617 Ga0068859_100001784 Ga0068859_1000017843 378
1852 3300005617 Ga0068859_100144251 Ga0068859_1001442512 378
1853 3300005718 Ga0068866_10000517 Ga0068866_1000051712 378
1854 3300005718 Ga0068866_10041100 Ga0068866_100411003 378
1855 3300005719 Ga0068861_100001353 Ga0068861_1000013531 378
1856 3300005719 Ga0068861_100055079 Ga0068861_1000550792 378
1857 3300005719 Ga0068861_100132503 Ga0068861_1001325032 378
1858 3300005842 Ga0068858_100005465 Ga0068858_1000054659 378
1859 3300005843 Ga0068860_100017715 Ga0068860_1000177152 378
1860 3300005844 Ga0068862_100004977 Ga0068862_1000049779 378
1861 3300005937 Ga0081455_10000082 Ga0081455_1000008264 378
1862 3300005937 Ga0081455_10098153 Ga0081455_100981532 378
1863 3300006051 Ga0075364_10000723 Ga0075364_100007233 378
1864 3300006051 Ga0075364_10034632 Ga0075364_100346323 378
1865 3300006163 Ga0070715_10055444 Ga0070715_100554441 378
1866 3300006173 Ga0070716_100007290 Ga0070716_1000072901 378
1867 3300006175 Ga0070712_100002802 Ga0070712_10000280210 378
1868 3300006175 Ga0070712_100012929 Ga0070712_1000129293 378
1869 3300006175 Ga0070712_100032414 Ga0070712_1000324141 378
1870 3300006175 Ga0070712_100036549 Ga0070712_1000365493 378
1871 3300006175 Ga0070712_100117682 Ga0070712_1001176821 378
1872 3300006177 Ga0075362_10029281 Ga0075362_100292812 378
1873 3300006186 Ga0075369_10004998 Ga0075369_100049982 378
1874 3300006186 Ga0075369_10005608 Ga0075369_100056085 378
1875 3300006353 Ga0075370_10044515 Ga0075370_100445152 378
1876 3300006844 Ga0075428_100005250 Ga0075428_1000052504 378
1877 3300006844 Ga0075428_100031735 Ga0075428_1000317353 378
1878 3300006846 Ga0075430_100062808 Ga0075430_1000628082 378
1879 3300006847 Ga0075431_100075899 Ga0075431_1000758992 378
1880 3300006880 Ga0075429_100070519 Ga0075429_1000705192 378
1881 3300006881 Ga0068865_100002468 Ga0068865_1000024685 378
1882 3300006881 Ga0068865_100066192 Ga0068865_1000661922 378
1883 3300006931 Ga0097620_100001784 Ga0097620_1000017843 378
1884 3300006931 Ga0097620_100144244 Ga0097620_1001442442 378
1885 3300009036 Ga0105244_10033017 Ga0105244_100330171 378
1886 3300009098 Ga0105245_10006332 Ga0105245_100063322 378
1887 3300009098 Ga0105245_10111351 Ga0105245_101113512 378
1888 3300009101 Ga0105247_10000376 Ga0105247_1000037618 378
1889 3300009147 Ga0114129_10043021 Ga0114129_100430217 378
1890 3300009147 Ga0114129_10063215 Ga0114129_100632154 378
1891 3300009174 Ga0105241_10007128 Ga0105241_100071283 378
1892 3300009176 Ga0105242_10000880 Ga0105242_100008805 378
1893 3300009177 Ga0105248_10015100 Ga0105248_100151008 378
1894 3300009177 Ga0105248_10085325 Ga0105248_100853251 378
1895 3300009177 Ga0105248_10093820 Ga0105248_100938202 378
1896 3300009177 Ga0105248_10102045 Ga0105248_101020452 378
1897 3300009551 Ga0105238_10026434 Ga0105238_100264342 378
1898 3300009553 Ga0105249_10048212 Ga0105249_100482122 378
1899 3300009553 Ga0105249_10082403 Ga0105249_100824032 378
1900 3300009553 Ga0105249_10172445 Ga0105249_101724452 378
1901 3300010375 Ga0105239_10100347 Ga0105239_101003473 378
1902 3300011119 Ga0105246_10073964 Ga0105246_100739642 378
1903 3300011119 Ga0105246_10096186 Ga0105246_100961862 378
1904 3300013100 Ga0157373_10035357 Ga0157373_100353573 378
1905 3300013102 Ga0157371_10066105 Ga0157371_100661052 378
1906 3300013104 Ga0157370_10007445 Ga0157370_100074459 378
1907 3300013105 Ga0157369_10000230 Ga0157369_1000023033 378
1908 3300013296 Ga0157374_10011242 Ga0157374_100112426 378
1909 3300013297 Ga0157378_10003787 Ga0157378_100037875 378
1910 3300013297 Ga0157378_10085185 Ga0157378_100851852 378
1911 3300013308 Ga0157375_10013718 Ga0157375_100137185 378
1912 3300013308 Ga0157375_10076311 Ga0157375_100763113 378
1913 3300013308 Ga0157375_10102159 Ga0157375_101021593 378
1914 3300013308 Ga0157375_10236263 Ga0157375_102362631 378
1915 3300014325 Ga0163163_10004486 Ga0163163_100044865 378
1916 3300014325 Ga0163163_10342163 Ga0163163_103421631 378
1917 3300014326 Ga0157380_10192700 Ga0157380_101927002 378
1918 3300014968 Ga0157379_10004386 Ga0157379_100043864 378
1919 3300017792 Ga0163161_10031311 Ga0163161_100313112 378
1920 3300017792 Ga0163161_10039383 Ga0163161_100393832 378
1921 3300020069 Ga0197907_10587311 Ga0197907_105873111 378
1922 3300020070 Ga0206356_10558971 Ga0206356_105589711 378
1923 3300025245 Ga0207425_1009908 Ga0207425_10099081 378
1924 3300025254 Ga0209148_1002289 Ga0209148_10022893 378
1925 3300025258 Ga0209129_1000109 Ga0209129_100010934 378
1926 3300025294 Ga0209025_1000984 Ga0209025_10009842 378
1927 3300025303 Ga0209051_1029411 Ga0209051_10294112 378
1928 3300025315 Ga0207697_10077557 Ga0207697_100775571 378
1929 3300025728 Ga0207655_1021163 Ga0207655_10211632 378
1930 3300025728 Ga0207655_1025368 Ga0207655_10253682 378
1931 3300025735 Ga0207713_1034408 Ga0207713_10344082 378
1932 3300025893 Ga0207682_10005955 Ga0207682_100059553 378
1933 3300025899 Ga0207642_10000166 Ga0207642_1000016610 378
1934 3300025899 Ga0207642_10085016 Ga0207642_100850162 378
1935 3300025901 Ga0207688_10008958 Ga0207688_100089585 378
1936 3300025904 Ga0207647_10023826 Ga0207647_100238264 378
1937 3300025905 Ga0207685_10000910 Ga0207685_100009103 378
1938 3300025905 Ga0207685_10056806 Ga0207685_100568061 378
1939 3300025907 Ga0207645_10029223 Ga0207645_100292232 378
1940 3300025912 Ga0207707_10008370 Ga0207707_100083703 378
1941 3300025914 Ga0207671_10097567 Ga0207671_100975672 378
1942 3300025915 Ga0207693_10004959 Ga0207693_100049593 378
1943 3300025915 Ga0207693_10005203 Ga0207693_100052034 378
1944 3300025915 Ga0207693_10019113 Ga0207693_100191134 378
1945 3300025916 Ga0207663_10019629 Ga0207663_100196292 378
1946 3300025917 Ga0207660_10111176 Ga0207660_101111762 378
1947 3300025921 Ga0207652_10033838 Ga0207652_100338385 378
1948 3300025923 Ga0207681_10012735 Ga0207681_100127353 378
1949 3300025923 Ga0207681_10124519 Ga0207681_101245192 378
1950 3300025924 Ga0207694_10011213 Ga0207694_100112131 378
1951 3300025925 Ga0207650_10050965 Ga0207650_100509652 378
1952 3300025925 Ga0207650_10090769 Ga0207650_100907692 378
1953 3300025926 Ga0207659_10071749 Ga0207659_100717491 378
1954 3300025927 Ga0207687_10002057 Ga0207687_100020573 378
1955 3300025927 Ga0207687_10028962 Ga0207687_100289622 378
1956 3300025927 Ga0207687_10111857 Ga0207687_101118572 378
1957 3300025931 Ga0207644_10000533 Ga0207644_100005333 378
1958 3300025931 Ga0207644_10156728 Ga0207644_101567282 378
1959 3300025932 Ga0207690_10046233 Ga0207690_100462332 378
1960 3300025933 Ga0207706_10023329 Ga0207706_100233295 378
1961 3300025934 Ga0207686_10013657 Ga0207686_100136573 378
1962 3300025935 Ga0207709_10003392 Ga0207709_100033922 378
1963 3300025935 Ga0207709_10041889 Ga0207709_100418892 378
1964 3300025935 Ga0207709_10090833 Ga0207709_100908332 378
1965 3300025937 Ga0207669_10000321 Ga0207669_1000032116 378
1966 3300025937 Ga0207669_10051938 Ga0207669_100519381 378
1967 3300025937 Ga0207669_10093143 Ga0207669_100931432 378
1968 3300025937 Ga0207669_10135214 Ga0207669_101352142 378
1969 3300025938 Ga0207704_10074438 Ga0207704_100744382 378
1970 3300025939 Ga0207665_10018374 Ga0207665_100183743 378
1971 3300025939 Ga0207665_10042074 Ga0207665_100420743 378
1972 3300025940 Ga0207691_10004828 Ga0207691_100048289 378
1973 3300025940 Ga0207691_10145476 Ga0207691_101454762 378
1974 3300025941 Ga0207711_10053676 Ga0207711_100536764 378
1975 3300025941 Ga0207711_10094465 Ga0207711_100944652 378
1976 3300025941 Ga0207711_10100070 Ga0207711_101000703 378
1977 3300025941 Ga0207711_10180181 Ga0207711_101801811 378
1978 3300025942 Ga0207689_10050492 Ga0207689_100504922 378
1979 3300025949 Ga0207667_10182780 Ga0207667_101827803 378
1980 3300025949 Ga0207667_10193446 Ga0207667_101934462 378
1981 3300025960 Ga0207651_10192083 Ga0207651_101920831 378
1982 3300025972 Ga0207668_10069477 Ga0207668_100694772 378
1983 3300025972 Ga0207668_10079801 Ga0207668_100798012 378
1984 3300026035 Ga0207703_10011120 Ga0207703_100111202 378
1985 3300026041 Ga0207639_10022472 Ga0207639_100224723 378
1986 3300026041 Ga0207639_10035803 Ga0207639_100358031 378
1987 3300026067 Ga0207678_10203261 Ga0207678_102032612 378
1988 3300026078 Ga0207702_10074804 Ga0207702_100748043 378
1989 3300026089 Ga0207648_10001482 Ga0207648_1000148217 378
1990 3300026095 Ga0207676_10208626 Ga0207676_102086262 378
1991 3300026118 Ga0207675_100003809 Ga0207675_1000038099 378
1992 3300026118 Ga0207675_100062849 Ga0207675_1000628492 378
1993 3300026118 Ga0207675_100142217 Ga0207675_1001422172 378
1994 3300026121 Ga0207683_10001283 Ga0207683_100012834 378
1995 3300026121 Ga0207683_10066126 Ga0207683_100661261 378
1996 3300026121 Ga0207683_10186624 Ga0207683_101866242 378
1997 3300026142 Ga0207698_10157060 Ga0207698_101570602 378
1998 3300027907 Ga0207428_10010654 Ga0207428_100106546 378
1999 3300028379 Ga0268266_10006280 Ga0268266_100062806 378
2000 3300028379 Ga0268266_10016431 Ga0268266_100164314 378
2001 3300028379 Ga0268266_10044774 Ga0268266_100447742 378
2002 3300028380 Ga0268265_10043944 Ga0268265_100439442 378
2003 3300028381 Ga0268264_10001010 Ga0268264_1000101013 378
2004 3300030744 Ga0316181_1233539 Ga0316181_12335392 378
2005 3300031548 Ga0307408_100171077 Ga0307408_1001710772 378
2006 3300031731 Ga0307405_10196397 Ga0307405_101963971 378
2007 3300031824 Ga0307413_10039726 Ga0307413_100397262 378
2008 3300031838 Ga0307518_10000445 Ga0307518_100004454 378
2009 3300031852 Ga0307410_10007860 Ga0307410_100078602 378
2010 3300031995 Ga0307409_100075439 Ga0307409_1000754392 378
2011 3300031995 Ga0307409_100168606 Ga0307409_1001686062 378
2012 3300032002 Ga0307416_100100882 Ga0307416_1001008822 378
2013 3300032002 Ga0307416_100495966 Ga0307416_1004959661 378
2014 3300032004 Ga0307414_10018011 Ga0307414_100180112 378
2015 3300032004 Ga0307414_10062940 Ga0307414_100629402 378
2016 3300032126 Ga0307415_100002009 Ga0307415_1000020095 378
2017 3300033179 Ga0307507_10014085 Ga0307507_100140853 378
2018 3300035119 Ga0373956_0002606 Ga0373956_0002606_2719_3888 378
2019 3300035691 Ga0373931_0009909 Ga0373931_0009909_1121_2296 378
2020 3300035691 Ga0373931_0017982 Ga0373931_0017982_205_1380 378
2021 3300036401 Ga0373937_0206334 Ga0373937_0206334_539_1717 378
2022 3300037312 Ga0395899_0008790 Ga0395899_0008790_5747_6922 378
2023 3300037312 Ga0395899_0071152 Ga0395899_0071152_541_1716 378
2024 3300037312 Ga0395899_0123009 Ga0395899_0123009_252_1439 378
2025 3300037418 Ga0395900_0040502 Ga0395900_0040502_1000_2175 378
2026 3300037418 Ga0395900_0074598 Ga0395900_0074598_2301_3470 378
2027 3300037418 Ga0395900_0140005 Ga0395900_0140005_602_1771 378
2028 3300037418 Ga0395900_0243208 Ga0395900_0243208_267_1454 378
2029 3300037466 Ga0395898_0115294 Ga0395898_0115294_21_1190 378
2030 3300037853 Ga0436364_0010700 Ga0436364_0010700_5381_6586 378
2031 3300038443 Ga0395901_0064601 Ga0395901_0064601_2305_3492 378
2032 3300038443 Ga0395901_0222281 Ga0395901_0222281_597_1784 378
2033 3300041405 Ga0439438_012377 Ga0439438_012377_141_1310 378
2034 3300041410 Ga0439461_0001042 Ga0439461_0001042_780_1949 378
2035 3300041410 Ga0439461_0006688 Ga0439461_0006688_49_1218 378
2036 3300041411 Ga0439466_0006330 Ga0439466_0006330_2595_3770 378
2037 3300041411 Ga0439466_0008648 Ga0439466_0008648_1183_2352 378
2038 3300041411 Ga0439466_0009136 Ga0439466_0009136_1079_2254 378
2039 3300041413 Ga0439465_0003293 Ga0439465_0003293_934_2109 378
2040 3300041997 Ga0439431_0013210 Ga0439431_0013210_436_1605 378
2041 3300041999 Ga0439433_0000286 Ga0439433_0000286_1035_2204 378
2042 3300041999 Ga0439433_0000832 Ga0439433_0000832_1597_2766 378
2043 3300042002 Ga0439442_026371 Ga0439442_026371_18_1187 378
2044 3300042007 Ga0439449_0001566 Ga0439449_0001566_2667_3836 378
2045 3300042010 Ga0439452_005887 Ga0439452_005887_1578_2747 378
2046 3300042014 Ga0439457_000878 Ga0439457_000878_997_2166 378
2047 3300042014 Ga0439457_002559 Ga0439457_002559_3050_4219 378
2048 3300042015 Ga0439462_0017634 Ga0439462_0017634_566_1735 378
2049 3300042121 Ga0450919_000123 Ga0450919_000123_950_2119 378
2050 3300042122 Ga0450920_006112 Ga0450920_006112_595_1764 378
2051 3300042156 Ga0439446_0008839 Ga0439446_0008839_696_1865 378
2052 3300042184 Ga0450908_002157 Ga0450908_002157_904_2073 378
2053 3300042185 Ga0450909_001471 Ga0450909_001471_965_2134 378
2054 3300042435 Ga0439434_0001620 Ga0439434_0001620_2388_3557 378
2055 3300042531 Ga0450918_003166 Ga0450918_003166_521_1690 378
2056 3300044658 Ga0466972_0025150 Ga0466972_0025150_130_1305 378
2057 3300044658 Ga0466972_0031016 Ga0466972_0031016_1107_2276 378
2058 3300044683 Ga0466965_0047425 Ga0466965_0047425_119_1288 378
2059 3300044693 Ga0466961_0209194 Ga0466961_0209194_24_1193 378
2060 3300044694 Ga0466963_0009504 Ga0466963_0009504_3314_4483 378
2061 3300044706 Ga0466964_0025463 Ga0466964_0025463_1021_2190 378
2062 3300044719 Ga0466971_0062121 Ga0466971_0062121_299_1468 378
2063 3300044765 Ga0466970_0013655 Ga0466970_0013655_2165_3334 378
2064 3300044765 Ga0466970_0034709 Ga0466970_0034709_760_1929 378
2065 3300044842 Ga0466957_0111467 Ga0466957_0111467_111_1316 378
2066 3300044901 Ga0466960_0004115 Ga0466960_0004115_1289_2494 378
2067 3300046460 Ga0495638_0078942 Ga0495638_0078942_362_1531 378
2068 3300046472 Ga0495580_0021278 Ga0495580_0021278_2417_3586 378
2069 3300046517 Ga0495630_0137601 Ga0495630_0137601_197_1366 378
2070 3300046522 Ga0495643_0077189 Ga0495643_0077189_404_1573 378
2071 3300046525 Ga0495663_0021342 Ga0495663_0021342_148_1317 378
2072 3300046530 Ga0495654_0057629 Ga0495654_0057629_519_1688 378
2073 3300046531 Ga0495665_0008383 Ga0495665_0008383_3466_4635 378
2074 3300046535 Ga0495586_0011384 Ga0495586_0011384_1066_2235 378
2075 3300046536 Ga0495587_0018456 Ga0495587_0018456_1151_2320 378
2076 3300046537 Ga0495598_0032263 Ga0495598_0032263_137_1306 378
2077 3300046559 Ga0495667_0031962 Ga0495667_0031962_1894_3063 378
2078 3300046616 Ga0495668_0000505 Ga0495668_0000505_12704_13873 378
2079 3300046664 Ga0495659_0008125 Ga0495659_0008125_1707_2876 378
2080 3300046665 Ga0495661_0054323 Ga0495661_0054323_981_2150 378
2081 3300046674 Ga0495588_0011453 Ga0495588_0011453_2504_3673 378
2082 3300046674 Ga0495588_0017198 Ga0495588_0017198_382_1551 378
2083 3300046674 Ga0495588_0027537 Ga0495588_0027537_1607_2776 378
2084 3300046679 Ga0495623_0063776 Ga0495623_0063776_926_2095 378
2085 3300047315 Ga0495581_0045150 Ga0495581_0045150_101_1270 378
2086 3300047315 Ga0495581_0053428 Ga0495581_0053428_1090_2259 378
2087 3300047317 Ga0495604_0131629 Ga0495604_0131629_408_1577 378
2088 3300047318 Ga0495636_0013480 Ga0495636_0013480_666_1835 378
2089 3300047320 Ga0495672_0011138 Ga0495672_0011138_1981_3150 378
2090 3300047445 Ga0495677_0042011 Ga0495677_0042011_284_1453 378
2091 3300048090 Ga0495615_0018625 Ga0495615_0018625_346_1515 378
2092 3300048904 Ga0496101_0002214 Ga0496101_0002214_1215_2390 378
2093 3300048904 Ga0496101_0015250 Ga0496101_0015250_3892_5064 378
2094 3300048904 Ga0496101_0127472 Ga0496101_0127472_439_1608 378
2095 3300048905 Ga0496102_0007433 Ga0496102_0007433_2886_4061 378
2096 3300048905 Ga0496102_0024381 Ga0496102_0024381_2727_3908 378
2097 3300048905 Ga0496102_0071661 Ga0496102_0071661_1002_2192 378
2098 3300048905 Ga0496102_0107025 Ga0496102_0107025_980_2155 378
2099 3300048905 Ga0496102_0346132 Ga0496102_0346132_102_1271 378
2100 3300048906 Ga0496103_0001651 Ga0496103_0001651_9920_11095 378
2101 3300048906 Ga0496103_0008384 Ga0496103_0008384_2187_3368 378
2102 3300048906 Ga0496103_0146301 Ga0496103_0146301_242_1411 378
2103 3300048907 Ga0496104_0003431 Ga0496104_0003431_10455_11630 378
2104 3300048907 Ga0496104_0075539 Ga0496104_0075539_1434_2606 378
2105 3300048907 Ga0496104_0434350 Ga0496104_0434350_14_1198 378
2106 3300048908 Ga0496105_0004208 Ga0496105_0004208_6145_7320 378
2107 3300048908 Ga0496105_0157242 Ga0496105_0157242_102_1271 378
2108 3300048909 Ga0496106_0000417 Ga0496106_0000417_24364_25539 378
2109 3300048909 Ga0496106_0072794 Ga0496106_0072794_819_1994 378
2110 3300048909 Ga0496106_0077479 Ga0496106_0077479_42_1232 378
2111 3300048909 Ga0496106_0160339 Ga0496106_0160339_179_1369 378
2112 3300048910 Ga0496107_0001611 Ga0496107_0001611_3531_4703 378
2113 3300048912 Ga0496109_0023643 Ga0496109_0023643_2091_3266 378
2114 3300048913 Ga0496110_0068720 Ga0496110_0068720_1520_2695 378
2115 3300048913 Ga0496110_0134866 Ga0496110_0134866_500_1669 378
2116 3300048914 Ga0496111_0090424 Ga0496111_0090424_894_2063 378
2117 3300048915 Ga0496112_0013235 Ga0496112_0013235_948_2117 378
2118 3300048915 Ga0496112_0063842 Ga0496112_0063842_2332_3507 378
2119 3300048916 Ga0496113_0004384 Ga0496113_0004384_501_1682 378
2120 3300048916 Ga0496113_0145554 Ga0496113_0145554_102_1271 378
2121 3300048917 Ga0496114_0002897 Ga0496114_0002897_1304_2479 378
2122 3300048917 Ga0496114_0004945 Ga0496114_0004945_4674_5846 378
2123 3300048917 Ga0496114_0296868 Ga0496114_0296868_61_1245 378
2124 3300048918 Ga0496115_0012370 Ga0496115_0012370_4341_5513 378
2125 3300048918 Ga0496115_0030427 Ga0496115_0030427_3013_4188 378
2126 3300048918 Ga0496115_0109880 Ga0496115_0109880_565_1734 378
2127 3300048920 Ga0496117_0000387 Ga0496117_0000387_32857_34062 378
2128 3300048920 Ga0496117_0000603 Ga0496117_0000603_56765_57934 378
2129 3300048921 Ga0496118_0000610 Ga0496118_0000610_56782_57951 378
2130 3300048922 Ga0496119_0032105 Ga0496119_0032105_2194_3363 378
2131 3300048922 Ga0496119_0085588 Ga0496119_0085588_337_1506 378
2132 3300048924 Ga0496121_0004937 Ga0496121_0004937_15681_16862 378
2133 3300048925 Ga0496122_0143312 Ga0496122_0143312_262_1431 378
2134 3300048927 Ga0496124_0000135 Ga0496124_0000135_78632_79801 378
2135 3300048927 Ga0496124_0035580 Ga0496124_0035580_39_1208 378
2136 3300048927 Ga0496124_0144633 Ga0496124_0144633_454_1623 378
2137 3300048928 Ga0496125_0055163 Ga0496125_0055163_548_1717 378
2138 3300049129 Ga0501309_003333 Ga0501309_003333_597_1766 378
2139 3300049539 Ga0501323_004697 Ga0501323_004697_183_1352 378
2140 3300049569 Ga0501032_0002711 Ga0501032_0002711_9907_11076 378
2141 3300049569 Ga0501032_0071221 Ga0501032_0071221_969_2138 378
2142 3300049570 Ga0501033_0060590 Ga0501033_0060590_911_2092 378
2143 3300049571 Ga0501034_0000112 Ga0501034_0000112_60632_61801 378
2144 3300049571 Ga0501034_0017156 Ga0501034_0017156_4374_5570 378
2145 3300049575 Ga0501039_0009621 Ga0501039_0009621_6070_7239 378
2146 3300049581 Ga0501047_0030469 Ga0501047_0030469_2600_3793 378
2147 3300049585 Ga0501069_0028354 Ga0501069_0028354_1599_2795 378
2148 3300049586 Ga0501070_0005678 Ga0501070_0005678_2430_3626 378
2149 3300049587 Ga0501071_0000327 Ga0501071_0000327_16149_17345 378
2150 3300050491 nmdc:mga00v17_56777_c1 nmdc:mga00v17_56777_c1_283_1452 378
2151 3300050491 nmdc:mga00v17_6346_c1 nmdc:mga00v17_6346_c1_1170_2345 378
2152 3300050496 nmdc:mga07m45_68468_c1 nmdc:mga07m45_68468_c1_459_1628 378
2153 3300050507 nmdc:mga05p37_59368_c1 nmdc:mga05p37_59368_c1_2753_3928 378
2154 3300050509 nmdc:mga0qj67_16520_c1 nmdc:mga0qj67_16520_c1_4020_5195 378
2155 3300050509 nmdc:mga0qj67_55011_c1 nmdc:mga0qj67_55011_c1_868_2043 378
2156 3300050510 nmdc:mga06r32_66862_c1 nmdc:mga06r32_66862_c1_1689_2864 378
2157 3300050510 nmdc:mga06r32_83948_c1 nmdc:mga06r32_83948_c1_1638_2819 378
2158 3300050516 nmdc:mga0sz30_1040_c1 nmdc:mga0sz30_1040_c1_3551_4726 378
2159 3300053085 Ga0495619_0152235 Ga0495619_0152235_269_1447 378
2160 3300053136 Ga0500559_0001016 Ga0500559_0001016_14790_15959 378
2161 3300053140 Ga0500573_0000014 Ga0500573_0000014_57538_58707 378
2162 3300053153 Ga0500616_0000027 Ga0500616_0000027_147490_148659 378
2163 3300053153 Ga0500616_0000115 Ga0500616_0000115_117436_118608 378
2164 3300053153 Ga0500616_0001308 Ga0500616_0001308_11875_13056 378
2165 3300053730 Ga0500645_013215 Ga0500645_013215_650_1876 378
2166 3300054114 Ga0501084_0056074 Ga0501084_0056074_1266_2435 378
2167 3300059505 Ga0587083_0019955 Ga0587083_0019955_26_1195 378
2168 3300059507 Ga0587086_005976 Ga0587086_005976_147_1316 378
2169 iso_pu_bacteria 2887443736 2887447174 378
2170 iso_pu_bacteria 2964326757 2964328541 378
2171 3300000549 LJQas_1002745 LJQas_10027452 379
2172 3300005366 Ga0070659_100182920 Ga0070659_1001829201 379
2173 3300006028 Ga0070717_10081630 Ga0070717_100816302 379
2174 3300031456 Ga0307513_10006259 Ga0307513_1000625911 379
2175 3300045976 Ga0466967_0050474 Ga0466967_0050474_1061_2233 379
2176 3300059505 Ga0587083_0013367 Ga0587083_0013367_155_1327 379

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08442

ATP-grasp_2

ATP-grasp domain

63

256

0.99

PF00549

Ligase_CoA

CoA-ligase

315

446

0.91

PF13549

ATP-grasp_5

ATP-grasp domain

61

271

0.84

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

66

188

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ufx-assembly5.cif.gz_G thermus aquaticus succinyl-coa synthetase in complex with gdp-mn2+ 0.9031 1 370
6no6-assembly1.cif.gz_B k46be&k114bd mutant atp-grasp fold of blastocystis hominis succinyl-coa synthetase 0.9017 1 205
3ufx-assembly1.cif.gz_B thermus aquaticus succinyl-coa synthetase in complex with gdp-mn2+ 0.8975 1 370
3ufx-assembly5.cif.gz_G thermus aquaticus succinyl-coa synthetase in complex with gdp-mn2+ 0.8962 1 370
6no5-assembly2.cif.gz_D adp bound to k46be&k114bd mutant atp-grasp fold of blastocystis hominis succinyl-coa synthetase 0.8932 1 205
ID Description Score Start End Superfamily
3ufxE01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9501 1 225 3.30.470.20
3ufxE01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9442 1 225 3.30.470.20
3ufxB02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1;ATP-grasp fold, A domain 0.9411 21 90 3.30.1490.20
1jkjB01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9383 1 225 3.30.470.20
1jkjB01 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9326 1 225 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A6J6TU45-F1-model_v4 Unannotated protein 0.98 237 376 GO:0000166
GO:0004775
GO:0005829
GO:0006099
GO:0006104
GO:0042709
AF-A0A1I5CT77-F1-model_v4 Succinyl-CoA synthetase beta subunit 0.979 1 222 GO:0004775
GO:0005524
GO:0005829
GO:0006099
GO:0006104
GO:0042709
GO:0046872
AF-A0A6B3E9J2-F1-model_v4 Succinate--CoA ligase subunit beta 0.9737 75 185 GO:0004775
GO:0005524
GO:0005829
GO:0006099
GO:0006104
GO:0042709
AF-A0A6B3E9J2-F1-model_v4 Succinate--CoA ligase subunit beta 0.9652 75 185 GO:0004775
GO:0005524
GO:0005829
GO:0006099
GO:0006104
GO:0042709
AF-A0A3C1L3G6-F1-model_v4 Succinate--CoA ligase subunit beta 0.9593 1 210 GO:0004775
GO:0005524
GO:0005829
GO:0006099
GO:0006104
GO:0042709
GO:0046872

Feature Viewer

pLDDT pTM Quality
89.7 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map