F496522
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2184 | 674 | 4369 | 303 |
Family's Representative Sequence
| Representative Sequence | 3300005719|Ga0068861_100001382|Ga0068861_10000138210 |
| Length | 355 |
| Sequence | MSTVPGFCDNCHVLPPPPFAYCRHRRNGVGIRLAPAFDLNVMSTVTKASVYSRTEDTPXXXSLASIDRFLDAVWMERGLSPNTLSAYRADLTALDRWLQGRGCSSLAAKRADVLAFIAFRVEAGARPRSTARQLSSFRRYYRYLIREGAIKEDPTAQIAMPKIGRSLPKSLTEEEVESLLAAPEIDDPLGNRDRSMLEVLYATGLRVSELVNLKSSQVNMNQGVLRIVGKGDRERLIPLGEEAVGWLQKFMSGPRLEILLERQTEYLFPTRRGDRMTRQAFWHIIKRYAQKAGVAKALSPHTLRHAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARERMKELHAQHHPRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 4 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 28 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 31 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 54 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 80 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 88 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 90 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 91 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 92 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 94 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 95 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 96 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 97 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 98 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 101 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 102 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 103 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 104 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 106 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 110 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 112 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 113 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 114 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 115 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 116 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 117 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 118 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 119 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 120 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 122 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 123 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 124 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 152 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 156 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 157 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 158 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 160 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 161 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 162 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 163 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 164 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 173 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 174 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 176 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 255 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 262 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 265 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 269 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 270 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 271 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 272 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 273 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 275 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 276 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 277 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 278 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 279 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 280 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 281 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 282 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 283 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 284 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 285 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 286 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 287 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 288 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 289 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 290 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 291 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 292 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 293 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 294 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 295 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 296 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 297 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 298 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 299 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 300 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 301 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 302 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 303 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 304 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 305 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 306 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 307 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 311 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 312 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 313 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 314 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 315 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 316 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 317 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 318 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 319 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 320 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 321 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 322 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 323 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 324 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 325 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 326 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 327 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 328 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 329 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 330 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 331 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 332 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 333 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 334 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 335 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 336 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 337 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 338 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 339 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 340 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 341 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 342 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 343 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 344 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 345 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 346 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 347 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 348 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 349 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 350 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 351 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 352 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 353 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 354 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 355 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 356 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 357 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 358 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 359 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 360 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 361 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 362 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 363 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 364 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 365 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 366 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 367 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 368 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 369 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 370 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 371 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 372 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 373 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 374 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 375 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 376 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 377 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 378 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 379 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 380 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 381 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 382 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 478 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 479 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 480 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 481 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 482 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 483 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 484 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 485 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 486 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 487 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 488 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 489 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 490 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 491 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 492 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 493 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 494 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 495 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 496 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 497 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 498 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 499 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 500 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 501 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 502 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 503 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 504 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 508 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 509 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 510 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 511 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 512 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 513 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 514 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 515 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 516 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 517 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 518 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 519 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 520 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 521 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 522 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 523 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 524 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 525 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 526 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 527 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 528 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 529 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 530 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 531 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 532 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 533 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 534 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 535 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 536 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 537 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 538 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 539 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 540 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 541 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 542 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 543 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 544 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 545 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 546 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 547 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 548 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 549 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 550 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 551 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 552 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 553 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 554 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 556 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 559 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 560 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 561 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 562 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 563 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 564 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 565 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 566 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 567 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 568 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 569 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 570 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 571 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 572 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 573 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 574 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 575 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 576 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 577 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 578 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 579 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 580 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 581 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 582 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 583 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 584 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 585 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 586 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 587 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 588 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 589 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 590 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 591 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 592 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 593 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 594 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 595 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 596 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 597 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 598 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 599 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 600 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 601 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 602 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 603 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 604 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 605 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 606 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 607 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 608 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 609 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 610 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 611 | 2690315857 | Rheinheimera sp. EpRS3 | Isolate | Unclassified |
| 612 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 613 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 614 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 615 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 616 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 617 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 618 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 619 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 620 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 621 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 622 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 623 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 624 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 625 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 626 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 627 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 628 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 629 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 630 | 2846033681 | Chromobacterium sinusclupearum MWU13-2610 | Isolate | Rhizosphere |
| 631 | 2846037992 | Chromobacterium alticapitis MWU14-2602 | Isolate | Rhizosphere |
| 632 | 2846540461 | Photorhabdus luminescens HIM3 | Isolate | Rhizosphere |
| 633 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 634 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 635 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 636 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 637 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 638 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 639 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 640 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 641 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 642 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 643 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 644 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 645 | 2887630918 | Psychrosphaera haliotis UCD-MCMsp1aY | Isolate | Unclassified |
| 646 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 647 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 648 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 649 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 650 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 651 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 652 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 653 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 654 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 655 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 656 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 657 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 658 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 659 | 2919493220 | Aeromonas salmonicida salmonicida 3466 | Isolate | Unclassified |
| 660 | 2919497567 | Shewanella putrefaciens 3469 | Isolate | Unclassified |
| 661 | 2919534386 | Rheinheimera pacifica 3879 | Isolate | Unclassified |
| 662 | 2919543075 | Aeromonas salmonicida masoucida 4076 | Isolate | Unclassified |
| 663 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 664 | 2923525760 | Aeromonas caviae SLBN-129 | Isolate | Rhizosphere |
| 665 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 666 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 667 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 668 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 669 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 670 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 671 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 672 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 673 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 674 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.38 |
| Metatranscriptomes | 0.23 |
| Isolates | 4.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.17 |
| Nodule | 0.92 |
| Rhizoplane | 2.79 |
| Rhizosphere | 84.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068861_100001382 | 3300005719 | Bacteria | 15229 |
| 2 | SwRhRL2b_contig_637244 | 2162886007 | Bacteria | 2832 |
| 3 | JGI25155J39150_1000136 | 3300002704 | Bacteria | 34706 |
| 4 | JGI25155J39150_1000346 | 3300002704 | Bacteria | 14831 |
| 5 | JGI25156J39149_1000156 | 3300002705 | Bacteria | 50177 |
| 6 | JGI25156J39149_1010186 | 3300002705 | Bacteria | 2227 |
| 7 | JGI25162J39368_1000025 | 3300002737 | Bacteria | 228879 |
| 8 | JGI25162J39368_1006852 | 3300002737 | Bacteria | 1873 |
| 9 | JGI25154J39366_1000430 | 3300002738 | Bacteria | 22349 |
| 10 | JGI25154J39366_1000531 | 3300002738 | Bacteria | 19097 |
| 11 | JGI25157J39369_1000277 | 3300002741 | Bacteria | 37605 |
| 12 | JGI25157J39369_1008646 | 3300002741 | Bacteria | 1407 |
| 13 | JGI25152J39213_1000113 | 3300002773 | Bacteria | 56427 |
| 14 | JGI25151J46595_10045536 | 3300003187 | Bacteria | 1547 |
| 15 | JGI25165J46597_1000054 | 3300003214 | Bacteria | 228891 |
| 16 | rootH1_10044520 | 3300003316 | Bacteria | 2234 |
| 17 | rootL2_10003689 | 3300003322 | Bacteria | 3346 |
| 18 | rootH1_10039841 | 3300003316 | Bacteria | 6678 |
| 19 | rootH1_10039841 | 3300003323 | Bacteria | 86560 |
| 20 | Ga0055538_1000008 | 3300003751 | Bacteria | 398547 |
| 21 | Ga0055538_1000026 | 3300003751 | Bacteria | 228891 |
| 22 | Ga0055539_1000012 | 3300003752 | Bacteria | 398547 |
| 23 | Ga0055539_1000033 | 3300003752 | Bacteria | 228891 |
| 24 | Ga0055533_1000015 | 3300003756 | Bacteria | 398547 |
| 25 | Ga0055533_1000044 | 3300003756 | Bacteria | 228891 |
| 26 | Ga0055532_1000005 | 3300003758 | Bacteria | 458107 |
| 27 | Ga0055525_1000017 | 3300003759 | Bacteria | 398547 |
| 28 | Ga0055525_1000052 | 3300003759 | Bacteria | 228891 |
| 29 | Ga0055535_1004655 | 3300003761 | Bacteria | 3254 |
| 30 | Ga0055526_1000129 | 3300003771 | Bacteria | 67279 |
| 31 | Ga0055526_1008158 | 3300003771 | Bacteria | 5275 |
| 32 | Ga0055537_1000156 | 3300003773 | Bacteria | 51559 |
| 33 | Ga0055537_1000223 | 3300003773 | Bacteria | 41876 |
| 34 | Ga0055524_1000029 | 3300003775 | Bacteria | 201332 |
| 35 | Ga0055524_1000824 | 3300003775 | Bacteria | 20504 |
| 36 | Ga0055534_1000230 | 3300003784 | Bacteria | 40350 |
| 37 | Ga0055534_1000632 | 3300003784 | Bacteria | 18001 |
| 38 | Ga0055528_1000341 | 3300003790 | Bacteria | 38736 |
| 39 | Ga0055541_1000009 | 3300003841 | Bacteria | 398547 |
| 40 | Ga0055541_1000049 | 3300003841 | Bacteria | 134251 |
| 41 | Ga0055543_1002523 | 3300004625 | Bacteria | 5985 |
| 42 | Ga0065165_1000050 | 3300005262 | Bacteria | 195237 |
| 43 | Ga0065165_1001239 | 3300005262 | Bacteria | 29150 |
| 44 | Ga0065714_10071968 | 3300005288 | Bacteria | 3459 |
| 45 | Ga0065704_10100794 | 3300005289 | Bacteria | 2261 |
| 46 | Ga0065712_10085621 | 3300005290 | Bacteria | 2686 |
| 47 | Ga0065707_10000575 | 3300005295 | Bacteria | 20383 |
| 48 | Ga0065707_10002291 | 3300005295 | Bacteria | 6264 |
| 49 | Ga0065707_10190954 | 3300005295 | Bacteria | 1361 |
| 50 | Ga0070676_10008532 | 3300005328 | Bacteria | 5523 |
| 51 | Ga0070676_10025203 | 3300005328 | Bacteria | 3359 |
| 52 | Ga0070676_10051702 | 3300005328 | Bacteria | 2413 |
| 53 | Ga0070676_10110602 | 3300005328 | Bacteria | 1710 |
| 54 | Ga0070683_100515260 | 3300005329 | Bacteria | 1143 |
| 55 | Ga0070683_100604523 | 3300005329 | Bacteria | 1049 |
| 56 | Ga0070690_100007662 | 3300005330 | Bacteria | 6188 |
| 57 | Ga0070690_100013534 | 3300005330 | Bacteria | 4823 |
| 58 | Ga0070690_100018489 | 3300005330 | Bacteria | 4211 |
| 59 | Ga0070690_100020957 | 3300005330 | Bacteria | 3988 |
| 60 | Ga0070690_100072859 | 3300005330 | Bacteria | 2234 |
| 61 | Ga0070670_100000633 | 3300005331 | Bacteria | 27394 |
| 62 | Ga0070670_100001609 | 3300005331 | Bacteria | 18253 |
| 63 | Ga0070670_100016449 | 3300005331 | Bacteria | 6351 |
| 64 | Ga0070670_100017843 | 3300005331 | Bacteria | 6091 |
| 65 | Ga0070670_100020260 | 3300005331 | Bacteria | 5714 |
| 66 | Ga0070670_100063985 | 3300005331 | Bacteria | 3156 |
| 67 | Ga0070670_100120482 | 3300005331 | Bacteria | 2263 |
| 68 | Ga0070670_100236968 | 3300005331 | Bacteria | 1588 |
| 69 | Ga0070677_10016184 | 3300005333 | Bacteria | 2652 |
| 70 | Ga0070677_10016731 | 3300005333 | Bacteria | 2614 |
| 71 | Ga0070677_10053548 | 3300005333 | Bacteria | 1641 |
| 72 | Ga0068869_100001563 | 3300005334 | Bacteria | 13602 |
| 73 | Ga0068869_100153854 | 3300005334 | Bacteria | 1786 |
| 74 | Ga0068869_100430261 | 3300005334 | Bacteria | 1090 |
| 75 | Ga0070666_10007516 | 3300005335 | Bacteria | 6717 |
| 76 | Ga0070666_10010612 | 3300005335 | Bacteria | 5764 |
| 77 | Ga0070666_10042685 | 3300005335 | Bacteria | 3035 |
| 78 | Ga0070666_10084826 | 3300005335 | Bacteria | 2169 |
| 79 | Ga0070666_10101206 | 3300005335 | Bacteria | 1986 |
| 80 | Ga0070666_10207289 | 3300005335 | Bacteria | 1380 |
| 81 | Ga0070680_100055192 | 3300005336 | Bacteria | 3246 |
| 82 | Ga0070680_100078763 | 3300005336 | Bacteria | 2715 |
| 83 | Ga0070680_100168296 | 3300005336 | Bacteria | 1843 |
| 84 | Ga0070680_100240115 | 3300005336 | Bacteria | 1531 |
| 85 | Ga0070682_100092547 | 3300005337 | Bacteria | 1981 |
| 86 | Ga0068868_100000807 | 3300005338 | Bacteria | 21238 |
| 87 | Ga0068868_100001147 | 3300005338 | Bacteria | 18142 |
| 88 | Ga0068868_100068614 | 3300005338 | Bacteria | 2824 |
| 89 | Ga0068868_100333480 | 3300005338 | Bacteria | 1295 |
| 90 | Ga0070660_100005509 | 3300005339 | Bacteria | 8766 |
| 91 | Ga0070660_100027230 | 3300005339 | Bacteria | 4264 |
| 92 | Ga0070689_100005128 | 3300005340 | Bacteria | 8907 |
| 93 | Ga0070689_100417583 | 3300005340 | Bacteria | 1136 |
| 94 | Ga0070687_100136906 | 3300005343 | Bacteria | 1421 |
| 95 | Ga0070661_100002263 | 3300005344 | Bacteria | 13196 |
| 96 | Ga0070661_100050285 | 3300005344 | Bacteria | 3049 |
| 97 | Ga0070661_100062228 | 3300005344 | Bacteria | 2740 |
| 98 | Ga0070661_100077123 | 3300005344 | Bacteria | 2456 |
| 99 | Ga0070661_100383580 | 3300005344 | Bacteria | 1108 |
| 100 | Ga0070692_10013609 | 3300005345 | Bacteria | 3797 |
| 101 | Ga0070692_10019466 | 3300005345 | Bacteria | 3275 |
| 102 | Ga0070692_10030016 | 3300005345 | Bacteria | 2715 |
| 103 | Ga0070668_100003121 | 3300005347 | Bacteria | 12238 |
| 104 | Ga0070668_100018583 | 3300005347 | Bacteria | 5219 |
| 105 | Ga0070668_100063651 | 3300005347 | Bacteria | 2859 |
| 106 | Ga0070668_100085647 | 3300005347 | Bacteria | 2477 |
| 107 | Ga0070668_100135195 | 3300005347 | Bacteria | 1982 |
| 108 | Ga0070668_100143969 | 3300005347 | Bacteria | 1923 |
| 109 | Ga0070668_100328630 | 3300005347 | Bacteria | 1289 |
| 110 | Ga0070669_100006519 | 3300005353 | Bacteria | 8406 |
| 111 | Ga0070669_100023970 | 3300005353 | Bacteria | 4372 |
| 112 | Ga0070669_100038713 | 3300005353 | Bacteria | 3462 |
| 113 | Ga0070669_100164069 | 3300005353 | Bacteria | 1728 |
| 114 | Ga0070669_100222985 | 3300005353 | Bacteria | 1491 |
| 115 | Ga0070675_100000783 | 3300005354 | Bacteria | 22262 |
| 116 | Ga0070675_100002509 | 3300005354 | Bacteria | 13735 |
| 117 | Ga0070675_100008395 | 3300005354 | Bacteria | 8015 |
| 118 | Ga0070675_100017563 | 3300005354 | Bacteria | 5687 |
| 119 | Ga0070675_100018880 | 3300005354 | Bacteria | 5490 |
| 120 | Ga0070675_100089061 | 3300005354 | Bacteria | 2583 |
| 121 | Ga0070675_100117136 | 3300005354 | Bacteria | 2260 |
| 122 | Ga0070675_100132751 | 3300005354 | Bacteria | 2123 |
| 123 | Ga0070675_100163678 | 3300005354 | Bacteria | 1915 |
| 124 | Ga0070675_100179809 | 3300005354 | Bacteria | 1828 |
| 125 | Ga0070671_100000128 | 3300005355 | Bacteria | 48658 |
| 126 | Ga0070671_100001372 | 3300005355 | Bacteria | 18255 |
| 127 | Ga0070671_100005466 | 3300005355 | Bacteria | 10141 |
| 128 | Ga0070671_100030200 | 3300005355 | Bacteria | 4472 |
| 129 | Ga0070671_100068872 | 3300005355 | Bacteria | 2951 |
| 130 | Ga0070671_100161273 | 3300005355 | Bacteria | 1895 |
| 131 | Ga0070674_100037101 | 3300005356 | Bacteria | 3276 |
| 132 | Ga0070674_100057351 | 3300005356 | Bacteria | 2703 |
| 133 | Ga0070674_100078994 | 3300005356 | Bacteria | 2346 |
| 134 | Ga0070674_100202216 | 3300005356 | Bacteria | 1535 |
| 135 | Ga0070674_100316970 | 3300005356 | Bacteria | 1249 |
| 136 | Ga0070673_100005763 | 3300005364 | Bacteria | 7972 |
| 137 | Ga0070673_100014207 | 3300005364 | Bacteria | 5535 |
| 138 | Ga0070673_100028391 | 3300005364 | Bacteria | 4161 |
| 139 | Ga0070673_100222274 | 3300005364 | Bacteria | 1635 |
| 140 | Ga0070673_100519437 | 3300005364 | Bacteria | 1079 |
| 141 | Ga0070688_100083773 | 3300005365 | Bacteria | 2070 |
| 142 | Ga0070688_100114136 | 3300005365 | Bacteria | 1800 |
| 143 | Ga0070659_100005049 | 3300005366 | Bacteria | 9461 |
| 144 | Ga0070659_100014648 | 3300005366 | Bacteria | 5863 |
| 145 | Ga0070659_100027629 | 3300005366 | Bacteria | 4374 |
| 146 | Ga0070667_100000052 | 3300005367 | Bacteria | 153455 |
| 147 | Ga0070667_100048364 | 3300005367 | Bacteria | 3580 |
| 148 | Ga0070667_100061546 | 3300005367 | Bacteria | 3178 |
| 149 | Ga0070667_100071115 | 3300005367 | Bacteria | 2963 |
| 150 | Ga0070667_100125180 | 3300005367 | Bacteria | 2239 |
| 151 | Ga0070667_100205062 | 3300005367 | Bacteria | 1750 |
| 152 | Ga0070709_10014713 | 3300005434 | Bacteria | 4431 |
| 153 | Ga0070714_100011747 | 3300005435 | Bacteria | 6958 |
| 154 | Ga0070713_100000045 | 3300005436 | Bacteria | 77398 |
| 155 | Ga0070713_100020371 | 3300005436 | Bacteria | 5084 |
| 156 | Ga0070710_10001552 | 3300005437 | Bacteria | 10857 |
| 157 | Ga0070710_10100547 | 3300005437 | Bacteria | 1721 |
| 158 | Ga0070701_10028035 | 3300005438 | Bacteria | 2766 |
| 159 | Ga0070701_10051835 | 3300005438 | Bacteria | 2130 |
| 160 | Ga0070701_10099871 | 3300005438 | Bacteria | 1605 |
| 161 | Ga0070711_100000979 | 3300005439 | Bacteria | 15125 |
| 162 | Ga0070711_100255271 | 3300005439 | Bacteria | 1377 |
| 163 | Ga0070705_100025129 | 3300005440 | Bacteria | 3225 |
| 164 | Ga0070705_100029556 | 3300005440 | Bacteria | 3016 |
| 165 | Ga0070705_100046639 | 3300005440 | Bacteria | 2499 |
| 166 | Ga0070705_100123843 | 3300005440 | Bacteria | 1674 |
| 167 | Ga0070705_100160790 | 3300005440 | Bacteria | 1501 |
| 168 | Ga0070705_100198605 | 3300005440 | Bacteria | 1373 |
| 169 | Ga0070700_100000396 | 3300005441 | Bacteria | 22554 |
| 170 | Ga0070700_100008805 | 3300005441 | Bacteria | 5512 |
| 171 | Ga0070700_100075575 | 3300005441 | Bacteria | 2161 |
| 172 | Ga0070700_100118476 | 3300005441 | Bacteria | 1770 |
| 173 | Ga0070700_100170436 | 3300005441 | Bacteria | 1507 |
| 174 | Ga0070694_100006107 | 3300005444 | Bacteria | 7306 |
| 175 | Ga0070694_100011182 | 3300005444 | Bacteria | 5559 |
| 176 | Ga0070694_100138562 | 3300005444 | Bacteria | 1765 |
| 177 | Ga0070694_100288708 | 3300005444 | Bacteria | 1253 |
| 178 | Ga0070708_100159991 | 3300005445 | Bacteria | 2098 |
| 179 | Ga0070708_100214483 | 3300005445 | Bacteria | 1804 |
| 180 | Ga0070708_100541720 | 3300005445 | Bacteria | 1098 |
| 181 | Ga0070663_100098582 | 3300005455 | Bacteria | 2178 |
| 182 | Ga0070663_100126147 | 3300005455 | Bacteria | 1939 |
| 183 | Ga0070663_100134393 | 3300005455 | Bacteria | 1882 |
| 184 | Ga0070678_100000463 | 3300005456 | Bacteria | 19357 |
| 185 | Ga0070678_100074427 | 3300005456 | Bacteria | 2552 |
| 186 | Ga0070678_100239553 | 3300005456 | Bacteria | 1516 |
| 187 | Ga0070678_100271757 | 3300005456 | Bacteria | 1430 |
| 188 | Ga0070678_100520236 | 3300005456 | Bacteria | 1052 |
| 189 | Ga0070662_100035077 | 3300005457 | Bacteria | 3541 |
| 190 | Ga0070662_100049496 | 3300005457 | Bacteria | 3030 |
| 191 | Ga0070662_100069978 | 3300005457 | Bacteria | 2585 |
| 192 | Ga0070662_100106050 | 3300005457 | Bacteria | 2134 |
| 193 | Ga0070681_10000611 | 3300005458 | Bacteria | 29403 |
| 194 | Ga0070681_10004528 | 3300005458 | Bacteria | 13264 |
| 195 | Ga0070681_10070181 | 3300005458 | Bacteria | 3469 |
| 196 | Ga0070681_10155279 | 3300005458 | Bacteria | 2214 |
| 197 | Ga0070681_10160361 | 3300005458 | Bacteria | 2173 |
| 198 | Ga0070681_10334616 | 3300005458 | Bacteria | 1423 |
| 199 | Ga0068867_100013837 | 3300005459 | Bacteria | 5711 |
| 200 | Ga0068867_100022066 | 3300005459 | Bacteria | 4549 |
| 201 | Ga0068867_100027056 | 3300005459 | Bacteria | 4120 |
| 202 | Ga0068867_100091467 | 3300005459 | Bacteria | 2310 |
| 203 | Ga0068867_100166609 | 3300005459 | Bacteria | 1742 |
| 204 | Ga0068867_100218794 | 3300005459 | Bacteria | 1534 |
| 205 | Ga0068867_100251397 | 3300005459 | Bacteria | 1438 |
| 206 | Ga0068867_100276704 | 3300005459 | Bacteria | 1375 |
| 207 | Ga0070685_10135671 | 3300005466 | Bacteria | 1543 |
| 208 | Ga0070706_100053743 | 3300005467 | Bacteria | 3717 |
| 209 | Ga0070706_100148134 | 3300005467 | Bacteria | 2191 |
| 210 | Ga0070706_100333276 | 3300005467 | Bacteria | 1415 |
| 211 | Ga0070706_100395146 | 3300005467 | Bacteria | 1287 |
| 212 | Ga0070707_100043483 | 3300005468 | Bacteria | 4299 |
| 213 | Ga0070707_100458324 | 3300005468 | Bacteria | 1236 |
| 214 | Ga0070698_100043148 | 3300005471 | Bacteria | 4625 |
| 215 | Ga0070698_100209886 | 3300005471 | Bacteria | 1882 |
| 216 | Ga0070698_100254665 | 3300005471 | Bacteria | 1688 |
| 217 | Ga0070699_100162578 | 3300005518 | Bacteria | 1976 |
| 218 | Ga0070679_100000602 | 3300005530 | Bacteria | 30622 |
| 219 | Ga0070679_100011268 | 3300005530 | Bacteria | 8523 |
| 220 | Ga0070679_100057543 | 3300005530 | Bacteria | 3875 |
| 221 | Ga0070679_100084974 | 3300005530 | Bacteria | 3152 |
| 222 | Ga0070679_100093957 | 3300005530 | Bacteria | 2986 |
| 223 | Ga0070679_100205385 | 3300005530 | Bacteria | 1934 |
| 224 | Ga0070684_100015628 | 3300005535 | Bacteria | 6190 |
| 225 | Ga0070684_100023889 | 3300005535 | Bacteria | 5121 |
| 226 | Ga0070684_100225660 | 3300005535 | Bacteria | 1710 |
| 227 | Ga0070697_100012581 | 3300005536 | Bacteria | 6628 |
| 228 | Ga0070697_100362198 | 3300005536 | Bacteria | 1254 |
| 229 | Ga0068853_100089805 | 3300005539 | Bacteria | 2699 |
| 230 | Ga0068853_100114170 | 3300005539 | Bacteria | 2402 |
| 231 | Ga0068853_100142464 | 3300005539 | Bacteria | 2152 |
| 232 | Ga0070672_100001093 | 3300005543 | Bacteria | 16524 |
| 233 | Ga0070672_100007042 | 3300005543 | Bacteria | 7603 |
| 234 | Ga0070672_100011072 | 3300005543 | Bacteria | 6280 |
| 235 | Ga0070672_100073618 | 3300005543 | Bacteria | 2723 |
| 236 | Ga0070672_100088301 | 3300005543 | Bacteria | 2496 |
| 237 | Ga0070672_100090873 | 3300005543 | Bacteria | 2463 |
| 238 | Ga0070672_100100022 | 3300005543 | Bacteria | 2351 |
| 239 | Ga0070672_100121530 | 3300005543 | Bacteria | 2138 |
| 240 | Ga0070672_100303564 | 3300005543 | Bacteria | 1354 |
| 241 | Ga0070686_100026176 | 3300005544 | Bacteria | 3518 |
| 242 | Ga0070686_100091550 | 3300005544 | Bacteria | 2035 |
| 243 | Ga0070686_100315452 | 3300005544 | Bacteria | 1164 |
| 244 | Ga0070695_100061566 | 3300005545 | Bacteria | 2435 |
| 245 | Ga0070695_100062960 | 3300005545 | Bacteria | 2410 |
| 246 | Ga0070695_100142281 | 3300005545 | Bacteria | 1665 |
| 247 | Ga0070696_100040363 | 3300005546 | Bacteria | 3222 |
| 248 | Ga0070696_100136994 | 3300005546 | Bacteria | 1785 |
| 249 | Ga0070693_100169307 | 3300005547 | Bacteria | 1398 |
| 250 | Ga0070665_100004349 | 3300005548 | Bacteria | 14899 |
| 251 | Ga0070665_100007432 | 3300005548 | Bacteria | 11140 |
| 252 | Ga0070665_100051901 | 3300005548 | Bacteria | 4113 |
| 253 | Ga0070665_100080808 | 3300005548 | Bacteria | 3256 |
| 254 | Ga0070665_100110207 | 3300005548 | Bacteria | 2755 |
| 255 | Ga0070665_100220341 | 3300005548 | Bacteria | 1898 |
| 256 | Ga0070665_100292897 | 3300005548 | Bacteria | 1630 |
| 257 | Ga0070704_100000018 | 3300005549 | Bacteria | 54668 |
| 258 | Ga0070704_100010603 | 3300005549 | Bacteria | 5611 |
| 259 | Ga0070704_100024777 | 3300005549 | Bacteria | 3941 |
| 260 | Ga0070704_100298246 | 3300005549 | Bacteria | 1342 |
| 261 | Ga0070704_100335764 | 3300005549 | Bacteria | 1271 |
| 262 | Ga0070704_100363017 | 3300005549 | Bacteria | 1226 |
| 263 | Ga0068855_100001182 | 3300005563 | Bacteria | 32433 |
| 264 | Ga0068855_100001706 | 3300005563 | Bacteria | 27486 |
| 265 | Ga0068855_100002465 | 3300005563 | Bacteria | 22841 |
| 266 | Ga0068855_100009248 | 3300005563 | Bacteria | 11906 |
| 267 | Ga0068855_100014961 | 3300005563 | Bacteria | 9345 |
| 268 | Ga0068855_100352464 | 3300005563 | Bacteria | 1621 |
| 269 | Ga0070664_100000712 | 3300005564 | Bacteria | 25469 |
| 270 | Ga0070664_100002382 | 3300005564 | Bacteria | 15098 |
| 271 | Ga0070664_100005456 | 3300005564 | Bacteria | 10210 |
| 272 | Ga0070664_100057493 | 3300005564 | Bacteria | 3306 |
| 273 | Ga0070664_100095791 | 3300005564 | Bacteria | 2574 |
| 274 | Ga0070664_100123823 | 3300005564 | Bacteria | 2266 |
| 275 | Ga0070664_100218292 | 3300005564 | Bacteria | 1706 |
| 276 | Ga0068857_100011829 | 3300005577 | Bacteria | 7591 |
| 277 | Ga0068857_100163791 | 3300005577 | Bacteria | 2019 |
| 278 | Ga0068857_100170142 | 3300005577 | Bacteria | 1980 |
| 279 | Ga0068854_100001881 | 3300005578 | Bacteria | 12806 |
| 280 | Ga0068854_100023240 | 3300005578 | Bacteria | 4233 |
| 281 | Ga0068854_100076706 | 3300005578 | Bacteria | 2457 |
| 282 | Ga0068854_100236407 | 3300005578 | Bacteria | 1453 |
| 283 | Ga0068854_100237094 | 3300005578 | Bacteria | 1451 |
| 284 | Ga0068856_100004553 | 3300005614 | Bacteria | 13778 |
| 285 | Ga0068856_100025692 | 3300005614 | Bacteria | 5742 |
| 286 | Ga0068856_100036576 | 3300005614 | Bacteria | 4813 |
| 287 | Ga0068856_100040053 | 3300005614 | Bacteria | 4601 |
| 288 | Ga0068856_100067169 | 3300005614 | Bacteria | 3543 |
| 289 | Ga0068856_100094059 | 3300005614 | Bacteria | 2984 |
| 290 | Ga0068856_100139945 | 3300005614 | Bacteria | 2427 |
| 291 | Ga0068856_100307555 | 3300005614 | Bacteria | 1603 |
| 292 | Ga0068856_100377852 | 3300005614 | Bacteria | 1436 |
| 293 | Ga0070702_100000536 | 3300005615 | Bacteria | 13724 |
| 294 | Ga0070702_100012238 | 3300005615 | Bacteria | 4292 |
| 295 | Ga0070702_100026041 | 3300005615 | Bacteria | 3140 |
| 296 | Ga0070702_100132516 | 3300005615 | Bacteria | 1576 |
| 297 | Ga0068852_100001103 | 3300005616 | Bacteria | 17810 |
| 298 | Ga0068852_100017508 | 3300005616 | Bacteria | 5624 |
| 299 | Ga0068859_100003776 | 3300005617 | Bacteria | 15454 |
| 300 | Ga0068859_100009497 | 3300005617 | Bacteria | 9823 |
| 301 | Ga0068859_100023708 | 3300005617 | Bacteria | 6159 |
| 302 | Ga0068859_100077712 | 3300005617 | Bacteria | 3360 |
| 303 | Ga0068859_100120205 | 3300005617 | Bacteria | 2693 |
| 304 | Ga0068859_100168757 | 3300005617 | Bacteria | 2269 |
| 305 | Ga0068859_100271922 | 3300005617 | Bacteria | 1787 |
| 306 | Ga0068864_100002031 | 3300005618 | Bacteria | 16705 |
| 307 | Ga0068864_100010073 | 3300005618 | Bacteria | 7806 |
| 308 | Ga0068864_100022732 | 3300005618 | Bacteria | 5258 |
| 309 | Ga0068864_100023356 | 3300005618 | Bacteria | 5192 |
| 310 | Ga0068864_100064135 | 3300005618 | Bacteria | 3185 |
| 311 | Ga0068864_100121236 | 3300005618 | Bacteria | 2338 |
| 312 | Ga0068864_100203346 | 3300005618 | Bacteria | 1820 |
| 313 | Ga0068864_100217787 | 3300005618 | Bacteria | 1760 |
| 314 | Ga0068864_100240406 | 3300005618 | Bacteria | 1678 |
| 315 | Ga0068864_100245706 | 3300005618 | Bacteria | 1659 |
| 316 | Ga0068864_100431323 | 3300005618 | Bacteria | 1257 |
| 317 | Ga0068866_10000717 | 3300005718 | Bacteria | 15051 |
| 318 | Ga0068866_10003912 | 3300005718 | Bacteria | 6111 |
| 319 | Ga0068866_10051421 | 3300005718 | Bacteria | 2097 |
| 320 | Ga0068866_10062206 | 3300005718 | Bacteria | 1941 |
| 321 | Ga0068866_10187591 | 3300005718 | Bacteria | 1226 |
| 322 | Ga0068861_100012489 | 3300005719 | Bacteria | 5927 |
| 323 | Ga0068861_100015622 | 3300005719 | Bacteria | 5355 |
| 324 | Ga0068861_100016209 | 3300005719 | Bacteria | 5268 |
| 325 | Ga0068861_100029458 | 3300005719 | Bacteria | 4017 |
| 326 | Ga0068861_100160014 | 3300005719 | Bacteria | 1856 |
| 327 | Ga0068861_100195762 | 3300005719 | Bacteria | 1693 |
| 328 | Ga0068861_100196842 | 3300005719 | Bacteria | 1689 |
| 329 | Ga0068861_100287360 | 3300005719 | Bacteria | 1419 |
| 330 | Ga0068851_10003231 | 3300005834 | Bacteria | 7222 |
| 331 | Ga0068851_10038885 | 3300005834 | Bacteria | 2388 |
| 332 | Ga0068851_10042935 | 3300005834 | Bacteria | 2278 |
| 333 | Ga0068870_10037587 | 3300005840 | Bacteria | 2496 |
| 334 | Ga0068863_100001012 | 3300005841 | Bacteria | 28130 |
| 335 | Ga0068863_100002456 | 3300005841 | Bacteria | 18419 |
| 336 | Ga0068863_100010910 | 3300005841 | Bacteria | 8811 |
| 337 | Ga0068863_100021801 | 3300005841 | Bacteria | 6114 |
| 338 | Ga0068863_100042478 | 3300005841 | Bacteria | 4319 |
| 339 | Ga0068863_100069864 | 3300005841 | Bacteria | 3320 |
| 340 | Ga0068863_100077118 | 3300005841 | Bacteria | 3154 |
| 341 | Ga0068863_100088880 | 3300005841 | Bacteria | 2929 |
| 342 | Ga0068863_100138272 | 3300005841 | Bacteria | 2327 |
| 343 | Ga0068863_100187450 | 3300005841 | Bacteria | 1987 |
| 344 | Ga0068863_100193491 | 3300005841 | Bacteria | 1955 |
| 345 | Ga0068863_100422239 | 3300005841 | Bacteria | 1306 |
| 346 | Ga0068858_100000838 | 3300005842 | Bacteria | 31992 |
| 347 | Ga0068858_100001334 | 3300005842 | Bacteria | 25476 |
| 348 | Ga0068858_100003187 | 3300005842 | Bacteria | 16393 |
| 349 | Ga0068858_100049450 | 3300005842 | Bacteria | 3894 |
| 350 | Ga0068858_100056595 | 3300005842 | Bacteria | 3624 |
| 351 | Ga0068858_100123497 | 3300005842 | Bacteria | 2423 |
| 352 | Ga0068858_100416596 | 3300005842 | Bacteria | 1292 |
| 353 | Ga0068858_100473361 | 3300005842 | Bacteria | 1208 |
| 354 | Ga0068860_100000941 | 3300005843 | Bacteria | 32265 |
| 355 | Ga0068860_100002554 | 3300005843 | Bacteria | 19028 |
| 356 | Ga0068860_100013492 | 3300005843 | Bacteria | 8012 |
| 357 | Ga0068860_100028810 | 3300005843 | Bacteria | 5344 |
| 358 | Ga0068860_100038795 | 3300005843 | Bacteria | 4557 |
| 359 | Ga0068860_100040424 | 3300005843 | Bacteria | 4457 |
| 360 | Ga0068860_100053102 | 3300005843 | Bacteria | 3853 |
| 361 | Ga0068860_100107013 | 3300005843 | Bacteria | 2672 |
| 362 | Ga0068860_100141667 | 3300005843 | Bacteria | 2311 |
| 363 | Ga0068860_100213605 | 3300005843 | Bacteria | 1871 |
| 364 | Ga0068862_100000627 | 3300005844 | Bacteria | 36553 |
| 365 | Ga0068862_100003677 | 3300005844 | Bacteria | 13117 |
| 366 | Ga0068862_100007347 | 3300005844 | Bacteria | 9152 |
| 367 | Ga0068862_100008433 | 3300005844 | Bacteria | 8527 |
| 368 | Ga0068862_100021370 | 3300005844 | Bacteria | 5407 |
| 369 | Ga0068862_100025886 | 3300005844 | Bacteria | 4928 |
| 370 | Ga0068862_100050489 | 3300005844 | Bacteria | 3555 |
| 371 | Ga0068862_100096277 | 3300005844 | Bacteria | 2583 |
| 372 | Ga0068862_100099445 | 3300005844 | Bacteria | 2542 |
| 373 | Ga0068862_100166692 | 3300005844 | Bacteria | 1969 |
| 374 | Ga0068862_100189099 | 3300005844 | Bacteria | 1851 |
| 375 | Ga0068862_100240492 | 3300005844 | Bacteria | 1646 |
| 376 | Ga0068862_100353240 | 3300005844 | Bacteria | 1364 |
| 377 | Ga0081455_10013572 | 3300005937 | Bacteria | 8029 |
| 378 | Ga0070717_10035050 | 3300006028 | Bacteria | 4059 |
| 379 | Ga0075364_10000513 | 3300006051 | Bacteria | 19718 |
| 380 | Ga0075364_10001919 | 3300006051 | Bacteria | 11578 |
| 381 | Ga0075364_10015072 | 3300006051 | Bacteria | 4787 |
| 382 | Ga0070715_10008322 | 3300006163 | Bacteria | 3611 |
| 383 | Ga0070715_10073462 | 3300006163 | Bacteria | 1534 |
| 384 | Ga0070716_100000244 | 3300006173 | Bacteria | 21728 |
| 385 | Ga0070712_100030129 | 3300006175 | Bacteria | 3643 |
| 386 | Ga0070712_100046364 | 3300006175 | Bacteria | 3005 |
| 387 | Ga0070712_100207631 | 3300006175 | Bacteria | 1543 |
| 388 | Ga0075366_10001562 | 3300006195 | Bacteria | 11450 |
| 389 | Ga0075366_10024270 | 3300006195 | Bacteria | 3536 |
| 390 | Ga0075366_10040010 | 3300006195 | Bacteria | 2772 |
| 391 | Ga0097621_100003986 | 3300006237 | Bacteria | 10232 |
| 392 | Ga0097621_100006125 | 3300006237 | Bacteria | 8517 |
| 393 | Ga0097621_100036360 | 3300006237 | Bacteria | 3940 |
| 394 | Ga0097621_100061784 | 3300006237 | Bacteria | 3073 |
| 395 | Ga0097621_100084227 | 3300006237 | Bacteria | 2650 |
| 396 | Ga0097621_100098407 | 3300006237 | Bacteria | 2457 |
| 397 | Ga0097621_100285937 | 3300006237 | Bacteria | 1453 |
| 398 | Ga0097621_100340364 | 3300006237 | Bacteria | 1332 |
| 399 | Ga0068871_100000888 | 3300006358 | Bacteria | 19940 |
| 400 | Ga0068871_100023710 | 3300006358 | Bacteria | 4751 |
| 401 | Ga0068871_100032115 | 3300006358 | Bacteria | 4144 |
| 402 | Ga0068871_100050198 | 3300006358 | Bacteria | 3374 |
| 403 | Ga0068871_100155363 | 3300006358 | Bacteria | 1953 |
| 404 | Ga0068871_100167521 | 3300006358 | Bacteria | 1882 |
| 405 | Ga0068871_100311729 | 3300006358 | Bacteria | 1383 |
| 406 | Ga0068871_100334706 | 3300006358 | Bacteria | 1336 |
| 407 | Ga0075428_100001820 | 3300006844 | Bacteria | 22828 |
| 408 | Ga0075428_100012398 | 3300006844 | Bacteria | 9482 |
| 409 | Ga0075428_100013313 | 3300006844 | Bacteria | 9151 |
| 410 | Ga0075428_100019629 | 3300006844 | Bacteria | 7479 |
| 411 | Ga0075428_100019983 | 3300006844 | Bacteria | 7417 |
| 412 | Ga0075428_100115633 | 3300006844 | Bacteria | 2922 |
| 413 | Ga0075430_100002494 | 3300006846 | Bacteria | 15338 |
| 414 | Ga0075430_100012275 | 3300006846 | Bacteria | 7290 |
| 415 | Ga0075430_100018473 | 3300006846 | Bacteria | 5933 |
| 416 | Ga0075430_100148725 | 3300006846 | Bacteria | 1950 |
| 417 | Ga0075430_100180082 | 3300006846 | Bacteria | 1758 |
| 418 | Ga0075430_100315010 | 3300006846 | Bacteria | 1294 |
| 419 | Ga0075430_100332803 | 3300006846 | Bacteria | 1255 |
| 420 | Ga0075430_100433765 | 3300006846 | Bacteria | 1084 |
| 421 | Ga0075431_100000992 | 3300006847 | Bacteria | 25307 |
| 422 | Ga0075431_100021306 | 3300006847 | Bacteria | 6625 |
| 423 | Ga0075431_100042431 | 3300006847 | Bacteria | 4692 |
| 424 | Ga0075431_100043121 | 3300006847 | Bacteria | 4655 |
| 425 | Ga0075431_100098948 | 3300006847 | Bacteria | 3010 |
| 426 | Ga0075431_100101385 | 3300006847 | Bacteria | 2970 |
| 427 | Ga0075431_100125262 | 3300006847 | Bacteria | 2651 |
| 428 | Ga0075431_100128352 | 3300006847 | Bacteria | 2616 |
| 429 | Ga0075431_100523932 | 3300006847 | Bacteria | 1174 |
| 430 | Ga0075433_10009350 | 3300006852 | Bacteria | 7837 |
| 431 | Ga0075433_10017867 | 3300006852 | Bacteria | 5885 |
| 432 | Ga0075433_10145124 | 3300006852 | Bacteria | 2110 |
| 433 | Ga0075433_10310431 | 3300006852 | Bacteria | 1396 |
| 434 | Ga0075433_10406665 | 3300006852 | Bacteria | 1201 |
| 435 | Ga0075434_100000358 | 3300006871 | Bacteria | 33110 |
| 436 | Ga0075434_100125348 | 3300006871 | Bacteria | 2585 |
| 437 | Ga0075429_100000646 | 3300006880 | Bacteria | 26951 |
| 438 | Ga0075429_100010240 | 3300006880 | Bacteria | 8117 |
| 439 | Ga0075429_100041093 | 3300006880 | Bacteria | 4027 |
| 440 | Ga0075429_100041561 | 3300006880 | Bacteria | 4004 |
| 441 | Ga0075429_100208170 | 3300006880 | Bacteria | 1713 |
| 442 | Ga0068865_100001823 | 3300006881 | Bacteria | 12517 |
| 443 | Ga0068865_100006486 | 3300006881 | Bacteria | 7142 |
| 444 | Ga0068865_100049038 | 3300006881 | Bacteria | 2908 |
| 445 | Ga0068865_100101036 | 3300006881 | Bacteria | 2112 |
| 446 | Ga0068865_100150787 | 3300006881 | Bacteria | 1763 |
| 447 | Ga0068865_100330874 | 3300006881 | Bacteria | 1228 |
| 448 | Ga0075436_100117052 | 3300006914 | Bacteria | 1863 |
| 449 | Ga0075436_100264469 | 3300006914 | Bacteria | 1227 |
| 450 | Ga0097620_100003775 | 3300006931 | Bacteria | 15454 |
| 451 | Ga0097620_100009496 | 3300006931 | Bacteria | 9823 |
| 452 | Ga0097620_100023708 | 3300006931 | Bacteria | 6159 |
| 453 | Ga0097620_100077708 | 3300006931 | Bacteria | 3360 |
| 454 | Ga0097620_100120210 | 3300006931 | Bacteria | 2693 |
| 455 | Ga0097620_100168761 | 3300006931 | Bacteria | 2269 |
| 456 | Ga0097620_100271907 | 3300006931 | Bacteria | 1787 |
| 457 | Ga0099826_10000014 | 3300006948 | Bacteria | 258520 |
| 458 | Ga0075435_100024948 | 3300007076 | Bacteria | 4648 |
| 459 | Ga0075435_100167129 | 3300007076 | Bacteria | 1855 |
| 460 | Ga0099794_10019591 | 3300007265 | Bacteria | 3052 |
| 461 | Ga0099794_10033455 | 3300007265 | Bacteria | 2417 |
| 462 | Ga0099794_10093686 | 3300007265 | Bacteria | 1493 |
| 463 | Ga0105251_10016322 | 3300009011 | Bacteria | 4017 |
| 464 | Ga0105251_10049227 | 3300009011 | Bacteria | 2018 |
| 465 | Ga0105244_10000480 | 3300009036 | Bacteria | 36191 |
| 466 | Ga0105244_10016069 | 3300009036 | Bacteria | 4275 |
| 467 | Ga0105250_10000021 | 3300009092 | Bacteria | 239960 |
| 468 | Ga0105250_10000023 | 3300009092 | Bacteria | 219389 |
| 469 | Ga0105240_10001345 | 3300009093 | Bacteria | 42171 |
| 470 | Ga0105240_10004508 | 3300009093 | Bacteria | 21175 |
| 471 | Ga0105240_10008645 | 3300009093 | Bacteria | 14548 |
| 472 | Ga0105240_10016284 | 3300009093 | Bacteria | 10071 |
| 473 | Ga0105240_10072048 | 3300009093 | Bacteria | 4271 |
| 474 | Ga0105240_10076281 | 3300009093 | Bacteria | 4133 |
| 475 | Ga0105240_10143498 | 3300009093 | Bacteria | 2852 |
| 476 | Ga0105240_10254013 | 3300009093 | Bacteria | 2031 |
| 477 | Ga0105240_10269139 | 3300009093 | Bacteria | 1963 |
| 478 | Ga0105240_10274055 | 3300009093 | Bacteria | 1941 |
| 479 | Ga0105240_10316293 | 3300009093 | Bacteria | 1781 |
| 480 | Ga0111539_10012428 | 3300009094 | Bacteria | 10676 |
| 481 | Ga0111539_10023233 | 3300009094 | Bacteria | 7617 |
| 482 | Ga0111539_10023375 | 3300009094 | Bacteria | 7593 |
| 483 | Ga0111539_10030460 | 3300009094 | Bacteria | 6558 |
| 484 | Ga0111539_10059404 | 3300009094 | Bacteria | 4534 |
| 485 | Ga0111539_10071890 | 3300009094 | Bacteria | 4081 |
| 486 | Ga0111539_10073043 | 3300009094 | Bacteria | 4044 |
| 487 | Ga0111539_10081579 | 3300009094 | Bacteria | 3804 |
| 488 | Ga0111539_10115901 | 3300009094 | Bacteria | 3141 |
| 489 | Ga0111539_10154829 | 3300009094 | Bacteria | 2682 |
| 490 | Ga0111539_10170118 | 3300009094 | Bacteria | 2546 |
| 491 | Ga0105245_10010418 | 3300009098 | Bacteria | 8096 |
| 492 | Ga0105245_10053253 | 3300009098 | Bacteria | 3632 |
| 493 | Ga0105245_10068994 | 3300009098 | Bacteria | 3205 |
| 494 | Ga0105247_10000613 | 3300009101 | Bacteria | 28740 |
| 495 | Ga0105247_10008368 | 3300009101 | Bacteria | 6307 |
| 496 | Ga0105247_10047507 | 3300009101 | Bacteria | 2636 |
| 497 | Ga0114129_10000246 | 3300009147 | Bacteria | 60999 |
| 498 | Ga0114129_10089197 | 3300009147 | Bacteria | 4275 |
| 499 | Ga0114129_10110589 | 3300009147 | Bacteria | 3792 |
| 500 | Ga0114129_10137685 | 3300009147 | Bacteria | 3349 |
| 501 | Ga0114129_10164161 | 3300009147 | Bacteria | 3032 |
| 502 | Ga0114129_10466527 | 3300009147 | Bacteria | 1654 |
| 503 | Ga0105243_10126161 | 3300009148 | Bacteria | 2165 |
| 504 | Ga0105243_10136173 | 3300009148 | Bacteria | 2090 |
| 505 | Ga0105243_10166897 | 3300009148 | Bacteria | 1903 |
| 506 | Ga0105243_10199049 | 3300009148 | Bacteria | 1755 |
| 507 | Ga0105241_10043275 | 3300009174 | Bacteria | 3410 |
| 508 | Ga0105241_10088500 | 3300009174 | Bacteria | 2438 |
| 509 | Ga0105241_10090077 | 3300009174 | Bacteria | 2418 |
| 510 | Ga0105241_10103482 | 3300009174 | Bacteria | 2267 |
| 511 | Ga0105242_10000991 | 3300009176 | Bacteria | 22219 |
| 512 | Ga0105242_10007522 | 3300009176 | Bacteria | 8382 |
| 513 | Ga0105242_10040873 | 3300009176 | Bacteria | 3737 |
| 514 | Ga0105248_10023598 | 3300009177 | Bacteria | 6833 |
| 515 | Ga0105248_10131071 | 3300009177 | Bacteria | 2829 |
| 516 | Ga0105248_10177228 | 3300009177 | Bacteria | 2402 |
| 517 | Ga0105248_10227184 | 3300009177 | Bacteria | 2101 |
| 518 | Ga0105248_10241296 | 3300009177 | Bacteria | 2034 |
| 519 | Ga0105237_10075394 | 3300009545 | Bacteria | 3365 |
| 520 | Ga0105237_10100737 | 3300009545 | Bacteria | 2880 |
| 521 | Ga0105237_10184415 | 3300009545 | Bacteria | 2087 |
| 522 | Ga0105237_10238664 | 3300009545 | Bacteria | 1819 |
| 523 | Ga0105237_10274841 | 3300009545 | Bacteria | 1687 |
| 524 | Ga0105237_10512246 | 3300009545 | Bacteria | 1206 |
| 525 | Ga0105238_10000155 | 3300009551 | Bacteria | 74637 |
| 526 | Ga0105238_10034261 | 3300009551 | Bacteria | 5167 |
| 527 | Ga0105238_10144279 | 3300009551 | Bacteria | 2357 |
| 528 | Ga0105238_10187472 | 3300009551 | Bacteria | 2045 |
| 529 | Ga0105238_10196176 | 3300009551 | Bacteria | 1995 |
| 530 | Ga0105238_10274929 | 3300009551 | Bacteria | 1665 |
| 531 | Ga0105238_10504531 | 3300009551 | Bacteria | 1211 |
| 532 | Ga0105249_10002480 | 3300009553 | Bacteria | 15981 |
| 533 | Ga0105249_10008606 | 3300009553 | Bacteria | 8894 |
| 534 | Ga0105249_10008927 | 3300009553 | Bacteria | 8756 |
| 535 | Ga0105239_10044029 | 3300010375 | Bacteria | 4894 |
| 536 | Ga0105239_10044801 | 3300010375 | Bacteria | 4849 |
| 537 | Ga0105239_10091472 | 3300010375 | Bacteria | 3357 |
| 538 | Ga0105239_10406084 | 3300010375 | Bacteria | 1542 |
| 539 | Ga0105246_10379433 | 3300011119 | Bacteria | 1168 |
| 540 | Ga0157373_10036577 | 3300013100 | Bacteria | 3522 |
| 541 | Ga0157373_10226157 | 3300013100 | Bacteria | 1320 |
| 542 | Ga0157370_10000459 | 3300013104 | Bacteria | 51005 |
| 543 | Ga0157370_10014928 | 3300013104 | Bacteria | 7922 |
| 544 | Ga0157370_10087259 | 3300013104 | Bacteria | 2931 |
| 545 | Ga0157370_10108624 | 3300013104 | Bacteria | 2594 |
| 546 | Ga0157369_10004509 | 3300013105 | Bacteria | 16394 |
| 547 | Ga0157369_10097160 | 3300013105 | Bacteria | 3142 |
| 548 | Ga0157369_10111504 | 3300013105 | Bacteria | 2907 |
| 549 | Ga0157369_10173360 | 3300013105 | Bacteria | 2272 |
| 550 | Ga0157369_10541853 | 3300013105 | Bacteria | 1203 |
| 551 | Ga0157374_10000173 | 3300013296 | Bacteria | 59752 |
| 552 | Ga0157374_10002787 | 3300013296 | Bacteria | 14681 |
| 553 | Ga0157374_10089052 | 3300013296 | Bacteria | 2940 |
| 554 | Ga0157374_10152622 | 3300013296 | Bacteria | 2246 |
| 555 | Ga0157378_10001843 | 3300013297 | Bacteria | 19029 |
| 556 | Ga0157378_10014679 | 3300013297 | Bacteria | 6862 |
| 557 | Ga0157378_10021870 | 3300013297 | Bacteria | 5624 |
| 558 | Ga0157378_10044427 | 3300013297 | Bacteria | 3946 |
| 559 | Ga0157378_10094127 | 3300013297 | Bacteria | 2728 |
| 560 | Ga0157378_10095848 | 3300013297 | Bacteria | 2703 |
| 561 | Ga0157378_10099426 | 3300013297 | Bacteria | 2654 |
| 562 | Ga0157378_10145822 | 3300013297 | Bacteria | 2202 |
| 563 | Ga0157378_10214315 | 3300013297 | Bacteria | 1827 |
| 564 | Ga0163162_10023826 | 3300013306 | Bacteria | 6041 |
| 565 | Ga0163162_10069959 | 3300013306 | Bacteria | 3561 |
| 566 | Ga0163162_10107599 | 3300013306 | Bacteria | 2884 |
| 567 | Ga0163162_10179065 | 3300013306 | Bacteria | 2246 |
| 568 | Ga0163162_10211385 | 3300013306 | Bacteria | 2070 |
| 569 | Ga0163162_10230726 | 3300013306 | Bacteria | 1981 |
| 570 | Ga0163162_10336618 | 3300013306 | Bacteria | 1642 |
| 571 | Ga0163162_10361935 | 3300013306 | Bacteria | 1584 |
| 572 | Ga0163162_10437256 | 3300013306 | Bacteria | 1440 |
| 573 | Ga0157372_10402653 | 3300013307 | Bacteria | 1595 |
| 574 | Ga0157372_10554451 | 3300013307 | Bacteria | 1340 |
| 575 | Ga0157375_10005969 | 3300013308 | Bacteria | 10621 |
| 576 | Ga0157375_10034170 | 3300013308 | Bacteria | 4841 |
| 577 | Ga0157375_10070454 | 3300013308 | Bacteria | 3506 |
| 578 | Ga0157375_10074486 | 3300013308 | Bacteria | 3416 |
| 579 | Ga0157375_10150513 | 3300013308 | Bacteria | 2462 |
| 580 | Ga0157375_10425051 | 3300013308 | Bacteria | 1495 |
| 581 | Ga0157375_10441387 | 3300013308 | Bacteria | 1467 |
| 582 | Ga0157375_10489370 | 3300013308 | Bacteria | 1395 |
| 583 | Ga0157375_10497835 | 3300013308 | Bacteria | 1383 |
| 584 | Ga0157375_10582767 | 3300013308 | Bacteria | 1279 |
| 585 | Ga0157375_10612726 | 3300013308 | Bacteria | 1247 |
| 586 | Ga0157375_10667433 | 3300013308 | Bacteria | 1195 |
| 587 | Ga0163163_10001413 | 3300014325 | Bacteria | 20296 |
| 588 | Ga0163163_10005314 | 3300014325 | Bacteria | 11120 |
| 589 | Ga0163163_10015469 | 3300014325 | Bacteria | 7053 |
| 590 | Ga0163163_10019986 | 3300014325 | Bacteria | 6300 |
| 591 | Ga0163163_10021863 | 3300014325 | Bacteria | 6045 |
| 592 | Ga0163163_10059902 | 3300014325 | Bacteria | 3768 |
| 593 | Ga0163163_10348635 | 3300014325 | Bacteria | 1536 |
| 594 | Ga0163163_10365138 | 3300014325 | Bacteria | 1500 |
| 595 | Ga0163163_10603203 | 3300014325 | Bacteria | 1161 |
| 596 | Ga0157380_10000523 | 3300014326 | Bacteria | 23586 |
| 597 | Ga0157380_10001490 | 3300014326 | Bacteria | 15328 |
| 598 | Ga0157380_10014833 | 3300014326 | Bacteria | 5709 |
| 599 | Ga0157380_10033583 | 3300014326 | Bacteria | 3952 |
| 600 | Ga0157380_10114009 | 3300014326 | Bacteria | 2277 |
| 601 | Ga0157380_10262497 | 3300014326 | Bacteria | 1569 |
| 602 | Ga0182008_10002199 | 3300014497 | Bacteria | 12381 |
| 603 | Ga0157377_10061290 | 3300014745 | Bacteria | 2150 |
| 604 | Ga0157377_10076224 | 3300014745 | Bacteria | 1950 |
| 605 | Ga0157379_10000241 | 3300014968 | Bacteria | 42825 |
| 606 | Ga0157379_10020413 | 3300014968 | Bacteria | 5857 |
| 607 | Ga0157379_10023113 | 3300014968 | Bacteria | 5513 |
| 608 | Ga0157379_10024272 | 3300014968 | Bacteria | 5383 |
| 609 | Ga0157379_10033388 | 3300014968 | Bacteria | 4589 |
| 610 | Ga0157379_10097250 | 3300014968 | Bacteria | 2643 |
| 611 | Ga0157376_10065831 | 3300014969 | Bacteria | 3062 |
| 612 | Ga0157376_10231633 | 3300014969 | Bacteria | 1716 |
| 613 | Ga0157376_10252551 | 3300014969 | Bacteria | 1648 |
| 614 | Ga0157376_10275270 | 3300014969 | Bacteria | 1583 |
| 615 | Ga0157376_10276692 | 3300014969 | Unclassified | 1579 |
| 616 | Ga0182006_1000014 | 3300015261 | Bacteria | 340159 |
| 617 | Ga0182006_1001667 | 3300015261 | Bacteria | 13062 |
| 618 | Ga0182006_1003394 | 3300015261 | Bacteria | 8158 |
| 619 | Ga0182006_1011676 | 3300015261 | Bacteria | 3860 |
| 620 | Ga0182007_10000011 | 3300015262 | Bacteria | 264045 |
| 621 | Ga0182007_10000938 | 3300015262 | Bacteria | 16060 |
| 622 | Ga0182007_10028723 | 3300015262 | Bacteria | 1909 |
| 623 | Ga0182005_1000014 | 3300015265 | Bacteria | 389763 |
| 624 | Ga0182005_1000052 | 3300015265 | Bacteria | 113532 |
| 625 | Ga0182005_1002111 | 3300015265 | Bacteria | 7388 |
| 626 | Ga0163161_10011439 | 3300017792 | Bacteria | 6156 |
| 627 | Ga0163161_10045423 | 3300017792 | Bacteria | 3168 |
| 628 | Ga0163161_10048220 | 3300017792 | Bacteria | 3076 |
| 629 | Ga0163161_10059877 | 3300017792 | Bacteria | 2770 |
| 630 | Ga0163161_10081193 | 3300017792 | Bacteria | 2387 |
| 631 | Ga0163161_10084995 | 3300017792 | Bacteria | 2334 |
| 632 | Ga0163161_10220170 | 3300017792 | Bacteria | 1470 |
| 633 | Ga0206353_12058834 | 3300020082 | Bacteria | 2286 |
| 634 | Ga0213872_10000002 | 3300021361 | Bacteria | 554092 |
| 635 | Ga0213872_10000305 | 3300021361 | Bacteria | 41889 |
| 636 | Ga0213872_10002860 | 3300021361 | Bacteria | 9864 |
| 637 | Ga0213872_10003308 | 3300021361 | Bacteria | 8984 |
| 638 | Ga0213872_10003721 | 3300021361 | Bacteria | 8340 |
| 639 | Ga0213872_10006075 | 3300021361 | Bacteria | 6107 |
| 640 | Ga0213872_10011337 | 3300021361 | Bacteria | 4218 |
| 641 | Ga0213872_10022038 | 3300021361 | Bacteria | 2934 |
| 642 | Ga0213872_10058781 | 3300021361 | Bacteria | 1740 |
| 643 | Ga0213874_10017033 | 3300021377 | Bacteria | 1943 |
| 644 | Ga0213874_10024331 | 3300021377 | Bacteria | 1697 |
| 645 | Ga0213876_10034937 | 3300021384 | Bacteria | 2652 |
| 646 | Ga0209435_100004 | 3300025206 | Bacteria | 633417 |
| 647 | Ga0209435_100156 | 3300025206 | Bacteria | 22357 |
| 648 | Ga0209760_101646 | 3300025207 | Bacteria | 2280 |
| 649 | Ga0209784_100005 | 3300025224 | Bacteria | 1040422 |
| 650 | Ga0209784_100020 | 3300025224 | Bacteria | 412353 |
| 651 | Ga0209566_100005 | 3300025225 | Bacteria | 1040422 |
| 652 | Ga0209566_100020 | 3300025225 | Bacteria | 412353 |
| 653 | Ga0209674_100009 | 3300025226 | Bacteria | 1040422 |
| 654 | Ga0209674_100035 | 3300025226 | Bacteria | 412353 |
| 655 | Ga0209147_100011 | 3300025229 | Bacteria | 702140 |
| 656 | Ga0209563_100012 | 3300025230 | Bacteria | 1040422 |
| 657 | Ga0209563_100038 | 3300025230 | Bacteria | 412353 |
| 658 | Ga0209437_100066 | 3300025233 | Bacteria | 327883 |
| 659 | Ga0209437_100084 | 3300025233 | Bacteria | 255423 |
| 660 | Ga0209258_100264 | 3300025242 | Bacteria | 90298 |
| 661 | Ga0209646_1000032 | 3300025246 | Bacteria | 375315 |
| 662 | Ga0209646_1000047 | 3300025246 | Bacteria | 323416 |
| 663 | Ga0209646_1000052 | 3300025246 | Bacteria | 286370 |
| 664 | Ga0209026_1000062 | 3300025250 | Bacteria | 213298 |
| 665 | Ga0209026_1002562 | 3300025250 | Bacteria | 6701 |
| 666 | Ga0209026_1004402 | 3300025250 | Bacteria | 4188 |
| 667 | Ga0209677_100006 | 3300025253 | Bacteria | 1040422 |
| 668 | Ga0209677_100031 | 3300025253 | Bacteria | 329719 |
| 669 | Ga0209759_1000054 | 3300025256 | Bacteria | 211422 |
| 670 | Ga0209759_1000514 | 3300025256 | Bacteria | 41893 |
| 671 | Ga0209233_1000060 | 3300025261 | Bacteria | 412379 |
| 672 | Ga0209565_1000006 | 3300025263 | Bacteria | 897294 |
| 673 | Ga0209455_1017960 | 3300025272 | Bacteria | 1466 |
| 674 | Ga0209673_1000004 | 3300025273 | Bacteria | 896155 |
| 675 | Ga0209130_1000065 | 3300025284 | Bacteria | 195251 |
| 676 | Ga0209675_1000006 | 3300025291 | Bacteria | 732267 |
| 677 | Ga0209025_1000554 | 3300025294 | Bacteria | 69453 |
| 678 | Ga0209025_1004464 | 3300025294 | Bacteria | 12151 |
| 679 | Ga0209025_1005334 | 3300025294 | Bacteria | 10549 |
| 680 | Ga0209564_1000006 | 3300025295 | Bacteria | 1100927 |
| 681 | Ga0209564_1000064 | 3300025295 | Bacteria | 316431 |
| 682 | Ga0209564_1000107 | 3300025295 | Bacteria | 214040 |
| 683 | Ga0209256_1000179 | 3300025299 | Bacteria | 123865 |
| 684 | Ga0209256_1000340 | 3300025299 | Bacteria | 76961 |
| 685 | Ga0209051_1002451 | 3300025303 | Bacteria | 13288 |
| 686 | Ga0207697_10007354 | 3300025315 | Bacteria | 4920 |
| 687 | Ga0207656_10046611 | 3300025321 | Bacteria | 1860 |
| 688 | Ga0207656_10081110 | 3300025321 | Bacteria | 1458 |
| 689 | Ga0207696_1000503 | 3300025711 | Bacteria | 32694 |
| 690 | Ga0207655_1020727 | 3300025728 | Bacteria | 3366 |
| 691 | Ga0207653_10062323 | 3300025885 | Bacteria | 1260 |
| 692 | Ga0207682_10009949 | 3300025893 | Bacteria | 3736 |
| 693 | Ga0207682_10020031 | 3300025893 | Bacteria | 2623 |
| 694 | Ga0207682_10050173 | 3300025893 | Bacteria | 1725 |
| 695 | Ga0207692_10029108 | 3300025898 | Bacteria | 2621 |
| 696 | Ga0207692_10083281 | 3300025898 | Bacteria | 1716 |
| 697 | Ga0207642_10011043 | 3300025899 | Bacteria | 3207 |
| 698 | Ga0207642_10104328 | 3300025899 | Bacteria | 1430 |
| 699 | Ga0207710_10006077 | 3300025900 | Bacteria | 5174 |
| 700 | Ga0207710_10023194 | 3300025900 | Bacteria | 2666 |
| 701 | Ga0207688_10051364 | 3300025901 | Bacteria | 2309 |
| 702 | Ga0207688_10087835 | 3300025901 | Bacteria | 1782 |
| 703 | Ga0207680_10005870 | 3300025903 | Bacteria | 5893 |
| 704 | Ga0207680_10056596 | 3300025903 | Bacteria | 2369 |
| 705 | Ga0207680_10092999 | 3300025903 | Bacteria | 1922 |
| 706 | Ga0207680_10190489 | 3300025903 | Bacteria | 1392 |
| 707 | Ga0207685_10041984 | 3300025905 | Bacteria | 1715 |
| 708 | Ga0207699_10021017 | 3300025906 | Bacteria | 3510 |
| 709 | Ga0207645_10014503 | 3300025907 | Bacteria | 5272 |
| 710 | Ga0207645_10029729 | 3300025907 | Bacteria | 3522 |
| 711 | Ga0207645_10046562 | 3300025907 | Bacteria | 2770 |
| 712 | Ga0207643_10005861 | 3300025908 | Bacteria | 6563 |
| 713 | Ga0207643_10031159 | 3300025908 | Bacteria | 2971 |
| 714 | Ga0207643_10071090 | 3300025908 | Bacteria | 2003 |
| 715 | Ga0207684_10163867 | 3300025910 | Bacteria | 1915 |
| 716 | Ga0207654_10044196 | 3300025911 | Bacteria | 2529 |
| 717 | Ga0207654_10232776 | 3300025911 | Bacteria | 1228 |
| 718 | Ga0207707_10000751 | 3300025912 | Bacteria | 31949 |
| 719 | Ga0207707_10003844 | 3300025912 | Bacteria | 13308 |
| 720 | Ga0207707_10015871 | 3300025912 | Bacteria | 6569 |
| 721 | Ga0207707_10028726 | 3300025912 | Bacteria | 4859 |
| 722 | Ga0207707_10036263 | 3300025912 | Bacteria | 4313 |
| 723 | Ga0207707_10065401 | 3300025912 | Bacteria | 3168 |
| 724 | Ga0207707_10090683 | 3300025912 | Bacteria | 2671 |
| 725 | Ga0207707_10337987 | 3300025912 | Bacteria | 1299 |
| 726 | Ga0207695_10002162 | 3300025913 | Bacteria | 29707 |
| 727 | Ga0207695_10003096 | 3300025913 | Bacteria | 23815 |
| 728 | Ga0207695_10008191 | 3300025913 | Bacteria | 13131 |
| 729 | Ga0207695_10034230 | 3300025913 | Bacteria | 5529 |
| 730 | Ga0207695_10039353 | 3300025913 | Bacteria | 5082 |
| 731 | Ga0207695_10041549 | 3300025913 | Bacteria | 4921 |
| 732 | Ga0207695_10055225 | 3300025913 | Bacteria | 4140 |
| 733 | Ga0207695_10074319 | 3300025913 | Bacteria | 3460 |
| 734 | Ga0207695_10075211 | 3300025913 | Bacteria | 3437 |
| 735 | Ga0207695_10205611 | 3300025913 | Bacteria | 1882 |
| 736 | Ga0207671_10060503 | 3300025914 | Bacteria | 2810 |
| 737 | Ga0207671_10109642 | 3300025914 | Bacteria | 2099 |
| 738 | Ga0207671_10362450 | 3300025914 | Bacteria | 1150 |
| 739 | Ga0207693_10000007 | 3300025915 | Bacteria | 173735 |
| 740 | Ga0207693_10059777 | 3300025915 | Bacteria | 2985 |
| 741 | Ga0207693_10098082 | 3300025915 | Bacteria | 2298 |
| 742 | Ga0207663_10012439 | 3300025916 | Bacteria | 4602 |
| 743 | Ga0207663_10185948 | 3300025916 | Bacteria | 1487 |
| 744 | Ga0207660_10006464 | 3300025917 | Bacteria | 7599 |
| 745 | Ga0207660_10027511 | 3300025917 | Bacteria | 3882 |
| 746 | Ga0207660_10145099 | 3300025917 | Bacteria | 1818 |
| 747 | Ga0207662_10000269 | 3300025918 | Bacteria | 23948 |
| 748 | Ga0207662_10163984 | 3300025918 | Bacteria | 1421 |
| 749 | Ga0207657_10002609 | 3300025919 | Bacteria | 19479 |
| 750 | Ga0207657_10004204 | 3300025919 | Bacteria | 15251 |
| 751 | Ga0207657_10156509 | 3300025919 | Bacteria | 1853 |
| 752 | Ga0207649_10003420 | 3300025920 | Bacteria | 8681 |
| 753 | Ga0207649_10011243 | 3300025920 | Bacteria | 4931 |
| 754 | Ga0207649_10014718 | 3300025920 | Bacteria | 4386 |
| 755 | Ga0207649_10021407 | 3300025920 | Bacteria | 3722 |
| 756 | Ga0207649_10322809 | 3300025920 | Bacteria | 1135 |
| 757 | Ga0207652_10002171 | 3300025921 | Bacteria | 16778 |
| 758 | Ga0207652_10018733 | 3300025921 | Bacteria | 5681 |
| 759 | Ga0207652_10079629 | 3300025921 | Bacteria | 2863 |
| 760 | Ga0207652_10110015 | 3300025921 | Bacteria | 2443 |
| 761 | Ga0207652_10119674 | 3300025921 | Bacteria | 2342 |
| 762 | Ga0207646_10004092 | 3300025922 | Bacteria | 16064 |
| 763 | Ga0207681_10002856 | 3300025923 | Bacteria | 10912 |
| 764 | Ga0207681_10003441 | 3300025923 | Bacteria | 9881 |
| 765 | Ga0207681_10045535 | 3300025923 | Bacteria | 2946 |
| 766 | Ga0207681_10108219 | 3300025923 | Bacteria | 2017 |
| 767 | Ga0207681_10113427 | 3300025923 | Bacteria | 1976 |
| 768 | Ga0207694_10000625 | 3300025924 | Bacteria | 32139 |
| 769 | Ga0207694_10037116 | 3300025924 | Bacteria | 3740 |
| 770 | Ga0207694_10060517 | 3300025924 | Bacteria | 2947 |
| 771 | Ga0207694_10120994 | 3300025924 | Bacteria | 2090 |
| 772 | Ga0207694_10239377 | 3300025924 | Bacteria | 1483 |
| 773 | Ga0207694_10333148 | 3300025924 | Bacteria | 1254 |
| 774 | Ga0207650_10002703 | 3300025925 | Bacteria | 12252 |
| 775 | Ga0207650_10017166 | 3300025925 | Bacteria | 5065 |
| 776 | Ga0207650_10021288 | 3300025925 | Bacteria | 4583 |
| 777 | Ga0207650_10027729 | 3300025925 | Bacteria | 4056 |
| 778 | Ga0207650_10041183 | 3300025925 | Bacteria | 3383 |
| 779 | Ga0207650_10129502 | 3300025925 | Bacteria | 1973 |
| 780 | Ga0207650_10449329 | 3300025925 | Bacteria | 1072 |
| 781 | Ga0207659_10003461 | 3300025926 | Bacteria | 9464 |
| 782 | Ga0207659_10009472 | 3300025926 | Bacteria | 6089 |
| 783 | Ga0207659_10010547 | 3300025926 | Bacteria | 5809 |
| 784 | Ga0207659_10015323 | 3300025926 | Bacteria | 4962 |
| 785 | Ga0207659_10015760 | 3300025926 | Bacteria | 4907 |
| 786 | Ga0207659_10037748 | 3300025926 | Bacteria | 3356 |
| 787 | Ga0207659_10071833 | 3300025926 | Bacteria | 2528 |
| 788 | Ga0207687_10005308 | 3300025927 | Bacteria | 8530 |
| 789 | Ga0207687_10007028 | 3300025927 | Bacteria | 7421 |
| 790 | Ga0207700_10000051 | 3300025928 | Bacteria | 77057 |
| 791 | Ga0207700_10031633 | 3300025928 | Bacteria | 3762 |
| 792 | Ga0207700_10052163 | 3300025928 | Bacteria | 3056 |
| 793 | Ga0207700_10223002 | 3300025928 | Bacteria | 1599 |
| 794 | Ga0207664_10422027 | 3300025929 | Bacteria | 1188 |
| 795 | Ga0207644_10000403 | 3300025931 | Bacteria | 28161 |
| 796 | Ga0207644_10000800 | 3300025931 | Bacteria | 19939 |
| 797 | Ga0207644_10056591 | 3300025931 | Bacteria | 2830 |
| 798 | Ga0207644_10067626 | 3300025931 | Bacteria | 2604 |
| 799 | Ga0207644_10148933 | 3300025931 | Bacteria | 1809 |
| 800 | Ga0207644_10204609 | 3300025931 | Bacteria | 1558 |
| 801 | Ga0207690_10002750 | 3300025932 | Bacteria | 10627 |
| 802 | Ga0207690_10163528 | 3300025932 | Bacteria | 1661 |
| 803 | Ga0207706_10007576 | 3300025933 | Bacteria | 10041 |
| 804 | Ga0207706_10048180 | 3300025933 | Bacteria | 3769 |
| 805 | Ga0207706_10067627 | 3300025933 | Bacteria | 3143 |
| 806 | Ga0207706_10099134 | 3300025933 | Bacteria | 2563 |
| 807 | Ga0207706_10131311 | 3300025933 | Bacteria | 2203 |
| 808 | Ga0207706_10132692 | 3300025933 | Bacteria | 2191 |
| 809 | Ga0207706_10211941 | 3300025933 | Bacteria | 1698 |
| 810 | Ga0207706_10360504 | 3300025933 | Bacteria | 1263 |
| 811 | Ga0207686_10011209 | 3300025934 | Bacteria | 4902 |
| 812 | Ga0207686_10016593 | 3300025934 | Bacteria | 4134 |
| 813 | Ga0207709_10030619 | 3300025935 | Bacteria | 3132 |
| 814 | Ga0207709_10115637 | 3300025935 | Bacteria | 1802 |
| 815 | Ga0207709_10294419 | 3300025935 | Bacteria | 1204 |
| 816 | Ga0207670_10002723 | 3300025936 | Bacteria | 9298 |
| 817 | Ga0207670_10004796 | 3300025936 | Bacteria | 7339 |
| 818 | Ga0207670_10070289 | 3300025936 | Bacteria | 2417 |
| 819 | Ga0207670_10081959 | 3300025936 | Bacteria | 2260 |
| 820 | Ga0207670_10110878 | 3300025936 | Bacteria | 1977 |
| 821 | Ga0207670_10111361 | 3300025936 | Bacteria | 1973 |
| 822 | Ga0207670_10128428 | 3300025936 | Bacteria | 1853 |
| 823 | Ga0207669_10019154 | 3300025937 | Bacteria | 3557 |
| 824 | Ga0207669_10146898 | 3300025937 | Bacteria | 1645 |
| 825 | Ga0207669_10149897 | 3300025937 | Bacteria | 1632 |
| 826 | Ga0207669_10172080 | 3300025937 | Bacteria | 1542 |
| 827 | Ga0207704_10052197 | 3300025938 | Bacteria | 2477 |
| 828 | Ga0207704_10058256 | 3300025938 | Bacteria | 2377 |
| 829 | Ga0207704_10065397 | 3300025938 | Bacteria | 2276 |
| 830 | Ga0207704_10080385 | 3300025938 | Bacteria | 2104 |
| 831 | Ga0207704_10120645 | 3300025938 | Bacteria | 1793 |
| 832 | Ga0207704_10188024 | 3300025938 | Bacteria | 1499 |
| 833 | Ga0207665_10006297 | 3300025939 | Bacteria | 7871 |
| 834 | Ga0207665_10020217 | 3300025939 | Bacteria | 4374 |
| 835 | Ga0207665_10027185 | 3300025939 | Bacteria | 3780 |
| 836 | Ga0207665_10050866 | 3300025939 | Bacteria | 2788 |
| 837 | Ga0207691_10001621 | 3300025940 | Bacteria | 22347 |
| 838 | Ga0207691_10002348 | 3300025940 | Bacteria | 18524 |
| 839 | Ga0207691_10002646 | 3300025940 | Bacteria | 17500 |
| 840 | Ga0207691_10008772 | 3300025940 | Bacteria | 9701 |
| 841 | Ga0207691_10009236 | 3300025940 | Bacteria | 9461 |
| 842 | Ga0207691_10027590 | 3300025940 | Bacteria | 5323 |
| 843 | Ga0207691_10059569 | 3300025940 | Bacteria | 3471 |
| 844 | Ga0207691_10139948 | 3300025940 | Bacteria | 2133 |
| 845 | Ga0207691_10504776 | 3300025940 | Bacteria | 1027 |
| 846 | Ga0207711_10021913 | 3300025941 | Bacteria | 5338 |
| 847 | Ga0207711_10145710 | 3300025941 | Bacteria | 2133 |
| 848 | Ga0207711_10158101 | 3300025941 | Bacteria | 2050 |
| 849 | Ga0207711_10642058 | 3300025941 | Bacteria | 990 |
| 850 | Ga0207689_10000310 | 3300025942 | Bacteria | 44928 |
| 851 | Ga0207689_10012716 | 3300025942 | Bacteria | 7190 |
| 852 | Ga0207689_10022140 | 3300025942 | Bacteria | 5344 |
| 853 | Ga0207689_10064597 | 3300025942 | Bacteria | 3011 |
| 854 | Ga0207689_10204123 | 3300025942 | Bacteria | 1632 |
| 855 | Ga0207661_10004522 | 3300025944 | Bacteria | 9751 |
| 856 | Ga0207661_10022639 | 3300025944 | Bacteria | 4737 |
| 857 | Ga0207661_10128755 | 3300025944 | Bacteria | 2165 |
| 858 | Ga0207679_10002358 | 3300025945 | Bacteria | 11620 |
| 859 | Ga0207679_10003296 | 3300025945 | Bacteria | 9962 |
| 860 | Ga0207679_10007770 | 3300025945 | Bacteria | 6815 |
| 861 | Ga0207679_10018376 | 3300025945 | Bacteria | 4683 |
| 862 | Ga0207679_10140289 | 3300025945 | Bacteria | 1953 |
| 863 | Ga0207679_10160835 | 3300025945 | Bacteria | 1838 |
| 864 | Ga0207679_10575924 | 3300025945 | Bacteria | 1012 |
| 865 | Ga0207667_10000019 | 3300025949 | Bacteria | 386233 |
| 866 | Ga0207667_10000637 | 3300025949 | Bacteria | 45399 |
| 867 | Ga0207667_10004938 | 3300025949 | Bacteria | 16285 |
| 868 | Ga0207667_10007781 | 3300025949 | Bacteria | 12814 |
| 869 | Ga0207667_10012690 | 3300025949 | Bacteria | 9683 |
| 870 | Ga0207667_10035515 | 3300025949 | Bacteria | 5347 |
| 871 | Ga0207667_10151395 | 3300025949 | Bacteria | 2387 |
| 872 | Ga0207667_10615245 | 3300025949 | Bacteria | 1094 |
| 873 | Ga0207651_10008002 | 3300025960 | Bacteria | 5675 |
| 874 | Ga0207651_10037092 | 3300025960 | Bacteria | 3190 |
| 875 | Ga0207651_10092708 | 3300025960 | Bacteria | 2216 |
| 876 | Ga0207651_10136389 | 3300025960 | Bacteria | 1888 |
| 877 | Ga0207651_10159781 | 3300025960 | Bacteria | 1765 |
| 878 | Ga0207712_10004779 | 3300025961 | Bacteria | 8554 |
| 879 | Ga0207712_10096474 | 3300025961 | Bacteria | 2188 |
| 880 | Ga0207712_10169107 | 3300025961 | Bacteria | 1707 |
| 881 | Ga0207712_10174577 | 3300025961 | Bacteria | 1683 |
| 882 | Ga0207712_10182754 | 3300025961 | Bacteria | 1648 |
| 883 | Ga0207668_10007417 | 3300025972 | Bacteria | 6519 |
| 884 | Ga0207668_10021249 | 3300025972 | Bacteria | 4137 |
| 885 | Ga0207668_10036814 | 3300025972 | Bacteria | 3269 |
| 886 | Ga0207668_10062992 | 3300025972 | Bacteria | 2614 |
| 887 | Ga0207668_10085593 | 3300025972 | Bacteria | 2301 |
| 888 | Ga0207668_10111689 | 3300025972 | Bacteria | 2052 |
| 889 | Ga0207668_10138774 | 3300025972 | Bacteria | 1866 |
| 890 | Ga0207640_10010217 | 3300025981 | Bacteria | 5280 |
| 891 | Ga0207640_10079111 | 3300025981 | Bacteria | 2240 |
| 892 | Ga0207640_10254310 | 3300025981 | Bacteria | 1365 |
| 893 | Ga0207640_10255473 | 3300025981 | Bacteria | 1362 |
| 894 | Ga0207658_10000197 | 3300025986 | Bacteria | 63743 |
| 895 | Ga0207658_10017504 | 3300025986 | Bacteria | 4940 |
| 896 | Ga0207658_10050590 | 3300025986 | Bacteria | 3058 |
| 897 | Ga0207658_10390411 | 3300025986 | Bacteria | 1221 |
| 898 | Ga0207677_10000943 | 3300026023 | Bacteria | 16236 |
| 899 | Ga0207677_10001689 | 3300026023 | Bacteria | 11673 |
| 900 | Ga0207677_10263760 | 3300026023 | Bacteria | 1405 |
| 901 | Ga0207677_10385404 | 3300026023 | Bacteria | 1184 |
| 902 | Ga0207703_10000527 | 3300026035 | Bacteria | 39354 |
| 903 | Ga0207703_10001924 | 3300026035 | Bacteria | 18395 |
| 904 | Ga0207703_10001944 | 3300026035 | Bacteria | 18270 |
| 905 | Ga0207703_10006799 | 3300026035 | Bacteria | 9117 |
| 906 | Ga0207703_10011508 | 3300026035 | Bacteria | 6883 |
| 907 | Ga0207703_10025444 | 3300026035 | Bacteria | 4655 |
| 908 | Ga0207703_10062891 | 3300026035 | Bacteria | 3041 |
| 909 | Ga0207703_10099188 | 3300026035 | Bacteria | 2465 |
| 910 | Ga0207703_10169809 | 3300026035 | Bacteria | 1917 |
| 911 | Ga0207703_10318622 | 3300026035 | Bacteria | 1423 |
| 912 | Ga0207639_10018834 | 3300026041 | Bacteria | 4912 |
| 913 | Ga0207639_10426315 | 3300026041 | Bacteria | 1200 |
| 914 | Ga0207639_10576079 | 3300026041 | Bacteria | 1036 |
| 915 | Ga0207678_10033565 | 3300026067 | Bacteria | 4470 |
| 916 | Ga0207678_10049277 | 3300026067 | Bacteria | 3640 |
| 917 | Ga0207678_10063471 | 3300026067 | Bacteria | 3174 |
| 918 | Ga0207678_10120026 | 3300026067 | Bacteria | 2243 |
| 919 | Ga0207678_10154389 | 3300026067 | Bacteria | 1960 |
| 920 | Ga0207678_10162218 | 3300026067 | Bacteria | 1909 |
| 921 | Ga0207708_10000736 | 3300026075 | Bacteria | 24605 |
| 922 | Ga0207708_10003489 | 3300026075 | Bacteria | 11597 |
| 923 | Ga0207708_10004110 | 3300026075 | Bacteria | 10713 |
| 924 | Ga0207708_10008914 | 3300026075 | Bacteria | 7426 |
| 925 | Ga0207708_10029484 | 3300026075 | Bacteria | 4160 |
| 926 | Ga0207708_10154061 | 3300026075 | Bacteria | 1811 |
| 927 | Ga0207708_10255149 | 3300026075 | Bacteria | 1414 |
| 928 | Ga0207702_10102503 | 3300026078 | Bacteria | 2529 |
| 929 | Ga0207702_10114892 | 3300026078 | Bacteria | 2400 |
| 930 | Ga0207702_10155092 | 3300026078 | Bacteria | 2087 |
| 931 | Ga0207702_10174799 | 3300026078 | Bacteria | 1972 |
| 932 | Ga0207702_10323913 | 3300026078 | Bacteria | 1468 |
| 933 | Ga0207641_10000604 | 3300026088 | Bacteria | 39468 |
| 934 | Ga0207641_10005610 | 3300026088 | Bacteria | 10692 |
| 935 | Ga0207641_10006006 | 3300026088 | Bacteria | 10290 |
| 936 | Ga0207641_10013697 | 3300026088 | Bacteria | 6655 |
| 937 | Ga0207641_10019332 | 3300026088 | Bacteria | 5590 |
| 938 | Ga0207641_10025786 | 3300026088 | Bacteria | 4848 |
| 939 | Ga0207641_10089203 | 3300026088 | Bacteria | 2694 |
| 940 | Ga0207641_10117158 | 3300026088 | Bacteria | 2371 |
| 941 | Ga0207641_10249778 | 3300026088 | Bacteria | 1656 |
| 942 | Ga0207648_10004465 | 3300026089 | Bacteria | 14352 |
| 943 | Ga0207648_10005674 | 3300026089 | Bacteria | 12526 |
| 944 | Ga0207648_10022643 | 3300026089 | Bacteria | 5641 |
| 945 | Ga0207648_10024077 | 3300026089 | Bacteria | 5440 |
| 946 | Ga0207648_10059271 | 3300026089 | Bacteria | 3338 |
| 947 | Ga0207648_10060255 | 3300026089 | Bacteria | 3310 |
| 948 | Ga0207648_10135010 | 3300026089 | Bacteria | 2173 |
| 949 | Ga0207648_10168935 | 3300026089 | Bacteria | 1933 |
| 950 | Ga0207648_10171019 | 3300026089 | Bacteria | 1920 |
| 951 | Ga0207648_10420907 | 3300026089 | Bacteria | 1213 |
| 952 | Ga0207676_10027004 | 3300026095 | Bacteria | 4272 |
| 953 | Ga0207676_10029276 | 3300026095 | Bacteria | 4121 |
| 954 | Ga0207676_10033816 | 3300026095 | Bacteria | 3866 |
| 955 | Ga0207676_10259985 | 3300026095 | Bacteria | 1567 |
| 956 | Ga0207676_10321638 | 3300026095 | Bacteria | 1420 |
| 957 | Ga0207674_10002650 | 3300026116 | Bacteria | 22350 |
| 958 | Ga0207674_10006753 | 3300026116 | Bacteria | 13469 |
| 959 | Ga0207674_10008122 | 3300026116 | Bacteria | 12166 |
| 960 | Ga0207674_10035125 | 3300026116 | Bacteria | 5233 |
| 961 | Ga0207674_10111069 | 3300026116 | Bacteria | 2716 |
| 962 | Ga0207674_10658064 | 3300026116 | Bacteria | 1012 |
| 963 | Ga0207675_100002123 | 3300026118 | Bacteria | 19651 |
| 964 | Ga0207675_100010044 | 3300026118 | Bacteria | 8874 |
| 965 | Ga0207675_100014526 | 3300026118 | Bacteria | 7339 |
| 966 | Ga0207675_100021498 | 3300026118 | Bacteria | 6009 |
| 967 | Ga0207675_100030104 | 3300026118 | Bacteria | 5055 |
| 968 | Ga0207675_100032847 | 3300026118 | Bacteria | 4835 |
| 969 | Ga0207675_100038209 | 3300026118 | Bacteria | 4479 |
| 970 | Ga0207675_100185737 | 3300026118 | Bacteria | 1992 |
| 971 | Ga0207683_10000817 | 3300026121 | Bacteria | 28494 |
| 972 | Ga0207683_10002350 | 3300026121 | Bacteria | 16570 |
| 973 | Ga0207683_10031427 | 3300026121 | Bacteria | 4608 |
| 974 | Ga0207683_10031673 | 3300026121 | Bacteria | 4590 |
| 975 | Ga0207683_10112081 | 3300026121 | Bacteria | 2443 |
| 976 | Ga0207683_10138474 | 3300026121 | Bacteria | 2192 |
| 977 | Ga0207683_10220808 | 3300026121 | Bacteria | 1727 |
| 978 | Ga0207698_10001140 | 3300026142 | Bacteria | 15472 |
| 979 | Ga0207698_10015798 | 3300026142 | Bacteria | 5070 |
| 980 | Ga0207698_10033350 | 3300026142 | Bacteria | 3741 |
| 981 | Ga0207698_10174114 | 3300026142 | Bacteria | 1898 |
| 982 | Ga0209281_1002645 | 3300027111 | Bacteria | 6839 |
| 983 | Ga0209967_1002770 | 3300027364 | Bacteria | 2282 |
| 984 | Ga0209981_1009413 | 3300027378 | Bacteria | 1336 |
| 985 | Ga0209999_1004154 | 3300027543 | Bacteria | 2607 |
| 986 | Ga0209970_1002765 | 3300027614 | Bacteria | 2967 |
| 987 | Ga0210002_1019511 | 3300027617 | Bacteria | 1088 |
| 988 | Ga0209983_1004835 | 3300027665 | Bacteria | 2812 |
| 989 | Ga0209282_1000046 | 3300027666 | Bacteria | 115032 |
| 990 | Ga0209588_1032041 | 3300027671 | Bacteria | 1683 |
| 991 | Ga0209974_10029239 | 3300027876 | Bacteria | 1825 |
| 992 | Ga0207428_10004796 | 3300027907 | Bacteria | 12774 |
| 993 | Ga0207428_10014528 | 3300027907 | Bacteria | 6832 |
| 994 | Ga0207428_10041023 | 3300027907 | Bacteria | 3749 |
| 995 | Ga0207428_10074137 | 3300027907 | Bacteria | 2669 |
| 996 | Ga0268266_10000796 | 3300028379 | Bacteria | 41984 |
| 997 | Ga0268266_10038457 | 3300028379 | Bacteria | 4073 |
| 998 | Ga0268266_10070210 | 3300028379 | Bacteria | 3035 |
| 999 | Ga0268266_10267124 | 3300028379 | Bacteria | 1587 |
| 1000 | Ga0268266_10469587 | 3300028379 | Bacteria | 1198 |
| 1001 | Ga0268265_10000932 | 3300028380 | Bacteria | 27011 |
| 1002 | Ga0268265_10001937 | 3300028380 | Bacteria | 16419 |
| 1003 | Ga0268265_10002340 | 3300028380 | Bacteria | 14383 |
| 1004 | Ga0268265_10006026 | 3300028380 | Bacteria | 8249 |
| 1005 | Ga0268265_10007525 | 3300028380 | Bacteria | 7352 |
| 1006 | Ga0268265_10020235 | 3300028380 | Bacteria | 4643 |
| 1007 | Ga0268265_10079250 | 3300028380 | Bacteria | 2586 |
| 1008 | Ga0268265_10183200 | 3300028380 | Bacteria | 1801 |
| 1009 | Ga0268265_10293712 | 3300028380 | Bacteria | 1460 |
| 1010 | Ga0268264_10000176 | 3300028381 | Bacteria | 136166 |
| 1011 | Ga0268264_10030223 | 3300028381 | Bacteria | 4441 |
| 1012 | Ga0268264_10044621 | 3300028381 | Bacteria | 3677 |
| 1013 | Ga0268264_10128460 | 3300028381 | Bacteria | 2243 |
| 1014 | Ga0265323_10006325 | 3300028653 | Bacteria | 4980 |
| 1015 | Ga0307515_10166593 | 3300028794 | Bacteria | 2218 |
| 1016 | Ga0307515_10243509 | 3300028794 | Bacteria | 1564 |
| 1017 | Ga0265338_10000057 | 3300028800 | Bacteria | 200477 |
| 1018 | Ga0265338_10005002 | 3300028800 | Bacteria | 17529 |
| 1019 | Ga0307511_10003352 | 3300030521 | Bacteria | 16486 |
| 1020 | Ga0316181_1231393 | 3300030744 | Bacteria | 3215 |
| 1021 | Ga0265766_1001995 | 3300030863 | Bacteria | 1095 |
| 1022 | Ga0265330_10000033 | 3300031235 | Bacteria | 126931 |
| 1023 | Ga0265330_10000827 | 3300031235 | Bacteria | 19446 |
| 1024 | Ga0265332_10000001 | 3300031238 | Bacteria | 863783 |
| 1025 | Ga0265332_10000742 | 3300031238 | Bacteria | 20271 |
| 1026 | Ga0265328_10002285 | 3300031239 | Bacteria | 8620 |
| 1027 | Ga0265328_10018006 | 3300031239 | Bacteria | 2730 |
| 1028 | Ga0265325_10017896 | 3300031241 | Bacteria | 3935 |
| 1029 | Ga0265329_10006654 | 3300031242 | Bacteria | 4562 |
| 1030 | Ga0265340_10032736 | 3300031247 | Bacteria | 2594 |
| 1031 | Ga0265331_10001605 | 3300031250 | Bacteria | 16512 |
| 1032 | Ga0265331_10002179 | 3300031250 | Bacteria | 13453 |
| 1033 | Ga0265331_10009384 | 3300031250 | Bacteria | 5493 |
| 1034 | Ga0265327_10000103 | 3300031251 | Bacteria | 185405 |
| 1035 | Ga0265327_10010155 | 3300031251 | Bacteria | 6660 |
| 1036 | Ga0265327_10020157 | 3300031251 | Bacteria | 4072 |
| 1037 | Ga0265327_10124707 | 3300031251 | Bacteria | 1217 |
| 1038 | Ga0265316_10010545 | 3300031344 | Bacteria | 8413 |
| 1039 | Ga0265316_10013150 | 3300031344 | Bacteria | 7373 |
| 1040 | Ga0265316_10030556 | 3300031344 | Bacteria | 4414 |
| 1041 | Ga0265316_10034228 | 3300031344 | Bacteria | 4128 |
| 1042 | Ga0307513_10008177 | 3300031456 | Bacteria | 13419 |
| 1043 | Ga0307513_10014609 | 3300031456 | Bacteria | 9559 |
| 1044 | Ga0307513_10116719 | 3300031456 | Bacteria | 2647 |
| 1045 | Ga0307509_10000021 | 3300031507 | Bacteria | 250589 |
| 1046 | Ga0307408_100000331 | 3300031548 | Bacteria | 45112 |
| 1047 | Ga0307408_100030530 | 3300031548 | Bacteria | 3743 |
| 1048 | Ga0307408_100043547 | 3300031548 | Bacteria | 3194 |
| 1049 | Ga0307408_100045527 | 3300031548 | Bacteria | 3134 |
| 1050 | Ga0307408_100048376 | 3300031548 | Bacteria | 3050 |
| 1051 | Ga0307408_100227248 | 3300031548 | Bacteria | 1526 |
| 1052 | Ga0307408_100346077 | 3300031548 | Bacteria | 1260 |
| 1053 | Ga0316575_10002733 | 3300031665 | Bacteria | 5953 |
| 1054 | Ga0316575_10015078 | 3300031665 | Bacteria | 2911 |
| 1055 | Ga0316575_10025792 | 3300031665 | Bacteria | 2282 |
| 1056 | Ga0316579_10002332 | 3300031691 | Bacteria | 7170 |
| 1057 | Ga0316579_10014957 | 3300031691 | Bacteria | 3363 |
| 1058 | Ga0316579_10053611 | 3300031691 | Bacteria | 1889 |
| 1059 | Ga0316579_10070788 | 3300031691 | Bacteria | 1652 |
| 1060 | Ga0316579_10072978 | 3300031691 | Bacteria | 1628 |
| 1061 | Ga0265314_10000022 | 3300031711 | Bacteria | 297299 |
| 1062 | Ga0265314_10009479 | 3300031711 | Bacteria | 8212 |
| 1063 | Ga0265314_10044351 | 3300031711 | Bacteria | 3153 |
| 1064 | Ga0265314_10158797 | 3300031711 | Bacteria | 1378 |
| 1065 | Ga0316576_10000007 | 3300031727 | Bacteria | 55305 |
| 1066 | Ga0316576_10002013 | 3300031727 | Bacteria | 11385 |
| 1067 | Ga0316576_10014172 | 3300031727 | Bacteria | 5321 |
| 1068 | Ga0316576_10023318 | 3300031727 | Bacteria | 4309 |
| 1069 | Ga0316576_10106015 | 3300031727 | Bacteria | 2104 |
| 1070 | Ga0316576_10115129 | 3300031727 | Bacteria | 2017 |
| 1071 | Ga0316578_10000247 | 3300031728 | Bacteria | 16110 |
| 1072 | Ga0316578_10011051 | 3300031728 | Bacteria | 4706 |
| 1073 | Ga0316578_10029415 | 3300031728 | Bacteria | 3118 |
| 1074 | Ga0316578_10032042 | 3300031728 | Bacteria | 2999 |
| 1075 | Ga0316578_10042096 | 3300031728 | Bacteria | 2647 |
| 1076 | Ga0316578_10080392 | 3300031728 | Bacteria | 1939 |
| 1077 | Ga0307516_10005678 | 3300031730 | Bacteria | 14806 |
| 1078 | Ga0307405_10009974 | 3300031731 | Bacteria | 4898 |
| 1079 | Ga0307405_10047459 | 3300031731 | Bacteria | 2645 |
| 1080 | Ga0307405_10287436 | 3300031731 | Bacteria | 1241 |
| 1081 | Ga0316577_10000060 | 3300031733 | Bacteria | 26325 |
| 1082 | Ga0316577_10002401 | 3300031733 | Bacteria | 9267 |
| 1083 | Ga0316577_10011270 | 3300031733 | Bacteria | 4841 |
| 1084 | Ga0316577_10021225 | 3300031733 | Bacteria | 3602 |
| 1085 | Ga0316577_10054363 | 3300031733 | Bacteria | 2235 |
| 1086 | Ga0316577_10137759 | 3300031733 | Bacteria | 1374 |
| 1087 | Ga0316577_10193824 | 3300031733 | Bacteria | 1148 |
| 1088 | Ga0307413_10035667 | 3300031824 | Bacteria | 2855 |
| 1089 | Ga0307413_10130081 | 3300031824 | Bacteria | 1721 |
| 1090 | Ga0307410_10023462 | 3300031852 | Bacteria | 3835 |
| 1091 | Ga0307410_10052426 | 3300031852 | Bacteria | 2755 |
| 1092 | Ga0307410_10086703 | 3300031852 | Bacteria | 2212 |
| 1093 | Ga0307410_10132131 | 3300031852 | Bacteria | 1835 |
| 1094 | Ga0307406_10022966 | 3300031901 | Bacteria | 3706 |
| 1095 | Ga0307406_10181664 | 3300031901 | Bacteria | 1532 |
| 1096 | Ga0307407_10020497 | 3300031903 | Bacteria | 3390 |
| 1097 | Ga0307407_10025997 | 3300031903 | Bacteria | 3094 |
| 1098 | Ga0307412_10019389 | 3300031911 | Bacteria | 4118 |
| 1099 | Ga0307412_10482665 | 3300031911 | Bacteria | 1028 |
| 1100 | Ga0307409_100003265 | 3300031995 | Bacteria | 8754 |
| 1101 | Ga0307409_100005682 | 3300031995 | Bacteria | 7224 |
| 1102 | Ga0307409_100085062 | 3300031995 | Bacteria | 2570 |
| 1103 | Ga0307409_100244334 | 3300031995 | Bacteria | 1636 |
| 1104 | Ga0307416_100007278 | 3300032002 | Bacteria | 7018 |
| 1105 | Ga0307416_100022471 | 3300032002 | Bacteria | 4554 |
| 1106 | Ga0307416_100053714 | 3300032002 | Bacteria | 3234 |
| 1107 | Ga0307416_100188320 | 3300032002 | Bacteria | 1943 |
| 1108 | Ga0307416_100196331 | 3300032002 | Bacteria | 1909 |
| 1109 | Ga0307416_100869372 | 3300032002 | Bacteria | 1000 |
| 1110 | Ga0307414_10162918 | 3300032004 | Bacteria | 1774 |
| 1111 | Ga0307414_10393846 | 3300032004 | Bacteria | 1201 |
| 1112 | Ga0307411_10012815 | 3300032005 | Bacteria | 4595 |
| 1113 | Ga0307411_10018834 | 3300032005 | Bacteria | 3972 |
| 1114 | Ga0307415_100009761 | 3300032126 | Bacteria | 5400 |
| 1115 | Ga0307415_100129907 | 3300032126 | Bacteria | 1905 |
| 1116 | Ga0307415_100132924 | 3300032126 | Bacteria | 1887 |
| 1117 | Ga0316585_10000120 | 3300032137 | Bacteria | 14794 |
| 1118 | Ga0316580_10004843 | 3300032139 | Bacteria | 3914 |
| 1119 | Ga0316580_10012007 | 3300032139 | Bacteria | 2634 |
| 1120 | Ga0316580_10014310 | 3300032139 | Bacteria | 2422 |
| 1121 | Ga0316580_10040740 | 3300032139 | Bacteria | 1435 |
| 1122 | Ga0307510_10000002 | 3300033180 | Bacteria | 801565 |
| 1123 | Ga0307510_10038803 | 3300033180 | Bacteria | 5259 |
| 1124 | Ga0307510_10121453 | 3300033180 | Bacteria | 2316 |
| 1125 | Ga0316588_1015333 | 3300033528 | Bacteria | 1687 |
| 1126 | Ga0316587_1021171 | 3300033529 | Bacteria | 1108 |
| 1127 | Ga0316596_1018730 | 3300033541 | Bacteria | 1752 |
| 1128 | Ga0373958_0005256 | 3300034819 | Bacteria | 1959 |
| 1129 | Ga0373926_0017403 | 3300035083 | Bacteria | 2467 |
| 1130 | Ga0373934_0004781 | 3300035086 | Bacteria | 5009 |
| 1131 | Ga0373934_0008021 | 3300035086 | Bacteria | 3929 |
| 1132 | Ga0373936_0030899 | 3300035113 | Bacteria | 2113 |
| 1133 | Ga0373941_0032107 | 3300035115 | Bacteria | 1569 |
| 1134 | Ga0373945_0014449 | 3300035116 | Bacteria | 2646 |
| 1135 | Ga0373945_0136109 | 3300035116 | Bacteria | 988 |
| 1136 | Ga0373953_0065061 | 3300035117 | Bacteria | 1496 |
| 1137 | Ga0373954_0121962 | 3300035118 | Bacteria | 1266 |
| 1138 | Ga0373956_0000029 | 3300035119 | Bacteria | 45843 |
| 1139 | Ga0373956_0030613 | 3300035119 | Bacteria | 2354 |
| 1140 | Ga0373956_0125656 | 3300035119 | Bacteria | 1199 |
| 1141 | Ga0373957_0000474 | 3300035120 | Bacteria | 10144 |
| 1142 | Ga0373957_0008879 | 3300035120 | Bacteria | 3273 |
| 1143 | Ga0373957_0061048 | 3300035120 | Bacteria | 1460 |
| 1144 | Ga0373943_0157862 | 3300035170 | Bacteria | 1233 |
| 1145 | Ga0373943_0227747 | 3300035170 | Bacteria | 1040 |
| 1146 | Ga0373955_0000731 | 3300035172 | Bacteria | 14077 |
| 1147 | Ga0373955_0011087 | 3300035172 | Bacteria | 4281 |
| 1148 | Ga0373955_0075734 | 3300035172 | Bacteria | 1891 |
| 1149 | Ga0373955_0178468 | 3300035172 | Bacteria | 1259 |
| 1150 | Ga0373961_0009521 | 3300035241 | Bacteria | 2379 |
| 1151 | Ga0373962_0042496 | 3300035242 | Bacteria | 1286 |
| 1152 | Ga0316574_0001501 | 3300035398 | Bacteria | 11110 |
| 1153 | Ga0316574_0002787 | 3300035398 | Bacteria | 8875 |
| 1154 | Ga0316574_0004096 | 3300035398 | Bacteria | 7597 |
| 1155 | Ga0316574_0005003 | 3300035398 | Bacteria | 7032 |
| 1156 | Ga0316574_0005513 | 3300035398 | Bacteria | 6753 |
| 1157 | Ga0316574_0006846 | 3300035398 | Bacteria | 6197 |
| 1158 | Ga0316574_0009834 | 3300035398 | Bacteria | 5376 |
| 1159 | Ga0316574_0010793 | 3300035398 | Bacteria | 5174 |
| 1160 | Ga0316574_0012984 | 3300035398 | Bacteria | 4778 |
| 1161 | Ga0316574_0020895 | 3300035398 | Bacteria | 3880 |
| 1162 | Ga0316574_0032015 | 3300035398 | Bacteria | 3193 |
| 1163 | Ga0316574_0032977 | 3300035398 | Bacteria | 3151 |
| 1164 | Ga0316574_0059360 | 3300035398 | Bacteria | 2398 |
| 1165 | Ga0316574_0083734 | 3300035398 | Bacteria | 2028 |
| 1166 | Ga0316574_0205946 | 3300035398 | Bacteria | 1263 |
| 1167 | Ga0373931_0015441 | 3300035691 | Bacteria | 3746 |
| 1168 | Ga0373931_0029386 | 3300035691 | Bacteria | 2821 |
| 1169 | Ga0373935_0008593 | 3300035692 | Bacteria | 6110 |
| 1170 | Ga0373935_0048854 | 3300035692 | Bacteria | 2680 |
| 1171 | Ga0373935_0104491 | 3300035692 | Bacteria | 1872 |
| 1172 | Ga0373927_0039972 | 3300035695 | Bacteria | 3043 |
| 1173 | Ga0373927_0054434 | 3300035695 | Bacteria | 2588 |
| 1174 | Ga0373927_0087643 | 3300035695 | Bacteria | 2021 |
| 1175 | Ga0373933_0000579 | 3300035724 | Bacteria | 22962 |
| 1176 | Ga0373933_0017867 | 3300035724 | Bacteria | 3983 |
| 1177 | Ga0373933_0053057 | 3300035724 | Bacteria | 2427 |
| 1178 | Ga0373933_0080850 | 3300035724 | Bacteria | 1993 |
| 1179 | Ga0373933_0091165 | 3300035724 | Bacteria | 1881 |
| 1180 | Ga0373933_0128412 | 3300035724 | Bacteria | 1592 |
| 1181 | Ga0373933_0202774 | 3300035724 | Bacteria | 1270 |
| 1182 | Ga0373947_0172461 | 3300035725 | Bacteria | 1404 |
| 1183 | Ga0373937_0000441 | 3300036401 | Bacteria | 38394 |
| 1184 | Ga0373937_0003520 | 3300036401 | Bacteria | 13176 |
| 1185 | Ga0373937_0014512 | 3300036401 | Bacteria | 6956 |
| 1186 | Ga0373937_0048250 | 3300036401 | Bacteria | 3897 |
| 1187 | Ga0373937_0049409 | 3300036401 | Bacteria | 3852 |
| 1188 | Ga0373937_0055776 | 3300036401 | Bacteria | 3628 |
| 1189 | Ga0373937_0061527 | 3300036401 | Bacteria | 3451 |
| 1190 | Ga0373937_0156332 | 3300036401 | Bacteria | 2137 |
| 1191 | Ga0373937_0184536 | 3300036401 | Bacteria | 1959 |
| 1192 | Ga0373937_0202246 | 3300036401 | Bacteria | 1867 |
| 1193 | Ga0373937_0213959 | 3300036401 | Bacteria | 1814 |
| 1194 | Ga0373937_0292077 | 3300036401 | Bacteria | 1540 |
| 1195 | Ga0373937_0295974 | 3300036401 | Bacteria | 1529 |
| 1196 | Ga0316582_0000395 | 3300036647 | Bacteria | 15815 |
| 1197 | Ga0316582_0003675 | 3300036647 | Bacteria | 7582 |
| 1198 | Ga0316582_0005547 | 3300036647 | Bacteria | 6514 |
| 1199 | Ga0316582_0006878 | 3300036647 | Bacteria | 6015 |
| 1200 | Ga0316582_0008980 | 3300036647 | Bacteria | 5400 |
| 1201 | Ga0316582_0018329 | 3300036647 | Bacteria | 4072 |
| 1202 | Ga0316582_0022562 | 3300036647 | Unclassified | 3738 |
| 1203 | Ga0316582_0036087 | 3300036647 | Bacteria | 3057 |
| 1204 | Ga0316582_0059008 | 3300036647 | Bacteria | 2455 |
| 1205 | Ga0316582_0063949 | 3300036647 | Bacteria | 2366 |
| 1206 | Ga0316582_0070281 | 3300036647 | Bacteria | 2265 |
| 1207 | Ga0316584_0000351 | 3300036712 | Bacteria | 23751 |
| 1208 | Ga0316584_0001066 | 3300036712 | Bacteria | 16003 |
| 1209 | Ga0316584_0002993 | 3300036712 | Bacteria | 10872 |
| 1210 | Ga0316584_0013493 | 3300036712 | Bacteria | 5785 |
| 1211 | Ga0316584_0015047 | 3300036712 | Bacteria | 5526 |
| 1212 | Ga0316584_0023503 | 3300036712 | Bacteria | 4502 |
| 1213 | Ga0316584_0035151 | 3300036712 | Bacteria | 3718 |
| 1214 | Ga0316584_0059173 | 3300036712 | Bacteria | 2869 |
| 1215 | Ga0316584_0064679 | 3300036712 | Bacteria | 2739 |
| 1216 | Ga0316584_0075894 | 3300036712 | Bacteria | 2519 |
| 1217 | Ga0316584_0110458 | 3300036712 | Bacteria | 2058 |
| 1218 | Ga0316584_0117465 | 3300036712 | Bacteria | 1989 |
| 1219 | Ga0316584_0131295 | 3300036712 | Bacteria | 1871 |
| 1220 | Ga0316584_0362705 | 3300036712 | Bacteria | 1038 |
| 1221 | Ga0373925_0024901 | 3300037068 | Bacteria | 4371 |
| 1222 | Ga0373925_0026437 | 3300037068 | Bacteria | 4246 |
| 1223 | Ga0373925_0059508 | 3300037068 | Bacteria | 2866 |
| 1224 | Ga0373925_0469901 | 3300037068 | Bacteria | 1031 |
| 1225 | Ga0395899_0001136 | 3300037312 | Bacteria | 23550 |
| 1226 | Ga0395899_0001535 | 3300037312 | Bacteria | 19501 |
| 1227 | Ga0395900_0007959 | 3300037418 | Bacteria | 10910 |
| 1228 | Ga0395900_0073358 | 3300037418 | Bacteria | 3519 |
| 1229 | Ga0395900_0121983 | 3300037418 | Bacteria | 2674 |
| 1230 | Ga0395900_0159102 | 3300037418 | Bacteria | 2305 |
| 1231 | Ga0395900_0217252 | 3300037418 | Bacteria | 1928 |
| 1232 | Ga0395900_0498418 | 3300037418 | Bacteria | 1168 |
| 1233 | Ga0395898_0011479 | 3300037466 | Bacteria | 9200 |
| 1234 | Ga0395898_0020896 | 3300037466 | Bacteria | 6644 |
| 1235 | Ga0395898_0037964 | 3300037466 | Bacteria | 4775 |
| 1236 | Ga0395905_0000059 | 3300037471 | Bacteria | 198101 |
| 1237 | Ga0395905_0001136 | 3300037471 | Bacteria | 33276 |
| 1238 | Ga0395905_0008938 | 3300037471 | Bacteria | 9836 |
| 1239 | Ga0395905_0010966 | 3300037471 | Bacteria | 8772 |
| 1240 | Ga0395905_0011248 | 3300037471 | Bacteria | 8651 |
| 1241 | Ga0395905_0073000 | 3300037471 | Bacteria | 3216 |
| 1242 | Ga0316581_0008348 | 3300037588 | Bacteria | 2815 |
| 1243 | Ga0395901_0000839 | 3300038443 | Bacteria | 33897 |
| 1244 | Ga0395901_0004488 | 3300038443 | Bacteria | 14071 |
| 1245 | Ga0395901_0199796 | 3300038443 | Bacteria | 2096 |
| 1246 | Ga0395901_0356467 | 3300038443 | Bacteria | 1509 |
| 1247 | Ga0395901_0393697 | 3300038443 | Bacteria | 1424 |
| 1248 | Ga0400490_36062 | 3300038726 | Bacteria | 4457 |
| 1249 | Ga0400488_28864 | 3300038741 | Bacteria | 3420 |
| 1250 | Ga0400483_041619 | 3300039062 | Bacteria | 6562 |
| 1251 | Ga0400483_060059 | 3300039062 | Bacteria | 2648 |
| 1252 | Ga0400483_190258 | 3300039062 | Bacteria | 3589 |
| 1253 | Ga0400483_199900 | 3300039062 | Bacteria | 2844 |
| 1254 | Ga0400487_14099 | 3300039110 | Bacteria | 43310 |
| 1255 | Ga0400487_59035 | 3300039110 | Bacteria | 5941 |
| 1256 | Ga0436365_0655415 | 3300039437 | Bacteria | 3162 |
| 1257 | Ga0436365_1360668 | 3300039437 | Bacteria | 4000 |
| 1258 | Ga0436365_1839211 | 3300039437 | Bacteria | 1265 |
| 1259 | Ga0436360_0128072 | 3300039438 | Bacteria | 2508 |
| 1260 | Ga0436360_0775847 | 3300039438 | Bacteria | 1472 |
| 1261 | Ga0436361_0091148 | 3300039447 | Bacteria | 7977 |
| 1262 | Ga0436361_0101333 | 3300039447 | Bacteria | 28993 |
| 1263 | Ga0436361_0148126 | 3300039447 | Bacteria | 2923 |
| 1264 | Ga0436361_0282854 | 3300039447 | Bacteria | 12597 |
| 1265 | Ga0436361_0334934 | 3300039447 | Bacteria | 33477 |
| 1266 | Ga0436361_0362646 | 3300039447 | Bacteria | 6899 |
| 1267 | Ga0436361_0594091 | 3300039447 | Bacteria | 35115 |
| 1268 | Ga0436361_0599318 | 3300039447 | Bacteria | 1994 |
| 1269 | Ga0436361_0798996 | 3300039447 | Bacteria | 3742 |
| 1270 | Ga0436361_1028197 | 3300039447 | Bacteria | 31240 |
| 1271 | Ga0436361_1176994 | 3300039447 | Bacteria | 7249 |
| 1272 | Ga0436363_0260147 | 3300039450 | Bacteria | 15545 |
| 1273 | Ga0436363_0952595 | 3300039450 | Bacteria | 5360 |
| 1274 | Ga0436363_1067387 | 3300039450 | Bacteria | 2131 |
| 1275 | Ga0436363_1706823 | 3300039450 | Bacteria | 1173 |
| 1276 | Ga0439438_003009 | 3300041405 | Bacteria | 6954 |
| 1277 | Ga0439453_0000441 | 3300041408 | Bacteria | 4520 |
| 1278 | Ga0439461_0028237 | 3300041410 | Bacteria | 1154 |
| 1279 | Ga0451849_0304227 | 3300041505 | Bacteria | 2153 |
| 1280 | Ga0451853_1138053 | 3300041512 | Bacteria | 2613 |
| 1281 | Ga0439431_0004894 | 3300041997 | Bacteria | 2953 |
| 1282 | Ga0439433_0004018 | 3300041999 | Bacteria | 3164 |
| 1283 | Ga0439441_001005 | 3300042001 | Bacteria | 3474 |
| 1284 | Ga0439456_012227 | 3300042013 | Bacteria | 1779 |
| 1285 | Ga0450923_000279 | 3300042125 | Bacteria | 5140 |
| 1286 | Ga0439446_0001893 | 3300042156 | Bacteria | 4917 |
| 1287 | Ga0439446_0002299 | 3300042156 | Bacteria | 4565 |
| 1288 | Ga0450908_007126 | 3300042184 | Bacteria | 2112 |
| 1289 | Ga0439434_0017129 | 3300042435 | Bacteria | 2167 |
| 1290 | Ga0439435_0000160 | 3300042436 | Bacteria | 9262 |
| 1291 | Ga0439435_0024671 | 3300042436 | Bacteria | 1588 |
| 1292 | Ga0439435_0047932 | 3300042436 | Bacteria | 1215 |
| 1293 | Ga0439444_0000639 | 3300042437 | Bacteria | 4055 |
| 1294 | Ga0451577_0000852 | 3300042876 | Bacteria | 45450 |
| 1295 | Ga0451577_0001784 | 3300042876 | Bacteria | 27608 |
| 1296 | Ga0451577_0006011 | 3300042876 | Bacteria | 12221 |
| 1297 | Ga0451577_0037562 | 3300042876 | Bacteria | 4358 |
| 1298 | Ga0451577_0114543 | 3300042876 | Bacteria | 2414 |
| 1299 | Ga0451577_0125120 | 3300042876 | Bacteria | 2303 |
| 1300 | Ga0451577_0143680 | 3300042876 | Bacteria | 2145 |
| 1301 | Ga0451577_0197135 | 3300042876 | Bacteria | 1817 |
| 1302 | Ga0451577_0197751 | 3300042876 | Bacteria | 1815 |
| 1303 | Ga0451577_0408492 | 3300042876 | Bacteria | 1232 |
| 1304 | Ga0466969_0001991 | 3300044656 | Bacteria | 10915 |
| 1305 | Ga0466969_0002917 | 3300044656 | Bacteria | 9122 |
| 1306 | Ga0466972_0000106 | 3300044658 | Bacteria | 72246 |
| 1307 | Ga0466973_0095500 | 3300044659 | Bacteria | 2542 |
| 1308 | Ga0466982_0076069 | 3300044672 | Bacteria | 2076 |
| 1309 | Ga0453683_0063641 | 3300044673 | Bacteria | 2306 |
| 1310 | Ga0466965_0013903 | 3300044683 | Bacteria | 3804 |
| 1311 | Ga0466965_0028050 | 3300044683 | Bacteria | 2733 |
| 1312 | Ga0466965_0049720 | 3300044683 | Bacteria | 2078 |
| 1313 | Ga0466965_0127988 | 3300044683 | Bacteria | 1315 |
| 1314 | Ga0466966_0004186 | 3300044684 | Bacteria | 9527 |
| 1315 | Ga0466966_0053658 | 3300044684 | Bacteria | 2556 |
| 1316 | Ga0466961_0000040 | 3300044693 | Bacteria | 78691 |
| 1317 | Ga0466961_0031713 | 3300044693 | Bacteria | 3398 |
| 1318 | Ga0466963_0010194 | 3300044694 | Bacteria | 5682 |
| 1319 | Ga0466964_0007850 | 3300044706 | Bacteria | 3995 |
| 1320 | Ga0453684_0002092 | 3300044712 | Bacteria | 50519 |
| 1321 | Ga0453684_0005854 | 3300044712 | Bacteria | 23899 |
| 1322 | Ga0453684_0007181 | 3300044712 | Bacteria | 20698 |
| 1323 | Ga0453684_0018446 | 3300044712 | Bacteria | 10709 |
| 1324 | Ga0453684_0033353 | 3300044712 | Bacteria | 7181 |
| 1325 | Ga0453684_0061503 | 3300044712 | Bacteria | 4820 |
| 1326 | Ga0453684_0144864 | 3300044712 | Bacteria | 2831 |
| 1327 | Ga0453684_0571099 | 3300044712 | Bacteria | 1243 |
| 1328 | Ga0453684_0577257 | 3300044712 | Bacteria | 1235 |
| 1329 | Ga0453684_0765213 | 3300044712 | Bacteria | 1044 |
| 1330 | Ga0466971_0002218 | 3300044719 | Bacteria | 8217 |
| 1331 | Ga0466971_0003507 | 3300044719 | Bacteria | 6700 |
| 1332 | Ga0466968_0000386 | 3300044735 | Bacteria | 14481 |
| 1333 | Ga0466970_0004185 | 3300044765 | Bacteria | 7096 |
| 1334 | Ga0466970_0048220 | 3300044765 | Bacteria | 2271 |
| 1335 | Ga0466970_0049287 | 3300044765 | Bacteria | 2246 |
| 1336 | Ga0466957_0011221 | 3300044842 | Bacteria | 5161 |
| 1337 | Ga0466957_0018370 | 3300044842 | Bacteria | 4106 |
| 1338 | Ga0466957_0081504 | 3300044842 | Bacteria | 2015 |
| 1339 | Ga0466959_0016051 | 3300045049 | Bacteria | 5466 |
| 1340 | Ga0466959_0021908 | 3300045049 | Bacteria | 4719 |
| 1341 | Ga0466959_0047999 | 3300045049 | Bacteria | 3139 |
| 1342 | Ga0466959_0072728 | 3300045049 | Bacteria | 2488 |
| 1343 | Ga0466959_0078464 | 3300045049 | Bacteria | 2381 |
| 1344 | Ga0451576_0003496 | 3300045051 | Bacteria | 21499 |
| 1345 | Ga0451576_0014390 | 3300045051 | Bacteria | 8809 |
| 1346 | Ga0451576_0027429 | 3300045051 | Bacteria | 6116 |
| 1347 | Ga0451576_0035476 | 3300045051 | Bacteria | 5290 |
| 1348 | Ga0451576_0045732 | 3300045051 | Bacteria | 4609 |
| 1349 | Ga0451576_0078988 | 3300045051 | Bacteria | 3423 |
| 1350 | Ga0451576_0486751 | 3300045051 | Bacteria | 1296 |
| 1351 | Ga0466967_0007982 | 3300045976 | Bacteria | 7704 |
| 1352 | Ga0466967_0416561 | 3300045976 | Bacteria | 1309 |
| 1353 | Ga0495617_047239 | 3300046452 | Bacteria | 1433 |
| 1354 | Ga0495627_000006 | 3300046453 | Bacteria | 581750 |
| 1355 | Ga0495627_013310 | 3300046453 | Bacteria | 2896 |
| 1356 | Ga0495592_0001747 | 3300046454 | Bacteria | 15259 |
| 1357 | Ga0495592_0009606 | 3300046454 | Bacteria | 7280 |
| 1358 | Ga0495592_0064178 | 3300046454 | Bacteria | 2692 |
| 1359 | Ga0495592_0104404 | 3300046454 | Bacteria | 2015 |
| 1360 | Ga0495592_0259506 | 3300046454 | Bacteria | 1145 |
| 1361 | Ga0495603_0001029 | 3300046455 | Bacteria | 16102 |
| 1362 | Ga0495603_0034806 | 3300046455 | Bacteria | 3028 |
| 1363 | Ga0495603_0069390 | 3300046455 | Bacteria | 2073 |
| 1364 | Ga0495603_0082058 | 3300046455 | Bacteria | 1889 |
| 1365 | Ga0495590_0000004 | 3300046457 | Bacteria | 402091 |
| 1366 | Ga0495590_0004686 | 3300046457 | Bacteria | 5484 |
| 1367 | Ga0495590_0008972 | 3300046457 | Bacteria | 3800 |
| 1368 | Ga0495591_000746 | 3300046458 | Bacteria | 23531 |
| 1369 | Ga0495629_0002657 | 3300046459 | Bacteria | 13702 |
| 1370 | Ga0495629_0022948 | 3300046459 | Bacteria | 4447 |
| 1371 | Ga0495629_0046606 | 3300046459 | Bacteria | 3040 |
| 1372 | Ga0495629_0077690 | 3300046459 | Bacteria | 2317 |
| 1373 | Ga0495629_0224579 | 3300046459 | Bacteria | 1295 |
| 1374 | Ga0495638_0000023 | 3300046460 | Bacteria | 363063 |
| 1375 | Ga0495638_0003523 | 3300046460 | Bacteria | 12286 |
| 1376 | Ga0495638_0003799 | 3300046460 | Bacteria | 11734 |
| 1377 | Ga0495638_0005570 | 3300046460 | Bacteria | 9311 |
| 1378 | Ga0495638_0014711 | 3300046460 | Bacteria | 5277 |
| 1379 | Ga0495638_0021947 | 3300046460 | Bacteria | 4196 |
| 1380 | Ga0495638_0027702 | 3300046460 | Bacteria | 3666 |
| 1381 | Ga0495638_0085233 | 3300046460 | Bacteria | 1911 |
| 1382 | Ga0495651_0000356 | 3300046462 | Bacteria | 35210 |
| 1383 | Ga0495651_0008683 | 3300046462 | Bacteria | 7797 |
| 1384 | Ga0495651_0049750 | 3300046462 | Bacteria | 3235 |
| 1385 | Ga0495651_0080330 | 3300046462 | Bacteria | 2464 |
| 1386 | Ga0495653_0000042 | 3300046463 | Bacteria | 117284 |
| 1387 | Ga0495653_0005300 | 3300046463 | Bacteria | 10489 |
| 1388 | Ga0495653_0085371 | 3300046463 | Bacteria | 2322 |
| 1389 | Ga0495650_0000215 | 3300046471 | Bacteria | 122533 |
| 1390 | Ga0495650_0000407 | 3300046471 | Bacteria | 70819 |
| 1391 | Ga0495650_0003561 | 3300046471 | Bacteria | 11262 |
| 1392 | Ga0495650_0004606 | 3300046471 | Bacteria | 9361 |
| 1393 | Ga0495650_0005137 | 3300046471 | Bacteria | 8636 |
| 1394 | Ga0495650_0012899 | 3300046471 | Bacteria | 4462 |
| 1395 | Ga0495650_0020898 | 3300046471 | Bacteria | 3179 |
| 1396 | Ga0495580_0001985 | 3300046472 | Bacteria | 17990 |
| 1397 | Ga0495580_0013252 | 3300046472 | Bacteria | 6301 |
| 1398 | Ga0495580_0027238 | 3300046472 | Bacteria | 4159 |
| 1399 | Ga0495580_0035563 | 3300046472 | Bacteria | 3581 |
| 1400 | Ga0495580_0083832 | 3300046472 | Bacteria | 2220 |
| 1401 | Ga0495580_0109778 | 3300046472 | Bacteria | 1915 |
| 1402 | Ga0495580_0183615 | 3300046472 | Bacteria | 1444 |
| 1403 | Ga0495582_0006012 | 3300046473 | Bacteria | 6767 |
| 1404 | Ga0495582_0011377 | 3300046473 | Bacteria | 4903 |
| 1405 | Ga0495605_0001550 | 3300046474 | Bacteria | 14938 |
| 1406 | Ga0495605_0004146 | 3300046474 | Bacteria | 8541 |
| 1407 | Ga0495605_0015524 | 3300046474 | Bacteria | 4139 |
| 1408 | Ga0495605_0122042 | 3300046474 | Bacteria | 1180 |
| 1409 | Ga0495639_0058849 | 3300046475 | Bacteria | 1758 |
| 1410 | Ga0495639_0071016 | 3300046475 | Bacteria | 1608 |
| 1411 | Ga0495662_0005181 | 3300046476 | Bacteria | 6534 |
| 1412 | Ga0495662_0027873 | 3300046476 | Bacteria | 2728 |
| 1413 | Ga0495662_0034579 | 3300046476 | Bacteria | 2439 |
| 1414 | Ga0495664_0000240 | 3300046477 | Bacteria | 26394 |
| 1415 | Ga0495584_0010228 | 3300046491 | Bacteria | 4819 |
| 1416 | Ga0495584_0020600 | 3300046491 | Bacteria | 3349 |
| 1417 | Ga0495584_0185118 | 3300046491 | Bacteria | 1058 |
| 1418 | Ga0495585_0011867 | 3300046492 | Bacteria | 5147 |
| 1419 | Ga0495585_0198791 | 3300046492 | Bacteria | 1022 |
| 1420 | Ga0495596_0000176 | 3300046500 | Bacteria | 44544 |
| 1421 | Ga0495596_0001852 | 3300046500 | Bacteria | 11732 |
| 1422 | Ga0495596_0014268 | 3300046500 | Bacteria | 3348 |
| 1423 | Ga0495596_0017785 | 3300046500 | Bacteria | 2939 |
| 1424 | Ga0495596_0035741 | 3300046500 | Bacteria | 1969 |
| 1425 | Ga0495596_0043672 | 3300046500 | Bacteria | 1766 |
| 1426 | Ga0495596_0061566 | 3300046500 | Bacteria | 1461 |
| 1427 | Ga0495607_0004205 | 3300046501 | Bacteria | 10682 |
| 1428 | Ga0495607_0017522 | 3300046501 | Bacteria | 4594 |
| 1429 | Ga0495607_0041247 | 3300046501 | Bacteria | 2743 |
| 1430 | Ga0495607_0082705 | 3300046501 | Bacteria | 1760 |
| 1431 | Ga0495583_0000093 | 3300046506 | Bacteria | 158708 |
| 1432 | Ga0495583_0000503 | 3300046506 | Bacteria | 56256 |
| 1433 | Ga0495583_0001963 | 3300046506 | Bacteria | 18871 |
| 1434 | Ga0495583_0018055 | 3300046506 | Bacteria | 3726 |
| 1435 | Ga0495583_0024245 | 3300046506 | Bacteria | 3052 |
| 1436 | Ga0495583_0034045 | 3300046506 | Bacteria | 2444 |
| 1437 | Ga0495583_0098078 | 3300046506 | Bacteria | 1253 |
| 1438 | Ga0495606_0000331 | 3300046507 | Bacteria | 81871 |
| 1439 | Ga0495606_0000659 | 3300046507 | Bacteria | 54217 |
| 1440 | Ga0495606_0002252 | 3300046507 | Bacteria | 22956 |
| 1441 | Ga0495606_0002286 | 3300046507 | Bacteria | 22645 |
| 1442 | Ga0495606_0004881 | 3300046507 | Bacteria | 13135 |
| 1443 | Ga0495606_0010885 | 3300046507 | Bacteria | 7489 |
| 1444 | Ga0495606_0020159 | 3300046507 | Bacteria | 4928 |
| 1445 | Ga0495606_0020497 | 3300046507 | Bacteria | 4871 |
| 1446 | Ga0495606_0021746 | 3300046507 | Bacteria | 4692 |
| 1447 | Ga0495606_0026393 | 3300046507 | Bacteria | 4141 |
| 1448 | Ga0495606_0030096 | 3300046507 | Bacteria | 3798 |
| 1449 | Ga0495606_0090633 | 3300046507 | Bacteria | 1881 |
| 1450 | Ga0495608_0004633 | 3300046511 | Bacteria | 9817 |
| 1451 | Ga0495608_0005174 | 3300046511 | Bacteria | 9322 |
| 1452 | Ga0495608_0158304 | 3300046511 | Bacteria | 1441 |
| 1453 | Ga0495610_0015455 | 3300046512 | Bacteria | 4433 |
| 1454 | Ga0495610_0029275 | 3300046512 | Bacteria | 2902 |
| 1455 | Ga0495610_0033021 | 3300046512 | Bacteria | 2680 |
| 1456 | Ga0495610_0117551 | 3300046512 | Bacteria | 1170 |
| 1457 | Ga0495616_0001514 | 3300046513 | Bacteria | 16018 |
| 1458 | Ga0495616_0001806 | 3300046513 | Bacteria | 14514 |
| 1459 | Ga0495616_0007505 | 3300046513 | Bacteria | 6528 |
| 1460 | Ga0495616_0018840 | 3300046513 | Bacteria | 3776 |
| 1461 | Ga0495616_0064442 | 3300046513 | Bacteria | 1788 |
| 1462 | Ga0495616_0090671 | 3300046513 | Bacteria | 1447 |
| 1463 | Ga0495618_0010183 | 3300046514 | Bacteria | 5687 |
| 1464 | Ga0495620_0017758 | 3300046515 | Bacteria | 3539 |
| 1465 | Ga0495628_0008086 | 3300046516 | Bacteria | 9045 |
| 1466 | Ga0495628_0010357 | 3300046516 | Bacteria | 7927 |
| 1467 | Ga0495628_0012517 | 3300046516 | Bacteria | 7149 |
| 1468 | Ga0495628_0041108 | 3300046516 | Bacteria | 3691 |
| 1469 | Ga0495628_0054706 | 3300046516 | Bacteria | 3145 |
| 1470 | Ga0495628_0075644 | 3300046516 | Bacteria | 2622 |
| 1471 | Ga0495630_0021896 | 3300046517 | Bacteria | 4720 |
| 1472 | Ga0495630_0140202 | 3300046517 | Bacteria | 1838 |
| 1473 | Ga0495630_0166096 | 3300046517 | Bacteria | 1680 |
| 1474 | Ga0495630_0341594 | 3300046517 | Bacteria | 1146 |
| 1475 | Ga0495631_0000109 | 3300046518 | Bacteria | 54778 |
| 1476 | Ga0495631_0052982 | 3300046518 | Bacteria | 1771 |
| 1477 | Ga0495632_0000837 | 3300046519 | Bacteria | 27084 |
| 1478 | Ga0495632_0041939 | 3300046519 | Bacteria | 2297 |
| 1479 | Ga0495637_0000338 | 3300046520 | Bacteria | 36248 |
| 1480 | Ga0495637_0000936 | 3300046520 | Bacteria | 18657 |
| 1481 | Ga0495643_0000681 | 3300046522 | Bacteria | 39588 |
| 1482 | Ga0495643_0001242 | 3300046522 | Bacteria | 24461 |
| 1483 | Ga0495643_0014741 | 3300046522 | Bacteria | 4642 |
| 1484 | Ga0495643_0017418 | 3300046522 | Bacteria | 4200 |
| 1485 | Ga0495643_0021636 | 3300046522 | Bacteria | 3686 |
| 1486 | Ga0495643_0043518 | 3300046522 | Bacteria | 2443 |
| 1487 | Ga0495643_0069479 | 3300046522 | Bacteria | 1851 |
| 1488 | Ga0495648_0000025 | 3300046524 | Bacteria | 233415 |
| 1489 | Ga0495648_0005380 | 3300046524 | Bacteria | 10646 |
| 1490 | Ga0495648_0008152 | 3300046524 | Bacteria | 8270 |
| 1491 | Ga0495648_0026461 | 3300046524 | Bacteria | 3904 |
| 1492 | Ga0495648_0050467 | 3300046524 | Bacteria | 2541 |
| 1493 | Ga0495648_0060546 | 3300046524 | Bacteria | 2252 |
| 1494 | Ga0495648_0089047 | 3300046524 | Bacteria | 1733 |
| 1495 | Ga0495648_0094609 | 3300046524 | Bacteria | 1663 |
| 1496 | Ga0495666_0004506 | 3300046526 | Bacteria | 7037 |
| 1497 | Ga0495666_0006287 | 3300046526 | Bacteria | 5981 |
| 1498 | Ga0495666_0027956 | 3300046526 | Bacteria | 2776 |
| 1499 | Ga0495666_0028427 | 3300046526 | Bacteria | 2751 |
| 1500 | Ga0495642_0003800 | 3300046528 | Bacteria | 5915 |
| 1501 | Ga0495642_0008352 | 3300046528 | Bacteria | 3963 |
| 1502 | Ga0495642_0012706 | 3300046528 | Bacteria | 3249 |
| 1503 | Ga0495642_0020062 | 3300046528 | Bacteria | 2622 |
| 1504 | Ga0495642_0021266 | 3300046528 | Bacteria | 2552 |
| 1505 | Ga0495652_0007174 | 3300046529 | Bacteria | 10286 |
| 1506 | Ga0495652_0007305 | 3300046529 | Bacteria | 10188 |
| 1507 | Ga0495652_0052416 | 3300046529 | Bacteria | 3480 |
| 1508 | Ga0495654_0000004 | 3300046530 | Bacteria | 515304 |
| 1509 | Ga0495654_0099935 | 3300046530 | Bacteria | 1336 |
| 1510 | Ga0495665_0008313 | 3300046531 | Bacteria | 5626 |
| 1511 | Ga0495665_0016793 | 3300046531 | Bacteria | 3940 |
| 1512 | Ga0495665_0024166 | 3300046531 | Bacteria | 3264 |
| 1513 | Ga0495665_0079305 | 3300046531 | Bacteria | 1727 |
| 1514 | Ga0495640_0002467 | 3300046533 | Bacteria | 14867 |
| 1515 | Ga0495640_0122907 | 3300046533 | Bacteria | 1685 |
| 1516 | Ga0495640_0136155 | 3300046533 | Bacteria | 1586 |
| 1517 | Ga0495586_0037835 | 3300046535 | Bacteria | 2590 |
| 1518 | Ga0495587_0003076 | 3300046536 | Bacteria | 11143 |
| 1519 | Ga0495587_0019220 | 3300046536 | Bacteria | 4231 |
| 1520 | Ga0495587_0067554 | 3300046536 | Bacteria | 2084 |
| 1521 | Ga0495587_0071881 | 3300046536 | Bacteria | 2012 |
| 1522 | Ga0495587_0120390 | 3300046536 | Bacteria | 1504 |
| 1523 | Ga0495598_0012097 | 3300046537 | Bacteria | 2108 |
| 1524 | Ga0495598_0025423 | 3300046537 | Bacteria | 1615 |
| 1525 | Ga0495609_0012302 | 3300046538 | Bacteria | 4059 |
| 1526 | Ga0495609_0018544 | 3300046538 | Bacteria | 3223 |
| 1527 | Ga0495609_0022503 | 3300046538 | Bacteria | 2902 |
| 1528 | Ga0495609_0113797 | 3300046538 | Bacteria | 1166 |
| 1529 | Ga0495621_0049300 | 3300046539 | Bacteria | 1502 |
| 1530 | Ga0495597_0000295 | 3300046542 | Bacteria | 44823 |
| 1531 | Ga0495597_0000629 | 3300046542 | Bacteria | 28799 |
| 1532 | Ga0495597_0004054 | 3300046542 | Bacteria | 8198 |
| 1533 | Ga0495597_0014825 | 3300046542 | Bacteria | 3705 |
| 1534 | Ga0495597_0024422 | 3300046542 | Bacteria | 2790 |
| 1535 | Ga0495597_0039758 | 3300046542 | Bacteria | 2104 |
| 1536 | Ga0495645_0000609 | 3300046543 | Bacteria | 24694 |
| 1537 | Ga0495645_0001936 | 3300046543 | Bacteria | 14058 |
| 1538 | Ga0495645_0005217 | 3300046543 | Bacteria | 8901 |
| 1539 | Ga0495645_0052106 | 3300046543 | Bacteria | 2978 |
| 1540 | Ga0495645_0057519 | 3300046543 | Bacteria | 2822 |
| 1541 | Ga0495645_0130090 | 3300046543 | Bacteria | 1765 |
| 1542 | Ga0495622_0000007 | 3300046557 | Bacteria | 239352 |
| 1543 | Ga0495622_0000063 | 3300046557 | Bacteria | 95713 |
| 1544 | Ga0495622_0000242 | 3300046557 | Bacteria | 42591 |
| 1545 | Ga0495622_0004064 | 3300046557 | Bacteria | 6831 |
| 1546 | Ga0495633_0000107 | 3300046558 | Bacteria | 111541 |
| 1547 | Ga0495633_0000317 | 3300046558 | Bacteria | 54706 |
| 1548 | Ga0495633_0001129 | 3300046558 | Bacteria | 21463 |
| 1549 | Ga0495633_0007175 | 3300046558 | Bacteria | 6460 |
| 1550 | Ga0495667_0006380 | 3300046559 | Bacteria | 7994 |
| 1551 | Ga0495667_0099029 | 3300046559 | Bacteria | 1887 |
| 1552 | Ga0495667_0160215 | 3300046559 | Bacteria | 1447 |
| 1553 | Ga0495656_0056747 | 3300046615 | Bacteria | 1693 |
| 1554 | Ga0495668_0000049 | 3300046616 | Bacteria | 217657 |
| 1555 | Ga0495668_0000198 | 3300046616 | Bacteria | 88730 |
| 1556 | Ga0495668_0016570 | 3300046616 | Bacteria | 4282 |
| 1557 | Ga0495668_0019695 | 3300046616 | Bacteria | 3886 |
| 1558 | Ga0495668_0042809 | 3300046616 | Bacteria | 2520 |
| 1559 | Ga0495668_0095661 | 3300046616 | Bacteria | 1625 |
| 1560 | Ga0495668_0109555 | 3300046616 | Bacteria | 1510 |
| 1561 | Ga0495668_0150331 | 3300046616 | Bacteria | 1275 |
| 1562 | Ga0495668_0227952 | 3300046616 | Bacteria | 1020 |
| 1563 | Ga0495634_0101385 | 3300046642 | Bacteria | 1859 |
| 1564 | Ga0495634_0137938 | 3300046642 | Bacteria | 1550 |
| 1565 | Ga0495611_0031080 | 3300046648 | Bacteria | 2349 |
| 1566 | Ga0495625_0000123 | 3300046660 | Bacteria | 120958 |
| 1567 | Ga0495625_0010365 | 3300046660 | Bacteria | 7720 |
| 1568 | Ga0495625_0026815 | 3300046660 | Bacteria | 4346 |
| 1569 | Ga0495625_0030323 | 3300046660 | Bacteria | 4037 |
| 1570 | Ga0495625_0043099 | 3300046660 | Bacteria | 3275 |
| 1571 | Ga0495625_0053168 | 3300046660 | Bacteria | 2898 |
| 1572 | Ga0495625_0067247 | 3300046660 | Bacteria | 2522 |
| 1573 | Ga0495625_0072876 | 3300046660 | Bacteria | 2408 |
| 1574 | Ga0495625_0088367 | 3300046660 | Bacteria | 2147 |
| 1575 | Ga0495625_0097592 | 3300046660 | Bacteria | 2022 |
| 1576 | Ga0495635_0024341 | 3300046663 | Bacteria | 4220 |
| 1577 | Ga0495635_0033671 | 3300046663 | Bacteria | 3554 |
| 1578 | Ga0495659_0000297 | 3300046664 | Bacteria | 19750 |
| 1579 | Ga0495659_0001065 | 3300046664 | Bacteria | 9582 |
| 1580 | Ga0495659_0052565 | 3300046664 | Bacteria | 1487 |
| 1581 | Ga0495661_0001776 | 3300046665 | Bacteria | 17331 |
| 1582 | Ga0495661_0002632 | 3300046665 | Bacteria | 13745 |
| 1583 | Ga0495661_0010293 | 3300046665 | Bacteria | 6387 |
| 1584 | Ga0495661_0011580 | 3300046665 | Bacteria | 5980 |
| 1585 | Ga0495661_0019506 | 3300046665 | Bacteria | 4442 |
| 1586 | Ga0495661_0021820 | 3300046665 | Bacteria | 4168 |
| 1587 | Ga0495661_0024741 | 3300046665 | Bacteria | 3887 |
| 1588 | Ga0495661_0060606 | 3300046665 | Bacteria | 2247 |
| 1589 | Ga0495661_0228521 | 3300046665 | Bacteria | 960 |
| 1590 | Ga0495588_0108749 | 3300046674 | Bacteria | 1460 |
| 1591 | Ga0495657_0128578 | 3300046675 | Bacteria | 1589 |
| 1592 | Ga0495657_0145606 | 3300046675 | Bacteria | 1474 |
| 1593 | Ga0495657_0161352 | 3300046675 | Bacteria | 1387 |
| 1594 | Ga0495657_0227210 | 3300046675 | Bacteria | 1130 |
| 1595 | Ga0495599_0001013 | 3300046678 | Bacteria | 15801 |
| 1596 | Ga0495599_0018906 | 3300046678 | Bacteria | 4295 |
| 1597 | Ga0495623_0003184 | 3300046679 | Bacteria | 10833 |
| 1598 | Ga0495623_0019436 | 3300046679 | Bacteria | 4391 |
| 1599 | Ga0495646_0008696 | 3300046680 | Bacteria | 6451 |
| 1600 | Ga0495646_0014620 | 3300046680 | Bacteria | 4989 |
| 1601 | Ga0495646_0022937 | 3300046680 | Bacteria | 3932 |
| 1602 | Ga0495646_0026086 | 3300046680 | Bacteria | 3671 |
| 1603 | Ga0495647_0004872 | 3300046681 | Bacteria | 4388 |
| 1604 | Ga0495647_0011506 | 3300046681 | Bacteria | 3033 |
| 1605 | Ga0495658_0008454 | 3300046683 | Bacteria | 5100 |
| 1606 | Ga0495658_0069680 | 3300046683 | Bacteria | 2039 |
| 1607 | Ga0495658_0080092 | 3300046683 | Bacteria | 1915 |
| 1608 | Ga0495669_0004604 | 3300046684 | Bacteria | 5712 |
| 1609 | Ga0495613_0030346 | 3300046689 | Bacteria | 4015 |
| 1610 | Ga0495613_0042571 | 3300046689 | Bacteria | 3360 |
| 1611 | Ga0495624_0007783 | 3300046690 | Bacteria | 7518 |
| 1612 | Ga0495624_0018248 | 3300046690 | Bacteria | 4694 |
| 1613 | Ga0495624_0031417 | 3300046690 | Bacteria | 3452 |
| 1614 | Ga0495670_0021155 | 3300046691 | Bacteria | 3208 |
| 1615 | Ga0495671_0001337 | 3300046692 | Bacteria | 16719 |
| 1616 | Ga0495671_0007676 | 3300046692 | Bacteria | 6126 |
| 1617 | Ga0495671_0009971 | 3300046692 | Bacteria | 5287 |
| 1618 | Ga0495671_0011133 | 3300046692 | Bacteria | 4964 |
| 1619 | Ga0495671_0015867 | 3300046692 | Bacteria | 4032 |
| 1620 | Ga0495671_0022132 | 3300046692 | Bacteria | 3333 |
| 1621 | Ga0495671_0137313 | 3300046692 | Bacteria | 1192 |
| 1622 | Ga0495649_0002825 | 3300046694 | Bacteria | 12054 |
| 1623 | Ga0495649_0003503 | 3300046694 | Bacteria | 10565 |
| 1624 | Ga0495649_0003798 | 3300046694 | Bacteria | 10007 |
| 1625 | Ga0495649_0014909 | 3300046694 | Bacteria | 4441 |
| 1626 | Ga0495649_0021389 | 3300046694 | Bacteria | 3624 |
| 1627 | Ga0495649_0037765 | 3300046694 | Bacteria | 2651 |
| 1628 | Ga0495589_0000569 | 3300046794 | Bacteria | 25465 |
| 1629 | Ga0495589_0004740 | 3300046794 | Bacteria | 7219 |
| 1630 | Ga0495589_0029450 | 3300046794 | Bacteria | 2767 |
| 1631 | Ga0495589_0061740 | 3300046794 | Bacteria | 1839 |
| 1632 | Ga0495589_0077449 | 3300046794 | Bacteria | 1620 |
| 1633 | Ga0495589_0084570 | 3300046794 | Bacteria | 1542 |
| 1634 | Ga0495589_0085513 | 3300046794 | Bacteria | 1532 |
| 1635 | Ga0495600_0006351 | 3300046809 | Bacteria | 7191 |
| 1636 | Ga0495600_0026810 | 3300046809 | Bacteria | 3721 |
| 1637 | Ga0495600_0086041 | 3300046809 | Bacteria | 2051 |
| 1638 | Ga0495660_0000542 | 3300046810 | Bacteria | 30925 |
| 1639 | Ga0495660_0001078 | 3300046810 | Bacteria | 19547 |
| 1640 | Ga0495660_0009807 | 3300046810 | Bacteria | 5577 |
| 1641 | Ga0495660_0010817 | 3300046810 | Bacteria | 5299 |
| 1642 | Ga0495660_0013133 | 3300046810 | Bacteria | 4800 |
| 1643 | Ga0495660_0035824 | 3300046810 | Bacteria | 2770 |
| 1644 | Ga0495660_0057450 | 3300046810 | Bacteria | 2099 |
| 1645 | Ga0495660_0063163 | 3300046810 | Bacteria | 1983 |
| 1646 | Ga0495660_0110881 | 3300046810 | Bacteria | 1400 |
| 1647 | Ga0495581_0009404 | 3300047315 | Bacteria | 5654 |
| 1648 | Ga0495581_0014371 | 3300047315 | Bacteria | 4592 |
| 1649 | Ga0495604_0178726 | 3300047317 | Bacteria | 1486 |
| 1650 | Ga0495604_0251153 | 3300047317 | Bacteria | 1205 |
| 1651 | Ga0495636_0029621 | 3300047318 | Bacteria | 2235 |
| 1652 | Ga0495636_0085188 | 3300047318 | Bacteria | 1366 |
| 1653 | Ga0495674_0008154 | 3300047319 | Bacteria | 9993 |
| 1654 | Ga0495674_0015022 | 3300047319 | Bacteria | 7245 |
| 1655 | Ga0495674_0049015 | 3300047319 | Bacteria | 3735 |
| 1656 | Ga0495674_0201770 | 3300047319 | Bacteria | 1649 |
| 1657 | Ga0495672_0000159 | 3300047320 | Bacteria | 98262 |
| 1658 | Ga0495672_0017796 | 3300047320 | Bacteria | 4742 |
| 1659 | Ga0495672_0024888 | 3300047320 | Bacteria | 3846 |
| 1660 | Ga0495676_0021709 | 3300047321 | Bacteria | 5600 |
| 1661 | Ga0495683_0004007 | 3300047323 | Bacteria | 8462 |
| 1662 | Ga0495683_0175317 | 3300047323 | Bacteria | 983 |
| 1663 | Ga0495687_000049 | 3300047443 | Bacteria | 205432 |
| 1664 | Ga0495687_000088 | 3300047443 | Bacteria | 142499 |
| 1665 | Ga0495687_004364 | 3300047443 | Bacteria | 9619 |
| 1666 | Ga0495687_011253 | 3300047443 | Bacteria | 4823 |
| 1667 | Ga0495687_016555 | 3300047443 | Bacteria | 3706 |
| 1668 | Ga0495687_023435 | 3300047443 | Bacteria | 2948 |
| 1669 | Ga0495675_0001488 | 3300047444 | Bacteria | 14179 |
| 1670 | Ga0495675_0026156 | 3300047444 | Bacteria | 3720 |
| 1671 | Ga0495675_0047698 | 3300047444 | Bacteria | 2725 |
| 1672 | Ga0495675_0092043 | 3300047444 | Bacteria | 1903 |
| 1673 | Ga0495677_0025577 | 3300047445 | Bacteria | 2141 |
| 1674 | Ga0495679_000044 | 3300047446 | Bacteria | 138399 |
| 1675 | Ga0495679_005164 | 3300047446 | Bacteria | 5843 |
| 1676 | Ga0495679_008760 | 3300047446 | Bacteria | 4091 |
| 1677 | Ga0495679_009205 | 3300047446 | Bacteria | 3969 |
| 1678 | Ga0495679_030588 | 3300047446 | Bacteria | 1746 |
| 1679 | Ga0495685_013452 | 3300047447 | Bacteria | 2778 |
| 1680 | Ga0495673_0002725 | 3300047469 | Bacteria | 12127 |
| 1681 | Ga0495681_0006863 | 3300047470 | Bacteria | 7392 |
| 1682 | Ga0495681_0011866 | 3300047470 | Bacteria | 5152 |
| 1683 | Ga0495681_0014148 | 3300047470 | Bacteria | 4592 |
| 1684 | Ga0495684_0099674 | 3300047471 | Bacteria | 2197 |
| 1685 | Ga0495684_0340291 | 3300047471 | Bacteria | 1068 |
| 1686 | Ga0495686_0000838 | 3300047472 | Bacteria | 39459 |
| 1687 | Ga0495686_0002406 | 3300047472 | Bacteria | 17757 |
| 1688 | Ga0495686_0012772 | 3300047472 | Bacteria | 5858 |
| 1689 | Ga0495686_0035681 | 3300047472 | Bacteria | 3195 |
| 1690 | Ga0495593_0002710 | 3300047673 | Bacteria | 10666 |
| 1691 | Ga0495602_0085499 | 3300048088 | Bacteria | 2635 |
| 1692 | Ga0495602_0128335 | 3300048088 | Bacteria | 2027 |
| 1693 | Ga0495614_0037819 | 3300048089 | Bacteria | 2071 |
| 1694 | Ga0495614_0079491 | 3300048089 | Bacteria | 1420 |
| 1695 | Ga0495626_0011661 | 3300048091 | Bacteria | 4638 |
| 1696 | Ga0495626_0015200 | 3300048091 | Bacteria | 3945 |
| 1697 | Ga0495626_0057747 | 3300048091 | Bacteria | 1775 |
| 1698 | Ga0495626_0110096 | 3300048091 | Bacteria | 1193 |
| 1699 | Ga0496100_0084443 | 3300048903 | Bacteria | 2152 |
| 1700 | Ga0496100_0115389 | 3300048903 | Bacteria | 1872 |
| 1701 | Ga0496100_0265162 | 3300048903 | Bacteria | 1275 |
| 1702 | Ga0496101_0005218 | 3300048904 | Bacteria | 8264 |
| 1703 | Ga0496101_0018089 | 3300048904 | Bacteria | 4786 |
| 1704 | Ga0496101_0034658 | 3300048904 | Bacteria | 3567 |
| 1705 | Ga0496101_0046403 | 3300048904 | Bacteria | 3116 |
| 1706 | Ga0496102_0007133 | 3300048905 | Bacteria | 9544 |
| 1707 | Ga0496102_0018478 | 3300048905 | Bacteria | 6128 |
| 1708 | Ga0496102_0018878 | 3300048905 | Bacteria | 6066 |
| 1709 | Ga0496102_0020468 | 3300048905 | Bacteria | 5847 |
| 1710 | Ga0496102_0023495 | 3300048905 | Bacteria | 5477 |
| 1711 | Ga0496102_0094375 | 3300048905 | Bacteria | 2772 |
| 1712 | Ga0496103_0003856 | 3300048906 | Bacteria | 9122 |
| 1713 | Ga0496103_0025210 | 3300048906 | Bacteria | 3593 |
| 1714 | Ga0496103_0030423 | 3300048906 | Bacteria | 3285 |
| 1715 | Ga0496103_0065050 | 3300048906 | Bacteria | 2274 |
| 1716 | Ga0496103_0180066 | 3300048906 | Bacteria | 1358 |
| 1717 | Ga0496104_0082539 | 3300048907 | Bacteria | 3065 |
| 1718 | Ga0496104_0169089 | 3300048907 | Bacteria | 2096 |
| 1719 | Ga0496104_0211420 | 3300048907 | Bacteria | 1851 |
| 1720 | Ga0496105_0097074 | 3300048908 | Bacteria | 2434 |
| 1721 | Ga0496105_0224954 | 3300048908 | Bacteria | 1526 |
| 1722 | Ga0496106_0003418 | 3300048909 | Bacteria | 11828 |
| 1723 | Ga0496106_0042385 | 3300048909 | Bacteria | 3414 |
| 1724 | Ga0496106_0160236 | 3300048909 | Bacteria | 1779 |
| 1725 | Ga0496106_0182554 | 3300048909 | Bacteria | 1666 |
| 1726 | Ga0496106_0302861 | 3300048909 | Bacteria | 1282 |
| 1727 | Ga0496107_0008872 | 3300048910 | Bacteria | 6966 |
| 1728 | Ga0496107_0014432 | 3300048910 | Bacteria | 5532 |
| 1729 | Ga0496108_0000870 | 3300048911 | Bacteria | 23533 |
| 1730 | Ga0496108_0108136 | 3300048911 | Bacteria | 2375 |
| 1731 | Ga0496109_0005839 | 3300048912 | Bacteria | 10321 |
| 1732 | Ga0496109_0023427 | 3300048912 | Bacteria | 5482 |
| 1733 | Ga0496109_0111543 | 3300048912 | Bacteria | 2543 |
| 1734 | Ga0496109_0120186 | 3300048912 | Bacteria | 2447 |
| 1735 | Ga0496109_0169013 | 3300048912 | Bacteria | 2051 |
| 1736 | Ga0496109_0501593 | 3300048912 | Bacteria | 1146 |
| 1737 | Ga0496110_0001741 | 3300048913 | Bacteria | 16058 |
| 1738 | Ga0496110_0002899 | 3300048913 | Bacteria | 12983 |
| 1739 | Ga0496110_0059733 | 3300048913 | Bacteria | 3361 |
| 1740 | Ga0496111_0037619 | 3300048914 | Bacteria | 3463 |
| 1741 | Ga0496111_0221310 | 3300048914 | Bacteria | 1406 |
| 1742 | Ga0496111_0227825 | 3300048914 | Bacteria | 1384 |
| 1743 | Ga0496111_0388518 | 3300048914 | Bacteria | 1032 |
| 1744 | Ga0496112_0344594 | 3300048915 | Bacteria | 1433 |
| 1745 | Ga0496112_0544014 | 3300048915 | Bacteria | 1095 |
| 1746 | Ga0496112_0582328 | 3300048915 | Bacteria | 1052 |
| 1747 | Ga0496113_0087979 | 3300048916 | Bacteria | 2389 |
| 1748 | Ga0496113_0130720 | 3300048916 | Bacteria | 1970 |
| 1749 | Ga0496113_0333523 | 3300048916 | Bacteria | 1216 |
| 1750 | Ga0496114_0001908 | 3300048917 | Bacteria | 15871 |
| 1751 | Ga0496114_0009802 | 3300048917 | Bacteria | 7611 |
| 1752 | Ga0496114_0010918 | 3300048917 | Bacteria | 7239 |
| 1753 | Ga0496114_0023986 | 3300048917 | Bacteria | 4977 |
| 1754 | Ga0496114_0051121 | 3300048917 | Bacteria | 3440 |
| 1755 | Ga0496114_0132819 | 3300048917 | Bacteria | 2151 |
| 1756 | Ga0496114_0265535 | 3300048917 | Bacteria | 1512 |
| 1757 | Ga0496115_0090752 | 3300048918 | Bacteria | 2496 |
| 1758 | Ga0496115_0291436 | 3300048918 | Bacteria | 1339 |
| 1759 | Ga0496116_0008971 | 3300048919 | Bacteria | 8599 |
| 1760 | Ga0496116_0054965 | 3300048919 | Bacteria | 2618 |
| 1761 | Ga0496116_0056200 | 3300048919 | Bacteria | 2581 |
| 1762 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 1763 | Ga0496117_0000054 | 3300048920 | Bacteria | 278013 |
| 1764 | Ga0496117_0077938 | 3300048920 | Bacteria | 2190 |
| 1765 | Ga0496117_0081202 | 3300048920 | Bacteria | 2129 |
| 1766 | Ga0496118_0000008 | 3300048921 | Bacteria | 644537 |
| 1767 | Ga0496118_0000045 | 3300048921 | Bacteria | 275165 |
| 1768 | Ga0496118_0028632 | 3300048921 | Bacteria | 4687 |
| 1769 | Ga0496118_0035124 | 3300048921 | Bacteria | 4076 |
| 1770 | Ga0496119_0000297 | 3300048922 | Bacteria | 69722 |
| 1771 | Ga0496119_0015657 | 3300048922 | Bacteria | 5819 |
| 1772 | Ga0496119_0079571 | 3300048922 | Bacteria | 1893 |
| 1773 | Ga0496120_0001653 | 3300048923 | Bacteria | 25763 |
| 1774 | Ga0496120_0024854 | 3300048923 | Bacteria | 3728 |
| 1775 | Ga0496120_0100607 | 3300048923 | Bacteria | 1528 |
| 1776 | Ga0496121_0002897 | 3300048924 | Bacteria | 25213 |
| 1777 | Ga0496121_0005334 | 3300048924 | Bacteria | 16527 |
| 1778 | Ga0496121_0011090 | 3300048924 | Bacteria | 10056 |
| 1779 | Ga0496121_0011103 | 3300048924 | Bacteria | 10053 |
| 1780 | Ga0496121_0015841 | 3300048924 | Bacteria | 7841 |
| 1781 | Ga0496121_0022299 | 3300048924 | Bacteria | 6155 |
| 1782 | Ga0496121_0135596 | 3300048924 | Bacteria | 1834 |
| 1783 | Ga0496121_0142416 | 3300048924 | Bacteria | 1776 |
| 1784 | Ga0496122_0000169 | 3300048925 | Bacteria | 155380 |
| 1785 | Ga0496122_0000249 | 3300048925 | Bacteria | 121066 |
| 1786 | Ga0496122_0000847 | 3300048925 | Bacteria | 57788 |
| 1787 | Ga0496122_0008495 | 3300048925 | Bacteria | 11059 |
| 1788 | Ga0496122_0013008 | 3300048925 | Bacteria | 8202 |
| 1789 | Ga0496122_0117199 | 3300048925 | Bacteria | 1729 |
| 1790 | Ga0496123_0000909 | 3300048926 | Bacteria | 46568 |
| 1791 | Ga0496123_0002226 | 3300048926 | Bacteria | 24595 |
| 1792 | Ga0496123_0002554 | 3300048926 | Bacteria | 22188 |
| 1793 | Ga0496123_0005545 | 3300048926 | Bacteria | 12652 |
| 1794 | Ga0496123_0012647 | 3300048926 | Bacteria | 7168 |
| 1795 | Ga0496123_0029996 | 3300048926 | Bacteria | 3990 |
| 1796 | Ga0496123_0103458 | 3300048926 | Bacteria | 1649 |
| 1797 | Ga0496124_0021421 | 3300048927 | Bacteria | 5956 |
| 1798 | Ga0496124_0129644 | 3300048927 | Bacteria | 2005 |
| 1799 | Ga0496124_0130056 | 3300048927 | Bacteria | 2001 |
| 1800 | Ga0496124_0145317 | 3300048927 | Bacteria | 1867 |
| 1801 | Ga0496124_0209894 | 3300048927 | Bacteria | 1474 |
| 1802 | Ga0496125_0000676 | 3300048928 | Bacteria | 56883 |
| 1803 | Ga0496125_0000812 | 3300048928 | Bacteria | 50762 |
| 1804 | Ga0496125_0001279 | 3300048928 | Bacteria | 37354 |
| 1805 | Ga0496125_0006029 | 3300048928 | Bacteria | 13256 |
| 1806 | Ga0496125_0007611 | 3300048928 | Bacteria | 11497 |
| 1807 | Ga0496125_0011048 | 3300048928 | Bacteria | 9061 |
| 1808 | Ga0496125_0019903 | 3300048928 | Bacteria | 6311 |
| 1809 | Ga0496125_0059606 | 3300048928 | Bacteria | 3074 |
| 1810 | Ga0496125_0248322 | 3300048928 | Bacteria | 1125 |
| 1811 | Ga0496126_0022848 | 3300048929 | Bacteria | 6072 |
| 1812 | Ga0496126_0029989 | 3300048929 | Bacteria | 5161 |
| 1813 | Ga0496126_0075257 | 3300048929 | Bacteria | 2997 |
| 1814 | Ga0496126_0232411 | 3300048929 | Bacteria | 1544 |
| 1815 | Ga0495678_000013 | 3300049459 | Bacteria | 316375 |
| 1816 | Ga0495678_000079 | 3300049459 | Bacteria | 122038 |
| 1817 | Ga0495678_000981 | 3300049459 | Bacteria | 24425 |
| 1818 | Ga0495678_002357 | 3300049459 | Bacteria | 12968 |
| 1819 | Ga0495678_005844 | 3300049459 | Bacteria | 6667 |
| 1820 | Ga0495678_006309 | 3300049459 | Bacteria | 6325 |
| 1821 | Ga0495678_046202 | 3300049459 | Bacteria | 1712 |
| 1822 | Ga0495682_0001431 | 3300049460 | Bacteria | 12906 |
| 1823 | Ga0495682_0012441 | 3300049460 | Bacteria | 3263 |
| 1824 | Ga0495682_0018400 | 3300049460 | Bacteria | 2631 |
| 1825 | Ga0501031_0001835 | 3300049568 | Bacteria | 13353 |
| 1826 | Ga0501032_0000036 | 3300049569 | Bacteria | 117044 |
| 1827 | Ga0501032_0003205 | 3300049569 | Bacteria | 12580 |
| 1828 | Ga0501032_0271260 | 3300049569 | Bacteria | 1099 |
| 1829 | Ga0501033_0002208 | 3300049570 | Bacteria | 16778 |
| 1830 | Ga0501033_0003067 | 3300049570 | Bacteria | 13882 |
| 1831 | Ga0501033_0006562 | 3300049570 | Bacteria | 9103 |
| 1832 | Ga0501034_0002523 | 3300049571 | Bacteria | 21945 |
| 1833 | Ga0501034_0026564 | 3300049571 | Bacteria | 5895 |
| 1834 | Ga0501036_0011654 | 3300049572 | Bacteria | 7287 |
| 1835 | Ga0501036_0040876 | 3300049572 | Bacteria | 3923 |
| 1836 | Ga0501036_0080670 | 3300049572 | Bacteria | 2750 |
| 1837 | Ga0501037_0000793 | 3300049573 | Bacteria | 23702 |
| 1838 | Ga0501037_0005568 | 3300049573 | Bacteria | 9183 |
| 1839 | Ga0501037_0083785 | 3300049573 | Bacteria | 2310 |
| 1840 | Ga0501038_0004695 | 3300049574 | Bacteria | 12711 |
| 1841 | Ga0501038_0005737 | 3300049574 | Bacteria | 11505 |
| 1842 | Ga0501038_0034864 | 3300049574 | Bacteria | 4422 |
| 1843 | Ga0501038_0036736 | 3300049574 | Bacteria | 4299 |
| 1844 | Ga0501039_0000386 | 3300049575 | Bacteria | 31668 |
| 1845 | Ga0501039_0005849 | 3300049575 | Bacteria | 9314 |
| 1846 | Ga0501039_0012218 | 3300049575 | Bacteria | 6546 |
| 1847 | Ga0501039_0013925 | 3300049575 | Bacteria | 6153 |
| 1848 | Ga0501039_0027225 | 3300049575 | Bacteria | 4396 |
| 1849 | Ga0501039_0084037 | 3300049575 | Bacteria | 2479 |
| 1850 | Ga0501039_0144347 | 3300049575 | Bacteria | 1870 |
| 1851 | Ga0501039_0146002 | 3300049575 | Bacteria | 1859 |
| 1852 | Ga0501039_0161925 | 3300049575 | Bacteria | 1759 |
| 1853 | Ga0501039_0288630 | 3300049575 | Bacteria | 1290 |
| 1854 | Ga0501039_0349290 | 3300049575 | Bacteria | 1162 |
| 1855 | Ga0501040_0000455 | 3300049576 | Bacteria | 24277 |
| 1856 | Ga0501040_0004740 | 3300049576 | Bacteria | 8825 |
| 1857 | Ga0501040_0008686 | 3300049576 | Bacteria | 6598 |
| 1858 | Ga0501040_0015767 | 3300049576 | Bacteria | 4996 |
| 1859 | Ga0501040_0017931 | 3300049576 | Bacteria | 4699 |
| 1860 | Ga0501040_0025609 | 3300049576 | Bacteria | 3967 |
| 1861 | Ga0501040_0100455 | 3300049576 | Bacteria | 2017 |
| 1862 | Ga0501040_0119241 | 3300049576 | Bacteria | 1850 |
| 1863 | Ga0501040_0310684 | 3300049576 | Bacteria | 1127 |
| 1864 | Ga0501041_0003215 | 3300049577 | Bacteria | 9390 |
| 1865 | Ga0501041_0004330 | 3300049577 | Bacteria | 8207 |
| 1866 | Ga0501041_0017877 | 3300049577 | Bacteria | 4219 |
| 1867 | Ga0501041_0022651 | 3300049577 | Bacteria | 3762 |
| 1868 | Ga0501041_0026794 | 3300049577 | Bacteria | 3470 |
| 1869 | Ga0501041_0037274 | 3300049577 | Bacteria | 2946 |
| 1870 | Ga0501042_0000031 | 3300049578 | Bacteria | 46017 |
| 1871 | Ga0501042_0007956 | 3300049578 | Bacteria | 6975 |
| 1872 | Ga0501042_0021847 | 3300049578 | Bacteria | 4465 |
| 1873 | Ga0501042_0051127 | 3300049578 | Bacteria | 2948 |
| 1874 | Ga0501042_0120917 | 3300049578 | Bacteria | 1885 |
| 1875 | Ga0501042_0128961 | 3300049578 | Bacteria | 1822 |
| 1876 | Ga0501042_0221755 | 3300049578 | Bacteria | 1364 |
| 1877 | Ga0501043_0000157 | 3300049579 | Bacteria | 62190 |
| 1878 | Ga0501043_0139362 | 3300049579 | Bacteria | 1900 |
| 1879 | Ga0501046_0001694 | 3300049580 | Bacteria | 21062 |
| 1880 | Ga0501046_0007774 | 3300049580 | Bacteria | 9406 |
| 1881 | Ga0501046_0021853 | 3300049580 | Bacteria | 5274 |
| 1882 | Ga0501046_0023907 | 3300049580 | Bacteria | 5019 |
| 1883 | Ga0501046_0054285 | 3300049580 | Bacteria | 3153 |
| 1884 | Ga0501046_0065898 | 3300049580 | Bacteria | 2824 |
| 1885 | Ga0501046_0149227 | 3300049580 | Bacteria | 1764 |
| 1886 | Ga0501047_0014303 | 3300049581 | Bacteria | 7547 |
| 1887 | Ga0501047_0077517 | 3300049581 | Bacteria | 3197 |
| 1888 | Ga0501048_0008923 | 3300049582 | Bacteria | 7549 |
| 1889 | Ga0501048_0023751 | 3300049582 | Bacteria | 4477 |
| 1890 | Ga0501048_0029291 | 3300049582 | Bacteria | 3993 |
| 1891 | Ga0501048_0097920 | 3300049582 | Bacteria | 2069 |
| 1892 | Ga0501067_0006809 | 3300049583 | Bacteria | 6339 |
| 1893 | Ga0501067_0021608 | 3300049583 | Bacteria | 3561 |
| 1894 | Ga0501067_0123725 | 3300049583 | Bacteria | 1440 |
| 1895 | Ga0501068_0002793 | 3300049584 | Bacteria | 9287 |
| 1896 | Ga0501068_0013939 | 3300049584 | Bacteria | 4585 |
| 1897 | Ga0501069_0036168 | 3300049585 | Bacteria | 2722 |
| 1898 | Ga0501069_0038859 | 3300049585 | Bacteria | 2628 |
| 1899 | Ga0501069_0141123 | 3300049585 | Bacteria | 1382 |
| 1900 | Ga0501070_0001696 | 3300049586 | Bacteria | 19515 |
| 1901 | Ga0501070_0007573 | 3300049586 | Bacteria | 9227 |
| 1902 | Ga0501070_0008433 | 3300049586 | Bacteria | 8705 |
| 1903 | Ga0501070_0133806 | 3300049586 | Bacteria | 2047 |
| 1904 | Ga0501071_0000686 | 3300049587 | Bacteria | 17688 |
| 1905 | Ga0501071_0001833 | 3300049587 | Bacteria | 12604 |
| 1906 | Ga0501071_0004638 | 3300049587 | Bacteria | 8724 |
| 1907 | Ga0501071_0009669 | 3300049587 | Bacteria | 6436 |
| 1908 | Ga0501071_0035993 | 3300049587 | Bacteria | 3529 |
| 1909 | Ga0501071_0046193 | 3300049587 | Bacteria | 3128 |
| 1910 | Ga0501071_0077313 | 3300049587 | Bacteria | 2431 |
| 1911 | Ga0501071_0093323 | 3300049587 | Bacteria | 2213 |
| 1912 | Ga0501072_0004342 | 3300049588 | Bacteria | 10759 |
| 1913 | Ga0501072_0026438 | 3300049588 | Bacteria | 4525 |
| 1914 | Ga0501072_0047153 | 3300049588 | Bacteria | 3393 |
| 1915 | Ga0501072_0049931 | 3300049588 | Bacteria | 3293 |
| 1916 | Ga0501072_0090907 | 3300049588 | Bacteria | 2423 |
| 1917 | Ga0501072_0192137 | 3300049588 | Bacteria | 1628 |
| 1918 | Ga0501072_0309186 | 3300049588 | Bacteria | 1256 |
| 1919 | Ga0501073_0000472 | 3300049589 | Bacteria | 27853 |
| 1920 | Ga0501073_0005363 | 3300049589 | Bacteria | 9608 |
| 1921 | Ga0501073_0055129 | 3300049589 | Bacteria | 2782 |
| 1922 | Ga0501073_0166225 | 3300049589 | Bacteria | 1528 |
| 1923 | Ga0501073_0221475 | 3300049589 | Bacteria | 1307 |
| 1924 | Ga0501074_0002836 | 3300049590 | Bacteria | 12136 |
| 1925 | Ga0501074_0005527 | 3300049590 | Bacteria | 9093 |
| 1926 | Ga0501074_0036301 | 3300049590 | Bacteria | 3571 |
| 1927 | Ga0501074_0100798 | 3300049590 | Bacteria | 2067 |
| 1928 | Ga0501074_0103298 | 3300049590 | Bacteria | 2040 |
| 1929 | Ga0501074_0189899 | 3300049590 | Bacteria | 1465 |
| 1930 | Ga0501074_0217459 | 3300049590 | Bacteria | 1361 |
| 1931 | Ga0501075_0000792 | 3300049591 | Bacteria | 19767 |
| 1932 | Ga0501075_0001305 | 3300049591 | Bacteria | 16161 |
| 1933 | Ga0501075_0002475 | 3300049591 | Bacteria | 12319 |
| 1934 | Ga0501075_0006009 | 3300049591 | Bacteria | 8319 |
| 1935 | Ga0501075_0014752 | 3300049591 | Bacteria | 5600 |
| 1936 | Ga0501075_0033278 | 3300049591 | Bacteria | 3835 |
| 1937 | Ga0501075_0045801 | 3300049591 | Bacteria | 3284 |
| 1938 | Ga0501075_0083095 | 3300049591 | Bacteria | 2426 |
| 1939 | Ga0501075_0223811 | 3300049591 | Bacteria | 1435 |
| 1940 | Ga0501076_0001408 | 3300049592 | Bacteria | 16105 |
| 1941 | Ga0501076_0007783 | 3300049592 | Bacteria | 7809 |
| 1942 | Ga0501076_0009825 | 3300049592 | Bacteria | 7072 |
| 1943 | Ga0501076_0093956 | 3300049592 | Bacteria | 2414 |
| 1944 | Ga0501076_0183345 | 3300049592 | Bacteria | 1707 |
| 1945 | Ga0501076_0315547 | 3300049592 | Bacteria | 1282 |
| 1946 | Ga0501077_0000280 | 3300049593 | Bacteria | 30354 |
| 1947 | Ga0501077_0005399 | 3300049593 | Bacteria | 7771 |
| 1948 | Ga0501077_0019320 | 3300049593 | Bacteria | 4310 |
| 1949 | Ga0501077_0093833 | 3300049593 | Bacteria | 1902 |
| 1950 | Ga0501217_049665 | 3300049661 | Bacteria | 1093 |
| 1951 | Ga0501249_003204 | 3300049679 | Bacteria | 3295 |
| 1952 | Ga0501079_0000811 | 3300049741 | Bacteria | 21278 |
| 1953 | Ga0501079_0001080 | 3300049741 | Bacteria | 18962 |
| 1954 | Ga0501079_0003255 | 3300049741 | Bacteria | 11903 |
| 1955 | Ga0501079_0007587 | 3300049741 | Bacteria | 8218 |
| 1956 | Ga0501079_0021711 | 3300049741 | Bacteria | 4913 |
| 1957 | Ga0501079_0182909 | 3300049741 | Bacteria | 1636 |
| 1958 | Ga0501080_0001568 | 3300049742 | Bacteria | 19339 |
| 1959 | Ga0501080_0003790 | 3300049742 | Bacteria | 13348 |
| 1960 | Ga0501080_0013669 | 3300049742 | Bacteria | 7474 |
| 1961 | Ga0501080_0016016 | 3300049742 | Bacteria | 6919 |
| 1962 | Ga0501080_0016298 | 3300049742 | Bacteria | 6861 |
| 1963 | Ga0501080_0165362 | 3300049742 | Bacteria | 2042 |
| 1964 | Ga0501080_0232048 | 3300049742 | Bacteria | 1686 |
| 1965 | Ga0501080_0365415 | 3300049742 | Bacteria | 1301 |
| 1966 | Ga0501081_0003604 | 3300049743 | Bacteria | 9904 |
| 1967 | Ga0501081_0005175 | 3300049743 | Bacteria | 8395 |
| 1968 | Ga0501081_0005236 | 3300049743 | Bacteria | 8356 |
| 1969 | Ga0501081_0013740 | 3300049743 | Bacteria | 5325 |
| 1970 | Ga0501083_0024949 | 3300049744 | Bacteria | 4141 |
| 1971 | Ga0501083_0047057 | 3300049744 | Bacteria | 2916 |
| 1972 | Ga0501083_0063656 | 3300049744 | Bacteria | 2460 |
| 1973 | Ga0501269_000103 | 3300049766 | Bacteria | 26706 |
| 1974 | Ga0501035_0000889 | 3300049822 | Bacteria | 31637 |
| 1975 | Ga0501035_0004008 | 3300049822 | Bacteria | 14050 |
| 1976 | Ga0501044_0002064 | 3300049823 | Bacteria | 23156 |
| 1977 | Ga0501044_0039558 | 3300049823 | Bacteria | 4919 |
| 1978 | Ga0501044_0066246 | 3300049823 | Bacteria | 3683 |
| 1979 | Ga0501045_0000607 | 3300049824 | Bacteria | 22605 |
| 1980 | Ga0501045_0013028 | 3300049824 | Bacteria | 5862 |
| 1981 | Ga0501045_0013215 | 3300049824 | Bacteria | 5824 |
| 1982 | Ga0501045_0015134 | 3300049824 | Bacteria | 5475 |
| 1983 | Ga0501045_0017936 | 3300049824 | Bacteria | 5026 |
| 1984 | Ga0501045_0022316 | 3300049824 | Bacteria | 4531 |
| 1985 | Ga0501045_0043656 | 3300049824 | Bacteria | 3265 |
| 1986 | Ga0501045_0056885 | 3300049824 | Bacteria | 2861 |
| 1987 | nmdc:mga03683_13573_c2 | 3300050489 | Bacteria | 2272 |
| 1988 | nmdc:mga00v17_1091_c1 | 3300050491 | Bacteria | 14290 |
| 1989 | nmdc:mga0k408_221_c1 | 3300050493 | Bacteria | 30239 |
| 1990 | nmdc:mga0k408_255643_c1 | 3300050493 | Bacteria | 1046 |
| 1991 | nmdc:mga0k408_36994_c1 | 3300050493 | Bacteria | 2801 |
| 1992 | nmdc:mga05p37_22213_c1 | 3300050507 | Bacteria | 7692 |
| 1993 | nmdc:mga05p37_286680_c1 | 3300050507 | Bacteria | 1961 |
| 1994 | nmdc:mga05p37_37857_c1 | 3300050507 | Bacteria | 5916 |
| 1995 | nmdc:mga05p37_467917_c1 | 3300050507 | Bacteria | 1455 |
| 1996 | nmdc:mga05p37_9357_c1 | 3300050507 | Bacteria | 11596 |
| 1997 | nmdc:mga09592_21320_c1 | 3300050508 | Bacteria | 5341 |
| 1998 | nmdc:mga09592_303696_c1 | 3300050508 | Bacteria | 1384 |
| 1999 | nmdc:mga09592_315_c1 | 3300050508 | Bacteria | 35276 |
| 2000 | nmdc:mga09592_58811_c1 | 3300050508 | Bacteria | 3250 |
| 2001 | nmdc:mga09592_61744_c1 | 3300050508 | Bacteria | 3170 |
| 2002 | nmdc:mga09592_78890_c1 | 3300050508 | Bacteria | 2803 |
| 2003 | nmdc:mga0qj67_108197_c1 | 3300050509 | Bacteria | 2243 |
| 2004 | nmdc:mga0qj67_17411_c1 | 3300050509 | Bacteria | 5463 |
| 2005 | nmdc:mga0qj67_274657_c1 | 3300050509 | Bacteria | 1366 |
| 2006 | nmdc:mga0qj67_2981_c1 | 3300050509 | Bacteria | 12149 |
| 2007 | nmdc:mga0qj67_321855_c1 | 3300050509 | Bacteria | 1252 |
| 2008 | nmdc:mga0qj67_39720_c1 | 3300050509 | Bacteria | 3697 |
| 2009 | nmdc:mga0qj67_66701_c1 | 3300050509 | Bacteria | 2867 |
| 2010 | nmdc:mga06r32_10212_c1 | 3300050510 | Bacteria | 8474 |
| 2011 | nmdc:mga06r32_19839_c1 | 3300050510 | Bacteria | 6178 |
| 2012 | nmdc:mga06r32_22391_c1 | 3300050510 | Bacteria | 5842 |
| 2013 | nmdc:mga06r32_499338_c1 | 3300050510 | Bacteria | 1194 |
| 2014 | nmdc:mga06r32_506616_c1 | 3300050510 | Bacteria | 1184 |
| 2015 | nmdc:mga06r32_52552_c1 | 3300050510 | Bacteria | 3902 |
| 2016 | nmdc:mga06r32_747_c1 | 3300050510 | Bacteria | 28538 |
| 2017 | nmdc:mga06r32_7750_c2 | 3300050510 | Bacteria | 7874 |
| 2018 | nmdc:mga08y16_121355_c1 | 3300050511 | Bacteria | 2720 |
| 2019 | nmdc:mga08y16_1255_c1 | 3300050511 | Bacteria | 25165 |
| 2020 | nmdc:mga08y16_14446_c1 | 3300050511 | Bacteria | 8305 |
| 2021 | nmdc:mga08y16_180689_c1 | 3300050511 | Bacteria | 2191 |
| 2022 | nmdc:mga08y16_204795_c1 | 3300050511 | Bacteria | 2044 |
| 2023 | nmdc:mga08y16_259436_c1 | 3300050511 | Bacteria | 1795 |
| 2024 | nmdc:mga08y16_385253_c1 | 3300050511 | Bacteria | 1437 |
| 2025 | nmdc:mga08y16_523719_c1 | 3300050511 | Bacteria | 1202 |
| 2026 | nmdc:mga08y16_646398_c1 | 3300050511 | Bacteria | 1062 |
| 2027 | nmdc:mga08y16_66776_c1 | 3300050511 | Bacteria | 3754 |
| 2028 | nmdc:mga08y16_7261_c1 | 3300050511 | Bacteria | 11631 |
| 2029 | nmdc:mga08y16_76782_c1 | 3300050511 | Bacteria | 3482 |
| 2030 | nmdc:mga0n895_426686_c1 | 3300050512 | Bacteria | 1340 |
| 2031 | nmdc:mga0n895_5209_c1 | 3300050512 | Bacteria | 10825 |
| 2032 | nmdc:mga0n895_60056_c1 | 3300050512 | Bacteria | 3751 |
| 2033 | nmdc:mga0rr50_11716_c1 | 3300050513 | Bacteria | 5628 |
| 2034 | nmdc:mga0rr50_80686_c1 | 3300050513 | Bacteria | 2509 |
| 2035 | nmdc:mga08x19_147225_c1 | 3300050514 | Bacteria | 1593 |
| 2036 | nmdc:mga08x19_25457_c1 | 3300050514 | Bacteria | 3685 |
| 2037 | nmdc:mga0a205_312544_c1 | 3300050515 | Bacteria | 1443 |
| 2038 | nmdc:mga0a205_331783_c1 | 3300050515 | Bacteria | 1391 |
| 2039 | nmdc:mga0a205_3868_c1 | 3300050515 | Bacteria | 13412 |
| 2040 | nmdc:mga0a205_438473_c1 | 3300050515 | Bacteria | 1167 |
| 2041 | nmdc:mga0a205_8456_c1 | 3300050515 | Bacteria | 9365 |
| 2042 | Ga0495601_0010336 | 3300053077 | Bacteria | 5552 |
| 2043 | Ga0495601_0013881 | 3300053077 | Bacteria | 4850 |
| 2044 | Ga0495601_0063437 | 3300053077 | Bacteria | 2348 |
| 2045 | Ga0500610_0000737 | 3300053079 | Bacteria | 10233 |
| 2046 | Ga0495595_0023181 | 3300053084 | Bacteria | 2730 |
| 2047 | Ga0495619_0048350 | 3300053085 | Bacteria | 2803 |
| 2048 | Ga0495619_0058679 | 3300053085 | Bacteria | 2555 |
| 2049 | Ga0495619_0112164 | 3300053085 | Bacteria | 1864 |
| 2050 | Ga0500641_0019869 | 3300053096 | Bacteria | 2544 |
| 2051 | Ga0500556_0000442 | 3300053104 | Bacteria | 29531 |
| 2052 | Ga0500594_0031812 | 3300053118 | Bacteria | 1394 |
| 2053 | Ga0500595_004294 | 3300053119 | Bacteria | 6423 |
| 2054 | Ga0500607_037246 | 3300053121 | Bacteria | 2652 |
| 2055 | Ga0500617_076143 | 3300053124 | Bacteria | 1461 |
| 2056 | Ga0500618_000965 | 3300053125 | Bacteria | 14663 |
| 2057 | Ga0500618_001599 | 3300053125 | Bacteria | 9847 |
| 2058 | Ga0500652_044821 | 3300053131 | Bacteria | 1791 |
| 2059 | Ga0500658_0007263 | 3300053134 | Bacteria | 4092 |
| 2060 | Ga0500586_000082 | 3300053145 | Bacteria | 16424 |
| 2061 | Ga0500588_0004325 | 3300053146 | Bacteria | 3071 |
| 2062 | Ga0500588_0011465 | 3300053146 | Bacteria | 2170 |
| 2063 | Ga0500589_094792 | 3300053147 | Bacteria | 1307 |
| 2064 | Ga0500622_0009746 | 3300053156 | Bacteria | 5306 |
| 2065 | Ga0500634_0026773 | 3300053161 | Bacteria | 3142 |
| 2066 | Ga0500636_0000369 | 3300053177 | Bacteria | 24646 |
| 2067 | Ga0500637_0001512 | 3300053178 | Bacteria | 9916 |
| 2068 | Ga0500637_0025044 | 3300053178 | Bacteria | 3274 |
| 2069 | Ga0500656_007160 | 3300053732 | Bacteria | 1152 |
| 2070 | Ga0501084_0001292 | 3300054114 | Bacteria | 19723 |
| 2071 | Ga0501084_0005101 | 3300054114 | Bacteria | 10747 |
| 2072 | Ga0501084_0012672 | 3300054114 | Bacteria | 6986 |
| 2073 | Ga0501084_0045939 | 3300054114 | Bacteria | 3656 |
| 2074 | Ga0501084_0079860 | 3300054114 | Bacteria | 2742 |
| 2075 | Ga0501084_0121784 | 3300054114 | Bacteria | 2193 |
| 2076 | Ga0501082_0009014 | 3300060353 | Bacteria | 8608 |
| 2077 | Ga0501082_0011508 | 3300060353 | Bacteria | 7616 |
| 2078 | Ga0501082_0058549 | 3300060353 | Bacteria | 3319 |
| 2079 | Ga0501082_0065570 | 3300060353 | Bacteria | 3127 |
| 2080 | Ga0501082_0179140 | 3300060353 | Bacteria | 1843 |
| 2081 | Ga0466962_0001556 | 3300061719 | Bacteria | 10706 |
| 2082 | Ga0466962_0004761 | 3300061719 | Bacteria | 6523 |
| 2083 | Ga0466962_0051937 | 3300061719 | Bacteria | 1960 |
| 2084 | Ga0530510_0001249 | 3300061734 | Bacteria | 16977 |
| 2085 | Ga0530510_0003476 | 3300061734 | Bacteria | 10827 |
| 2086 | Ga0530510_0006355 | 3300061734 | Bacteria | 8221 |
| 2087 | Ga0530510_0007480 | 3300061734 | Bacteria | 7606 |
| 2088 | Ga0530510_0151846 | 3300061734 | Bacteria | 1711 |
| 2089 | Ga0530510_0243398 | 3300061734 | Bacteria | 1339 |
| 2090 | 2501071044 | 2501025501 | Bacteria | 7768574 |
| 2091 | 2501078765 | 2501025502 | Bacteria | 9641094 |
| 2092 | 2501413916 | 2501025504 | Bacteria | 8008976 |
| 2093 | 2509130198 | 2508501125 | Bacteria | 7208311 |
| 2094 | 2510252157 | 2510065045 | Bacteria | 7761063 |
| 2095 | 2511089410 | 2510917013 | Bacteria | 9951648 |
| 2096 | 2511094820 | 2510917014 | Bacteria | 8296963 |
| 2097 | 2511104519 | 2510917015 | Bacteria | 7950052 |
| 2098 | 2511248143 | 2511231003 | Bacteria | 5606035 |
| 2099 | 2511387018 | 2511231026 | Bacteria | 5225445 |
| 2100 | 2513551629 | 2513237082 | Bacteria | 8640282 |
| 2101 | 2513563805 | 2513237083 | Bacteria | 8410967 |
| 2102 | 2513954086 | 2513237150 | Bacteria | 6553639 |
| 2103 | 2513963084 | 2513237151 | Bacteria | 6309801 |
| 2104 | 2514040213 | 2513237165 | Bacteria | 6771773 |
| 2105 | 2514047533 | 2513237166 | Bacteria | 10373764 |
| 2106 | 2515682696 | 2515154122 | Bacteria | 8609520 |
| 2107 | 2515691270 | 2515154123 | Bacteria | 6387382 |
| 2108 | 2516017028 | 2515154189 | Bacteria | 9629850 |
| 2109 | 2519459604 | 2519103095 | Bacteria | 6629912 |
| 2110 | 2521556771 | 2521172590 | Bacteria | 5047645 |
| 2111 | 2550697282 | 2548876994 | Bacteria | 4904866 |
| 2112 | 2553004537 | 2551306416 | Bacteria | 6152985 |
| 2113 | 2585291189 | 2582581311 | Bacteria | 6763856 |
| 2114 | 2600814591 | 2600255067 | Bacteria | 6795583 |
| 2115 | 2601670644 | 2600255292 | Bacteria | 6300551 |
| 2116 | 2644027893 | 2643221603 | Bacteria | 6147767 |
| 2117 | 2644059880 | 2643221609 | Bacteria | 6756331 |
| 2118 | 2644074499 | 2643221611 | Bacteria | 6820941 |
| 2119 | 2644250888 | 2643221645 | Bacteria | 7207331 |
| 2120 | 2644356307 | 2643221664 | Bacteria | 7272945 |
| 2121 | 2644644580 | 2643221717 | Bacteria | 5676132 |
| 2122 | 2691331001 | 2690315857 | Bacteria | 4396207 |
| 2123 | 2738739051 | 2738541280 | Bacteria | 6630198 |
| 2124 | 2738846283 | 2738541300 | Bacteria | 6675882 |
| 2125 | 2739275068 | 2738543018 | Bacteria | 6718814 |
| 2126 | 2739344112 | 2738543030 | Bacteria | 6719714 |
| 2127 | 2765567963 | 2765235838 | Bacteria | 5445269 |
| 2128 | 2792840267 | 2791355137 | Bacteria | 9654227 |
| 2129 | 2808943045 | 2808606379 | Bacteria | 5022697 |
| 2130 | 2808983813 | 2808606386 | Bacteria | 4471946 |
| 2131 | 2809129485 | 2808606415 | Bacteria | 4576710 |
| 2132 | 2809149460 | 2808606419 | Bacteria | 4576925 |
| 2133 | 2817261882 | 2816332253 | Bacteria | 6764532 |
| 2134 | 2817279586 | 2816332256 | Bacteria | 6891714 |
| 2135 | 2817454338 | 2816332286 | Bacteria | 6853759 |
| 2136 | 2819542989 | 2818991436 | Bacteria | 5376622 |
| 2137 | 2819592493 | 2818991445 | Bacteria | 4955017 |
| 2138 | 2819618620 | 2818991449 | Bacteria | 5518009 |
| 2139 | 2821134042 | 2821131069 | Bacteria | 6108407 |
| 2140 | 2839097747 | 2839094727 | Bacteria | 5534556 |
| 2141 | 2846037039 | 2846033681 | Bacteria | 4377894 |
| 2142 | 2846040170 | 2846037992 | Bacteria | 4526407 |
| 2143 | 2846542968 | 2846540461 | Bacteria | 5471451 |
| 2144 | 2852619607 | 2852618963 | Bacteria | 4577824 |
| 2145 | 2856292254 | 2856287931 | Bacteria | 7223934 |
| 2146 | 2857365768 | 2857357740 | Bacteria | 9937880 |
| 2147 | 2857548011 | 2857547612 | Bacteria | 6179999 |
| 2148 | 2857556502 | 2857553236 | Bacteria | 6166726 |
| 2149 | 2858696555 | 2858688981 | Bacteria | 8184122 |
| 2150 | 2883094783 | 2883087390 | Bacteria | 9532701 |
| 2151 | 2884814660 | 2884811622 | Bacteria | 5552861 |
| 2152 | 2884839019 | 2884836552 | Bacteria | 5219991 |
| 2153 | 2884855310 | 2884852848 | Bacteria | 5221161 |
| 2154 | 2885080732 | 2885080285 | Bacteria | 6355622 |
| 2155 | 2885273964 | 2885270888 | Bacteria | 9831543 |
| 2156 | 2887632750 | 2887630918 | Bacteria | 3239855 |
| 2157 | 2894024515 | 2894023352 | Bacteria | 5167372 |
| 2158 | 2894510783 | 2894510363 | Bacteria | 5121143 |
| 2159 | 2896159183 | 2896154374 | Bacteria | 5221518 |
| 2160 | 2902687255 | 2902682994 | Bacteria | 8951596 |
| 2161 | 2904429152 | 2904424332 | Bacteria | 7633521 |
| 2162 | 2904440652 | 2904439833 | Bacteria | 5931679 |
| 2163 | 2904535756 | 2904530477 | Bacteria | 5876334 |
| 2164 | 2904586083 | 2904584206 | Bacteria | 6028872 |
| 2165 | 2904592104 | 2904589729 | Bacteria | 6113573 |
| 2166 | 2904601739 | 2904601388 | Bacteria | 5884906 |
| 2167 | 2919049575 | 2919046199 | Bacteria | 5567169 |
| 2168 | 2919084806 | 2919079590 | Bacteria | 5946433 |
| 2169 | 2919480736 | 2919476304 | Bacteria | 5888696 |
| 2170 | 2919493882 | 2919493220 | Bacteria | 4598500 |
| 2171 | 2919499364 | 2919497567 | Bacteria | 4408621 |
| 2172 | 2919534562 | 2919534386 | Bacteria | 4577686 |
| 2173 | 2919545763 | 2919543075 | Bacteria | 4728703 |
| 2174 | 2923515363 | 2923510766 | Bacteria | 5926163 |
| 2175 | 2923527471 | 2923525760 | Bacteria | 4472324 |
| 2176 | 2928132422 | 2928130867 | Bacteria | 5467269 |
| 2177 | 2932412602 | 2932410948 | Bacteria | 6312192 |
| 2178 | 2932420117 | 2932416698 | Bacteria | 6315112 |
| 2179 | 2998348351 | 2998344455 | Bacteria | 4222996 |
| 2180 | 639788380 | 639633007 | Bacteria | 4376040 |
| 2181 | 644746875 | 644736347 | Bacteria | 6476522 |
| 2182 | 8003960505 | 8003955200 | Bacteria | 8601927 |
| 2183 | 8020808261 | 8020807995 | Bacteria | 6801506 |
| 2184 | 8040169009 | 8040167225 | Bacteria | 6542727 |
| 2185 | 8040179290 | 8040173305 | Bacteria | 6827067 |
| 2186 | Ga0068861_100001382 | |||
| 2187 | SwRhRL2b_contig_637244 | |||
| 2188 | JGI25155J39150_1000136 | |||
| 2189 | JGI25155J39150_1000346 | |||
| 2190 | JGI25156J39149_1000156 | |||
| 2191 | JGI25156J39149_1010186 | |||
| 2192 | JGI25162J39368_1000025 | |||
| 2193 | JGI25162J39368_1006852 | |||
| 2194 | JGI25154J39366_1000430 | |||
| 2195 | JGI25154J39366_1000531 | |||
| 2196 | JGI25157J39369_1000277 | |||
| 2197 | JGI25157J39369_1008646 | |||
| 2198 | JGI25152J39213_1000113 | |||
| 2199 | JGI25151J46595_10045536 | |||
| 2200 | JGI25165J46597_1000054 | |||
| 2201 | rootH1_10044520 | |||
| 2202 | rootL2_10003689 | |||
| 2203 | rootH1_10039841 | |||
| 2204 | Ga0055538_1000008 | |||
| 2205 | Ga0055538_1000026 | |||
| 2206 | Ga0055539_1000012 | |||
| 2207 | Ga0055539_1000033 | |||
| 2208 | Ga0055533_1000015 | |||
| 2209 | Ga0055533_1000044 | |||
| 2210 | Ga0055532_1000005 | |||
| 2211 | Ga0055525_1000017 | |||
| 2212 | Ga0055525_1000052 | |||
| 2213 | Ga0055535_1004655 | |||
| 2214 | Ga0055526_1000129 | |||
| 2215 | Ga0055526_1008158 | |||
| 2216 | Ga0055537_1000156 | |||
| 2217 | Ga0055537_1000223 | |||
| 2218 | Ga0055524_1000029 | |||
| 2219 | Ga0055524_1000824 | |||
| 2220 | Ga0055534_1000230 | |||
| 2221 | Ga0055534_1000632 | |||
| 2222 | Ga0055528_1000341 | |||
| 2223 | Ga0055541_1000009 | |||
| 2224 | Ga0055541_1000049 | |||
| 2225 | Ga0055543_1002523 | |||
| 2226 | Ga0065165_1000050 | |||
| 2227 | Ga0065165_1001239 | |||
| 2228 | Ga0065714_10071968 | |||
| 2229 | Ga0065704_10100794 | |||
| 2230 | Ga0065712_10085621 | |||
| 2231 | Ga0065707_10000575 | |||
| 2232 | Ga0065707_10002291 | |||
| 2233 | Ga0065707_10190954 | |||
| 2234 | Ga0070676_10008532 | |||
| 2235 | Ga0070676_10025203 | |||
| 2236 | Ga0070676_10051702 | |||
| 2237 | Ga0070676_10110602 | |||
| 2238 | Ga0070683_100515260 | |||
| 2239 | Ga0070683_100604523 | |||
| 2240 | Ga0070690_100007662 | |||
| 2241 | Ga0070690_100013534 | |||
| 2242 | Ga0070690_100018489 | |||
| 2243 | Ga0070690_100020957 | |||
| 2244 | Ga0070690_100072859 | |||
| 2245 | Ga0070670_100000633 | |||
| 2246 | Ga0070670_100001609 | |||
| 2247 | Ga0070670_100016449 | |||
| 2248 | Ga0070670_100017843 | |||
| 2249 | Ga0070670_100020260 | |||
| 2250 | Ga0070670_100063985 | |||
| 2251 | Ga0070670_100120482 | |||
| 2252 | Ga0070670_100236968 | |||
| 2253 | Ga0070677_10016184 | |||
| 2254 | Ga0070677_10016731 | |||
| 2255 | Ga0070677_10053548 | |||
| 2256 | Ga0068869_100001563 | |||
| 2257 | Ga0068869_100153854 | |||
| 2258 | Ga0068869_100430261 | |||
| 2259 | Ga0070666_10007516 | |||
| 2260 | Ga0070666_10010612 | |||
| 2261 | Ga0070666_10042685 | |||
| 2262 | Ga0070666_10084826 | |||
| 2263 | Ga0070666_10101206 | |||
| 2264 | Ga0070666_10207289 | |||
| 2265 | Ga0070680_100055192 | |||
| 2266 | Ga0070680_100078763 | |||
| 2267 | Ga0070680_100168296 | |||
| 2268 | Ga0070680_100240115 | |||
| 2269 | Ga0070682_100092547 | |||
| 2270 | Ga0068868_100000807 | |||
| 2271 | Ga0068868_100001147 | |||
| 2272 | Ga0068868_100068614 | |||
| 2273 | Ga0068868_100333480 | |||
| 2274 | Ga0070660_100005509 | |||
| 2275 | Ga0070660_100027230 | |||
| 2276 | Ga0070689_100005128 | |||
| 2277 | Ga0070689_100417583 | |||
| 2278 | Ga0070687_100136906 | |||
| 2279 | Ga0070661_100002263 | |||
| 2280 | Ga0070661_100050285 | |||
| 2281 | Ga0070661_100062228 | |||
| 2282 | Ga0070661_100077123 | |||
| 2283 | Ga0070661_100383580 | |||
| 2284 | Ga0070692_10013609 | |||
| 2285 | Ga0070692_10019466 | |||
| 2286 | Ga0070692_10030016 | |||
| 2287 | Ga0070668_100003121 | |||
| 2288 | Ga0070668_100018583 | |||
| 2289 | Ga0070668_100063651 | |||
| 2290 | Ga0070668_100085647 | |||
| 2291 | Ga0070668_100135195 | |||
| 2292 | Ga0070668_100143969 | |||
| 2293 | Ga0070668_100328630 | |||
| 2294 | Ga0070669_100006519 | |||
| 2295 | Ga0070669_100023970 | |||
| 2296 | Ga0070669_100038713 | |||
| 2297 | Ga0070669_100164069 | |||
| 2298 | Ga0070669_100222985 | |||
| 2299 | Ga0070675_100000783 | |||
| 2300 | Ga0070675_100002509 | |||
| 2301 | Ga0070675_100008395 | |||
| 2302 | Ga0070675_100017563 | |||
| 2303 | Ga0070675_100018880 | |||
| 2304 | Ga0070675_100089061 | |||
| 2305 | Ga0070675_100117136 | |||
| 2306 | Ga0070675_100132751 | |||
| 2307 | Ga0070675_100163678 | |||
| 2308 | Ga0070675_100179809 | |||
| 2309 | Ga0070671_100000128 | |||
| 2310 | Ga0070671_100001372 | |||
| 2311 | Ga0070671_100005466 | |||
| 2312 | Ga0070671_100030200 | |||
| 2313 | Ga0070671_100068872 | |||
| 2314 | Ga0070671_100161273 | |||
| 2315 | Ga0070674_100037101 | |||
| 2316 | Ga0070674_100057351 | |||
| 2317 | Ga0070674_100078994 | |||
| 2318 | Ga0070674_100202216 | |||
| 2319 | Ga0070674_100316970 | |||
| 2320 | Ga0070673_100005763 | |||
| 2321 | Ga0070673_100014207 | |||
| 2322 | Ga0070673_100028391 | |||
| 2323 | Ga0070673_100222274 | |||
| 2324 | Ga0070673_100519437 | |||
| 2325 | Ga0070688_100083773 | |||
| 2326 | Ga0070688_100114136 | |||
| 2327 | Ga0070659_100005049 | |||
| 2328 | Ga0070659_100014648 | |||
| 2329 | Ga0070659_100027629 | |||
| 2330 | Ga0070667_100000052 | |||
| 2331 | Ga0070667_100048364 | |||
| 2332 | Ga0070667_100061546 | |||
| 2333 | Ga0070667_100071115 | |||
| 2334 | Ga0070667_100125180 | |||
| 2335 | Ga0070667_100205062 | |||
| 2336 | Ga0070709_10014713 | |||
| 2337 | Ga0070714_100011747 | |||
| 2338 | Ga0070713_100000045 | |||
| 2339 | Ga0070713_100020371 | |||
| 2340 | Ga0070710_10001552 | |||
| 2341 | Ga0070710_10100547 | |||
| 2342 | Ga0070701_10028035 | |||
| 2343 | Ga0070701_10051835 | |||
| 2344 | Ga0070701_10099871 | |||
| 2345 | Ga0070711_100000979 | |||
| 2346 | Ga0070711_100255271 | |||
| 2347 | Ga0070705_100025129 | |||
| 2348 | Ga0070705_100029556 | |||
| 2349 | Ga0070705_100046639 | |||
| 2350 | Ga0070705_100123843 | |||
| 2351 | Ga0070705_100160790 | |||
| 2352 | Ga0070705_100198605 | |||
| 2353 | Ga0070700_100000396 | |||
| 2354 | Ga0070700_100008805 | |||
| 2355 | Ga0070700_100075575 | |||
| 2356 | Ga0070700_100118476 | |||
| 2357 | Ga0070700_100170436 | |||
| 2358 | Ga0070694_100006107 | |||
| 2359 | Ga0070694_100011182 | |||
| 2360 | Ga0070694_100138562 | |||
| 2361 | Ga0070694_100288708 | |||
| 2362 | Ga0070708_100159991 | |||
| 2363 | Ga0070708_100214483 | |||
| 2364 | Ga0070708_100541720 | |||
| 2365 | Ga0070663_100098582 | |||
| 2366 | Ga0070663_100126147 | |||
| 2367 | Ga0070663_100134393 | |||
| 2368 | Ga0070678_100000463 | |||
| 2369 | Ga0070678_100074427 | |||
| 2370 | Ga0070678_100239553 | |||
| 2371 | Ga0070678_100271757 | |||
| 2372 | Ga0070678_100520236 | |||
| 2373 | Ga0070662_100035077 | |||
| 2374 | Ga0070662_100049496 | |||
| 2375 | Ga0070662_100069978 | |||
| 2376 | Ga0070662_100106050 | |||
| 2377 | Ga0070681_10000611 | |||
| 2378 | Ga0070681_10004528 | |||
| 2379 | Ga0070681_10070181 | |||
| 2380 | Ga0070681_10155279 | |||
| 2381 | Ga0070681_10160361 | |||
| 2382 | Ga0070681_10334616 | |||
| 2383 | Ga0068867_100013837 | |||
| 2384 | Ga0068867_100022066 | |||
| 2385 | Ga0068867_100027056 | |||
| 2386 | Ga0068867_100091467 | |||
| 2387 | Ga0068867_100166609 | |||
| 2388 | Ga0068867_100218794 | |||
| 2389 | Ga0068867_100251397 | |||
| 2390 | Ga0068867_100276704 | |||
| 2391 | Ga0070685_10135671 | |||
| 2392 | Ga0070706_100053743 | |||
| 2393 | Ga0070706_100148134 | |||
| 2394 | Ga0070706_100333276 | |||
| 2395 | Ga0070706_100395146 | |||
| 2396 | Ga0070707_100043483 | |||
| 2397 | Ga0070707_100458324 | |||
| 2398 | Ga0070698_100043148 | |||
| 2399 | Ga0070698_100209886 | |||
| 2400 | Ga0070698_100254665 | |||
| 2401 | Ga0070699_100162578 | |||
| 2402 | Ga0070679_100000602 | |||
| 2403 | Ga0070679_100011268 | |||
| 2404 | Ga0070679_100057543 | |||
| 2405 | Ga0070679_100084974 | |||
| 2406 | Ga0070679_100093957 | |||
| 2407 | Ga0070679_100205385 | |||
| 2408 | Ga0070684_100015628 | |||
| 2409 | Ga0070684_100023889 | |||
| 2410 | Ga0070684_100225660 | |||
| 2411 | Ga0070697_100012581 | |||
| 2412 | Ga0070697_100362198 | |||
| 2413 | Ga0068853_100089805 | |||
| 2414 | Ga0068853_100114170 | |||
| 2415 | Ga0068853_100142464 | |||
| 2416 | Ga0070672_100001093 | |||
| 2417 | Ga0070672_100007042 | |||
| 2418 | Ga0070672_100011072 | |||
| 2419 | Ga0070672_100073618 | |||
| 2420 | Ga0070672_100088301 | |||
| 2421 | Ga0070672_100090873 | |||
| 2422 | Ga0070672_100100022 | |||
| 2423 | Ga0070672_100121530 | |||
| 2424 | Ga0070672_100303564 | |||
| 2425 | Ga0070686_100026176 | |||
| 2426 | Ga0070686_100091550 | |||
| 2427 | Ga0070686_100315452 | |||
| 2428 | Ga0070695_100061566 | |||
| 2429 | Ga0070695_100062960 | |||
| 2430 | Ga0070695_100142281 | |||
| 2431 | Ga0070696_100040363 | |||
| 2432 | Ga0070696_100136994 | |||
| 2433 | Ga0070693_100169307 | |||
| 2434 | Ga0070665_100004349 | |||
| 2435 | Ga0070665_100007432 | |||
| 2436 | Ga0070665_100051901 | |||
| 2437 | Ga0070665_100080808 | |||
| 2438 | Ga0070665_100110207 | |||
| 2439 | Ga0070665_100220341 | |||
| 2440 | Ga0070665_100292897 | |||
| 2441 | Ga0070704_100000018 | |||
| 2442 | Ga0070704_100010603 | |||
| 2443 | Ga0070704_100024777 | |||
| 2444 | Ga0070704_100298246 | |||
| 2445 | Ga0070704_100335764 | |||
| 2446 | Ga0070704_100363017 | |||
| 2447 | Ga0068855_100001182 | |||
| 2448 | Ga0068855_100001706 | |||
| 2449 | Ga0068855_100002465 | |||
| 2450 | Ga0068855_100009248 | |||
| 2451 | Ga0068855_100014961 | |||
| 2452 | Ga0068855_100352464 | |||
| 2453 | Ga0070664_100000712 | |||
| 2454 | Ga0070664_100002382 | |||
| 2455 | Ga0070664_100005456 | |||
| 2456 | Ga0070664_100057493 | |||
| 2457 | Ga0070664_100095791 | |||
| 2458 | Ga0070664_100123823 | |||
| 2459 | Ga0070664_100218292 | |||
| 2460 | Ga0068857_100011829 | |||
| 2461 | Ga0068857_100163791 | |||
| 2462 | Ga0068857_100170142 | |||
| 2463 | Ga0068854_100001881 | |||
| 2464 | Ga0068854_100023240 | |||
| 2465 | Ga0068854_100076706 | |||
| 2466 | Ga0068854_100236407 | |||
| 2467 | Ga0068854_100237094 | |||
| 2468 | Ga0068856_100004553 | |||
| 2469 | Ga0068856_100025692 | |||
| 2470 | Ga0068856_100036576 | |||
| 2471 | Ga0068856_100040053 | |||
| 2472 | Ga0068856_100067169 | |||
| 2473 | Ga0068856_100094059 | |||
| 2474 | Ga0068856_100139945 | |||
| 2475 | Ga0068856_100307555 | |||
| 2476 | Ga0068856_100377852 | |||
| 2477 | Ga0070702_100000536 | |||
| 2478 | Ga0070702_100012238 | |||
| 2479 | Ga0070702_100026041 | |||
| 2480 | Ga0070702_100132516 | |||
| 2481 | Ga0068852_100001103 | |||
| 2482 | Ga0068852_100017508 | |||
| 2483 | Ga0068859_100003776 | |||
| 2484 | Ga0068859_100009497 | |||
| 2485 | Ga0068859_100023708 | |||
| 2486 | Ga0068859_100077712 | |||
| 2487 | Ga0068859_100120205 | |||
| 2488 | Ga0068859_100168757 | |||
| 2489 | Ga0068859_100271922 | |||
| 2490 | Ga0068864_100002031 | |||
| 2491 | Ga0068864_100010073 | |||
| 2492 | Ga0068864_100022732 | |||
| 2493 | Ga0068864_100023356 | |||
| 2494 | Ga0068864_100064135 | |||
| 2495 | Ga0068864_100121236 | |||
| 2496 | Ga0068864_100203346 | |||
| 2497 | Ga0068864_100217787 | |||
| 2498 | Ga0068864_100240406 | |||
| 2499 | Ga0068864_100245706 | |||
| 2500 | Ga0068864_100431323 | |||
| 2501 | Ga0068866_10000717 | |||
| 2502 | Ga0068866_10003912 | |||
| 2503 | Ga0068866_10051421 | |||
| 2504 | Ga0068866_10062206 | |||
| 2505 | Ga0068866_10187591 | |||
| 2506 | Ga0068861_100012489 | |||
| 2507 | Ga0068861_100015622 | |||
| 2508 | Ga0068861_100016209 | |||
| 2509 | Ga0068861_100029458 | |||
| 2510 | Ga0068861_100160014 | |||
| 2511 | Ga0068861_100195762 | |||
| 2512 | Ga0068861_100196842 | |||
| 2513 | Ga0068861_100287360 | |||
| 2514 | Ga0068851_10003231 | |||
| 2515 | Ga0068851_10038885 | |||
| 2516 | Ga0068851_10042935 | |||
| 2517 | Ga0068870_10037587 | |||
| 2518 | Ga0068863_100001012 | |||
| 2519 | Ga0068863_100002456 | |||
| 2520 | Ga0068863_100010910 | |||
| 2521 | Ga0068863_100021801 | |||
| 2522 | Ga0068863_100042478 | |||
| 2523 | Ga0068863_100069864 | |||
| 2524 | Ga0068863_100077118 | |||
| 2525 | Ga0068863_100088880 | |||
| 2526 | Ga0068863_100138272 | |||
| 2527 | Ga0068863_100187450 | |||
| 2528 | Ga0068863_100193491 | |||
| 2529 | Ga0068863_100422239 | |||
| 2530 | Ga0068858_100000838 | |||
| 2531 | Ga0068858_100001334 | |||
| 2532 | Ga0068858_100003187 | |||
| 2533 | Ga0068858_100049450 | |||
| 2534 | Ga0068858_100056595 | |||
| 2535 | Ga0068858_100123497 | |||
| 2536 | Ga0068858_100416596 | |||
| 2537 | Ga0068858_100473361 | |||
| 2538 | Ga0068860_100000941 | |||
| 2539 | Ga0068860_100002554 | |||
| 2540 | Ga0068860_100013492 | |||
| 2541 | Ga0068860_100028810 | |||
| 2542 | Ga0068860_100038795 | |||
| 2543 | Ga0068860_100040424 | |||
| 2544 | Ga0068860_100053102 | |||
| 2545 | Ga0068860_100107013 | |||
| 2546 | Ga0068860_100141667 | |||
| 2547 | Ga0068860_100213605 | |||
| 2548 | Ga0068862_100000627 | |||
| 2549 | Ga0068862_100003677 | |||
| 2550 | Ga0068862_100007347 | |||
| 2551 | Ga0068862_100008433 | |||
| 2552 | Ga0068862_100021370 | |||
| 2553 | Ga0068862_100025886 | |||
| 2554 | Ga0068862_100050489 | |||
| 2555 | Ga0068862_100096277 | |||
| 2556 | Ga0068862_100099445 | |||
| 2557 | Ga0068862_100166692 | |||
| 2558 | Ga0068862_100189099 | |||
| 2559 | Ga0068862_100240492 | |||
| 2560 | Ga0068862_100353240 | |||
| 2561 | Ga0081455_10013572 | |||
| 2562 | Ga0070717_10035050 | |||
| 2563 | Ga0075364_10000513 | |||
| 2564 | Ga0075364_10001919 | |||
| 2565 | Ga0075364_10015072 | |||
| 2566 | Ga0070715_10008322 | |||
| 2567 | Ga0070715_10073462 | |||
| 2568 | Ga0070716_100000244 | |||
| 2569 | Ga0070712_100030129 | |||
| 2570 | Ga0070712_100046364 | |||
| 2571 | Ga0070712_100207631 | |||
| 2572 | Ga0075366_10001562 | |||
| 2573 | Ga0075366_10024270 | |||
| 2574 | Ga0075366_10040010 | |||
| 2575 | Ga0097621_100003986 | |||
| 2576 | Ga0097621_100006125 | |||
| 2577 | Ga0097621_100036360 | |||
| 2578 | Ga0097621_100061784 | |||
| 2579 | Ga0097621_100084227 | |||
| 2580 | Ga0097621_100098407 | |||
| 2581 | Ga0097621_100285937 | |||
| 2582 | Ga0097621_100340364 | |||
| 2583 | Ga0068871_100000888 | |||
| 2584 | Ga0068871_100023710 | |||
| 2585 | Ga0068871_100032115 | |||
| 2586 | Ga0068871_100050198 | |||
| 2587 | Ga0068871_100155363 | |||
| 2588 | Ga0068871_100167521 | |||
| 2589 | Ga0068871_100311729 | |||
| 2590 | Ga0068871_100334706 | |||
| 2591 | Ga0075428_100001820 | |||
| 2592 | Ga0075428_100012398 | |||
| 2593 | Ga0075428_100013313 | |||
| 2594 | Ga0075428_100019629 | |||
| 2595 | Ga0075428_100019983 | |||
| 2596 | Ga0075428_100115633 | |||
| 2597 | Ga0075430_100002494 | |||
| 2598 | Ga0075430_100012275 | |||
| 2599 | Ga0075430_100018473 | |||
| 2600 | Ga0075430_100148725 | |||
| 2601 | Ga0075430_100180082 | |||
| 2602 | Ga0075430_100315010 | |||
| 2603 | Ga0075430_100332803 | |||
| 2604 | Ga0075430_100433765 | |||
| 2605 | Ga0075431_100000992 | |||
| 2606 | Ga0075431_100021306 | |||
| 2607 | Ga0075431_100042431 | |||
| 2608 | Ga0075431_100043121 | |||
| 2609 | Ga0075431_100098948 | |||
| 2610 | Ga0075431_100101385 | |||
| 2611 | Ga0075431_100125262 | |||
| 2612 | Ga0075431_100128352 | |||
| 2613 | Ga0075431_100523932 | |||
| 2614 | Ga0075433_10009350 | |||
| 2615 | Ga0075433_10017867 | |||
| 2616 | Ga0075433_10145124 | |||
| 2617 | Ga0075433_10310431 | |||
| 2618 | Ga0075433_10406665 | |||
| 2619 | Ga0075434_100000358 | |||
| 2620 | Ga0075434_100125348 | |||
| 2621 | Ga0075429_100000646 | |||
| 2622 | Ga0075429_100010240 | |||
| 2623 | Ga0075429_100041093 | |||
| 2624 | Ga0075429_100041561 | |||
| 2625 | Ga0075429_100208170 | |||
| 2626 | Ga0068865_100001823 | |||
| 2627 | Ga0068865_100006486 | |||
| 2628 | Ga0068865_100049038 | |||
| 2629 | Ga0068865_100101036 | |||
| 2630 | Ga0068865_100150787 | |||
| 2631 | Ga0068865_100330874 | |||
| 2632 | Ga0075436_100117052 | |||
| 2633 | Ga0075436_100264469 | |||
| 2634 | Ga0097620_100003775 | |||
| 2635 | Ga0097620_100009496 | |||
| 2636 | Ga0097620_100023708 | |||
| 2637 | Ga0097620_100077708 | |||
| 2638 | Ga0097620_100120210 | |||
| 2639 | Ga0097620_100168761 | |||
| 2640 | Ga0097620_100271907 | |||
| 2641 | Ga0099826_10000014 | |||
| 2642 | Ga0075435_100024948 | |||
| 2643 | Ga0075435_100167129 | |||
| 2644 | Ga0099794_10019591 | |||
| 2645 | Ga0099794_10033455 | |||
| 2646 | Ga0099794_10093686 | |||
| 2647 | Ga0105251_10016322 | |||
| 2648 | Ga0105251_10049227 | |||
| 2649 | Ga0105244_10000480 | |||
| 2650 | Ga0105244_10016069 | |||
| 2651 | Ga0105250_10000021 | |||
| 2652 | Ga0105250_10000023 | |||
| 2653 | Ga0105240_10001345 | |||
| 2654 | Ga0105240_10004508 | |||
| 2655 | Ga0105240_10008645 | |||
| 2656 | Ga0105240_10016284 | |||
| 2657 | Ga0105240_10072048 | |||
| 2658 | Ga0105240_10076281 | |||
| 2659 | Ga0105240_10143498 | |||
| 2660 | Ga0105240_10254013 | |||
| 2661 | Ga0105240_10269139 | |||
| 2662 | Ga0105240_10274055 | |||
| 2663 | Ga0105240_10316293 | |||
| 2664 | Ga0111539_10012428 | |||
| 2665 | Ga0111539_10023233 | |||
| 2666 | Ga0111539_10023375 | |||
| 2667 | Ga0111539_10030460 | |||
| 2668 | Ga0111539_10059404 | |||
| 2669 | Ga0111539_10071890 | |||
| 2670 | Ga0111539_10073043 | |||
| 2671 | Ga0111539_10081579 | |||
| 2672 | Ga0111539_10115901 | |||
| 2673 | Ga0111539_10154829 | |||
| 2674 | Ga0111539_10170118 | |||
| 2675 | Ga0105245_10010418 | |||
| 2676 | Ga0105245_10053253 | |||
| 2677 | Ga0105245_10068994 | |||
| 2678 | Ga0105247_10000613 | |||
| 2679 | Ga0105247_10008368 | |||
| 2680 | Ga0105247_10047507 | |||
| 2681 | Ga0114129_10000246 | |||
| 2682 | Ga0114129_10089197 | |||
| 2683 | Ga0114129_10110589 | |||
| 2684 | Ga0114129_10137685 | |||
| 2685 | Ga0114129_10164161 | |||
| 2686 | Ga0114129_10466527 | |||
| 2687 | Ga0105243_10126161 | |||
| 2688 | Ga0105243_10136173 | |||
| 2689 | Ga0105243_10166897 | |||
| 2690 | Ga0105243_10199049 | |||
| 2691 | Ga0105241_10043275 | |||
| 2692 | Ga0105241_10088500 | |||
| 2693 | Ga0105241_10090077 | |||
| 2694 | Ga0105241_10103482 | |||
| 2695 | Ga0105242_10000991 | |||
| 2696 | Ga0105242_10007522 | |||
| 2697 | Ga0105242_10040873 | |||
| 2698 | Ga0105248_10023598 | |||
| 2699 | Ga0105248_10131071 | |||
| 2700 | Ga0105248_10177228 | |||
| 2701 | Ga0105248_10227184 | |||
| 2702 | Ga0105248_10241296 | |||
| 2703 | Ga0105237_10075394 | |||
| 2704 | Ga0105237_10100737 | |||
| 2705 | Ga0105237_10184415 | |||
| 2706 | Ga0105237_10238664 | |||
| 2707 | Ga0105237_10274841 | |||
| 2708 | Ga0105237_10512246 | |||
| 2709 | Ga0105238_10000155 | |||
| 2710 | Ga0105238_10034261 | |||
| 2711 | Ga0105238_10144279 | |||
| 2712 | Ga0105238_10187472 | |||
| 2713 | Ga0105238_10196176 | |||
| 2714 | Ga0105238_10274929 | |||
| 2715 | Ga0105238_10504531 | |||
| 2716 | Ga0105249_10002480 | |||
| 2717 | Ga0105249_10008606 | |||
| 2718 | Ga0105249_10008927 | |||
| 2719 | Ga0105239_10044029 | |||
| 2720 | Ga0105239_10044801 | |||
| 2721 | Ga0105239_10091472 | |||
| 2722 | Ga0105239_10406084 | |||
| 2723 | Ga0105246_10379433 | |||
| 2724 | Ga0157373_10036577 | |||
| 2725 | Ga0157373_10226157 | |||
| 2726 | Ga0157370_10000459 | |||
| 2727 | Ga0157370_10014928 | |||
| 2728 | Ga0157370_10087259 | |||
| 2729 | Ga0157370_10108624 | |||
| 2730 | Ga0157369_10004509 | |||
| 2731 | Ga0157369_10097160 | |||
| 2732 | Ga0157369_10111504 | |||
| 2733 | Ga0157369_10173360 | |||
| 2734 | Ga0157369_10541853 | |||
| 2735 | Ga0157374_10000173 | |||
| 2736 | Ga0157374_10002787 | |||
| 2737 | Ga0157374_10089052 | |||
| 2738 | Ga0157374_10152622 | |||
| 2739 | Ga0157378_10001843 | |||
| 2740 | Ga0157378_10014679 | |||
| 2741 | Ga0157378_10021870 | |||
| 2742 | Ga0157378_10044427 | |||
| 2743 | Ga0157378_10094127 | |||
| 2744 | Ga0157378_10095848 | |||
| 2745 | Ga0157378_10099426 | |||
| 2746 | Ga0157378_10145822 | |||
| 2747 | Ga0157378_10214315 | |||
| 2748 | Ga0163162_10023826 | |||
| 2749 | Ga0163162_10069959 | |||
| 2750 | Ga0163162_10107599 | |||
| 2751 | Ga0163162_10179065 | |||
| 2752 | Ga0163162_10211385 | |||
| 2753 | Ga0163162_10230726 | |||
| 2754 | Ga0163162_10336618 | |||
| 2755 | Ga0163162_10361935 | |||
| 2756 | Ga0163162_10437256 | |||
| 2757 | Ga0157372_10402653 | |||
| 2758 | Ga0157372_10554451 | |||
| 2759 | Ga0157375_10005969 | |||
| 2760 | Ga0157375_10034170 | |||
| 2761 | Ga0157375_10070454 | |||
| 2762 | Ga0157375_10074486 | |||
| 2763 | Ga0157375_10150513 | |||
| 2764 | Ga0157375_10425051 | |||
| 2765 | Ga0157375_10441387 | |||
| 2766 | Ga0157375_10489370 | |||
| 2767 | Ga0157375_10497835 | |||
| 2768 | Ga0157375_10582767 | |||
| 2769 | Ga0157375_10612726 | |||
| 2770 | Ga0157375_10667433 | |||
| 2771 | Ga0163163_10001413 | |||
| 2772 | Ga0163163_10005314 | |||
| 2773 | Ga0163163_10015469 | |||
| 2774 | Ga0163163_10019986 | |||
| 2775 | Ga0163163_10021863 | |||
| 2776 | Ga0163163_10059902 | |||
| 2777 | Ga0163163_10348635 | |||
| 2778 | Ga0163163_10365138 | |||
| 2779 | Ga0163163_10603203 | |||
| 2780 | Ga0157380_10000523 | |||
| 2781 | Ga0157380_10001490 | |||
| 2782 | Ga0157380_10014833 | |||
| 2783 | Ga0157380_10033583 | |||
| 2784 | Ga0157380_10114009 | |||
| 2785 | Ga0157380_10262497 | |||
| 2786 | Ga0182008_10002199 | |||
| 2787 | Ga0157377_10061290 | |||
| 2788 | Ga0157377_10076224 | |||
| 2789 | Ga0157379_10000241 | |||
| 2790 | Ga0157379_10020413 | |||
| 2791 | Ga0157379_10023113 | |||
| 2792 | Ga0157379_10024272 | |||
| 2793 | Ga0157379_10033388 | |||
| 2794 | Ga0157379_10097250 | |||
| 2795 | Ga0157376_10065831 | |||
| 2796 | Ga0157376_10231633 | |||
| 2797 | Ga0157376_10252551 | |||
| 2798 | Ga0157376_10275270 | |||
| 2799 | Ga0157376_10276692 | |||
| 2800 | Ga0182006_1000014 | |||
| 2801 | Ga0182006_1001667 | |||
| 2802 | Ga0182006_1003394 | |||
| 2803 | Ga0182006_1011676 | |||
| 2804 | Ga0182007_10000011 | |||
| 2805 | Ga0182007_10000938 | |||
| 2806 | Ga0182007_10028723 | |||
| 2807 | Ga0182005_1000014 | |||
| 2808 | Ga0182005_1000052 | |||
| 2809 | Ga0182005_1002111 | |||
| 2810 | Ga0163161_10011439 | |||
| 2811 | Ga0163161_10045423 | |||
| 2812 | Ga0163161_10048220 | |||
| 2813 | Ga0163161_10059877 | |||
| 2814 | Ga0163161_10081193 | |||
| 2815 | Ga0163161_10084995 | |||
| 2816 | Ga0163161_10220170 | |||
| 2817 | Ga0206353_12058834 | |||
| 2818 | Ga0213872_10000002 | |||
| 2819 | Ga0213872_10000305 | |||
| 2820 | Ga0213872_10002860 | |||
| 2821 | Ga0213872_10003308 | |||
| 2822 | Ga0213872_10003721 | |||
| 2823 | Ga0213872_10006075 | |||
| 2824 | Ga0213872_10011337 | |||
| 2825 | Ga0213872_10022038 | |||
| 2826 | Ga0213872_10058781 | |||
| 2827 | Ga0213874_10017033 | |||
| 2828 | Ga0213874_10024331 | |||
| 2829 | Ga0213876_10034937 | |||
| 2830 | Ga0209435_100004 | |||
| 2831 | Ga0209435_100156 | |||
| 2832 | Ga0209760_101646 | |||
| 2833 | Ga0209784_100005 | |||
| 2834 | Ga0209784_100020 | |||
| 2835 | Ga0209566_100005 | |||
| 2836 | Ga0209566_100020 | |||
| 2837 | Ga0209674_100009 | |||
| 2838 | Ga0209674_100035 | |||
| 2839 | Ga0209147_100011 | |||
| 2840 | Ga0209563_100012 | |||
| 2841 | Ga0209563_100038 | |||
| 2842 | Ga0209437_100066 | |||
| 2843 | Ga0209437_100084 | |||
| 2844 | Ga0209258_100264 | |||
| 2845 | Ga0209646_1000032 | |||
| 2846 | Ga0209646_1000047 | |||
| 2847 | Ga0209646_1000052 | |||
| 2848 | Ga0209026_1000062 | |||
| 2849 | Ga0209026_1002562 | |||
| 2850 | Ga0209026_1004402 | |||
| 2851 | Ga0209677_100006 | |||
| 2852 | Ga0209677_100031 | |||
| 2853 | Ga0209759_1000054 | |||
| 2854 | Ga0209759_1000514 | |||
| 2855 | Ga0209233_1000060 | |||
| 2856 | Ga0209565_1000006 | |||
| 2857 | Ga0209455_1017960 | |||
| 2858 | Ga0209673_1000004 | |||
| 2859 | Ga0209130_1000065 | |||
| 2860 | Ga0209675_1000006 | |||
| 2861 | Ga0209025_1000554 | |||
| 2862 | Ga0209025_1004464 | |||
| 2863 | Ga0209025_1005334 | |||
| 2864 | Ga0209564_1000006 | |||
| 2865 | Ga0209564_1000064 | |||
| 2866 | Ga0209564_1000107 | |||
| 2867 | Ga0209256_1000179 | |||
| 2868 | Ga0209256_1000340 | |||
| 2869 | Ga0209051_1002451 | |||
| 2870 | Ga0207697_10007354 | |||
| 2871 | Ga0207656_10046611 | |||
| 2872 | Ga0207656_10081110 | |||
| 2873 | Ga0207696_1000503 | |||
| 2874 | Ga0207655_1020727 | |||
| 2875 | Ga0207653_10062323 | |||
| 2876 | Ga0207682_10009949 | |||
| 2877 | Ga0207682_10020031 | |||
| 2878 | Ga0207682_10050173 | |||
| 2879 | Ga0207692_10029108 | |||
| 2880 | Ga0207692_10083281 | |||
| 2881 | Ga0207642_10011043 | |||
| 2882 | Ga0207642_10104328 | |||
| 2883 | Ga0207710_10006077 | |||
| 2884 | Ga0207710_10023194 | |||
| 2885 | Ga0207688_10051364 | |||
| 2886 | Ga0207688_10087835 | |||
| 2887 | Ga0207680_10005870 | |||
| 2888 | Ga0207680_10056596 | |||
| 2889 | Ga0207680_10092999 | |||
| 2890 | Ga0207680_10190489 | |||
| 2891 | Ga0207685_10041984 | |||
| 2892 | Ga0207699_10021017 | |||
| 2893 | Ga0207645_10014503 | |||
| 2894 | Ga0207645_10029729 | |||
| 2895 | Ga0207645_10046562 | |||
| 2896 | Ga0207643_10005861 | |||
| 2897 | Ga0207643_10031159 | |||
| 2898 | Ga0207643_10071090 | |||
| 2899 | Ga0207684_10163867 | |||
| 2900 | Ga0207654_10044196 | |||
| 2901 | Ga0207654_10232776 | |||
| 2902 | Ga0207707_10000751 | |||
| 2903 | Ga0207707_10003844 | |||
| 2904 | Ga0207707_10015871 | |||
| 2905 | Ga0207707_10028726 | |||
| 2906 | Ga0207707_10036263 | |||
| 2907 | Ga0207707_10065401 | |||
| 2908 | Ga0207707_10090683 | |||
| 2909 | Ga0207707_10337987 | |||
| 2910 | Ga0207695_10002162 | |||
| 2911 | Ga0207695_10003096 | |||
| 2912 | Ga0207695_10008191 | |||
| 2913 | Ga0207695_10034230 | |||
| 2914 | Ga0207695_10039353 | |||
| 2915 | Ga0207695_10041549 | |||
| 2916 | Ga0207695_10055225 | |||
| 2917 | Ga0207695_10074319 | |||
| 2918 | Ga0207695_10075211 | |||
| 2919 | Ga0207695_10205611 | |||
| 2920 | Ga0207671_10060503 | |||
| 2921 | Ga0207671_10109642 | |||
| 2922 | Ga0207671_10362450 | |||
| 2923 | Ga0207693_10000007 | |||
| 2924 | Ga0207693_10059777 | |||
| 2925 | Ga0207693_10098082 | |||
| 2926 | Ga0207663_10012439 | |||
| 2927 | Ga0207663_10185948 | |||
| 2928 | Ga0207660_10006464 | |||
| 2929 | Ga0207660_10027511 | |||
| 2930 | Ga0207660_10145099 | |||
| 2931 | Ga0207662_10000269 | |||
| 2932 | Ga0207662_10163984 | |||
| 2933 | Ga0207657_10002609 | |||
| 2934 | Ga0207657_10004204 | |||
| 2935 | Ga0207657_10156509 | |||
| 2936 | Ga0207649_10003420 | |||
| 2937 | Ga0207649_10011243 | |||
| 2938 | Ga0207649_10014718 | |||
| 2939 | Ga0207649_10021407 | |||
| 2940 | Ga0207649_10322809 | |||
| 2941 | Ga0207652_10002171 | |||
| 2942 | Ga0207652_10018733 | |||
| 2943 | Ga0207652_10079629 | |||
| 2944 | Ga0207652_10110015 | |||
| 2945 | Ga0207652_10119674 | |||
| 2946 | Ga0207646_10004092 | |||
| 2947 | Ga0207681_10002856 | |||
| 2948 | Ga0207681_10003441 | |||
| 2949 | Ga0207681_10045535 | |||
| 2950 | Ga0207681_10108219 | |||
| 2951 | Ga0207681_10113427 | |||
| 2952 | Ga0207694_10000625 | |||
| 2953 | Ga0207694_10037116 | |||
| 2954 | Ga0207694_10060517 | |||
| 2955 | Ga0207694_10120994 | |||
| 2956 | Ga0207694_10239377 | |||
| 2957 | Ga0207694_10333148 | |||
| 2958 | Ga0207650_10002703 | |||
| 2959 | Ga0207650_10017166 | |||
| 2960 | Ga0207650_10021288 | |||
| 2961 | Ga0207650_10027729 | |||
| 2962 | Ga0207650_10041183 | |||
| 2963 | Ga0207650_10129502 | |||
| 2964 | Ga0207650_10449329 | |||
| 2965 | Ga0207659_10003461 | |||
| 2966 | Ga0207659_10009472 | |||
| 2967 | Ga0207659_10010547 | |||
| 2968 | Ga0207659_10015323 | |||
| 2969 | Ga0207659_10015760 | |||
| 2970 | Ga0207659_10037748 | |||
| 2971 | Ga0207659_10071833 | |||
| 2972 | Ga0207687_10005308 | |||
| 2973 | Ga0207687_10007028 | |||
| 2974 | Ga0207700_10000051 | |||
| 2975 | Ga0207700_10031633 | |||
| 2976 | Ga0207700_10052163 | |||
| 2977 | Ga0207700_10223002 | |||
| 2978 | Ga0207664_10422027 | |||
| 2979 | Ga0207644_10000403 | |||
| 2980 | Ga0207644_10000800 | |||
| 2981 | Ga0207644_10056591 | |||
| 2982 | Ga0207644_10067626 | |||
| 2983 | Ga0207644_10148933 | |||
| 2984 | Ga0207644_10204609 | |||
| 2985 | Ga0207690_10002750 | |||
| 2986 | Ga0207690_10163528 | |||
| 2987 | Ga0207706_10007576 | |||
| 2988 | Ga0207706_10048180 | |||
| 2989 | Ga0207706_10067627 | |||
| 2990 | Ga0207706_10099134 | |||
| 2991 | Ga0207706_10131311 | |||
| 2992 | Ga0207706_10132692 | |||
| 2993 | Ga0207706_10211941 | |||
| 2994 | Ga0207706_10360504 | |||
| 2995 | Ga0207686_10011209 | |||
| 2996 | Ga0207686_10016593 | |||
| 2997 | Ga0207709_10030619 | |||
| 2998 | Ga0207709_10115637 | |||
| 2999 | Ga0207709_10294419 | |||
| 3000 | Ga0207670_10002723 | |||
| 3001 | Ga0207670_10004796 | |||
| 3002 | Ga0207670_10070289 | |||
| 3003 | Ga0207670_10081959 | |||
| 3004 | Ga0207670_10110878 | |||
| 3005 | Ga0207670_10111361 | |||
| 3006 | Ga0207670_10128428 | |||
| 3007 | Ga0207669_10019154 | |||
| 3008 | Ga0207669_10146898 | |||
| 3009 | Ga0207669_10149897 | |||
| 3010 | Ga0207669_10172080 | |||
| 3011 | Ga0207704_10052197 | |||
| 3012 | Ga0207704_10058256 | |||
| 3013 | Ga0207704_10065397 | |||
| 3014 | Ga0207704_10080385 | |||
| 3015 | Ga0207704_10120645 | |||
| 3016 | Ga0207704_10188024 | |||
| 3017 | Ga0207665_10006297 | |||
| 3018 | Ga0207665_10020217 | |||
| 3019 | Ga0207665_10027185 | |||
| 3020 | Ga0207665_10050866 | |||
| 3021 | Ga0207691_10001621 | |||
| 3022 | Ga0207691_10002348 | |||
| 3023 | Ga0207691_10002646 | |||
| 3024 | Ga0207691_10008772 | |||
| 3025 | Ga0207691_10009236 | |||
| 3026 | Ga0207691_10027590 | |||
| 3027 | Ga0207691_10059569 | |||
| 3028 | Ga0207691_10139948 | |||
| 3029 | Ga0207691_10504776 | |||
| 3030 | Ga0207711_10021913 | |||
| 3031 | Ga0207711_10145710 | |||
| 3032 | Ga0207711_10158101 | |||
| 3033 | Ga0207711_10642058 | |||
| 3034 | Ga0207689_10000310 | |||
| 3035 | Ga0207689_10012716 | |||
| 3036 | Ga0207689_10022140 | |||
| 3037 | Ga0207689_10064597 | |||
| 3038 | Ga0207689_10204123 | |||
| 3039 | Ga0207661_10004522 | |||
| 3040 | Ga0207661_10022639 | |||
| 3041 | Ga0207661_10128755 | |||
| 3042 | Ga0207679_10002358 | |||
| 3043 | Ga0207679_10003296 | |||
| 3044 | Ga0207679_10007770 | |||
| 3045 | Ga0207679_10018376 | |||
| 3046 | Ga0207679_10140289 | |||
| 3047 | Ga0207679_10160835 | |||
| 3048 | Ga0207679_10575924 | |||
| 3049 | Ga0207667_10000019 | |||
| 3050 | Ga0207667_10000637 | |||
| 3051 | Ga0207667_10004938 | |||
| 3052 | Ga0207667_10007781 | |||
| 3053 | Ga0207667_10012690 | |||
| 3054 | Ga0207667_10035515 | |||
| 3055 | Ga0207667_10151395 | |||
| 3056 | Ga0207667_10615245 | |||
| 3057 | Ga0207651_10008002 | |||
| 3058 | Ga0207651_10037092 | |||
| 3059 | Ga0207651_10092708 | |||
| 3060 | Ga0207651_10136389 | |||
| 3061 | Ga0207651_10159781 | |||
| 3062 | Ga0207712_10004779 | |||
| 3063 | Ga0207712_10096474 | |||
| 3064 | Ga0207712_10169107 | |||
| 3065 | Ga0207712_10174577 | |||
| 3066 | Ga0207712_10182754 | |||
| 3067 | Ga0207668_10007417 | |||
| 3068 | Ga0207668_10021249 | |||
| 3069 | Ga0207668_10036814 | |||
| 3070 | Ga0207668_10062992 | |||
| 3071 | Ga0207668_10085593 | |||
| 3072 | Ga0207668_10111689 | |||
| 3073 | Ga0207668_10138774 | |||
| 3074 | Ga0207640_10010217 | |||
| 3075 | Ga0207640_10079111 | |||
| 3076 | Ga0207640_10254310 | |||
| 3077 | Ga0207640_10255473 | |||
| 3078 | Ga0207658_10000197 | |||
| 3079 | Ga0207658_10017504 | |||
| 3080 | Ga0207658_10050590 | |||
| 3081 | Ga0207658_10390411 | |||
| 3082 | Ga0207677_10000943 | |||
| 3083 | Ga0207677_10001689 | |||
| 3084 | Ga0207677_10263760 | |||
| 3085 | Ga0207677_10385404 | |||
| 3086 | Ga0207703_10000527 | |||
| 3087 | Ga0207703_10001924 | |||
| 3088 | Ga0207703_10001944 | |||
| 3089 | Ga0207703_10006799 | |||
| 3090 | Ga0207703_10011508 | |||
| 3091 | Ga0207703_10025444 | |||
| 3092 | Ga0207703_10062891 | |||
| 3093 | Ga0207703_10099188 | |||
| 3094 | Ga0207703_10169809 | |||
| 3095 | Ga0207703_10318622 | |||
| 3096 | Ga0207639_10018834 | |||
| 3097 | Ga0207639_10426315 | |||
| 3098 | Ga0207639_10576079 | |||
| 3099 | Ga0207678_10033565 | |||
| 3100 | Ga0207678_10049277 | |||
| 3101 | Ga0207678_10063471 | |||
| 3102 | Ga0207678_10120026 | |||
| 3103 | Ga0207678_10154389 | |||
| 3104 | Ga0207678_10162218 | |||
| 3105 | Ga0207708_10000736 | |||
| 3106 | Ga0207708_10003489 | |||
| 3107 | Ga0207708_10004110 | |||
| 3108 | Ga0207708_10008914 | |||
| 3109 | Ga0207708_10029484 | |||
| 3110 | Ga0207708_10154061 | |||
| 3111 | Ga0207708_10255149 | |||
| 3112 | Ga0207702_10102503 | |||
| 3113 | Ga0207702_10114892 | |||
| 3114 | Ga0207702_10155092 | |||
| 3115 | Ga0207702_10174799 | |||
| 3116 | Ga0207702_10323913 | |||
| 3117 | Ga0207641_10000604 | |||
| 3118 | Ga0207641_10005610 | |||
| 3119 | Ga0207641_10006006 | |||
| 3120 | Ga0207641_10013697 | |||
| 3121 | Ga0207641_10019332 | |||
| 3122 | Ga0207641_10025786 | |||
| 3123 | Ga0207641_10089203 | |||
| 3124 | Ga0207641_10117158 | |||
| 3125 | Ga0207641_10249778 | |||
| 3126 | Ga0207648_10004465 | |||
| 3127 | Ga0207648_10005674 | |||
| 3128 | Ga0207648_10022643 | |||
| 3129 | Ga0207648_10024077 | |||
| 3130 | Ga0207648_10059271 | |||
| 3131 | Ga0207648_10060255 | |||
| 3132 | Ga0207648_10135010 | |||
| 3133 | Ga0207648_10168935 | |||
| 3134 | Ga0207648_10171019 | |||
| 3135 | Ga0207648_10420907 | |||
| 3136 | Ga0207676_10027004 | |||
| 3137 | Ga0207676_10029276 | |||
| 3138 | Ga0207676_10033816 | |||
| 3139 | Ga0207676_10259985 | |||
| 3140 | Ga0207676_10321638 | |||
| 3141 | Ga0207674_10002650 | |||
| 3142 | Ga0207674_10006753 | |||
| 3143 | Ga0207674_10008122 | |||
| 3144 | Ga0207674_10035125 | |||
| 3145 | Ga0207674_10111069 | |||
| 3146 | Ga0207674_10658064 | |||
| 3147 | Ga0207675_100002123 | |||
| 3148 | Ga0207675_100010044 | |||
| 3149 | Ga0207675_100014526 | |||
| 3150 | Ga0207675_100021498 | |||
| 3151 | Ga0207675_100030104 | |||
| 3152 | Ga0207675_100032847 | |||
| 3153 | Ga0207675_100038209 | |||
| 3154 | Ga0207675_100185737 | |||
| 3155 | Ga0207683_10000817 | |||
| 3156 | Ga0207683_10002350 | |||
| 3157 | Ga0207683_10031427 | |||
| 3158 | Ga0207683_10031673 | |||
| 3159 | Ga0207683_10112081 | |||
| 3160 | Ga0207683_10138474 | |||
| 3161 | Ga0207683_10220808 | |||
| 3162 | Ga0207698_10001140 | |||
| 3163 | Ga0207698_10015798 | |||
| 3164 | Ga0207698_10033350 | |||
| 3165 | Ga0207698_10174114 | |||
| 3166 | Ga0209281_1002645 | |||
| 3167 | Ga0209967_1002770 | |||
| 3168 | Ga0209981_1009413 | |||
| 3169 | Ga0209999_1004154 | |||
| 3170 | Ga0209970_1002765 | |||
| 3171 | Ga0210002_1019511 | |||
| 3172 | Ga0209983_1004835 | |||
| 3173 | Ga0209282_1000046 | |||
| 3174 | Ga0209588_1032041 | |||
| 3175 | Ga0209974_10029239 | |||
| 3176 | Ga0207428_10004796 | |||
| 3177 | Ga0207428_10014528 | |||
| 3178 | Ga0207428_10041023 | |||
| 3179 | Ga0207428_10074137 | |||
| 3180 | Ga0268266_10000796 | |||
| 3181 | Ga0268266_10038457 | |||
| 3182 | Ga0268266_10070210 | |||
| 3183 | Ga0268266_10267124 | |||
| 3184 | Ga0268266_10469587 | |||
| 3185 | Ga0268265_10000932 | |||
| 3186 | Ga0268265_10001937 | |||
| 3187 | Ga0268265_10002340 | |||
| 3188 | Ga0268265_10006026 | |||
| 3189 | Ga0268265_10007525 | |||
| 3190 | Ga0268265_10020235 | |||
| 3191 | Ga0268265_10079250 | |||
| 3192 | Ga0268265_10183200 | |||
| 3193 | Ga0268265_10293712 | |||
| 3194 | Ga0268264_10000176 | |||
| 3195 | Ga0268264_10030223 | |||
| 3196 | Ga0268264_10044621 | |||
| 3197 | Ga0268264_10128460 | |||
| 3198 | Ga0265323_10006325 | |||
| 3199 | Ga0307515_10166593 | |||
| 3200 | Ga0307515_10243509 | |||
| 3201 | Ga0265338_10000057 | |||
| 3202 | Ga0265338_10005002 | |||
| 3203 | Ga0307511_10003352 | |||
| 3204 | Ga0316181_1231393 | |||
| 3205 | Ga0265766_1001995 | |||
| 3206 | Ga0265330_10000033 | |||
| 3207 | Ga0265330_10000827 | |||
| 3208 | Ga0265332_10000001 | |||
| 3209 | Ga0265332_10000742 | |||
| 3210 | Ga0265328_10002285 | |||
| 3211 | Ga0265328_10018006 | |||
| 3212 | Ga0265325_10017896 | |||
| 3213 | Ga0265329_10006654 | |||
| 3214 | Ga0265340_10032736 | |||
| 3215 | Ga0265331_10001605 | |||
| 3216 | Ga0265331_10002179 | |||
| 3217 | Ga0265331_10009384 | |||
| 3218 | Ga0265327_10000103 | |||
| 3219 | Ga0265327_10010155 | |||
| 3220 | Ga0265327_10020157 | |||
| 3221 | Ga0265327_10124707 | |||
| 3222 | Ga0265316_10010545 | |||
| 3223 | Ga0265316_10013150 | |||
| 3224 | Ga0265316_10030556 | |||
| 3225 | Ga0265316_10034228 | |||
| 3226 | Ga0307513_10008177 | |||
| 3227 | Ga0307513_10014609 | |||
| 3228 | Ga0307513_10116719 | |||
| 3229 | Ga0307509_10000021 | |||
| 3230 | Ga0307408_100000331 | |||
| 3231 | Ga0307408_100030530 | |||
| 3232 | Ga0307408_100043547 | |||
| 3233 | Ga0307408_100045527 | |||
| 3234 | Ga0307408_100048376 | |||
| 3235 | Ga0307408_100227248 | |||
| 3236 | Ga0307408_100346077 | |||
| 3237 | Ga0316575_10002733 | |||
| 3238 | Ga0316575_10015078 | |||
| 3239 | Ga0316575_10025792 | |||
| 3240 | Ga0316579_10002332 | |||
| 3241 | Ga0316579_10014957 | |||
| 3242 | Ga0316579_10053611 | |||
| 3243 | Ga0316579_10070788 | |||
| 3244 | Ga0316579_10072978 | |||
| 3245 | Ga0265314_10000022 | |||
| 3246 | Ga0265314_10009479 | |||
| 3247 | Ga0265314_10044351 | |||
| 3248 | Ga0265314_10158797 | |||
| 3249 | Ga0316576_10000007 | |||
| 3250 | Ga0316576_10002013 | |||
| 3251 | Ga0316576_10014172 | |||
| 3252 | Ga0316576_10023318 | |||
| 3253 | Ga0316576_10106015 | |||
| 3254 | Ga0316576_10115129 | |||
| 3255 | Ga0316578_10000247 | |||
| 3256 | Ga0316578_10011051 | |||
| 3257 | Ga0316578_10029415 | |||
| 3258 | Ga0316578_10032042 | |||
| 3259 | Ga0316578_10042096 | |||
| 3260 | Ga0316578_10080392 | |||
| 3261 | Ga0307516_10005678 | |||
| 3262 | Ga0307405_10009974 | |||
| 3263 | Ga0307405_10047459 | |||
| 3264 | Ga0307405_10287436 | |||
| 3265 | Ga0316577_10000060 | |||
| 3266 | Ga0316577_10002401 | |||
| 3267 | Ga0316577_10011270 | |||
| 3268 | Ga0316577_10021225 | |||
| 3269 | Ga0316577_10054363 | |||
| 3270 | Ga0316577_10137759 | |||
| 3271 | Ga0316577_10193824 | |||
| 3272 | Ga0307413_10035667 | |||
| 3273 | Ga0307413_10130081 | |||
| 3274 | Ga0307410_10023462 | |||
| 3275 | Ga0307410_10052426 | |||
| 3276 | Ga0307410_10086703 | |||
| 3277 | Ga0307410_10132131 | |||
| 3278 | Ga0307406_10022966 | |||
| 3279 | Ga0307406_10181664 | |||
| 3280 | Ga0307407_10020497 | |||
| 3281 | Ga0307407_10025997 | |||
| 3282 | Ga0307412_10019389 | |||
| 3283 | Ga0307412_10482665 | |||
| 3284 | Ga0307409_100003265 | |||
| 3285 | Ga0307409_100005682 | |||
| 3286 | Ga0307409_100085062 | |||
| 3287 | Ga0307409_100244334 | |||
| 3288 | Ga0307416_100007278 | |||
| 3289 | Ga0307416_100022471 | |||
| 3290 | Ga0307416_100053714 | |||
| 3291 | Ga0307416_100188320 | |||
| 3292 | Ga0307416_100196331 | |||
| 3293 | Ga0307416_100869372 | |||
| 3294 | Ga0307414_10162918 | |||
| 3295 | Ga0307414_10393846 | |||
| 3296 | Ga0307411_10012815 | |||
| 3297 | Ga0307411_10018834 | |||
| 3298 | Ga0307415_100009761 | |||
| 3299 | Ga0307415_100129907 | |||
| 3300 | Ga0307415_100132924 | |||
| 3301 | Ga0316585_10000120 | |||
| 3302 | Ga0316580_10004843 | |||
| 3303 | Ga0316580_10012007 | |||
| 3304 | Ga0316580_10014310 | |||
| 3305 | Ga0316580_10040740 | |||
| 3306 | Ga0307510_10000002 | |||
| 3307 | Ga0307510_10038803 | |||
| 3308 | Ga0307510_10121453 | |||
| 3309 | Ga0316588_1015333 | |||
| 3310 | Ga0316587_1021171 | |||
| 3311 | Ga0316596_1018730 | |||
| 3312 | Ga0373958_0005256 | |||
| 3313 | Ga0373926_0017403 | |||
| 3314 | Ga0373934_0004781 | |||
| 3315 | Ga0373934_0008021 | |||
| 3316 | Ga0373936_0030899 | |||
| 3317 | Ga0373941_0032107 | |||
| 3318 | Ga0373945_0014449 | |||
| 3319 | Ga0373945_0136109 | |||
| 3320 | Ga0373953_0065061 | |||
| 3321 | Ga0373954_0121962 | |||
| 3322 | Ga0373956_0000029 | |||
| 3323 | Ga0373956_0030613 | |||
| 3324 | Ga0373956_0125656 | |||
| 3325 | Ga0373957_0000474 | |||
| 3326 | Ga0373957_0008879 | |||
| 3327 | Ga0373957_0061048 | |||
| 3328 | Ga0373943_0157862 | |||
| 3329 | Ga0373943_0227747 | |||
| 3330 | Ga0373955_0000731 | |||
| 3331 | Ga0373955_0011087 | |||
| 3332 | Ga0373955_0075734 | |||
| 3333 | Ga0373955_0178468 | |||
| 3334 | Ga0373961_0009521 | |||
| 3335 | Ga0373962_0042496 | |||
| 3336 | Ga0316574_0001501 | |||
| 3337 | Ga0316574_0002787 | |||
| 3338 | Ga0316574_0004096 | |||
| 3339 | Ga0316574_0005003 | |||
| 3340 | Ga0316574_0005513 | |||
| 3341 | Ga0316574_0006846 | |||
| 3342 | Ga0316574_0009834 | |||
| 3343 | Ga0316574_0010793 | |||
| 3344 | Ga0316574_0012984 | |||
| 3345 | Ga0316574_0020895 | |||
| 3346 | Ga0316574_0032015 | |||
| 3347 | Ga0316574_0032977 | |||
| 3348 | Ga0316574_0059360 | |||
| 3349 | Ga0316574_0083734 | |||
| 3350 | Ga0316574_0205946 | |||
| 3351 | Ga0373931_0015441 | |||
| 3352 | Ga0373931_0029386 | |||
| 3353 | Ga0373935_0008593 | |||
| 3354 | Ga0373935_0048854 | |||
| 3355 | Ga0373935_0104491 | |||
| 3356 | Ga0373927_0039972 | |||
| 3357 | Ga0373927_0054434 | |||
| 3358 | Ga0373927_0087643 | |||
| 3359 | Ga0373933_0000579 | |||
| 3360 | Ga0373933_0017867 | |||
| 3361 | Ga0373933_0053057 | |||
| 3362 | Ga0373933_0080850 | |||
| 3363 | Ga0373933_0091165 | |||
| 3364 | Ga0373933_0128412 | |||
| 3365 | Ga0373933_0202774 | |||
| 3366 | Ga0373947_0172461 | |||
| 3367 | Ga0373937_0000441 | |||
| 3368 | Ga0373937_0003520 | |||
| 3369 | Ga0373937_0014512 | |||
| 3370 | Ga0373937_0048250 | |||
| 3371 | Ga0373937_0049409 | |||
| 3372 | Ga0373937_0055776 | |||
| 3373 | Ga0373937_0061527 | |||
| 3374 | Ga0373937_0156332 | |||
| 3375 | Ga0373937_0184536 | |||
| 3376 | Ga0373937_0202246 | |||
| 3377 | Ga0373937_0213959 | |||
| 3378 | Ga0373937_0292077 | |||
| 3379 | Ga0373937_0295974 | |||
| 3380 | Ga0316582_0000395 | |||
| 3381 | Ga0316582_0003675 | |||
| 3382 | Ga0316582_0005547 | |||
| 3383 | Ga0316582_0006878 | |||
| 3384 | Ga0316582_0008980 | |||
| 3385 | Ga0316582_0018329 | |||
| 3386 | Ga0316582_0022562 | |||
| 3387 | Ga0316582_0036087 | |||
| 3388 | Ga0316582_0059008 | |||
| 3389 | Ga0316582_0063949 | |||
| 3390 | Ga0316582_0070281 | |||
| 3391 | Ga0316584_0000351 | |||
| 3392 | Ga0316584_0001066 | |||
| 3393 | Ga0316584_0002993 | |||
| 3394 | Ga0316584_0013493 | |||
| 3395 | Ga0316584_0015047 | |||
| 3396 | Ga0316584_0023503 | |||
| 3397 | Ga0316584_0035151 | |||
| 3398 | Ga0316584_0059173 | |||
| 3399 | Ga0316584_0064679 | |||
| 3400 | Ga0316584_0075894 | |||
| 3401 | Ga0316584_0110458 | |||
| 3402 | Ga0316584_0117465 | |||
| 3403 | Ga0316584_0131295 | |||
| 3404 | Ga0316584_0362705 | |||
| 3405 | Ga0373925_0024901 | |||
| 3406 | Ga0373925_0026437 | |||
| 3407 | Ga0373925_0059508 | |||
| 3408 | Ga0373925_0469901 | |||
| 3409 | Ga0395899_0001136 | |||
| 3410 | Ga0395899_0001535 | |||
| 3411 | Ga0395900_0007959 | |||
| 3412 | Ga0395900_0073358 | |||
| 3413 | Ga0395900_0121983 | |||
| 3414 | Ga0395900_0159102 | |||
| 3415 | Ga0395900_0217252 | |||
| 3416 | Ga0395900_0498418 | |||
| 3417 | Ga0395898_0011479 | |||
| 3418 | Ga0395898_0020896 | |||
| 3419 | Ga0395898_0037964 | |||
| 3420 | Ga0395905_0000059 | |||
| 3421 | Ga0395905_0001136 | |||
| 3422 | Ga0395905_0008938 | |||
| 3423 | Ga0395905_0010966 | |||
| 3424 | Ga0395905_0011248 | |||
| 3425 | Ga0395905_0073000 | |||
| 3426 | Ga0316581_0008348 | |||
| 3427 | Ga0395901_0000839 | |||
| 3428 | Ga0395901_0004488 | |||
| 3429 | Ga0395901_0199796 | |||
| 3430 | Ga0395901_0356467 | |||
| 3431 | Ga0395901_0393697 | |||
| 3432 | Ga0400490_36062 | |||
| 3433 | Ga0400488_28864 | |||
| 3434 | Ga0400483_041619 | |||
| 3435 | Ga0400483_060059 | |||
| 3436 | Ga0400483_190258 | |||
| 3437 | Ga0400483_199900 | |||
| 3438 | Ga0400487_14099 | |||
| 3439 | Ga0400487_59035 | |||
| 3440 | Ga0436365_0655415 | |||
| 3441 | Ga0436365_1360668 | |||
| 3442 | Ga0436365_1839211 | |||
| 3443 | Ga0436360_0128072 | |||
| 3444 | Ga0436360_0775847 | |||
| 3445 | Ga0436361_0091148 | |||
| 3446 | Ga0436361_0101333 | |||
| 3447 | Ga0436361_0148126 | |||
| 3448 | Ga0436361_0282854 | |||
| 3449 | Ga0436361_0334934 | |||
| 3450 | Ga0436361_0362646 | |||
| 3451 | Ga0436361_0594091 | |||
| 3452 | Ga0436361_0599318 | |||
| 3453 | Ga0436361_0798996 | |||
| 3454 | Ga0436361_1028197 | |||
| 3455 | Ga0436361_1176994 | |||
| 3456 | Ga0436363_0260147 | |||
| 3457 | Ga0436363_0952595 | |||
| 3458 | Ga0436363_1067387 | |||
| 3459 | Ga0436363_1706823 | |||
| 3460 | Ga0439438_003009 | |||
| 3461 | Ga0439453_0000441 | |||
| 3462 | Ga0439461_0028237 | |||
| 3463 | Ga0451849_0304227 | |||
| 3464 | Ga0451853_1138053 | |||
| 3465 | Ga0439431_0004894 | |||
| 3466 | Ga0439433_0004018 | |||
| 3467 | Ga0439441_001005 | |||
| 3468 | Ga0439456_012227 | |||
| 3469 | Ga0450923_000279 | |||
| 3470 | Ga0439446_0001893 | |||
| 3471 | Ga0439446_0002299 | |||
| 3472 | Ga0450908_007126 | |||
| 3473 | Ga0439434_0017129 | |||
| 3474 | Ga0439435_0000160 | |||
| 3475 | Ga0439435_0024671 | |||
| 3476 | Ga0439435_0047932 | |||
| 3477 | Ga0439444_0000639 | |||
| 3478 | Ga0451577_0000852 | |||
| 3479 | Ga0451577_0001784 | |||
| 3480 | Ga0451577_0006011 | |||
| 3481 | Ga0451577_0037562 | |||
| 3482 | Ga0451577_0114543 | |||
| 3483 | Ga0451577_0125120 | |||
| 3484 | Ga0451577_0143680 | |||
| 3485 | Ga0451577_0197135 | |||
| 3486 | Ga0451577_0197751 | |||
| 3487 | Ga0451577_0408492 | |||
| 3488 | Ga0466969_0001991 | |||
| 3489 | Ga0466969_0002917 | |||
| 3490 | Ga0466972_0000106 | |||
| 3491 | Ga0466973_0095500 | |||
| 3492 | Ga0466982_0076069 | |||
| 3493 | Ga0453683_0063641 | |||
| 3494 | Ga0466965_0013903 | |||
| 3495 | Ga0466965_0028050 | |||
| 3496 | Ga0466965_0049720 | |||
| 3497 | Ga0466965_0127988 | |||
| 3498 | Ga0466966_0004186 | |||
| 3499 | Ga0466966_0053658 | |||
| 3500 | Ga0466961_0000040 | |||
| 3501 | Ga0466961_0031713 | |||
| 3502 | Ga0466963_0010194 | |||
| 3503 | Ga0466964_0007850 | |||
| 3504 | Ga0453684_0002092 | |||
| 3505 | Ga0453684_0005854 | |||
| 3506 | Ga0453684_0007181 | |||
| 3507 | Ga0453684_0018446 | |||
| 3508 | Ga0453684_0033353 | |||
| 3509 | Ga0453684_0061503 | |||
| 3510 | Ga0453684_0144864 | |||
| 3511 | Ga0453684_0571099 | |||
| 3512 | Ga0453684_0577257 | |||
| 3513 | Ga0453684_0765213 | |||
| 3514 | Ga0466971_0002218 | |||
| 3515 | Ga0466971_0003507 | |||
| 3516 | Ga0466968_0000386 | |||
| 3517 | Ga0466970_0004185 | |||
| 3518 | Ga0466970_0048220 | |||
| 3519 | Ga0466970_0049287 | |||
| 3520 | Ga0466957_0011221 | |||
| 3521 | Ga0466957_0018370 | |||
| 3522 | Ga0466957_0081504 | |||
| 3523 | Ga0466959_0016051 | |||
| 3524 | Ga0466959_0021908 | |||
| 3525 | Ga0466959_0047999 | |||
| 3526 | Ga0466959_0072728 | |||
| 3527 | Ga0466959_0078464 | |||
| 3528 | Ga0451576_0003496 | |||
| 3529 | Ga0451576_0014390 | |||
| 3530 | Ga0451576_0027429 | |||
| 3531 | Ga0451576_0035476 | |||
| 3532 | Ga0451576_0045732 | |||
| 3533 | Ga0451576_0078988 | |||
| 3534 | Ga0451576_0486751 | |||
| 3535 | Ga0466967_0007982 | |||
| 3536 | Ga0466967_0416561 | |||
| 3537 | Ga0495617_047239 | |||
| 3538 | Ga0495627_000006 | |||
| 3539 | Ga0495627_013310 | |||
| 3540 | Ga0495592_0001747 | |||
| 3541 | Ga0495592_0009606 | |||
| 3542 | Ga0495592_0064178 | |||
| 3543 | Ga0495592_0104404 | |||
| 3544 | Ga0495592_0259506 | |||
| 3545 | Ga0495603_0001029 | |||
| 3546 | Ga0495603_0034806 | |||
| 3547 | Ga0495603_0069390 | |||
| 3548 | Ga0495603_0082058 | |||
| 3549 | Ga0495590_0000004 | |||
| 3550 | Ga0495590_0004686 | |||
| 3551 | Ga0495590_0008972 | |||
| 3552 | Ga0495591_000746 | |||
| 3553 | Ga0495629_0002657 | |||
| 3554 | Ga0495629_0022948 | |||
| 3555 | Ga0495629_0046606 | |||
| 3556 | Ga0495629_0077690 | |||
| 3557 | Ga0495629_0224579 | |||
| 3558 | Ga0495638_0000023 | |||
| 3559 | Ga0495638_0003523 | |||
| 3560 | Ga0495638_0003799 | |||
| 3561 | Ga0495638_0005570 | |||
| 3562 | Ga0495638_0014711 | |||
| 3563 | Ga0495638_0021947 | |||
| 3564 | Ga0495638_0027702 | |||
| 3565 | Ga0495638_0085233 | |||
| 3566 | Ga0495651_0000356 | |||
| 3567 | Ga0495651_0008683 | |||
| 3568 | Ga0495651_0049750 | |||
| 3569 | Ga0495651_0080330 | |||
| 3570 | Ga0495653_0000042 | |||
| 3571 | Ga0495653_0005300 | |||
| 3572 | Ga0495653_0085371 | |||
| 3573 | Ga0495650_0000215 | |||
| 3574 | Ga0495650_0000407 | |||
| 3575 | Ga0495650_0003561 | |||
| 3576 | Ga0495650_0004606 | |||
| 3577 | Ga0495650_0005137 | |||
| 3578 | Ga0495650_0012899 | |||
| 3579 | Ga0495650_0020898 | |||
| 3580 | Ga0495580_0001985 | |||
| 3581 | Ga0495580_0013252 | |||
| 3582 | Ga0495580_0027238 | |||
| 3583 | Ga0495580_0035563 | |||
| 3584 | Ga0495580_0083832 | |||
| 3585 | Ga0495580_0109778 | |||
| 3586 | Ga0495580_0183615 | |||
| 3587 | Ga0495582_0006012 | |||
| 3588 | Ga0495582_0011377 | |||
| 3589 | Ga0495605_0001550 | |||
| 3590 | Ga0495605_0004146 | |||
| 3591 | Ga0495605_0015524 | |||
| 3592 | Ga0495605_0122042 | |||
| 3593 | Ga0495639_0058849 | |||
| 3594 | Ga0495639_0071016 | |||
| 3595 | Ga0495662_0005181 | |||
| 3596 | Ga0495662_0027873 | |||
| 3597 | Ga0495662_0034579 | |||
| 3598 | Ga0495664_0000240 | |||
| 3599 | Ga0495584_0010228 | |||
| 3600 | Ga0495584_0020600 | |||
| 3601 | Ga0495584_0185118 | |||
| 3602 | Ga0495585_0011867 | |||
| 3603 | Ga0495585_0198791 | |||
| 3604 | Ga0495596_0000176 | |||
| 3605 | Ga0495596_0001852 | |||
| 3606 | Ga0495596_0014268 | |||
| 3607 | Ga0495596_0017785 | |||
| 3608 | Ga0495596_0035741 | |||
| 3609 | Ga0495596_0043672 | |||
| 3610 | Ga0495596_0061566 | |||
| 3611 | Ga0495607_0004205 | |||
| 3612 | Ga0495607_0017522 | |||
| 3613 | Ga0495607_0041247 | |||
| 3614 | Ga0495607_0082705 | |||
| 3615 | Ga0495583_0000093 | |||
| 3616 | Ga0495583_0000503 | |||
| 3617 | Ga0495583_0001963 | |||
| 3618 | Ga0495583_0018055 | |||
| 3619 | Ga0495583_0024245 | |||
| 3620 | Ga0495583_0034045 | |||
| 3621 | Ga0495583_0098078 | |||
| 3622 | Ga0495606_0000331 | |||
| 3623 | Ga0495606_0000659 | |||
| 3624 | Ga0495606_0002252 | |||
| 3625 | Ga0495606_0002286 | |||
| 3626 | Ga0495606_0004881 | |||
| 3627 | Ga0495606_0010885 | |||
| 3628 | Ga0495606_0020159 | |||
| 3629 | Ga0495606_0020497 | |||
| 3630 | Ga0495606_0021746 | |||
| 3631 | Ga0495606_0026393 | |||
| 3632 | Ga0495606_0030096 | |||
| 3633 | Ga0495606_0090633 | |||
| 3634 | Ga0495608_0004633 | |||
| 3635 | Ga0495608_0005174 | |||
| 3636 | Ga0495608_0158304 | |||
| 3637 | Ga0495610_0015455 | |||
| 3638 | Ga0495610_0029275 | |||
| 3639 | Ga0495610_0033021 | |||
| 3640 | Ga0495610_0117551 | |||
| 3641 | Ga0495616_0001514 | |||
| 3642 | Ga0495616_0001806 | |||
| 3643 | Ga0495616_0007505 | |||
| 3644 | Ga0495616_0018840 | |||
| 3645 | Ga0495616_0064442 | |||
| 3646 | Ga0495616_0090671 | |||
| 3647 | Ga0495618_0010183 | |||
| 3648 | Ga0495620_0017758 | |||
| 3649 | Ga0495628_0008086 | |||
| 3650 | Ga0495628_0010357 | |||
| 3651 | Ga0495628_0012517 | |||
| 3652 | Ga0495628_0041108 | |||
| 3653 | Ga0495628_0054706 | |||
| 3654 | Ga0495628_0075644 | |||
| 3655 | Ga0495630_0021896 | |||
| 3656 | Ga0495630_0140202 | |||
| 3657 | Ga0495630_0166096 | |||
| 3658 | Ga0495630_0341594 | |||
| 3659 | Ga0495631_0000109 | |||
| 3660 | Ga0495631_0052982 | |||
| 3661 | Ga0495632_0000837 | |||
| 3662 | Ga0495632_0041939 | |||
| 3663 | Ga0495637_0000338 | |||
| 3664 | Ga0495637_0000936 | |||
| 3665 | Ga0495643_0000681 | |||
| 3666 | Ga0495643_0001242 | |||
| 3667 | Ga0495643_0014741 | |||
| 3668 | Ga0495643_0017418 | |||
| 3669 | Ga0495643_0021636 | |||
| 3670 | Ga0495643_0043518 | |||
| 3671 | Ga0495643_0069479 | |||
| 3672 | Ga0495648_0000025 | |||
| 3673 | Ga0495648_0005380 | |||
| 3674 | Ga0495648_0008152 | |||
| 3675 | Ga0495648_0026461 | |||
| 3676 | Ga0495648_0050467 | |||
| 3677 | Ga0495648_0060546 | |||
| 3678 | Ga0495648_0089047 | |||
| 3679 | Ga0495648_0094609 | |||
| 3680 | Ga0495666_0004506 | |||
| 3681 | Ga0495666_0006287 | |||
| 3682 | Ga0495666_0027956 | |||
| 3683 | Ga0495666_0028427 | |||
| 3684 | Ga0495642_0003800 | |||
| 3685 | Ga0495642_0008352 | |||
| 3686 | Ga0495642_0012706 | |||
| 3687 | Ga0495642_0020062 | |||
| 3688 | Ga0495642_0021266 | |||
| 3689 | Ga0495652_0007174 | |||
| 3690 | Ga0495652_0007305 | |||
| 3691 | Ga0495652_0052416 | |||
| 3692 | Ga0495654_0000004 | |||
| 3693 | Ga0495654_0099935 | |||
| 3694 | Ga0495665_0008313 | |||
| 3695 | Ga0495665_0016793 | |||
| 3696 | Ga0495665_0024166 | |||
| 3697 | Ga0495665_0079305 | |||
| 3698 | Ga0495640_0002467 | |||
| 3699 | Ga0495640_0122907 | |||
| 3700 | Ga0495640_0136155 | |||
| 3701 | Ga0495586_0037835 | |||
| 3702 | Ga0495587_0003076 | |||
| 3703 | Ga0495587_0019220 | |||
| 3704 | Ga0495587_0067554 | |||
| 3705 | Ga0495587_0071881 | |||
| 3706 | Ga0495587_0120390 | |||
| 3707 | Ga0495598_0012097 | |||
| 3708 | Ga0495598_0025423 | |||
| 3709 | Ga0495609_0012302 | |||
| 3710 | Ga0495609_0018544 | |||
| 3711 | Ga0495609_0022503 | |||
| 3712 | Ga0495609_0113797 | |||
| 3713 | Ga0495621_0049300 | |||
| 3714 | Ga0495597_0000295 | |||
| 3715 | Ga0495597_0000629 | |||
| 3716 | Ga0495597_0004054 | |||
| 3717 | Ga0495597_0014825 | |||
| 3718 | Ga0495597_0024422 | |||
| 3719 | Ga0495597_0039758 | |||
| 3720 | Ga0495645_0000609 | |||
| 3721 | Ga0495645_0001936 | |||
| 3722 | Ga0495645_0005217 | |||
| 3723 | Ga0495645_0052106 | |||
| 3724 | Ga0495645_0057519 | |||
| 3725 | Ga0495645_0130090 | |||
| 3726 | Ga0495622_0000007 | |||
| 3727 | Ga0495622_0000063 | |||
| 3728 | Ga0495622_0000242 | |||
| 3729 | Ga0495622_0004064 | |||
| 3730 | Ga0495633_0000107 | |||
| 3731 | Ga0495633_0000317 | |||
| 3732 | Ga0495633_0001129 | |||
| 3733 | Ga0495633_0007175 | |||
| 3734 | Ga0495667_0006380 | |||
| 3735 | Ga0495667_0099029 | |||
| 3736 | Ga0495667_0160215 | |||
| 3737 | Ga0495656_0056747 | |||
| 3738 | Ga0495668_0000049 | |||
| 3739 | Ga0495668_0000198 | |||
| 3740 | Ga0495668_0016570 | |||
| 3741 | Ga0495668_0019695 | |||
| 3742 | Ga0495668_0042809 | |||
| 3743 | Ga0495668_0095661 | |||
| 3744 | Ga0495668_0109555 | |||
| 3745 | Ga0495668_0150331 | |||
| 3746 | Ga0495668_0227952 | |||
| 3747 | Ga0495634_0101385 | |||
| 3748 | Ga0495634_0137938 | |||
| 3749 | Ga0495611_0031080 | |||
| 3750 | Ga0495625_0000123 | |||
| 3751 | Ga0495625_0010365 | |||
| 3752 | Ga0495625_0026815 | |||
| 3753 | Ga0495625_0030323 | |||
| 3754 | Ga0495625_0043099 | |||
| 3755 | Ga0495625_0053168 | |||
| 3756 | Ga0495625_0067247 | |||
| 3757 | Ga0495625_0072876 | |||
| 3758 | Ga0495625_0088367 | |||
| 3759 | Ga0495625_0097592 | |||
| 3760 | Ga0495635_0024341 | |||
| 3761 | Ga0495635_0033671 | |||
| 3762 | Ga0495659_0000297 | |||
| 3763 | Ga0495659_0001065 | |||
| 3764 | Ga0495659_0052565 | |||
| 3765 | Ga0495661_0001776 | |||
| 3766 | Ga0495661_0002632 | |||
| 3767 | Ga0495661_0010293 | |||
| 3768 | Ga0495661_0011580 | |||
| 3769 | Ga0495661_0019506 | |||
| 3770 | Ga0495661_0021820 | |||
| 3771 | Ga0495661_0024741 | |||
| 3772 | Ga0495661_0060606 | |||
| 3773 | Ga0495661_0228521 | |||
| 3774 | Ga0495588_0108749 | |||
| 3775 | Ga0495657_0128578 | |||
| 3776 | Ga0495657_0145606 | |||
| 3777 | Ga0495657_0161352 | |||
| 3778 | Ga0495657_0227210 | |||
| 3779 | Ga0495599_0001013 | |||
| 3780 | Ga0495599_0018906 | |||
| 3781 | Ga0495623_0003184 | |||
| 3782 | Ga0495623_0019436 | |||
| 3783 | Ga0495646_0008696 | |||
| 3784 | Ga0495646_0014620 | |||
| 3785 | Ga0495646_0022937 | |||
| 3786 | Ga0495646_0026086 | |||
| 3787 | Ga0495647_0004872 | |||
| 3788 | Ga0495647_0011506 | |||
| 3789 | Ga0495658_0008454 | |||
| 3790 | Ga0495658_0069680 | |||
| 3791 | Ga0495658_0080092 | |||
| 3792 | Ga0495669_0004604 | |||
| 3793 | Ga0495613_0030346 | |||
| 3794 | Ga0495613_0042571 | |||
| 3795 | Ga0495624_0007783 | |||
| 3796 | Ga0495624_0018248 | |||
| 3797 | Ga0495624_0031417 | |||
| 3798 | Ga0495670_0021155 | |||
| 3799 | Ga0495671_0001337 | |||
| 3800 | Ga0495671_0007676 | |||
| 3801 | Ga0495671_0009971 | |||
| 3802 | Ga0495671_0011133 | |||
| 3803 | Ga0495671_0015867 | |||
| 3804 | Ga0495671_0022132 | |||
| 3805 | Ga0495671_0137313 | |||
| 3806 | Ga0495649_0002825 | |||
| 3807 | Ga0495649_0003503 | |||
| 3808 | Ga0495649_0003798 | |||
| 3809 | Ga0495649_0014909 | |||
| 3810 | Ga0495649_0021389 | |||
| 3811 | Ga0495649_0037765 | |||
| 3812 | Ga0495589_0000569 | |||
| 3813 | Ga0495589_0004740 | |||
| 3814 | Ga0495589_0029450 | |||
| 3815 | Ga0495589_0061740 | |||
| 3816 | Ga0495589_0077449 | |||
| 3817 | Ga0495589_0084570 | |||
| 3818 | Ga0495589_0085513 | |||
| 3819 | Ga0495600_0006351 | |||
| 3820 | Ga0495600_0026810 | |||
| 3821 | Ga0495600_0086041 | |||
| 3822 | Ga0495660_0000542 | |||
| 3823 | Ga0495660_0001078 | |||
| 3824 | Ga0495660_0009807 | |||
| 3825 | Ga0495660_0010817 | |||
| 3826 | Ga0495660_0013133 | |||
| 3827 | Ga0495660_0035824 | |||
| 3828 | Ga0495660_0057450 | |||
| 3829 | Ga0495660_0063163 | |||
| 3830 | Ga0495660_0110881 | |||
| 3831 | Ga0495581_0009404 | |||
| 3832 | Ga0495581_0014371 | |||
| 3833 | Ga0495604_0178726 | |||
| 3834 | Ga0495604_0251153 | |||
| 3835 | Ga0495636_0029621 | |||
| 3836 | Ga0495636_0085188 | |||
| 3837 | Ga0495674_0008154 | |||
| 3838 | Ga0495674_0015022 | |||
| 3839 | Ga0495674_0049015 | |||
| 3840 | Ga0495674_0201770 | |||
| 3841 | Ga0495672_0000159 | |||
| 3842 | Ga0495672_0017796 | |||
| 3843 | Ga0495672_0024888 | |||
| 3844 | Ga0495676_0021709 | |||
| 3845 | Ga0495683_0004007 | |||
| 3846 | Ga0495683_0175317 | |||
| 3847 | Ga0495687_000049 | |||
| 3848 | Ga0495687_000088 | |||
| 3849 | Ga0495687_004364 | |||
| 3850 | Ga0495687_011253 | |||
| 3851 | Ga0495687_016555 | |||
| 3852 | Ga0495687_023435 | |||
| 3853 | Ga0495675_0001488 | |||
| 3854 | Ga0495675_0026156 | |||
| 3855 | Ga0495675_0047698 | |||
| 3856 | Ga0495675_0092043 | |||
| 3857 | Ga0495677_0025577 | |||
| 3858 | Ga0495679_000044 | |||
| 3859 | Ga0495679_005164 | |||
| 3860 | Ga0495679_008760 | |||
| 3861 | Ga0495679_009205 | |||
| 3862 | Ga0495679_030588 | |||
| 3863 | Ga0495685_013452 | |||
| 3864 | Ga0495673_0002725 | |||
| 3865 | Ga0495681_0006863 | |||
| 3866 | Ga0495681_0011866 | |||
| 3867 | Ga0495681_0014148 | |||
| 3868 | Ga0495684_0099674 | |||
| 3869 | Ga0495684_0340291 | |||
| 3870 | Ga0495686_0000838 | |||
| 3871 | Ga0495686_0002406 | |||
| 3872 | Ga0495686_0012772 | |||
| 3873 | Ga0495686_0035681 | |||
| 3874 | Ga0495593_0002710 | |||
| 3875 | Ga0495602_0085499 | |||
| 3876 | Ga0495602_0128335 | |||
| 3877 | Ga0495614_0037819 | |||
| 3878 | Ga0495614_0079491 | |||
| 3879 | Ga0495626_0011661 | |||
| 3880 | Ga0495626_0015200 | |||
| 3881 | Ga0495626_0057747 | |||
| 3882 | Ga0495626_0110096 | |||
| 3883 | Ga0496100_0084443 | |||
| 3884 | Ga0496100_0115389 | |||
| 3885 | Ga0496100_0265162 | |||
| 3886 | Ga0496101_0005218 | |||
| 3887 | Ga0496101_0018089 | |||
| 3888 | Ga0496101_0034658 | |||
| 3889 | Ga0496101_0046403 | |||
| 3890 | Ga0496102_0007133 | |||
| 3891 | Ga0496102_0018478 | |||
| 3892 | Ga0496102_0018878 | |||
| 3893 | Ga0496102_0020468 | |||
| 3894 | Ga0496102_0023495 | |||
| 3895 | Ga0496102_0094375 | |||
| 3896 | Ga0496103_0003856 | |||
| 3897 | Ga0496103_0025210 | |||
| 3898 | Ga0496103_0030423 | |||
| 3899 | Ga0496103_0065050 | |||
| 3900 | Ga0496103_0180066 | |||
| 3901 | Ga0496104_0082539 | |||
| 3902 | Ga0496104_0169089 | |||
| 3903 | Ga0496104_0211420 | |||
| 3904 | Ga0496105_0097074 | |||
| 3905 | Ga0496105_0224954 | |||
| 3906 | Ga0496106_0003418 | |||
| 3907 | Ga0496106_0042385 | |||
| 3908 | Ga0496106_0160236 | |||
| 3909 | Ga0496106_0182554 | |||
| 3910 | Ga0496106_0302861 | |||
| 3911 | Ga0496107_0008872 | |||
| 3912 | Ga0496107_0014432 | |||
| 3913 | Ga0496108_0000870 | |||
| 3914 | Ga0496108_0108136 | |||
| 3915 | Ga0496109_0005839 | |||
| 3916 | Ga0496109_0023427 | |||
| 3917 | Ga0496109_0111543 | |||
| 3918 | Ga0496109_0120186 | |||
| 3919 | Ga0496109_0169013 | |||
| 3920 | Ga0496109_0501593 | |||
| 3921 | Ga0496110_0001741 | |||
| 3922 | Ga0496110_0002899 | |||
| 3923 | Ga0496110_0059733 | |||
| 3924 | Ga0496111_0037619 | |||
| 3925 | Ga0496111_0221310 | |||
| 3926 | Ga0496111_0227825 | |||
| 3927 | Ga0496111_0388518 | |||
| 3928 | Ga0496112_0344594 | |||
| 3929 | Ga0496112_0544014 | |||
| 3930 | Ga0496112_0582328 | |||
| 3931 | Ga0496113_0087979 | |||
| 3932 | Ga0496113_0130720 | |||
| 3933 | Ga0496113_0333523 | |||
| 3934 | Ga0496114_0001908 | |||
| 3935 | Ga0496114_0009802 | |||
| 3936 | Ga0496114_0010918 | |||
| 3937 | Ga0496114_0023986 | |||
| 3938 | Ga0496114_0051121 | |||
| 3939 | Ga0496114_0132819 | |||
| 3940 | Ga0496114_0265535 | |||
| 3941 | Ga0496115_0090752 | |||
| 3942 | Ga0496115_0291436 | |||
| 3943 | Ga0496116_0008971 | |||
| 3944 | Ga0496116_0054965 | |||
| 3945 | Ga0496116_0056200 | |||
| 3946 | Ga0496117_0000001 | |||
| 3947 | Ga0496117_0000054 | |||
| 3948 | Ga0496117_0077938 | |||
| 3949 | Ga0496117_0081202 | |||
| 3950 | Ga0496118_0000008 | |||
| 3951 | Ga0496118_0000045 | |||
| 3952 | Ga0496118_0028632 | |||
| 3953 | Ga0496118_0035124 | |||
| 3954 | Ga0496119_0000297 | |||
| 3955 | Ga0496119_0015657 | |||
| 3956 | Ga0496119_0079571 | |||
| 3957 | Ga0496120_0001653 | |||
| 3958 | Ga0496120_0024854 | |||
| 3959 | Ga0496120_0100607 | |||
| 3960 | Ga0496121_0002897 | |||
| 3961 | Ga0496121_0005334 | |||
| 3962 | Ga0496121_0011090 | |||
| 3963 | Ga0496121_0011103 | |||
| 3964 | Ga0496121_0015841 | |||
| 3965 | Ga0496121_0022299 | |||
| 3966 | Ga0496121_0135596 | |||
| 3967 | Ga0496121_0142416 | |||
| 3968 | Ga0496122_0000169 | |||
| 3969 | Ga0496122_0000249 | |||
| 3970 | Ga0496122_0000847 | |||
| 3971 | Ga0496122_0008495 | |||
| 3972 | Ga0496122_0013008 | |||
| 3973 | Ga0496122_0117199 | |||
| 3974 | Ga0496123_0000909 | |||
| 3975 | Ga0496123_0002226 | |||
| 3976 | Ga0496123_0002554 | |||
| 3977 | Ga0496123_0005545 | |||
| 3978 | Ga0496123_0012647 | |||
| 3979 | Ga0496123_0029996 | |||
| 3980 | Ga0496123_0103458 | |||
| 3981 | Ga0496124_0021421 | |||
| 3982 | Ga0496124_0129644 | |||
| 3983 | Ga0496124_0130056 | |||
| 3984 | Ga0496124_0145317 | |||
| 3985 | Ga0496124_0209894 | |||
| 3986 | Ga0496125_0000676 | |||
| 3987 | Ga0496125_0000812 | |||
| 3988 | Ga0496125_0001279 | |||
| 3989 | Ga0496125_0006029 | |||
| 3990 | Ga0496125_0007611 | |||
| 3991 | Ga0496125_0011048 | |||
| 3992 | Ga0496125_0019903 | |||
| 3993 | Ga0496125_0059606 | |||
| 3994 | Ga0496125_0248322 | |||
| 3995 | Ga0496126_0022848 | |||
| 3996 | Ga0496126_0029989 | |||
| 3997 | Ga0496126_0075257 | |||
| 3998 | Ga0496126_0232411 | |||
| 3999 | Ga0495678_000013 | |||
| 4000 | Ga0495678_000079 | |||
| 4001 | Ga0495678_000981 | |||
| 4002 | Ga0495678_002357 | |||
| 4003 | Ga0495678_005844 | |||
| 4004 | Ga0495678_006309 | |||
| 4005 | Ga0495678_046202 | |||
| 4006 | Ga0495682_0001431 | |||
| 4007 | Ga0495682_0012441 | |||
| 4008 | Ga0495682_0018400 | |||
| 4009 | Ga0501031_0001835 | |||
| 4010 | Ga0501032_0000036 | |||
| 4011 | Ga0501032_0003205 | |||
| 4012 | Ga0501032_0271260 | |||
| 4013 | Ga0501033_0002208 | |||
| 4014 | Ga0501033_0003067 | |||
| 4015 | Ga0501033_0006562 | |||
| 4016 | Ga0501034_0002523 | |||
| 4017 | Ga0501034_0026564 | |||
| 4018 | Ga0501036_0011654 | |||
| 4019 | Ga0501036_0040876 | |||
| 4020 | Ga0501036_0080670 | |||
| 4021 | Ga0501037_0000793 | |||
| 4022 | Ga0501037_0005568 | |||
| 4023 | Ga0501037_0083785 | |||
| 4024 | Ga0501038_0004695 | |||
| 4025 | Ga0501038_0005737 | |||
| 4026 | Ga0501038_0034864 | |||
| 4027 | Ga0501038_0036736 | |||
| 4028 | Ga0501039_0000386 | |||
| 4029 | Ga0501039_0005849 | |||
| 4030 | Ga0501039_0012218 | |||
| 4031 | Ga0501039_0013925 | |||
| 4032 | Ga0501039_0027225 | |||
| 4033 | Ga0501039_0084037 | |||
| 4034 | Ga0501039_0144347 | |||
| 4035 | Ga0501039_0146002 | |||
| 4036 | Ga0501039_0161925 | |||
| 4037 | Ga0501039_0288630 | |||
| 4038 | Ga0501039_0349290 | |||
| 4039 | Ga0501040_0000455 | |||
| 4040 | Ga0501040_0004740 | |||
| 4041 | Ga0501040_0008686 | |||
| 4042 | Ga0501040_0015767 | |||
| 4043 | Ga0501040_0017931 | |||
| 4044 | Ga0501040_0025609 | |||
| 4045 | Ga0501040_0100455 | |||
| 4046 | Ga0501040_0119241 | |||
| 4047 | Ga0501040_0310684 | |||
| 4048 | Ga0501041_0003215 | |||
| 4049 | Ga0501041_0004330 | |||
| 4050 | Ga0501041_0017877 | |||
| 4051 | Ga0501041_0022651 | |||
| 4052 | Ga0501041_0026794 | |||
| 4053 | Ga0501041_0037274 | |||
| 4054 | Ga0501042_0000031 | |||
| 4055 | Ga0501042_0007956 | |||
| 4056 | Ga0501042_0021847 | |||
| 4057 | Ga0501042_0051127 | |||
| 4058 | Ga0501042_0120917 | |||
| 4059 | Ga0501042_0128961 | |||
| 4060 | Ga0501042_0221755 | |||
| 4061 | Ga0501043_0000157 | |||
| 4062 | Ga0501043_0139362 | |||
| 4063 | Ga0501046_0001694 | |||
| 4064 | Ga0501046_0007774 | |||
| 4065 | Ga0501046_0021853 | |||
| 4066 | Ga0501046_0023907 | |||
| 4067 | Ga0501046_0054285 | |||
| 4068 | Ga0501046_0065898 | |||
| 4069 | Ga0501046_0149227 | |||
| 4070 | Ga0501047_0014303 | |||
| 4071 | Ga0501047_0077517 | |||
| 4072 | Ga0501048_0008923 | |||
| 4073 | Ga0501048_0023751 | |||
| 4074 | Ga0501048_0029291 | |||
| 4075 | Ga0501048_0097920 | |||
| 4076 | Ga0501067_0006809 | |||
| 4077 | Ga0501067_0021608 | |||
| 4078 | Ga0501067_0123725 | |||
| 4079 | Ga0501068_0002793 | |||
| 4080 | Ga0501068_0013939 | |||
| 4081 | Ga0501069_0036168 | |||
| 4082 | Ga0501069_0038859 | |||
| 4083 | Ga0501069_0141123 | |||
| 4084 | Ga0501070_0001696 | |||
| 4085 | Ga0501070_0007573 | |||
| 4086 | Ga0501070_0008433 | |||
| 4087 | Ga0501070_0133806 | |||
| 4088 | Ga0501071_0000686 | |||
| 4089 | Ga0501071_0001833 | |||
| 4090 | Ga0501071_0004638 | |||
| 4091 | Ga0501071_0009669 | |||
| 4092 | Ga0501071_0035993 | |||
| 4093 | Ga0501071_0046193 | |||
| 4094 | Ga0501071_0077313 | |||
| 4095 | Ga0501071_0093323 | |||
| 4096 | Ga0501072_0004342 | |||
| 4097 | Ga0501072_0026438 | |||
| 4098 | Ga0501072_0047153 | |||
| 4099 | Ga0501072_0049931 | |||
| 4100 | Ga0501072_0090907 | |||
| 4101 | Ga0501072_0192137 | |||
| 4102 | Ga0501072_0309186 | |||
| 4103 | Ga0501073_0000472 | |||
| 4104 | Ga0501073_0005363 | |||
| 4105 | Ga0501073_0055129 | |||
| 4106 | Ga0501073_0166225 | |||
| 4107 | Ga0501073_0221475 | |||
| 4108 | Ga0501074_0002836 | |||
| 4109 | Ga0501074_0005527 | |||
| 4110 | Ga0501074_0036301 | |||
| 4111 | Ga0501074_0100798 | |||
| 4112 | Ga0501074_0103298 | |||
| 4113 | Ga0501074_0189899 | |||
| 4114 | Ga0501074_0217459 | |||
| 4115 | Ga0501075_0000792 | |||
| 4116 | Ga0501075_0001305 | |||
| 4117 | Ga0501075_0002475 | |||
| 4118 | Ga0501075_0006009 | |||
| 4119 | Ga0501075_0014752 | |||
| 4120 | Ga0501075_0033278 | |||
| 4121 | Ga0501075_0045801 | |||
| 4122 | Ga0501075_0083095 | |||
| 4123 | Ga0501075_0223811 | |||
| 4124 | Ga0501076_0001408 | |||
| 4125 | Ga0501076_0007783 | |||
| 4126 | Ga0501076_0009825 | |||
| 4127 | Ga0501076_0093956 | |||
| 4128 | Ga0501076_0183345 | |||
| 4129 | Ga0501076_0315547 | |||
| 4130 | Ga0501077_0000280 | |||
| 4131 | Ga0501077_0005399 | |||
| 4132 | Ga0501077_0019320 | |||
| 4133 | Ga0501077_0093833 | |||
| 4134 | Ga0501217_049665 | |||
| 4135 | Ga0501249_003204 | |||
| 4136 | Ga0501079_0000811 | |||
| 4137 | Ga0501079_0001080 | |||
| 4138 | Ga0501079_0003255 | |||
| 4139 | Ga0501079_0007587 | |||
| 4140 | Ga0501079_0021711 | |||
| 4141 | Ga0501079_0182909 | |||
| 4142 | Ga0501080_0001568 | |||
| 4143 | Ga0501080_0003790 | |||
| 4144 | Ga0501080_0013669 | |||
| 4145 | Ga0501080_0016016 | |||
| 4146 | Ga0501080_0016298 | |||
| 4147 | Ga0501080_0165362 | |||
| 4148 | Ga0501080_0232048 | |||
| 4149 | Ga0501080_0365415 | |||
| 4150 | Ga0501081_0003604 | |||
| 4151 | Ga0501081_0005175 | |||
| 4152 | Ga0501081_0005236 | |||
| 4153 | Ga0501081_0013740 | |||
| 4154 | Ga0501083_0024949 | |||
| 4155 | Ga0501083_0047057 | |||
| 4156 | Ga0501083_0063656 | |||
| 4157 | Ga0501269_000103 | |||
| 4158 | Ga0501035_0000889 | |||
| 4159 | Ga0501035_0004008 | |||
| 4160 | Ga0501044_0002064 | |||
| 4161 | Ga0501044_0039558 | |||
| 4162 | Ga0501044_0066246 | |||
| 4163 | Ga0501045_0000607 | |||
| 4164 | Ga0501045_0013028 | |||
| 4165 | Ga0501045_0013215 | |||
| 4166 | Ga0501045_0015134 | |||
| 4167 | Ga0501045_0017936 | |||
| 4168 | Ga0501045_0022316 | |||
| 4169 | Ga0501045_0043656 | |||
| 4170 | Ga0501045_0056885 | |||
| 4171 | nmdc:mga03683_13573_c2 | |||
| 4172 | nmdc:mga00v17_1091_c1 | |||
| 4173 | nmdc:mga0k408_221_c1 | |||
| 4174 | nmdc:mga0k408_255643_c1 | |||
| 4175 | nmdc:mga0k408_36994_c1 | |||
| 4176 | nmdc:mga05p37_22213_c1 | |||
| 4177 | nmdc:mga05p37_286680_c1 | |||
| 4178 | nmdc:mga05p37_37857_c1 | |||
| 4179 | nmdc:mga05p37_467917_c1 | |||
| 4180 | nmdc:mga05p37_9357_c1 | |||
| 4181 | nmdc:mga09592_21320_c1 | |||
| 4182 | nmdc:mga09592_303696_c1 | |||
| 4183 | nmdc:mga09592_315_c1 | |||
| 4184 | nmdc:mga09592_58811_c1 | |||
| 4185 | nmdc:mga09592_61744_c1 | |||
| 4186 | nmdc:mga09592_78890_c1 | |||
| 4187 | nmdc:mga0qj67_108197_c1 | |||
| 4188 | nmdc:mga0qj67_17411_c1 | |||
| 4189 | nmdc:mga0qj67_274657_c1 | |||
| 4190 | nmdc:mga0qj67_2981_c1 | |||
| 4191 | nmdc:mga0qj67_321855_c1 | |||
| 4192 | nmdc:mga0qj67_39720_c1 | |||
| 4193 | nmdc:mga0qj67_66701_c1 | |||
| 4194 | nmdc:mga06r32_10212_c1 | |||
| 4195 | nmdc:mga06r32_19839_c1 | |||
| 4196 | nmdc:mga06r32_22391_c1 | |||
| 4197 | nmdc:mga06r32_499338_c1 | |||
| 4198 | nmdc:mga06r32_506616_c1 | |||
| 4199 | nmdc:mga06r32_52552_c1 | |||
| 4200 | nmdc:mga06r32_747_c1 | |||
| 4201 | nmdc:mga06r32_7750_c2 | |||
| 4202 | nmdc:mga08y16_121355_c1 | |||
| 4203 | nmdc:mga08y16_1255_c1 | |||
| 4204 | nmdc:mga08y16_14446_c1 | |||
| 4205 | nmdc:mga08y16_180689_c1 | |||
| 4206 | nmdc:mga08y16_204795_c1 | |||
| 4207 | nmdc:mga08y16_259436_c1 | |||
| 4208 | nmdc:mga08y16_385253_c1 | |||
| 4209 | nmdc:mga08y16_523719_c1 | |||
| 4210 | nmdc:mga08y16_646398_c1 | |||
| 4211 | nmdc:mga08y16_66776_c1 | |||
| 4212 | nmdc:mga08y16_7261_c1 | |||
| 4213 | nmdc:mga08y16_76782_c1 | |||
| 4214 | nmdc:mga0n895_426686_c1 | |||
| 4215 | nmdc:mga0n895_5209_c1 | |||
| 4216 | nmdc:mga0n895_60056_c1 | |||
| 4217 | nmdc:mga0rr50_11716_c1 | |||
| 4218 | nmdc:mga0rr50_80686_c1 | |||
| 4219 | nmdc:mga08x19_147225_c1 | |||
| 4220 | nmdc:mga08x19_25457_c1 | |||
| 4221 | nmdc:mga0a205_312544_c1 | |||
| 4222 | nmdc:mga0a205_331783_c1 | |||
| 4223 | nmdc:mga0a205_3868_c1 | |||
| 4224 | nmdc:mga0a205_438473_c1 | |||
| 4225 | nmdc:mga0a205_8456_c1 | |||
| 4226 | Ga0495601_0010336 | |||
| 4227 | Ga0495601_0013881 | |||
| 4228 | Ga0495601_0063437 | |||
| 4229 | Ga0500610_0000737 | |||
| 4230 | Ga0495595_0023181 | |||
| 4231 | Ga0495619_0048350 | |||
| 4232 | Ga0495619_0058679 | |||
| 4233 | Ga0495619_0112164 | |||
| 4234 | Ga0500641_0019869 | |||
| 4235 | Ga0500556_0000442 | |||
| 4236 | Ga0500594_0031812 | |||
| 4237 | Ga0500595_004294 | |||
| 4238 | Ga0500607_037246 | |||
| 4239 | Ga0500617_076143 | |||
| 4240 | Ga0500618_000965 | |||
| 4241 | Ga0500618_001599 | |||
| 4242 | Ga0500652_044821 | |||
| 4243 | Ga0500658_0007263 | |||
| 4244 | Ga0500586_000082 | |||
| 4245 | Ga0500588_0004325 | |||
| 4246 | Ga0500588_0011465 | |||
| 4247 | Ga0500589_094792 | |||
| 4248 | Ga0500622_0009746 | |||
| 4249 | Ga0500634_0026773 | |||
| 4250 | Ga0500636_0000369 | |||
| 4251 | Ga0500637_0001512 | |||
| 4252 | Ga0500637_0025044 | |||
| 4253 | Ga0500656_007160 | |||
| 4254 | Ga0501084_0001292 | |||
| 4255 | Ga0501084_0005101 | |||
| 4256 | Ga0501084_0012672 | |||
| 4257 | Ga0501084_0045939 | |||
| 4258 | Ga0501084_0079860 | |||
| 4259 | Ga0501084_0121784 | |||
| 4260 | Ga0501082_0009014 | |||
| 4261 | Ga0501082_0011508 | |||
| 4262 | Ga0501082_0058549 | |||
| 4263 | Ga0501082_0065570 | |||
| 4264 | Ga0501082_0179140 | |||
| 4265 | Ga0466962_0001556 | |||
| 4266 | Ga0466962_0004761 | |||
| 4267 | Ga0466962_0051937 | |||
| 4268 | Ga0530510_0001249 | |||
| 4269 | Ga0530510_0003476 | |||
| 4270 | Ga0530510_0006355 | |||
| 4271 | Ga0530510_0007480 | |||
| 4272 | Ga0530510_0151846 | |||
| 4273 | Ga0530510_0243398 | |||
| 4274 | 2501071044 | |||
| 4275 | 2501078765 | |||
| 4276 | 2501413916 | |||
| 4277 | 2509130198 | |||
| 4278 | 2510252157 | |||
| 4279 | 2511089410 | |||
| 4280 | 2511094820 | |||
| 4281 | 2511104519 | |||
| 4282 | 2511248143 | |||
| 4283 | 2511387018 | |||
| 4284 | 2513551629 | |||
| 4285 | 2513563805 | |||
| 4286 | 2513954086 | |||
| 4287 | 2513963084 | |||
| 4288 | 2514040213 | |||
| 4289 | 2514047533 | |||
| 4290 | 2515682696 | |||
| 4291 | 2515691270 | |||
| 4292 | 2516017028 | |||
| 4293 | 2519459604 | |||
| 4294 | 2521556771 | |||
| 4295 | 2550697282 | |||
| 4296 | 2553004537 | |||
| 4297 | 2585291189 | |||
| 4298 | 2600814591 | |||
| 4299 | 2601670644 | |||
| 4300 | 2644027893 | |||
| 4301 | 2644059880 | |||
| 4302 | 2644074499 | |||
| 4303 | 2644250888 | |||
| 4304 | 2644356307 | |||
| 4305 | 2644644580 | |||
| 4306 | 2691331001 | |||
| 4307 | 2738739051 | |||
| 4308 | 2738846283 | |||
| 4309 | 2739275068 | |||
| 4310 | 2739344112 | |||
| 4311 | 2765567963 | |||
| 4312 | 2792840267 | |||
| 4313 | 2808943045 | |||
| 4314 | 2808983813 | |||
| 4315 | 2809129485 | |||
| 4316 | 2809149460 | |||
| 4317 | 2817261882 | |||
| 4318 | 2817279586 | |||
| 4319 | 2817454338 | |||
| 4320 | 2819542989 | |||
| 4321 | 2819592493 | |||
| 4322 | 2819618620 | |||
| 4323 | 2821134042 | |||
| 4324 | 2839097747 | |||
| 4325 | 2846037039 | |||
| 4326 | 2846040170 | |||
| 4327 | 2846542968 | |||
| 4328 | 2852619607 | |||
| 4329 | 2856292254 | |||
| 4330 | 2857365768 | |||
| 4331 | 2857548011 | |||
| 4332 | 2857556502 | |||
| 4333 | 2858696555 | |||
| 4334 | 2883094783 | |||
| 4335 | 2884814660 | |||
| 4336 | 2884839019 | |||
| 4337 | 2884855310 | |||
| 4338 | 2885080732 | |||
| 4339 | 2885273964 | |||
| 4340 | 2887632750 | |||
| 4341 | 2894024515 | |||
| 4342 | 2894510783 | |||
| 4343 | 2896159183 | |||
| 4344 | 2902687255 | |||
| 4345 | 2904429152 | |||
| 4346 | 2904440652 | |||
| 4347 | 2904535756 | |||
| 4348 | 2904586083 | |||
| 4349 | 2904592104 | |||
| 4350 | 2904601739 | |||
| 4351 | 2919049575 | |||
| 4352 | 2919084806 | |||
| 4353 | 2919480736 | |||
| 4354 | 2919493882 | |||
| 4355 | 2919499364 | |||
| 4356 | 2919534562 | |||
| 4357 | 2919545763 | |||
| 4358 | 2923515363 | |||
| 4359 | 2923527471 | |||
| 4360 | 2928132422 | |||
| 4361 | 2932412602 | |||
| 4362 | 2932420117 | |||
| 4363 | 2998348351 | |||
| 4364 | 639788380 | |||
| 4365 | 644746875 | |||
| 4366 | 8003960505 | |||
| 4367 | 8020808261 | |||
| 4368 | 8040169009 | |||
| 4369 | 8040179290 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3nrw-assembly1.cif.gz_A | crystal structure of the n-terminal domain of phage integrase/site-specific recombinase (tnp) from haloarcula marismortui, northeast structural genomics consortium target hmr208a | 0.8855 | 29 | 125 |
| 6wat-assembly14.cif.gz_NC | complex structure of phf1 | 0.8218 | 163 | 184 |
| 3nrw-assembly1.cif.gz_A | crystal structure of the n-terminal domain of phage integrase/site-specific recombinase (tnp) from haloarcula marismortui, northeast structural genomics consortium target hmr208a | 0.8154 | 29 | 125 |
| 2kd1-assembly1.cif.gz_A | solution nmr structure of the integrase-like domain from bacillus cereus ordered locus bc_1272. northeast structural genomics consortium target bcr268f | 0.8133 | 29 | 130 |
| 8h43-assembly3.cif.gz_C | crystal structure of phf1 tudor domain in complex with hit 1 | 0.8066 | 163 | 184 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A8P6_5_99_1.10.150.130 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain | 0.9579 | 29 | 119 | 1.10.150.130 |
| af_Q2FY74_2_96_1.10.150.130 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain | 0.9375 | 27 | 119 | 1.10.150.130 |
| af_P9WF35_2_96_1.10.150.130 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain | 0.9295 | 27 | 121 | 1.10.150.130 |
| af_Q2FZ30_3_95_1.10.150.130 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain | 0.9277 | 29 | 119 | 1.10.150.130 |
| 1a0pA01 | Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain | 0.9229 | 29 | 122 | 1.10.150.130 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A448QXK0-F1-model_v4 | deleted | 0.9874 | 133 | 198 |
|
| AF-A0A3B8PAE6-F1-model_v4 | deleted | 0.9835 | 29 | 119 |
|
| AF-A0A090SYA2-F1-model_v4 | Tyrosine recombinase XerD | 0.9514 | 28 | 128 |
GO:0003677
GO:0015074 |
| AF-A0A846KK45-F1-model_v4 | deleted | 0.9331 | 130 | 227 |
|
| AF-X1IKC8-F1-model_v4 | Tyr recombinase domain-containing protein | 0.9317 | 134 | 238 |
GO:0003677
GO:0006310 GO:0015074 |