F496522

General Info

Members Datasets Scaffolds Average Seq Length
2184 674 4369 303

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_100001382|Ga0068861_10000138210
Length 355
Sequence MSTVPGFCDNCHVLPPPPFAYCRHRRNGVGIRLAPAFDLNVMSTVTKASVYSRTEDTPXXXSLASIDRFLDAVWMERGLSPNTLSAYRADLTALDRWLQGRGCSSLAAKRADVLAFIAFRVEAGARPRSTARQLSSFRRYYRYLIREGAIKEDPTAQIAMPKIGRSLPKSLTEEEVESLLAAPEIDDPLGNRDRSMLEVLYATGLRVSELVNLKSSQVNMNQGVLRIVGKGDRERLIPLGEEAVGWLQKFMSGPRLEILLERQTEYLFPTRRGDRMTRQAFWHIIKRYAQKAGVAKALSPHTLRHAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHVARERMKELHAQHHPRG

Samples

Sample ID Description Type Environment
1 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
26 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
31 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
52 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
53 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
57 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
60 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
61 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
62 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
63 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
64 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
65 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
73 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
74 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
75 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
76 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
77 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
78 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
81 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
82 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
83 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
84 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
93 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
94 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
95 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
96 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
105 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
106 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
107 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
108 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
112 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
113 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
114 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
115 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
116 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
117 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
118 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
119 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
120 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
122 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
123 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
124 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
125 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
126 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
127 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
128 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
130 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
131 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
132 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
133 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
134 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
135 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
136 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
137 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
138 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
139 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
140 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
141 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
142 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
143 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
144 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
145 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
146 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
147 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
148 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
149 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
150 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
151 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
152 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
153 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
154 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
155 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
156 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
157 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
158 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
159 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
160 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
161 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
162 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
163 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
164 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
165 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
171 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
173 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
174 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
176 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
177 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
181 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
183 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
255 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
262 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
265 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
269 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
270 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
271 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
272 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
273 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
275 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
276 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
277 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
278 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
279 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
280 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
281 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
282 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
283 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
284 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
285 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
286 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
287 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
288 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
289 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
290 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
291 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
292 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
293 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
294 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
295 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
296 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
297 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
298 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
299 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
300 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
301 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
302 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
303 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
304 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
305 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
306 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
307 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
311 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
312 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
313 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
314 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
315 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
316 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
317 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
318 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
319 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
320 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
321 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
322 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
323 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
324 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
325 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
326 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
327 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
328 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
329 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
330 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
331 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
332 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
333 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
334 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
335 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
336 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
337 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
338 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
339 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
340 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
341 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
342 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
343 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
344 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
345 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
346 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
347 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
348 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
349 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
350 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
351 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
352 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
353 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
354 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
355 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
356 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
357 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
358 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
359 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
360 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
361 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
362 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
363 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
364 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
365 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
366 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
367 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
368 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
369 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
370 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
371 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
372 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
373 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
374 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
375 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
376 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
377 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
378 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
379 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
380 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
381 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
382 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
383 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
384 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
385 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
386 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
387 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
388 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
389 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
390 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
391 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
392 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
393 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
394 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
395 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
396 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
397 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
398 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
399 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
400 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
401 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
402 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
403 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
404 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
405 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
406 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
407 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
408 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
409 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
410 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
411 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
412 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
413 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
414 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
415 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
416 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
417 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
418 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
419 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
420 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
421 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
422 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
423 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
424 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
425 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
426 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
427 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
428 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
429 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
430 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
431 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
432 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
433 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
434 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
435 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
436 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
437 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
438 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
439 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
440 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
441 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
442 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
443 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
444 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
445 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
446 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
447 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
448 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
449 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
450 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
451 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
452 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
453 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
454 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
455 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
456 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
457 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
458 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
459 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
460 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
461 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
462 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
463 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
464 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
465 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
466 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
467 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
468 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
469 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
470 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
471 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
472 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
473 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
474 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
475 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
476 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
477 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
478 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
479 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
480 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
481 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
482 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
483 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
484 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
485 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
486 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
487 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
488 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
489 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
490 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
491 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
492 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
493 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
494 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
495 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
496 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
497 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
498 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
499 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
500 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
501 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
502 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
503 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
504 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
505 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
506 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
507 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
508 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
509 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
510 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
511 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
512 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
513 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
514 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
515 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
516 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
517 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
518 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
519 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
520 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
521 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
522 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
523 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
524 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
525 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
526 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
527 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
528 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
529 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
530 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
531 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
532 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
533 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
534 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
535 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
536 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
537 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
538 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
539 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
540 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
541 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
542 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
543 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
544 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
545 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
546 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
547 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
548 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
549 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
550 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
551 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
552 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
553 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
554 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
555 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
556 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
557 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
558 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
559 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
560 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
561 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
562 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
563 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
564 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
565 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
566 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
567 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
568 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
569 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
570 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
571 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
572 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
573 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
574 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
575 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
576 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
577 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
578 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
579 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
580 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
581 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
582 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
583 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
584 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
585 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
586 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
587 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
588 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
589 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
590 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
591 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
592 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
593 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
594 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
595 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
596 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
597 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
598 2519103095 Burkholderia sp. KJ006 Isolate Nodule
599 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
600 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
601 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
602 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
603 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
604 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
605 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
606 2643221609 Acidovorax sp. Root217 Isolate Unclassified
607 2643221611 Acidovorax sp. Root219 Isolate Unclassified
608 2643221645 Massilia sp. Root351 Isolate Unclassified
609 2643221664 Massilia sp. Root418 Isolate Unclassified
610 2643221717 Acidovorax sp. Root267 Isolate Unclassified
611 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
612 2738541280 Massilia sp. GV090 Isolate Unclassified
613 2738541300 Massilia sp. GV016 Isolate Unclassified
614 2738543018 Massilia sp. GV045 Isolate Unclassified
615 2738543030 Massilia sp. GV097 Isolate Unclassified
616 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
617 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
618 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
619 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
620 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
621 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
622 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
623 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
624 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
625 2818991436 Collimonas arenae 515 Isolate Unclassified
626 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
627 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
628 2821131069 Duganella sp. 1224 Isolate Unclassified
629 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
630 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
631 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
632 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
633 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
634 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
635 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
636 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
637 2857553236 Duganella sp. R-74557 Isolate Unclassified
638 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
639 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
640 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
641 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
642 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
643 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
644 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
645 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
646 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
647 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
648 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
649 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
650 2904424332 Duganella sp. 1411 Isolate Rhizosphere
651 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
652 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
653 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
654 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
655 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
656 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
657 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
658 2919476304 Duganella sp. 3397 Isolate Unclassified
659 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
660 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
661 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
662 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
663 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
664 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
665 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
666 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
667 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
668 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
669 639633007 Azoarcus olearius BH72 Isolate Unclassified
670 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
671 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
672 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
673 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
674 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.38
Metatranscriptomes 0.23
Isolates 4.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.17
Nodule 0.92
Rhizoplane 2.79
Rhizosphere 84.8
Stem 0
Stem Tuber 0
Unclassified 0.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068861_100001382 3300005719 Bacteria 15229
2 SwRhRL2b_contig_637244 2162886007 Bacteria 2832
3 JGI25155J39150_1000136 3300002704 Bacteria 34706
4 JGI25155J39150_1000346 3300002704 Bacteria 14831
5 JGI25156J39149_1000156 3300002705 Bacteria 50177
6 JGI25156J39149_1010186 3300002705 Bacteria 2227
7 JGI25162J39368_1000025 3300002737 Bacteria 228879
8 JGI25162J39368_1006852 3300002737 Bacteria 1873
9 JGI25154J39366_1000430 3300002738 Bacteria 22349
10 JGI25154J39366_1000531 3300002738 Bacteria 19097
11 JGI25157J39369_1000277 3300002741 Bacteria 37605
12 JGI25157J39369_1008646 3300002741 Bacteria 1407
13 JGI25152J39213_1000113 3300002773 Bacteria 56427
14 JGI25151J46595_10045536 3300003187 Bacteria 1547
15 JGI25165J46597_1000054 3300003214 Bacteria 228891
16 rootH1_10044520 3300003316 Bacteria 2234
17 rootL2_10003689 3300003322 Bacteria 3346
18 rootH1_10039841 3300003316 Bacteria 6678
19 rootH1_10039841 3300003323 Bacteria 86560
20 Ga0055538_1000008 3300003751 Bacteria 398547
21 Ga0055538_1000026 3300003751 Bacteria 228891
22 Ga0055539_1000012 3300003752 Bacteria 398547
23 Ga0055539_1000033 3300003752 Bacteria 228891
24 Ga0055533_1000015 3300003756 Bacteria 398547
25 Ga0055533_1000044 3300003756 Bacteria 228891
26 Ga0055532_1000005 3300003758 Bacteria 458107
27 Ga0055525_1000017 3300003759 Bacteria 398547
28 Ga0055525_1000052 3300003759 Bacteria 228891
29 Ga0055535_1004655 3300003761 Bacteria 3254
30 Ga0055526_1000129 3300003771 Bacteria 67279
31 Ga0055526_1008158 3300003771 Bacteria 5275
32 Ga0055537_1000156 3300003773 Bacteria 51559
33 Ga0055537_1000223 3300003773 Bacteria 41876
34 Ga0055524_1000029 3300003775 Bacteria 201332
35 Ga0055524_1000824 3300003775 Bacteria 20504
36 Ga0055534_1000230 3300003784 Bacteria 40350
37 Ga0055534_1000632 3300003784 Bacteria 18001
38 Ga0055528_1000341 3300003790 Bacteria 38736
39 Ga0055541_1000009 3300003841 Bacteria 398547
40 Ga0055541_1000049 3300003841 Bacteria 134251
41 Ga0055543_1002523 3300004625 Bacteria 5985
42 Ga0065165_1000050 3300005262 Bacteria 195237
43 Ga0065165_1001239 3300005262 Bacteria 29150
44 Ga0065714_10071968 3300005288 Bacteria 3459
45 Ga0065704_10100794 3300005289 Bacteria 2261
46 Ga0065712_10085621 3300005290 Bacteria 2686
47 Ga0065707_10000575 3300005295 Bacteria 20383
48 Ga0065707_10002291 3300005295 Bacteria 6264
49 Ga0065707_10190954 3300005295 Bacteria 1361
50 Ga0070676_10008532 3300005328 Bacteria 5523
51 Ga0070676_10025203 3300005328 Bacteria 3359
52 Ga0070676_10051702 3300005328 Bacteria 2413
53 Ga0070676_10110602 3300005328 Bacteria 1710
54 Ga0070683_100515260 3300005329 Bacteria 1143
55 Ga0070683_100604523 3300005329 Bacteria 1049
56 Ga0070690_100007662 3300005330 Bacteria 6188
57 Ga0070690_100013534 3300005330 Bacteria 4823
58 Ga0070690_100018489 3300005330 Bacteria 4211
59 Ga0070690_100020957 3300005330 Bacteria 3988
60 Ga0070690_100072859 3300005330 Bacteria 2234
61 Ga0070670_100000633 3300005331 Bacteria 27394
62 Ga0070670_100001609 3300005331 Bacteria 18253
63 Ga0070670_100016449 3300005331 Bacteria 6351
64 Ga0070670_100017843 3300005331 Bacteria 6091
65 Ga0070670_100020260 3300005331 Bacteria 5714
66 Ga0070670_100063985 3300005331 Bacteria 3156
67 Ga0070670_100120482 3300005331 Bacteria 2263
68 Ga0070670_100236968 3300005331 Bacteria 1588
69 Ga0070677_10016184 3300005333 Bacteria 2652
70 Ga0070677_10016731 3300005333 Bacteria 2614
71 Ga0070677_10053548 3300005333 Bacteria 1641
72 Ga0068869_100001563 3300005334 Bacteria 13602
73 Ga0068869_100153854 3300005334 Bacteria 1786
74 Ga0068869_100430261 3300005334 Bacteria 1090
75 Ga0070666_10007516 3300005335 Bacteria 6717
76 Ga0070666_10010612 3300005335 Bacteria 5764
77 Ga0070666_10042685 3300005335 Bacteria 3035
78 Ga0070666_10084826 3300005335 Bacteria 2169
79 Ga0070666_10101206 3300005335 Bacteria 1986
80 Ga0070666_10207289 3300005335 Bacteria 1380
81 Ga0070680_100055192 3300005336 Bacteria 3246
82 Ga0070680_100078763 3300005336 Bacteria 2715
83 Ga0070680_100168296 3300005336 Bacteria 1843
84 Ga0070680_100240115 3300005336 Bacteria 1531
85 Ga0070682_100092547 3300005337 Bacteria 1981
86 Ga0068868_100000807 3300005338 Bacteria 21238
87 Ga0068868_100001147 3300005338 Bacteria 18142
88 Ga0068868_100068614 3300005338 Bacteria 2824
89 Ga0068868_100333480 3300005338 Bacteria 1295
90 Ga0070660_100005509 3300005339 Bacteria 8766
91 Ga0070660_100027230 3300005339 Bacteria 4264
92 Ga0070689_100005128 3300005340 Bacteria 8907
93 Ga0070689_100417583 3300005340 Bacteria 1136
94 Ga0070687_100136906 3300005343 Bacteria 1421
95 Ga0070661_100002263 3300005344 Bacteria 13196
96 Ga0070661_100050285 3300005344 Bacteria 3049
97 Ga0070661_100062228 3300005344 Bacteria 2740
98 Ga0070661_100077123 3300005344 Bacteria 2456
99 Ga0070661_100383580 3300005344 Bacteria 1108
100 Ga0070692_10013609 3300005345 Bacteria 3797
101 Ga0070692_10019466 3300005345 Bacteria 3275
102 Ga0070692_10030016 3300005345 Bacteria 2715
103 Ga0070668_100003121 3300005347 Bacteria 12238
104 Ga0070668_100018583 3300005347 Bacteria 5219
105 Ga0070668_100063651 3300005347 Bacteria 2859
106 Ga0070668_100085647 3300005347 Bacteria 2477
107 Ga0070668_100135195 3300005347 Bacteria 1982
108 Ga0070668_100143969 3300005347 Bacteria 1923
109 Ga0070668_100328630 3300005347 Bacteria 1289
110 Ga0070669_100006519 3300005353 Bacteria 8406
111 Ga0070669_100023970 3300005353 Bacteria 4372
112 Ga0070669_100038713 3300005353 Bacteria 3462
113 Ga0070669_100164069 3300005353 Bacteria 1728
114 Ga0070669_100222985 3300005353 Bacteria 1491
115 Ga0070675_100000783 3300005354 Bacteria 22262
116 Ga0070675_100002509 3300005354 Bacteria 13735
117 Ga0070675_100008395 3300005354 Bacteria 8015
118 Ga0070675_100017563 3300005354 Bacteria 5687
119 Ga0070675_100018880 3300005354 Bacteria 5490
120 Ga0070675_100089061 3300005354 Bacteria 2583
121 Ga0070675_100117136 3300005354 Bacteria 2260
122 Ga0070675_100132751 3300005354 Bacteria 2123
123 Ga0070675_100163678 3300005354 Bacteria 1915
124 Ga0070675_100179809 3300005354 Bacteria 1828
125 Ga0070671_100000128 3300005355 Bacteria 48658
126 Ga0070671_100001372 3300005355 Bacteria 18255
127 Ga0070671_100005466 3300005355 Bacteria 10141
128 Ga0070671_100030200 3300005355 Bacteria 4472
129 Ga0070671_100068872 3300005355 Bacteria 2951
130 Ga0070671_100161273 3300005355 Bacteria 1895
131 Ga0070674_100037101 3300005356 Bacteria 3276
132 Ga0070674_100057351 3300005356 Bacteria 2703
133 Ga0070674_100078994 3300005356 Bacteria 2346
134 Ga0070674_100202216 3300005356 Bacteria 1535
135 Ga0070674_100316970 3300005356 Bacteria 1249
136 Ga0070673_100005763 3300005364 Bacteria 7972
137 Ga0070673_100014207 3300005364 Bacteria 5535
138 Ga0070673_100028391 3300005364 Bacteria 4161
139 Ga0070673_100222274 3300005364 Bacteria 1635
140 Ga0070673_100519437 3300005364 Bacteria 1079
141 Ga0070688_100083773 3300005365 Bacteria 2070
142 Ga0070688_100114136 3300005365 Bacteria 1800
143 Ga0070659_100005049 3300005366 Bacteria 9461
144 Ga0070659_100014648 3300005366 Bacteria 5863
145 Ga0070659_100027629 3300005366 Bacteria 4374
146 Ga0070667_100000052 3300005367 Bacteria 153455
147 Ga0070667_100048364 3300005367 Bacteria 3580
148 Ga0070667_100061546 3300005367 Bacteria 3178
149 Ga0070667_100071115 3300005367 Bacteria 2963
150 Ga0070667_100125180 3300005367 Bacteria 2239
151 Ga0070667_100205062 3300005367 Bacteria 1750
152 Ga0070709_10014713 3300005434 Bacteria 4431
153 Ga0070714_100011747 3300005435 Bacteria 6958
154 Ga0070713_100000045 3300005436 Bacteria 77398
155 Ga0070713_100020371 3300005436 Bacteria 5084
156 Ga0070710_10001552 3300005437 Bacteria 10857
157 Ga0070710_10100547 3300005437 Bacteria 1721
158 Ga0070701_10028035 3300005438 Bacteria 2766
159 Ga0070701_10051835 3300005438 Bacteria 2130
160 Ga0070701_10099871 3300005438 Bacteria 1605
161 Ga0070711_100000979 3300005439 Bacteria 15125
162 Ga0070711_100255271 3300005439 Bacteria 1377
163 Ga0070705_100025129 3300005440 Bacteria 3225
164 Ga0070705_100029556 3300005440 Bacteria 3016
165 Ga0070705_100046639 3300005440 Bacteria 2499
166 Ga0070705_100123843 3300005440 Bacteria 1674
167 Ga0070705_100160790 3300005440 Bacteria 1501
168 Ga0070705_100198605 3300005440 Bacteria 1373
169 Ga0070700_100000396 3300005441 Bacteria 22554
170 Ga0070700_100008805 3300005441 Bacteria 5512
171 Ga0070700_100075575 3300005441 Bacteria 2161
172 Ga0070700_100118476 3300005441 Bacteria 1770
173 Ga0070700_100170436 3300005441 Bacteria 1507
174 Ga0070694_100006107 3300005444 Bacteria 7306
175 Ga0070694_100011182 3300005444 Bacteria 5559
176 Ga0070694_100138562 3300005444 Bacteria 1765
177 Ga0070694_100288708 3300005444 Bacteria 1253
178 Ga0070708_100159991 3300005445 Bacteria 2098
179 Ga0070708_100214483 3300005445 Bacteria 1804
180 Ga0070708_100541720 3300005445 Bacteria 1098
181 Ga0070663_100098582 3300005455 Bacteria 2178
182 Ga0070663_100126147 3300005455 Bacteria 1939
183 Ga0070663_100134393 3300005455 Bacteria 1882
184 Ga0070678_100000463 3300005456 Bacteria 19357
185 Ga0070678_100074427 3300005456 Bacteria 2552
186 Ga0070678_100239553 3300005456 Bacteria 1516
187 Ga0070678_100271757 3300005456 Bacteria 1430
188 Ga0070678_100520236 3300005456 Bacteria 1052
189 Ga0070662_100035077 3300005457 Bacteria 3541
190 Ga0070662_100049496 3300005457 Bacteria 3030
191 Ga0070662_100069978 3300005457 Bacteria 2585
192 Ga0070662_100106050 3300005457 Bacteria 2134
193 Ga0070681_10000611 3300005458 Bacteria 29403
194 Ga0070681_10004528 3300005458 Bacteria 13264
195 Ga0070681_10070181 3300005458 Bacteria 3469
196 Ga0070681_10155279 3300005458 Bacteria 2214
197 Ga0070681_10160361 3300005458 Bacteria 2173
198 Ga0070681_10334616 3300005458 Bacteria 1423
199 Ga0068867_100013837 3300005459 Bacteria 5711
200 Ga0068867_100022066 3300005459 Bacteria 4549
201 Ga0068867_100027056 3300005459 Bacteria 4120
202 Ga0068867_100091467 3300005459 Bacteria 2310
203 Ga0068867_100166609 3300005459 Bacteria 1742
204 Ga0068867_100218794 3300005459 Bacteria 1534
205 Ga0068867_100251397 3300005459 Bacteria 1438
206 Ga0068867_100276704 3300005459 Bacteria 1375
207 Ga0070685_10135671 3300005466 Bacteria 1543
208 Ga0070706_100053743 3300005467 Bacteria 3717
209 Ga0070706_100148134 3300005467 Bacteria 2191
210 Ga0070706_100333276 3300005467 Bacteria 1415
211 Ga0070706_100395146 3300005467 Bacteria 1287
212 Ga0070707_100043483 3300005468 Bacteria 4299
213 Ga0070707_100458324 3300005468 Bacteria 1236
214 Ga0070698_100043148 3300005471 Bacteria 4625
215 Ga0070698_100209886 3300005471 Bacteria 1882
216 Ga0070698_100254665 3300005471 Bacteria 1688
217 Ga0070699_100162578 3300005518 Bacteria 1976
218 Ga0070679_100000602 3300005530 Bacteria 30622
219 Ga0070679_100011268 3300005530 Bacteria 8523
220 Ga0070679_100057543 3300005530 Bacteria 3875
221 Ga0070679_100084974 3300005530 Bacteria 3152
222 Ga0070679_100093957 3300005530 Bacteria 2986
223 Ga0070679_100205385 3300005530 Bacteria 1934
224 Ga0070684_100015628 3300005535 Bacteria 6190
225 Ga0070684_100023889 3300005535 Bacteria 5121
226 Ga0070684_100225660 3300005535 Bacteria 1710
227 Ga0070697_100012581 3300005536 Bacteria 6628
228 Ga0070697_100362198 3300005536 Bacteria 1254
229 Ga0068853_100089805 3300005539 Bacteria 2699
230 Ga0068853_100114170 3300005539 Bacteria 2402
231 Ga0068853_100142464 3300005539 Bacteria 2152
232 Ga0070672_100001093 3300005543 Bacteria 16524
233 Ga0070672_100007042 3300005543 Bacteria 7603
234 Ga0070672_100011072 3300005543 Bacteria 6280
235 Ga0070672_100073618 3300005543 Bacteria 2723
236 Ga0070672_100088301 3300005543 Bacteria 2496
237 Ga0070672_100090873 3300005543 Bacteria 2463
238 Ga0070672_100100022 3300005543 Bacteria 2351
239 Ga0070672_100121530 3300005543 Bacteria 2138
240 Ga0070672_100303564 3300005543 Bacteria 1354
241 Ga0070686_100026176 3300005544 Bacteria 3518
242 Ga0070686_100091550 3300005544 Bacteria 2035
243 Ga0070686_100315452 3300005544 Bacteria 1164
244 Ga0070695_100061566 3300005545 Bacteria 2435
245 Ga0070695_100062960 3300005545 Bacteria 2410
246 Ga0070695_100142281 3300005545 Bacteria 1665
247 Ga0070696_100040363 3300005546 Bacteria 3222
248 Ga0070696_100136994 3300005546 Bacteria 1785
249 Ga0070693_100169307 3300005547 Bacteria 1398
250 Ga0070665_100004349 3300005548 Bacteria 14899
251 Ga0070665_100007432 3300005548 Bacteria 11140
252 Ga0070665_100051901 3300005548 Bacteria 4113
253 Ga0070665_100080808 3300005548 Bacteria 3256
254 Ga0070665_100110207 3300005548 Bacteria 2755
255 Ga0070665_100220341 3300005548 Bacteria 1898
256 Ga0070665_100292897 3300005548 Bacteria 1630
257 Ga0070704_100000018 3300005549 Bacteria 54668
258 Ga0070704_100010603 3300005549 Bacteria 5611
259 Ga0070704_100024777 3300005549 Bacteria 3941
260 Ga0070704_100298246 3300005549 Bacteria 1342
261 Ga0070704_100335764 3300005549 Bacteria 1271
262 Ga0070704_100363017 3300005549 Bacteria 1226
263 Ga0068855_100001182 3300005563 Bacteria 32433
264 Ga0068855_100001706 3300005563 Bacteria 27486
265 Ga0068855_100002465 3300005563 Bacteria 22841
266 Ga0068855_100009248 3300005563 Bacteria 11906
267 Ga0068855_100014961 3300005563 Bacteria 9345
268 Ga0068855_100352464 3300005563 Bacteria 1621
269 Ga0070664_100000712 3300005564 Bacteria 25469
270 Ga0070664_100002382 3300005564 Bacteria 15098
271 Ga0070664_100005456 3300005564 Bacteria 10210
272 Ga0070664_100057493 3300005564 Bacteria 3306
273 Ga0070664_100095791 3300005564 Bacteria 2574
274 Ga0070664_100123823 3300005564 Bacteria 2266
275 Ga0070664_100218292 3300005564 Bacteria 1706
276 Ga0068857_100011829 3300005577 Bacteria 7591
277 Ga0068857_100163791 3300005577 Bacteria 2019
278 Ga0068857_100170142 3300005577 Bacteria 1980
279 Ga0068854_100001881 3300005578 Bacteria 12806
280 Ga0068854_100023240 3300005578 Bacteria 4233
281 Ga0068854_100076706 3300005578 Bacteria 2457
282 Ga0068854_100236407 3300005578 Bacteria 1453
283 Ga0068854_100237094 3300005578 Bacteria 1451
284 Ga0068856_100004553 3300005614 Bacteria 13778
285 Ga0068856_100025692 3300005614 Bacteria 5742
286 Ga0068856_100036576 3300005614 Bacteria 4813
287 Ga0068856_100040053 3300005614 Bacteria 4601
288 Ga0068856_100067169 3300005614 Bacteria 3543
289 Ga0068856_100094059 3300005614 Bacteria 2984
290 Ga0068856_100139945 3300005614 Bacteria 2427
291 Ga0068856_100307555 3300005614 Bacteria 1603
292 Ga0068856_100377852 3300005614 Bacteria 1436
293 Ga0070702_100000536 3300005615 Bacteria 13724
294 Ga0070702_100012238 3300005615 Bacteria 4292
295 Ga0070702_100026041 3300005615 Bacteria 3140
296 Ga0070702_100132516 3300005615 Bacteria 1576
297 Ga0068852_100001103 3300005616 Bacteria 17810
298 Ga0068852_100017508 3300005616 Bacteria 5624
299 Ga0068859_100003776 3300005617 Bacteria 15454
300 Ga0068859_100009497 3300005617 Bacteria 9823
301 Ga0068859_100023708 3300005617 Bacteria 6159
302 Ga0068859_100077712 3300005617 Bacteria 3360
303 Ga0068859_100120205 3300005617 Bacteria 2693
304 Ga0068859_100168757 3300005617 Bacteria 2269
305 Ga0068859_100271922 3300005617 Bacteria 1787
306 Ga0068864_100002031 3300005618 Bacteria 16705
307 Ga0068864_100010073 3300005618 Bacteria 7806
308 Ga0068864_100022732 3300005618 Bacteria 5258
309 Ga0068864_100023356 3300005618 Bacteria 5192
310 Ga0068864_100064135 3300005618 Bacteria 3185
311 Ga0068864_100121236 3300005618 Bacteria 2338
312 Ga0068864_100203346 3300005618 Bacteria 1820
313 Ga0068864_100217787 3300005618 Bacteria 1760
314 Ga0068864_100240406 3300005618 Bacteria 1678
315 Ga0068864_100245706 3300005618 Bacteria 1659
316 Ga0068864_100431323 3300005618 Bacteria 1257
317 Ga0068866_10000717 3300005718 Bacteria 15051
318 Ga0068866_10003912 3300005718 Bacteria 6111
319 Ga0068866_10051421 3300005718 Bacteria 2097
320 Ga0068866_10062206 3300005718 Bacteria 1941
321 Ga0068866_10187591 3300005718 Bacteria 1226
322 Ga0068861_100012489 3300005719 Bacteria 5927
323 Ga0068861_100015622 3300005719 Bacteria 5355
324 Ga0068861_100016209 3300005719 Bacteria 5268
325 Ga0068861_100029458 3300005719 Bacteria 4017
326 Ga0068861_100160014 3300005719 Bacteria 1856
327 Ga0068861_100195762 3300005719 Bacteria 1693
328 Ga0068861_100196842 3300005719 Bacteria 1689
329 Ga0068861_100287360 3300005719 Bacteria 1419
330 Ga0068851_10003231 3300005834 Bacteria 7222
331 Ga0068851_10038885 3300005834 Bacteria 2388
332 Ga0068851_10042935 3300005834 Bacteria 2278
333 Ga0068870_10037587 3300005840 Bacteria 2496
334 Ga0068863_100001012 3300005841 Bacteria 28130
335 Ga0068863_100002456 3300005841 Bacteria 18419
336 Ga0068863_100010910 3300005841 Bacteria 8811
337 Ga0068863_100021801 3300005841 Bacteria 6114
338 Ga0068863_100042478 3300005841 Bacteria 4319
339 Ga0068863_100069864 3300005841 Bacteria 3320
340 Ga0068863_100077118 3300005841 Bacteria 3154
341 Ga0068863_100088880 3300005841 Bacteria 2929
342 Ga0068863_100138272 3300005841 Bacteria 2327
343 Ga0068863_100187450 3300005841 Bacteria 1987
344 Ga0068863_100193491 3300005841 Bacteria 1955
345 Ga0068863_100422239 3300005841 Bacteria 1306
346 Ga0068858_100000838 3300005842 Bacteria 31992
347 Ga0068858_100001334 3300005842 Bacteria 25476
348 Ga0068858_100003187 3300005842 Bacteria 16393
349 Ga0068858_100049450 3300005842 Bacteria 3894
350 Ga0068858_100056595 3300005842 Bacteria 3624
351 Ga0068858_100123497 3300005842 Bacteria 2423
352 Ga0068858_100416596 3300005842 Bacteria 1292
353 Ga0068858_100473361 3300005842 Bacteria 1208
354 Ga0068860_100000941 3300005843 Bacteria 32265
355 Ga0068860_100002554 3300005843 Bacteria 19028
356 Ga0068860_100013492 3300005843 Bacteria 8012
357 Ga0068860_100028810 3300005843 Bacteria 5344
358 Ga0068860_100038795 3300005843 Bacteria 4557
359 Ga0068860_100040424 3300005843 Bacteria 4457
360 Ga0068860_100053102 3300005843 Bacteria 3853
361 Ga0068860_100107013 3300005843 Bacteria 2672
362 Ga0068860_100141667 3300005843 Bacteria 2311
363 Ga0068860_100213605 3300005843 Bacteria 1871
364 Ga0068862_100000627 3300005844 Bacteria 36553
365 Ga0068862_100003677 3300005844 Bacteria 13117
366 Ga0068862_100007347 3300005844 Bacteria 9152
367 Ga0068862_100008433 3300005844 Bacteria 8527
368 Ga0068862_100021370 3300005844 Bacteria 5407
369 Ga0068862_100025886 3300005844 Bacteria 4928
370 Ga0068862_100050489 3300005844 Bacteria 3555
371 Ga0068862_100096277 3300005844 Bacteria 2583
372 Ga0068862_100099445 3300005844 Bacteria 2542
373 Ga0068862_100166692 3300005844 Bacteria 1969
374 Ga0068862_100189099 3300005844 Bacteria 1851
375 Ga0068862_100240492 3300005844 Bacteria 1646
376 Ga0068862_100353240 3300005844 Bacteria 1364
377 Ga0081455_10013572 3300005937 Bacteria 8029
378 Ga0070717_10035050 3300006028 Bacteria 4059
379 Ga0075364_10000513 3300006051 Bacteria 19718
380 Ga0075364_10001919 3300006051 Bacteria 11578
381 Ga0075364_10015072 3300006051 Bacteria 4787
382 Ga0070715_10008322 3300006163 Bacteria 3611
383 Ga0070715_10073462 3300006163 Bacteria 1534
384 Ga0070716_100000244 3300006173 Bacteria 21728
385 Ga0070712_100030129 3300006175 Bacteria 3643
386 Ga0070712_100046364 3300006175 Bacteria 3005
387 Ga0070712_100207631 3300006175 Bacteria 1543
388 Ga0075366_10001562 3300006195 Bacteria 11450
389 Ga0075366_10024270 3300006195 Bacteria 3536
390 Ga0075366_10040010 3300006195 Bacteria 2772
391 Ga0097621_100003986 3300006237 Bacteria 10232
392 Ga0097621_100006125 3300006237 Bacteria 8517
393 Ga0097621_100036360 3300006237 Bacteria 3940
394 Ga0097621_100061784 3300006237 Bacteria 3073
395 Ga0097621_100084227 3300006237 Bacteria 2650
396 Ga0097621_100098407 3300006237 Bacteria 2457
397 Ga0097621_100285937 3300006237 Bacteria 1453
398 Ga0097621_100340364 3300006237 Bacteria 1332
399 Ga0068871_100000888 3300006358 Bacteria 19940
400 Ga0068871_100023710 3300006358 Bacteria 4751
401 Ga0068871_100032115 3300006358 Bacteria 4144
402 Ga0068871_100050198 3300006358 Bacteria 3374
403 Ga0068871_100155363 3300006358 Bacteria 1953
404 Ga0068871_100167521 3300006358 Bacteria 1882
405 Ga0068871_100311729 3300006358 Bacteria 1383
406 Ga0068871_100334706 3300006358 Bacteria 1336
407 Ga0075428_100001820 3300006844 Bacteria 22828
408 Ga0075428_100012398 3300006844 Bacteria 9482
409 Ga0075428_100013313 3300006844 Bacteria 9151
410 Ga0075428_100019629 3300006844 Bacteria 7479
411 Ga0075428_100019983 3300006844 Bacteria 7417
412 Ga0075428_100115633 3300006844 Bacteria 2922
413 Ga0075430_100002494 3300006846 Bacteria 15338
414 Ga0075430_100012275 3300006846 Bacteria 7290
415 Ga0075430_100018473 3300006846 Bacteria 5933
416 Ga0075430_100148725 3300006846 Bacteria 1950
417 Ga0075430_100180082 3300006846 Bacteria 1758
418 Ga0075430_100315010 3300006846 Bacteria 1294
419 Ga0075430_100332803 3300006846 Bacteria 1255
420 Ga0075430_100433765 3300006846 Bacteria 1084
421 Ga0075431_100000992 3300006847 Bacteria 25307
422 Ga0075431_100021306 3300006847 Bacteria 6625
423 Ga0075431_100042431 3300006847 Bacteria 4692
424 Ga0075431_100043121 3300006847 Bacteria 4655
425 Ga0075431_100098948 3300006847 Bacteria 3010
426 Ga0075431_100101385 3300006847 Bacteria 2970
427 Ga0075431_100125262 3300006847 Bacteria 2651
428 Ga0075431_100128352 3300006847 Bacteria 2616
429 Ga0075431_100523932 3300006847 Bacteria 1174
430 Ga0075433_10009350 3300006852 Bacteria 7837
431 Ga0075433_10017867 3300006852 Bacteria 5885
432 Ga0075433_10145124 3300006852 Bacteria 2110
433 Ga0075433_10310431 3300006852 Bacteria 1396
434 Ga0075433_10406665 3300006852 Bacteria 1201
435 Ga0075434_100000358 3300006871 Bacteria 33110
436 Ga0075434_100125348 3300006871 Bacteria 2585
437 Ga0075429_100000646 3300006880 Bacteria 26951
438 Ga0075429_100010240 3300006880 Bacteria 8117
439 Ga0075429_100041093 3300006880 Bacteria 4027
440 Ga0075429_100041561 3300006880 Bacteria 4004
441 Ga0075429_100208170 3300006880 Bacteria 1713
442 Ga0068865_100001823 3300006881 Bacteria 12517
443 Ga0068865_100006486 3300006881 Bacteria 7142
444 Ga0068865_100049038 3300006881 Bacteria 2908
445 Ga0068865_100101036 3300006881 Bacteria 2112
446 Ga0068865_100150787 3300006881 Bacteria 1763
447 Ga0068865_100330874 3300006881 Bacteria 1228
448 Ga0075436_100117052 3300006914 Bacteria 1863
449 Ga0075436_100264469 3300006914 Bacteria 1227
450 Ga0097620_100003775 3300006931 Bacteria 15454
451 Ga0097620_100009496 3300006931 Bacteria 9823
452 Ga0097620_100023708 3300006931 Bacteria 6159
453 Ga0097620_100077708 3300006931 Bacteria 3360
454 Ga0097620_100120210 3300006931 Bacteria 2693
455 Ga0097620_100168761 3300006931 Bacteria 2269
456 Ga0097620_100271907 3300006931 Bacteria 1787
457 Ga0099826_10000014 3300006948 Bacteria 258520
458 Ga0075435_100024948 3300007076 Bacteria 4648
459 Ga0075435_100167129 3300007076 Bacteria 1855
460 Ga0099794_10019591 3300007265 Bacteria 3052
461 Ga0099794_10033455 3300007265 Bacteria 2417
462 Ga0099794_10093686 3300007265 Bacteria 1493
463 Ga0105251_10016322 3300009011 Bacteria 4017
464 Ga0105251_10049227 3300009011 Bacteria 2018
465 Ga0105244_10000480 3300009036 Bacteria 36191
466 Ga0105244_10016069 3300009036 Bacteria 4275
467 Ga0105250_10000021 3300009092 Bacteria 239960
468 Ga0105250_10000023 3300009092 Bacteria 219389
469 Ga0105240_10001345 3300009093 Bacteria 42171
470 Ga0105240_10004508 3300009093 Bacteria 21175
471 Ga0105240_10008645 3300009093 Bacteria 14548
472 Ga0105240_10016284 3300009093 Bacteria 10071
473 Ga0105240_10072048 3300009093 Bacteria 4271
474 Ga0105240_10076281 3300009093 Bacteria 4133
475 Ga0105240_10143498 3300009093 Bacteria 2852
476 Ga0105240_10254013 3300009093 Bacteria 2031
477 Ga0105240_10269139 3300009093 Bacteria 1963
478 Ga0105240_10274055 3300009093 Bacteria 1941
479 Ga0105240_10316293 3300009093 Bacteria 1781
480 Ga0111539_10012428 3300009094 Bacteria 10676
481 Ga0111539_10023233 3300009094 Bacteria 7617
482 Ga0111539_10023375 3300009094 Bacteria 7593
483 Ga0111539_10030460 3300009094 Bacteria 6558
484 Ga0111539_10059404 3300009094 Bacteria 4534
485 Ga0111539_10071890 3300009094 Bacteria 4081
486 Ga0111539_10073043 3300009094 Bacteria 4044
487 Ga0111539_10081579 3300009094 Bacteria 3804
488 Ga0111539_10115901 3300009094 Bacteria 3141
489 Ga0111539_10154829 3300009094 Bacteria 2682
490 Ga0111539_10170118 3300009094 Bacteria 2546
491 Ga0105245_10010418 3300009098 Bacteria 8096
492 Ga0105245_10053253 3300009098 Bacteria 3632
493 Ga0105245_10068994 3300009098 Bacteria 3205
494 Ga0105247_10000613 3300009101 Bacteria 28740
495 Ga0105247_10008368 3300009101 Bacteria 6307
496 Ga0105247_10047507 3300009101 Bacteria 2636
497 Ga0114129_10000246 3300009147 Bacteria 60999
498 Ga0114129_10089197 3300009147 Bacteria 4275
499 Ga0114129_10110589 3300009147 Bacteria 3792
500 Ga0114129_10137685 3300009147 Bacteria 3349
501 Ga0114129_10164161 3300009147 Bacteria 3032
502 Ga0114129_10466527 3300009147 Bacteria 1654
503 Ga0105243_10126161 3300009148 Bacteria 2165
504 Ga0105243_10136173 3300009148 Bacteria 2090
505 Ga0105243_10166897 3300009148 Bacteria 1903
506 Ga0105243_10199049 3300009148 Bacteria 1755
507 Ga0105241_10043275 3300009174 Bacteria 3410
508 Ga0105241_10088500 3300009174 Bacteria 2438
509 Ga0105241_10090077 3300009174 Bacteria 2418
510 Ga0105241_10103482 3300009174 Bacteria 2267
511 Ga0105242_10000991 3300009176 Bacteria 22219
512 Ga0105242_10007522 3300009176 Bacteria 8382
513 Ga0105242_10040873 3300009176 Bacteria 3737
514 Ga0105248_10023598 3300009177 Bacteria 6833
515 Ga0105248_10131071 3300009177 Bacteria 2829
516 Ga0105248_10177228 3300009177 Bacteria 2402
517 Ga0105248_10227184 3300009177 Bacteria 2101
518 Ga0105248_10241296 3300009177 Bacteria 2034
519 Ga0105237_10075394 3300009545 Bacteria 3365
520 Ga0105237_10100737 3300009545 Bacteria 2880
521 Ga0105237_10184415 3300009545 Bacteria 2087
522 Ga0105237_10238664 3300009545 Bacteria 1819
523 Ga0105237_10274841 3300009545 Bacteria 1687
524 Ga0105237_10512246 3300009545 Bacteria 1206
525 Ga0105238_10000155 3300009551 Bacteria 74637
526 Ga0105238_10034261 3300009551 Bacteria 5167
527 Ga0105238_10144279 3300009551 Bacteria 2357
528 Ga0105238_10187472 3300009551 Bacteria 2045
529 Ga0105238_10196176 3300009551 Bacteria 1995
530 Ga0105238_10274929 3300009551 Bacteria 1665
531 Ga0105238_10504531 3300009551 Bacteria 1211
532 Ga0105249_10002480 3300009553 Bacteria 15981
533 Ga0105249_10008606 3300009553 Bacteria 8894
534 Ga0105249_10008927 3300009553 Bacteria 8756
535 Ga0105239_10044029 3300010375 Bacteria 4894
536 Ga0105239_10044801 3300010375 Bacteria 4849
537 Ga0105239_10091472 3300010375 Bacteria 3357
538 Ga0105239_10406084 3300010375 Bacteria 1542
539 Ga0105246_10379433 3300011119 Bacteria 1168
540 Ga0157373_10036577 3300013100 Bacteria 3522
541 Ga0157373_10226157 3300013100 Bacteria 1320
542 Ga0157370_10000459 3300013104 Bacteria 51005
543 Ga0157370_10014928 3300013104 Bacteria 7922
544 Ga0157370_10087259 3300013104 Bacteria 2931
545 Ga0157370_10108624 3300013104 Bacteria 2594
546 Ga0157369_10004509 3300013105 Bacteria 16394
547 Ga0157369_10097160 3300013105 Bacteria 3142
548 Ga0157369_10111504 3300013105 Bacteria 2907
549 Ga0157369_10173360 3300013105 Bacteria 2272
550 Ga0157369_10541853 3300013105 Bacteria 1203
551 Ga0157374_10000173 3300013296 Bacteria 59752
552 Ga0157374_10002787 3300013296 Bacteria 14681
553 Ga0157374_10089052 3300013296 Bacteria 2940
554 Ga0157374_10152622 3300013296 Bacteria 2246
555 Ga0157378_10001843 3300013297 Bacteria 19029
556 Ga0157378_10014679 3300013297 Bacteria 6862
557 Ga0157378_10021870 3300013297 Bacteria 5624
558 Ga0157378_10044427 3300013297 Bacteria 3946
559 Ga0157378_10094127 3300013297 Bacteria 2728
560 Ga0157378_10095848 3300013297 Bacteria 2703
561 Ga0157378_10099426 3300013297 Bacteria 2654
562 Ga0157378_10145822 3300013297 Bacteria 2202
563 Ga0157378_10214315 3300013297 Bacteria 1827
564 Ga0163162_10023826 3300013306 Bacteria 6041
565 Ga0163162_10069959 3300013306 Bacteria 3561
566 Ga0163162_10107599 3300013306 Bacteria 2884
567 Ga0163162_10179065 3300013306 Bacteria 2246
568 Ga0163162_10211385 3300013306 Bacteria 2070
569 Ga0163162_10230726 3300013306 Bacteria 1981
570 Ga0163162_10336618 3300013306 Bacteria 1642
571 Ga0163162_10361935 3300013306 Bacteria 1584
572 Ga0163162_10437256 3300013306 Bacteria 1440
573 Ga0157372_10402653 3300013307 Bacteria 1595
574 Ga0157372_10554451 3300013307 Bacteria 1340
575 Ga0157375_10005969 3300013308 Bacteria 10621
576 Ga0157375_10034170 3300013308 Bacteria 4841
577 Ga0157375_10070454 3300013308 Bacteria 3506
578 Ga0157375_10074486 3300013308 Bacteria 3416
579 Ga0157375_10150513 3300013308 Bacteria 2462
580 Ga0157375_10425051 3300013308 Bacteria 1495
581 Ga0157375_10441387 3300013308 Bacteria 1467
582 Ga0157375_10489370 3300013308 Bacteria 1395
583 Ga0157375_10497835 3300013308 Bacteria 1383
584 Ga0157375_10582767 3300013308 Bacteria 1279
585 Ga0157375_10612726 3300013308 Bacteria 1247
586 Ga0157375_10667433 3300013308 Bacteria 1195
587 Ga0163163_10001413 3300014325 Bacteria 20296
588 Ga0163163_10005314 3300014325 Bacteria 11120
589 Ga0163163_10015469 3300014325 Bacteria 7053
590 Ga0163163_10019986 3300014325 Bacteria 6300
591 Ga0163163_10021863 3300014325 Bacteria 6045
592 Ga0163163_10059902 3300014325 Bacteria 3768
593 Ga0163163_10348635 3300014325 Bacteria 1536
594 Ga0163163_10365138 3300014325 Bacteria 1500
595 Ga0163163_10603203 3300014325 Bacteria 1161
596 Ga0157380_10000523 3300014326 Bacteria 23586
597 Ga0157380_10001490 3300014326 Bacteria 15328
598 Ga0157380_10014833 3300014326 Bacteria 5709
599 Ga0157380_10033583 3300014326 Bacteria 3952
600 Ga0157380_10114009 3300014326 Bacteria 2277
601 Ga0157380_10262497 3300014326 Bacteria 1569
602 Ga0182008_10002199 3300014497 Bacteria 12381
603 Ga0157377_10061290 3300014745 Bacteria 2150
604 Ga0157377_10076224 3300014745 Bacteria 1950
605 Ga0157379_10000241 3300014968 Bacteria 42825
606 Ga0157379_10020413 3300014968 Bacteria 5857
607 Ga0157379_10023113 3300014968 Bacteria 5513
608 Ga0157379_10024272 3300014968 Bacteria 5383
609 Ga0157379_10033388 3300014968 Bacteria 4589
610 Ga0157379_10097250 3300014968 Bacteria 2643
611 Ga0157376_10065831 3300014969 Bacteria 3062
612 Ga0157376_10231633 3300014969 Bacteria 1716
613 Ga0157376_10252551 3300014969 Bacteria 1648
614 Ga0157376_10275270 3300014969 Bacteria 1583
615 Ga0157376_10276692 3300014969 Unclassified 1579
616 Ga0182006_1000014 3300015261 Bacteria 340159
617 Ga0182006_1001667 3300015261 Bacteria 13062
618 Ga0182006_1003394 3300015261 Bacteria 8158
619 Ga0182006_1011676 3300015261 Bacteria 3860
620 Ga0182007_10000011 3300015262 Bacteria 264045
621 Ga0182007_10000938 3300015262 Bacteria 16060
622 Ga0182007_10028723 3300015262 Bacteria 1909
623 Ga0182005_1000014 3300015265 Bacteria 389763
624 Ga0182005_1000052 3300015265 Bacteria 113532
625 Ga0182005_1002111 3300015265 Bacteria 7388
626 Ga0163161_10011439 3300017792 Bacteria 6156
627 Ga0163161_10045423 3300017792 Bacteria 3168
628 Ga0163161_10048220 3300017792 Bacteria 3076
629 Ga0163161_10059877 3300017792 Bacteria 2770
630 Ga0163161_10081193 3300017792 Bacteria 2387
631 Ga0163161_10084995 3300017792 Bacteria 2334
632 Ga0163161_10220170 3300017792 Bacteria 1470
633 Ga0206353_12058834 3300020082 Bacteria 2286
634 Ga0213872_10000002 3300021361 Bacteria 554092
635 Ga0213872_10000305 3300021361 Bacteria 41889
636 Ga0213872_10002860 3300021361 Bacteria 9864
637 Ga0213872_10003308 3300021361 Bacteria 8984
638 Ga0213872_10003721 3300021361 Bacteria 8340
639 Ga0213872_10006075 3300021361 Bacteria 6107
640 Ga0213872_10011337 3300021361 Bacteria 4218
641 Ga0213872_10022038 3300021361 Bacteria 2934
642 Ga0213872_10058781 3300021361 Bacteria 1740
643 Ga0213874_10017033 3300021377 Bacteria 1943
644 Ga0213874_10024331 3300021377 Bacteria 1697
645 Ga0213876_10034937 3300021384 Bacteria 2652
646 Ga0209435_100004 3300025206 Bacteria 633417
647 Ga0209435_100156 3300025206 Bacteria 22357
648 Ga0209760_101646 3300025207 Bacteria 2280
649 Ga0209784_100005 3300025224 Bacteria 1040422
650 Ga0209784_100020 3300025224 Bacteria 412353
651 Ga0209566_100005 3300025225 Bacteria 1040422
652 Ga0209566_100020 3300025225 Bacteria 412353
653 Ga0209674_100009 3300025226 Bacteria 1040422
654 Ga0209674_100035 3300025226 Bacteria 412353
655 Ga0209147_100011 3300025229 Bacteria 702140
656 Ga0209563_100012 3300025230 Bacteria 1040422
657 Ga0209563_100038 3300025230 Bacteria 412353
658 Ga0209437_100066 3300025233 Bacteria 327883
659 Ga0209437_100084 3300025233 Bacteria 255423
660 Ga0209258_100264 3300025242 Bacteria 90298
661 Ga0209646_1000032 3300025246 Bacteria 375315
662 Ga0209646_1000047 3300025246 Bacteria 323416
663 Ga0209646_1000052 3300025246 Bacteria 286370
664 Ga0209026_1000062 3300025250 Bacteria 213298
665 Ga0209026_1002562 3300025250 Bacteria 6701
666 Ga0209026_1004402 3300025250 Bacteria 4188
667 Ga0209677_100006 3300025253 Bacteria 1040422
668 Ga0209677_100031 3300025253 Bacteria 329719
669 Ga0209759_1000054 3300025256 Bacteria 211422
670 Ga0209759_1000514 3300025256 Bacteria 41893
671 Ga0209233_1000060 3300025261 Bacteria 412379
672 Ga0209565_1000006 3300025263 Bacteria 897294
673 Ga0209455_1017960 3300025272 Bacteria 1466
674 Ga0209673_1000004 3300025273 Bacteria 896155
675 Ga0209130_1000065 3300025284 Bacteria 195251
676 Ga0209675_1000006 3300025291 Bacteria 732267
677 Ga0209025_1000554 3300025294 Bacteria 69453
678 Ga0209025_1004464 3300025294 Bacteria 12151
679 Ga0209025_1005334 3300025294 Bacteria 10549
680 Ga0209564_1000006 3300025295 Bacteria 1100927
681 Ga0209564_1000064 3300025295 Bacteria 316431
682 Ga0209564_1000107 3300025295 Bacteria 214040
683 Ga0209256_1000179 3300025299 Bacteria 123865
684 Ga0209256_1000340 3300025299 Bacteria 76961
685 Ga0209051_1002451 3300025303 Bacteria 13288
686 Ga0207697_10007354 3300025315 Bacteria 4920
687 Ga0207656_10046611 3300025321 Bacteria 1860
688 Ga0207656_10081110 3300025321 Bacteria 1458
689 Ga0207696_1000503 3300025711 Bacteria 32694
690 Ga0207655_1020727 3300025728 Bacteria 3366
691 Ga0207653_10062323 3300025885 Bacteria 1260
692 Ga0207682_10009949 3300025893 Bacteria 3736
693 Ga0207682_10020031 3300025893 Bacteria 2623
694 Ga0207682_10050173 3300025893 Bacteria 1725
695 Ga0207692_10029108 3300025898 Bacteria 2621
696 Ga0207692_10083281 3300025898 Bacteria 1716
697 Ga0207642_10011043 3300025899 Bacteria 3207
698 Ga0207642_10104328 3300025899 Bacteria 1430
699 Ga0207710_10006077 3300025900 Bacteria 5174
700 Ga0207710_10023194 3300025900 Bacteria 2666
701 Ga0207688_10051364 3300025901 Bacteria 2309
702 Ga0207688_10087835 3300025901 Bacteria 1782
703 Ga0207680_10005870 3300025903 Bacteria 5893
704 Ga0207680_10056596 3300025903 Bacteria 2369
705 Ga0207680_10092999 3300025903 Bacteria 1922
706 Ga0207680_10190489 3300025903 Bacteria 1392
707 Ga0207685_10041984 3300025905 Bacteria 1715
708 Ga0207699_10021017 3300025906 Bacteria 3510
709 Ga0207645_10014503 3300025907 Bacteria 5272
710 Ga0207645_10029729 3300025907 Bacteria 3522
711 Ga0207645_10046562 3300025907 Bacteria 2770
712 Ga0207643_10005861 3300025908 Bacteria 6563
713 Ga0207643_10031159 3300025908 Bacteria 2971
714 Ga0207643_10071090 3300025908 Bacteria 2003
715 Ga0207684_10163867 3300025910 Bacteria 1915
716 Ga0207654_10044196 3300025911 Bacteria 2529
717 Ga0207654_10232776 3300025911 Bacteria 1228
718 Ga0207707_10000751 3300025912 Bacteria 31949
719 Ga0207707_10003844 3300025912 Bacteria 13308
720 Ga0207707_10015871 3300025912 Bacteria 6569
721 Ga0207707_10028726 3300025912 Bacteria 4859
722 Ga0207707_10036263 3300025912 Bacteria 4313
723 Ga0207707_10065401 3300025912 Bacteria 3168
724 Ga0207707_10090683 3300025912 Bacteria 2671
725 Ga0207707_10337987 3300025912 Bacteria 1299
726 Ga0207695_10002162 3300025913 Bacteria 29707
727 Ga0207695_10003096 3300025913 Bacteria 23815
728 Ga0207695_10008191 3300025913 Bacteria 13131
729 Ga0207695_10034230 3300025913 Bacteria 5529
730 Ga0207695_10039353 3300025913 Bacteria 5082
731 Ga0207695_10041549 3300025913 Bacteria 4921
732 Ga0207695_10055225 3300025913 Bacteria 4140
733 Ga0207695_10074319 3300025913 Bacteria 3460
734 Ga0207695_10075211 3300025913 Bacteria 3437
735 Ga0207695_10205611 3300025913 Bacteria 1882
736 Ga0207671_10060503 3300025914 Bacteria 2810
737 Ga0207671_10109642 3300025914 Bacteria 2099
738 Ga0207671_10362450 3300025914 Bacteria 1150
739 Ga0207693_10000007 3300025915 Bacteria 173735
740 Ga0207693_10059777 3300025915 Bacteria 2985
741 Ga0207693_10098082 3300025915 Bacteria 2298
742 Ga0207663_10012439 3300025916 Bacteria 4602
743 Ga0207663_10185948 3300025916 Bacteria 1487
744 Ga0207660_10006464 3300025917 Bacteria 7599
745 Ga0207660_10027511 3300025917 Bacteria 3882
746 Ga0207660_10145099 3300025917 Bacteria 1818
747 Ga0207662_10000269 3300025918 Bacteria 23948
748 Ga0207662_10163984 3300025918 Bacteria 1421
749 Ga0207657_10002609 3300025919 Bacteria 19479
750 Ga0207657_10004204 3300025919 Bacteria 15251
751 Ga0207657_10156509 3300025919 Bacteria 1853
752 Ga0207649_10003420 3300025920 Bacteria 8681
753 Ga0207649_10011243 3300025920 Bacteria 4931
754 Ga0207649_10014718 3300025920 Bacteria 4386
755 Ga0207649_10021407 3300025920 Bacteria 3722
756 Ga0207649_10322809 3300025920 Bacteria 1135
757 Ga0207652_10002171 3300025921 Bacteria 16778
758 Ga0207652_10018733 3300025921 Bacteria 5681
759 Ga0207652_10079629 3300025921 Bacteria 2863
760 Ga0207652_10110015 3300025921 Bacteria 2443
761 Ga0207652_10119674 3300025921 Bacteria 2342
762 Ga0207646_10004092 3300025922 Bacteria 16064
763 Ga0207681_10002856 3300025923 Bacteria 10912
764 Ga0207681_10003441 3300025923 Bacteria 9881
765 Ga0207681_10045535 3300025923 Bacteria 2946
766 Ga0207681_10108219 3300025923 Bacteria 2017
767 Ga0207681_10113427 3300025923 Bacteria 1976
768 Ga0207694_10000625 3300025924 Bacteria 32139
769 Ga0207694_10037116 3300025924 Bacteria 3740
770 Ga0207694_10060517 3300025924 Bacteria 2947
771 Ga0207694_10120994 3300025924 Bacteria 2090
772 Ga0207694_10239377 3300025924 Bacteria 1483
773 Ga0207694_10333148 3300025924 Bacteria 1254
774 Ga0207650_10002703 3300025925 Bacteria 12252
775 Ga0207650_10017166 3300025925 Bacteria 5065
776 Ga0207650_10021288 3300025925 Bacteria 4583
777 Ga0207650_10027729 3300025925 Bacteria 4056
778 Ga0207650_10041183 3300025925 Bacteria 3383
779 Ga0207650_10129502 3300025925 Bacteria 1973
780 Ga0207650_10449329 3300025925 Bacteria 1072
781 Ga0207659_10003461 3300025926 Bacteria 9464
782 Ga0207659_10009472 3300025926 Bacteria 6089
783 Ga0207659_10010547 3300025926 Bacteria 5809
784 Ga0207659_10015323 3300025926 Bacteria 4962
785 Ga0207659_10015760 3300025926 Bacteria 4907
786 Ga0207659_10037748 3300025926 Bacteria 3356
787 Ga0207659_10071833 3300025926 Bacteria 2528
788 Ga0207687_10005308 3300025927 Bacteria 8530
789 Ga0207687_10007028 3300025927 Bacteria 7421
790 Ga0207700_10000051 3300025928 Bacteria 77057
791 Ga0207700_10031633 3300025928 Bacteria 3762
792 Ga0207700_10052163 3300025928 Bacteria 3056
793 Ga0207700_10223002 3300025928 Bacteria 1599
794 Ga0207664_10422027 3300025929 Bacteria 1188
795 Ga0207644_10000403 3300025931 Bacteria 28161
796 Ga0207644_10000800 3300025931 Bacteria 19939
797 Ga0207644_10056591 3300025931 Bacteria 2830
798 Ga0207644_10067626 3300025931 Bacteria 2604
799 Ga0207644_10148933 3300025931 Bacteria 1809
800 Ga0207644_10204609 3300025931 Bacteria 1558
801 Ga0207690_10002750 3300025932 Bacteria 10627
802 Ga0207690_10163528 3300025932 Bacteria 1661
803 Ga0207706_10007576 3300025933 Bacteria 10041
804 Ga0207706_10048180 3300025933 Bacteria 3769
805 Ga0207706_10067627 3300025933 Bacteria 3143
806 Ga0207706_10099134 3300025933 Bacteria 2563
807 Ga0207706_10131311 3300025933 Bacteria 2203
808 Ga0207706_10132692 3300025933 Bacteria 2191
809 Ga0207706_10211941 3300025933 Bacteria 1698
810 Ga0207706_10360504 3300025933 Bacteria 1263
811 Ga0207686_10011209 3300025934 Bacteria 4902
812 Ga0207686_10016593 3300025934 Bacteria 4134
813 Ga0207709_10030619 3300025935 Bacteria 3132
814 Ga0207709_10115637 3300025935 Bacteria 1802
815 Ga0207709_10294419 3300025935 Bacteria 1204
816 Ga0207670_10002723 3300025936 Bacteria 9298
817 Ga0207670_10004796 3300025936 Bacteria 7339
818 Ga0207670_10070289 3300025936 Bacteria 2417
819 Ga0207670_10081959 3300025936 Bacteria 2260
820 Ga0207670_10110878 3300025936 Bacteria 1977
821 Ga0207670_10111361 3300025936 Bacteria 1973
822 Ga0207670_10128428 3300025936 Bacteria 1853
823 Ga0207669_10019154 3300025937 Bacteria 3557
824 Ga0207669_10146898 3300025937 Bacteria 1645
825 Ga0207669_10149897 3300025937 Bacteria 1632
826 Ga0207669_10172080 3300025937 Bacteria 1542
827 Ga0207704_10052197 3300025938 Bacteria 2477
828 Ga0207704_10058256 3300025938 Bacteria 2377
829 Ga0207704_10065397 3300025938 Bacteria 2276
830 Ga0207704_10080385 3300025938 Bacteria 2104
831 Ga0207704_10120645 3300025938 Bacteria 1793
832 Ga0207704_10188024 3300025938 Bacteria 1499
833 Ga0207665_10006297 3300025939 Bacteria 7871
834 Ga0207665_10020217 3300025939 Bacteria 4374
835 Ga0207665_10027185 3300025939 Bacteria 3780
836 Ga0207665_10050866 3300025939 Bacteria 2788
837 Ga0207691_10001621 3300025940 Bacteria 22347
838 Ga0207691_10002348 3300025940 Bacteria 18524
839 Ga0207691_10002646 3300025940 Bacteria 17500
840 Ga0207691_10008772 3300025940 Bacteria 9701
841 Ga0207691_10009236 3300025940 Bacteria 9461
842 Ga0207691_10027590 3300025940 Bacteria 5323
843 Ga0207691_10059569 3300025940 Bacteria 3471
844 Ga0207691_10139948 3300025940 Bacteria 2133
845 Ga0207691_10504776 3300025940 Bacteria 1027
846 Ga0207711_10021913 3300025941 Bacteria 5338
847 Ga0207711_10145710 3300025941 Bacteria 2133
848 Ga0207711_10158101 3300025941 Bacteria 2050
849 Ga0207711_10642058 3300025941 Bacteria 990
850 Ga0207689_10000310 3300025942 Bacteria 44928
851 Ga0207689_10012716 3300025942 Bacteria 7190
852 Ga0207689_10022140 3300025942 Bacteria 5344
853 Ga0207689_10064597 3300025942 Bacteria 3011
854 Ga0207689_10204123 3300025942 Bacteria 1632
855 Ga0207661_10004522 3300025944 Bacteria 9751
856 Ga0207661_10022639 3300025944 Bacteria 4737
857 Ga0207661_10128755 3300025944 Bacteria 2165
858 Ga0207679_10002358 3300025945 Bacteria 11620
859 Ga0207679_10003296 3300025945 Bacteria 9962
860 Ga0207679_10007770 3300025945 Bacteria 6815
861 Ga0207679_10018376 3300025945 Bacteria 4683
862 Ga0207679_10140289 3300025945 Bacteria 1953
863 Ga0207679_10160835 3300025945 Bacteria 1838
864 Ga0207679_10575924 3300025945 Bacteria 1012
865 Ga0207667_10000019 3300025949 Bacteria 386233
866 Ga0207667_10000637 3300025949 Bacteria 45399
867 Ga0207667_10004938 3300025949 Bacteria 16285
868 Ga0207667_10007781 3300025949 Bacteria 12814
869 Ga0207667_10012690 3300025949 Bacteria 9683
870 Ga0207667_10035515 3300025949 Bacteria 5347
871 Ga0207667_10151395 3300025949 Bacteria 2387
872 Ga0207667_10615245 3300025949 Bacteria 1094
873 Ga0207651_10008002 3300025960 Bacteria 5675
874 Ga0207651_10037092 3300025960 Bacteria 3190
875 Ga0207651_10092708 3300025960 Bacteria 2216
876 Ga0207651_10136389 3300025960 Bacteria 1888
877 Ga0207651_10159781 3300025960 Bacteria 1765
878 Ga0207712_10004779 3300025961 Bacteria 8554
879 Ga0207712_10096474 3300025961 Bacteria 2188
880 Ga0207712_10169107 3300025961 Bacteria 1707
881 Ga0207712_10174577 3300025961 Bacteria 1683
882 Ga0207712_10182754 3300025961 Bacteria 1648
883 Ga0207668_10007417 3300025972 Bacteria 6519
884 Ga0207668_10021249 3300025972 Bacteria 4137
885 Ga0207668_10036814 3300025972 Bacteria 3269
886 Ga0207668_10062992 3300025972 Bacteria 2614
887 Ga0207668_10085593 3300025972 Bacteria 2301
888 Ga0207668_10111689 3300025972 Bacteria 2052
889 Ga0207668_10138774 3300025972 Bacteria 1866
890 Ga0207640_10010217 3300025981 Bacteria 5280
891 Ga0207640_10079111 3300025981 Bacteria 2240
892 Ga0207640_10254310 3300025981 Bacteria 1365
893 Ga0207640_10255473 3300025981 Bacteria 1362
894 Ga0207658_10000197 3300025986 Bacteria 63743
895 Ga0207658_10017504 3300025986 Bacteria 4940
896 Ga0207658_10050590 3300025986 Bacteria 3058
897 Ga0207658_10390411 3300025986 Bacteria 1221
898 Ga0207677_10000943 3300026023 Bacteria 16236
899 Ga0207677_10001689 3300026023 Bacteria 11673
900 Ga0207677_10263760 3300026023 Bacteria 1405
901 Ga0207677_10385404 3300026023 Bacteria 1184
902 Ga0207703_10000527 3300026035 Bacteria 39354
903 Ga0207703_10001924 3300026035 Bacteria 18395
904 Ga0207703_10001944 3300026035 Bacteria 18270
905 Ga0207703_10006799 3300026035 Bacteria 9117
906 Ga0207703_10011508 3300026035 Bacteria 6883
907 Ga0207703_10025444 3300026035 Bacteria 4655
908 Ga0207703_10062891 3300026035 Bacteria 3041
909 Ga0207703_10099188 3300026035 Bacteria 2465
910 Ga0207703_10169809 3300026035 Bacteria 1917
911 Ga0207703_10318622 3300026035 Bacteria 1423
912 Ga0207639_10018834 3300026041 Bacteria 4912
913 Ga0207639_10426315 3300026041 Bacteria 1200
914 Ga0207639_10576079 3300026041 Bacteria 1036
915 Ga0207678_10033565 3300026067 Bacteria 4470
916 Ga0207678_10049277 3300026067 Bacteria 3640
917 Ga0207678_10063471 3300026067 Bacteria 3174
918 Ga0207678_10120026 3300026067 Bacteria 2243
919 Ga0207678_10154389 3300026067 Bacteria 1960
920 Ga0207678_10162218 3300026067 Bacteria 1909
921 Ga0207708_10000736 3300026075 Bacteria 24605
922 Ga0207708_10003489 3300026075 Bacteria 11597
923 Ga0207708_10004110 3300026075 Bacteria 10713
924 Ga0207708_10008914 3300026075 Bacteria 7426
925 Ga0207708_10029484 3300026075 Bacteria 4160
926 Ga0207708_10154061 3300026075 Bacteria 1811
927 Ga0207708_10255149 3300026075 Bacteria 1414
928 Ga0207702_10102503 3300026078 Bacteria 2529
929 Ga0207702_10114892 3300026078 Bacteria 2400
930 Ga0207702_10155092 3300026078 Bacteria 2087
931 Ga0207702_10174799 3300026078 Bacteria 1972
932 Ga0207702_10323913 3300026078 Bacteria 1468
933 Ga0207641_10000604 3300026088 Bacteria 39468
934 Ga0207641_10005610 3300026088 Bacteria 10692
935 Ga0207641_10006006 3300026088 Bacteria 10290
936 Ga0207641_10013697 3300026088 Bacteria 6655
937 Ga0207641_10019332 3300026088 Bacteria 5590
938 Ga0207641_10025786 3300026088 Bacteria 4848
939 Ga0207641_10089203 3300026088 Bacteria 2694
940 Ga0207641_10117158 3300026088 Bacteria 2371
941 Ga0207641_10249778 3300026088 Bacteria 1656
942 Ga0207648_10004465 3300026089 Bacteria 14352
943 Ga0207648_10005674 3300026089 Bacteria 12526
944 Ga0207648_10022643 3300026089 Bacteria 5641
945 Ga0207648_10024077 3300026089 Bacteria 5440
946 Ga0207648_10059271 3300026089 Bacteria 3338
947 Ga0207648_10060255 3300026089 Bacteria 3310
948 Ga0207648_10135010 3300026089 Bacteria 2173
949 Ga0207648_10168935 3300026089 Bacteria 1933
950 Ga0207648_10171019 3300026089 Bacteria 1920
951 Ga0207648_10420907 3300026089 Bacteria 1213
952 Ga0207676_10027004 3300026095 Bacteria 4272
953 Ga0207676_10029276 3300026095 Bacteria 4121
954 Ga0207676_10033816 3300026095 Bacteria 3866
955 Ga0207676_10259985 3300026095 Bacteria 1567
956 Ga0207676_10321638 3300026095 Bacteria 1420
957 Ga0207674_10002650 3300026116 Bacteria 22350
958 Ga0207674_10006753 3300026116 Bacteria 13469
959 Ga0207674_10008122 3300026116 Bacteria 12166
960 Ga0207674_10035125 3300026116 Bacteria 5233
961 Ga0207674_10111069 3300026116 Bacteria 2716
962 Ga0207674_10658064 3300026116 Bacteria 1012
963 Ga0207675_100002123 3300026118 Bacteria 19651
964 Ga0207675_100010044 3300026118 Bacteria 8874
965 Ga0207675_100014526 3300026118 Bacteria 7339
966 Ga0207675_100021498 3300026118 Bacteria 6009
967 Ga0207675_100030104 3300026118 Bacteria 5055
968 Ga0207675_100032847 3300026118 Bacteria 4835
969 Ga0207675_100038209 3300026118 Bacteria 4479
970 Ga0207675_100185737 3300026118 Bacteria 1992
971 Ga0207683_10000817 3300026121 Bacteria 28494
972 Ga0207683_10002350 3300026121 Bacteria 16570
973 Ga0207683_10031427 3300026121 Bacteria 4608
974 Ga0207683_10031673 3300026121 Bacteria 4590
975 Ga0207683_10112081 3300026121 Bacteria 2443
976 Ga0207683_10138474 3300026121 Bacteria 2192
977 Ga0207683_10220808 3300026121 Bacteria 1727
978 Ga0207698_10001140 3300026142 Bacteria 15472
979 Ga0207698_10015798 3300026142 Bacteria 5070
980 Ga0207698_10033350 3300026142 Bacteria 3741
981 Ga0207698_10174114 3300026142 Bacteria 1898
982 Ga0209281_1002645 3300027111 Bacteria 6839
983 Ga0209967_1002770 3300027364 Bacteria 2282
984 Ga0209981_1009413 3300027378 Bacteria 1336
985 Ga0209999_1004154 3300027543 Bacteria 2607
986 Ga0209970_1002765 3300027614 Bacteria 2967
987 Ga0210002_1019511 3300027617 Bacteria 1088
988 Ga0209983_1004835 3300027665 Bacteria 2812
989 Ga0209282_1000046 3300027666 Bacteria 115032
990 Ga0209588_1032041 3300027671 Bacteria 1683
991 Ga0209974_10029239 3300027876 Bacteria 1825
992 Ga0207428_10004796 3300027907 Bacteria 12774
993 Ga0207428_10014528 3300027907 Bacteria 6832
994 Ga0207428_10041023 3300027907 Bacteria 3749
995 Ga0207428_10074137 3300027907 Bacteria 2669
996 Ga0268266_10000796 3300028379 Bacteria 41984
997 Ga0268266_10038457 3300028379 Bacteria 4073
998 Ga0268266_10070210 3300028379 Bacteria 3035
999 Ga0268266_10267124 3300028379 Bacteria 1587
1000 Ga0268266_10469587 3300028379 Bacteria 1198
1001 Ga0268265_10000932 3300028380 Bacteria 27011
1002 Ga0268265_10001937 3300028380 Bacteria 16419
1003 Ga0268265_10002340 3300028380 Bacteria 14383
1004 Ga0268265_10006026 3300028380 Bacteria 8249
1005 Ga0268265_10007525 3300028380 Bacteria 7352
1006 Ga0268265_10020235 3300028380 Bacteria 4643
1007 Ga0268265_10079250 3300028380 Bacteria 2586
1008 Ga0268265_10183200 3300028380 Bacteria 1801
1009 Ga0268265_10293712 3300028380 Bacteria 1460
1010 Ga0268264_10000176 3300028381 Bacteria 136166
1011 Ga0268264_10030223 3300028381 Bacteria 4441
1012 Ga0268264_10044621 3300028381 Bacteria 3677
1013 Ga0268264_10128460 3300028381 Bacteria 2243
1014 Ga0265323_10006325 3300028653 Bacteria 4980
1015 Ga0307515_10166593 3300028794 Bacteria 2218
1016 Ga0307515_10243509 3300028794 Bacteria 1564
1017 Ga0265338_10000057 3300028800 Bacteria 200477
1018 Ga0265338_10005002 3300028800 Bacteria 17529
1019 Ga0307511_10003352 3300030521 Bacteria 16486
1020 Ga0316181_1231393 3300030744 Bacteria 3215
1021 Ga0265766_1001995 3300030863 Bacteria 1095
1022 Ga0265330_10000033 3300031235 Bacteria 126931
1023 Ga0265330_10000827 3300031235 Bacteria 19446
1024 Ga0265332_10000001 3300031238 Bacteria 863783
1025 Ga0265332_10000742 3300031238 Bacteria 20271
1026 Ga0265328_10002285 3300031239 Bacteria 8620
1027 Ga0265328_10018006 3300031239 Bacteria 2730
1028 Ga0265325_10017896 3300031241 Bacteria 3935
1029 Ga0265329_10006654 3300031242 Bacteria 4562
1030 Ga0265340_10032736 3300031247 Bacteria 2594
1031 Ga0265331_10001605 3300031250 Bacteria 16512
1032 Ga0265331_10002179 3300031250 Bacteria 13453
1033 Ga0265331_10009384 3300031250 Bacteria 5493
1034 Ga0265327_10000103 3300031251 Bacteria 185405
1035 Ga0265327_10010155 3300031251 Bacteria 6660
1036 Ga0265327_10020157 3300031251 Bacteria 4072
1037 Ga0265327_10124707 3300031251 Bacteria 1217
1038 Ga0265316_10010545 3300031344 Bacteria 8413
1039 Ga0265316_10013150 3300031344 Bacteria 7373
1040 Ga0265316_10030556 3300031344 Bacteria 4414
1041 Ga0265316_10034228 3300031344 Bacteria 4128
1042 Ga0307513_10008177 3300031456 Bacteria 13419
1043 Ga0307513_10014609 3300031456 Bacteria 9559
1044 Ga0307513_10116719 3300031456 Bacteria 2647
1045 Ga0307509_10000021 3300031507 Bacteria 250589
1046 Ga0307408_100000331 3300031548 Bacteria 45112
1047 Ga0307408_100030530 3300031548 Bacteria 3743
1048 Ga0307408_100043547 3300031548 Bacteria 3194
1049 Ga0307408_100045527 3300031548 Bacteria 3134
1050 Ga0307408_100048376 3300031548 Bacteria 3050
1051 Ga0307408_100227248 3300031548 Bacteria 1526
1052 Ga0307408_100346077 3300031548 Bacteria 1260
1053 Ga0316575_10002733 3300031665 Bacteria 5953
1054 Ga0316575_10015078 3300031665 Bacteria 2911
1055 Ga0316575_10025792 3300031665 Bacteria 2282
1056 Ga0316579_10002332 3300031691 Bacteria 7170
1057 Ga0316579_10014957 3300031691 Bacteria 3363
1058 Ga0316579_10053611 3300031691 Bacteria 1889
1059 Ga0316579_10070788 3300031691 Bacteria 1652
1060 Ga0316579_10072978 3300031691 Bacteria 1628
1061 Ga0265314_10000022 3300031711 Bacteria 297299
1062 Ga0265314_10009479 3300031711 Bacteria 8212
1063 Ga0265314_10044351 3300031711 Bacteria 3153
1064 Ga0265314_10158797 3300031711 Bacteria 1378
1065 Ga0316576_10000007 3300031727 Bacteria 55305
1066 Ga0316576_10002013 3300031727 Bacteria 11385
1067 Ga0316576_10014172 3300031727 Bacteria 5321
1068 Ga0316576_10023318 3300031727 Bacteria 4309
1069 Ga0316576_10106015 3300031727 Bacteria 2104
1070 Ga0316576_10115129 3300031727 Bacteria 2017
1071 Ga0316578_10000247 3300031728 Bacteria 16110
1072 Ga0316578_10011051 3300031728 Bacteria 4706
1073 Ga0316578_10029415 3300031728 Bacteria 3118
1074 Ga0316578_10032042 3300031728 Bacteria 2999
1075 Ga0316578_10042096 3300031728 Bacteria 2647
1076 Ga0316578_10080392 3300031728 Bacteria 1939
1077 Ga0307516_10005678 3300031730 Bacteria 14806
1078 Ga0307405_10009974 3300031731 Bacteria 4898
1079 Ga0307405_10047459 3300031731 Bacteria 2645
1080 Ga0307405_10287436 3300031731 Bacteria 1241
1081 Ga0316577_10000060 3300031733 Bacteria 26325
1082 Ga0316577_10002401 3300031733 Bacteria 9267
1083 Ga0316577_10011270 3300031733 Bacteria 4841
1084 Ga0316577_10021225 3300031733 Bacteria 3602
1085 Ga0316577_10054363 3300031733 Bacteria 2235
1086 Ga0316577_10137759 3300031733 Bacteria 1374
1087 Ga0316577_10193824 3300031733 Bacteria 1148
1088 Ga0307413_10035667 3300031824 Bacteria 2855
1089 Ga0307413_10130081 3300031824 Bacteria 1721
1090 Ga0307410_10023462 3300031852 Bacteria 3835
1091 Ga0307410_10052426 3300031852 Bacteria 2755
1092 Ga0307410_10086703 3300031852 Bacteria 2212
1093 Ga0307410_10132131 3300031852 Bacteria 1835
1094 Ga0307406_10022966 3300031901 Bacteria 3706
1095 Ga0307406_10181664 3300031901 Bacteria 1532
1096 Ga0307407_10020497 3300031903 Bacteria 3390
1097 Ga0307407_10025997 3300031903 Bacteria 3094
1098 Ga0307412_10019389 3300031911 Bacteria 4118
1099 Ga0307412_10482665 3300031911 Bacteria 1028
1100 Ga0307409_100003265 3300031995 Bacteria 8754
1101 Ga0307409_100005682 3300031995 Bacteria 7224
1102 Ga0307409_100085062 3300031995 Bacteria 2570
1103 Ga0307409_100244334 3300031995 Bacteria 1636
1104 Ga0307416_100007278 3300032002 Bacteria 7018
1105 Ga0307416_100022471 3300032002 Bacteria 4554
1106 Ga0307416_100053714 3300032002 Bacteria 3234
1107 Ga0307416_100188320 3300032002 Bacteria 1943
1108 Ga0307416_100196331 3300032002 Bacteria 1909
1109 Ga0307416_100869372 3300032002 Bacteria 1000
1110 Ga0307414_10162918 3300032004 Bacteria 1774
1111 Ga0307414_10393846 3300032004 Bacteria 1201
1112 Ga0307411_10012815 3300032005 Bacteria 4595
1113 Ga0307411_10018834 3300032005 Bacteria 3972
1114 Ga0307415_100009761 3300032126 Bacteria 5400
1115 Ga0307415_100129907 3300032126 Bacteria 1905
1116 Ga0307415_100132924 3300032126 Bacteria 1887
1117 Ga0316585_10000120 3300032137 Bacteria 14794
1118 Ga0316580_10004843 3300032139 Bacteria 3914
1119 Ga0316580_10012007 3300032139 Bacteria 2634
1120 Ga0316580_10014310 3300032139 Bacteria 2422
1121 Ga0316580_10040740 3300032139 Bacteria 1435
1122 Ga0307510_10000002 3300033180 Bacteria 801565
1123 Ga0307510_10038803 3300033180 Bacteria 5259
1124 Ga0307510_10121453 3300033180 Bacteria 2316
1125 Ga0316588_1015333 3300033528 Bacteria 1687
1126 Ga0316587_1021171 3300033529 Bacteria 1108
1127 Ga0316596_1018730 3300033541 Bacteria 1752
1128 Ga0373958_0005256 3300034819 Bacteria 1959
1129 Ga0373926_0017403 3300035083 Bacteria 2467
1130 Ga0373934_0004781 3300035086 Bacteria 5009
1131 Ga0373934_0008021 3300035086 Bacteria 3929
1132 Ga0373936_0030899 3300035113 Bacteria 2113
1133 Ga0373941_0032107 3300035115 Bacteria 1569
1134 Ga0373945_0014449 3300035116 Bacteria 2646
1135 Ga0373945_0136109 3300035116 Bacteria 988
1136 Ga0373953_0065061 3300035117 Bacteria 1496
1137 Ga0373954_0121962 3300035118 Bacteria 1266
1138 Ga0373956_0000029 3300035119 Bacteria 45843
1139 Ga0373956_0030613 3300035119 Bacteria 2354
1140 Ga0373956_0125656 3300035119 Bacteria 1199
1141 Ga0373957_0000474 3300035120 Bacteria 10144
1142 Ga0373957_0008879 3300035120 Bacteria 3273
1143 Ga0373957_0061048 3300035120 Bacteria 1460
1144 Ga0373943_0157862 3300035170 Bacteria 1233
1145 Ga0373943_0227747 3300035170 Bacteria 1040
1146 Ga0373955_0000731 3300035172 Bacteria 14077
1147 Ga0373955_0011087 3300035172 Bacteria 4281
1148 Ga0373955_0075734 3300035172 Bacteria 1891
1149 Ga0373955_0178468 3300035172 Bacteria 1259
1150 Ga0373961_0009521 3300035241 Bacteria 2379
1151 Ga0373962_0042496 3300035242 Bacteria 1286
1152 Ga0316574_0001501 3300035398 Bacteria 11110
1153 Ga0316574_0002787 3300035398 Bacteria 8875
1154 Ga0316574_0004096 3300035398 Bacteria 7597
1155 Ga0316574_0005003 3300035398 Bacteria 7032
1156 Ga0316574_0005513 3300035398 Bacteria 6753
1157 Ga0316574_0006846 3300035398 Bacteria 6197
1158 Ga0316574_0009834 3300035398 Bacteria 5376
1159 Ga0316574_0010793 3300035398 Bacteria 5174
1160 Ga0316574_0012984 3300035398 Bacteria 4778
1161 Ga0316574_0020895 3300035398 Bacteria 3880
1162 Ga0316574_0032015 3300035398 Bacteria 3193
1163 Ga0316574_0032977 3300035398 Bacteria 3151
1164 Ga0316574_0059360 3300035398 Bacteria 2398
1165 Ga0316574_0083734 3300035398 Bacteria 2028
1166 Ga0316574_0205946 3300035398 Bacteria 1263
1167 Ga0373931_0015441 3300035691 Bacteria 3746
1168 Ga0373931_0029386 3300035691 Bacteria 2821
1169 Ga0373935_0008593 3300035692 Bacteria 6110
1170 Ga0373935_0048854 3300035692 Bacteria 2680
1171 Ga0373935_0104491 3300035692 Bacteria 1872
1172 Ga0373927_0039972 3300035695 Bacteria 3043
1173 Ga0373927_0054434 3300035695 Bacteria 2588
1174 Ga0373927_0087643 3300035695 Bacteria 2021
1175 Ga0373933_0000579 3300035724 Bacteria 22962
1176 Ga0373933_0017867 3300035724 Bacteria 3983
1177 Ga0373933_0053057 3300035724 Bacteria 2427
1178 Ga0373933_0080850 3300035724 Bacteria 1993
1179 Ga0373933_0091165 3300035724 Bacteria 1881
1180 Ga0373933_0128412 3300035724 Bacteria 1592
1181 Ga0373933_0202774 3300035724 Bacteria 1270
1182 Ga0373947_0172461 3300035725 Bacteria 1404
1183 Ga0373937_0000441 3300036401 Bacteria 38394
1184 Ga0373937_0003520 3300036401 Bacteria 13176
1185 Ga0373937_0014512 3300036401 Bacteria 6956
1186 Ga0373937_0048250 3300036401 Bacteria 3897
1187 Ga0373937_0049409 3300036401 Bacteria 3852
1188 Ga0373937_0055776 3300036401 Bacteria 3628
1189 Ga0373937_0061527 3300036401 Bacteria 3451
1190 Ga0373937_0156332 3300036401 Bacteria 2137
1191 Ga0373937_0184536 3300036401 Bacteria 1959
1192 Ga0373937_0202246 3300036401 Bacteria 1867
1193 Ga0373937_0213959 3300036401 Bacteria 1814
1194 Ga0373937_0292077 3300036401 Bacteria 1540
1195 Ga0373937_0295974 3300036401 Bacteria 1529
1196 Ga0316582_0000395 3300036647 Bacteria 15815
1197 Ga0316582_0003675 3300036647 Bacteria 7582
1198 Ga0316582_0005547 3300036647 Bacteria 6514
1199 Ga0316582_0006878 3300036647 Bacteria 6015
1200 Ga0316582_0008980 3300036647 Bacteria 5400
1201 Ga0316582_0018329 3300036647 Bacteria 4072
1202 Ga0316582_0022562 3300036647 Unclassified 3738
1203 Ga0316582_0036087 3300036647 Bacteria 3057
1204 Ga0316582_0059008 3300036647 Bacteria 2455
1205 Ga0316582_0063949 3300036647 Bacteria 2366
1206 Ga0316582_0070281 3300036647 Bacteria 2265
1207 Ga0316584_0000351 3300036712 Bacteria 23751
1208 Ga0316584_0001066 3300036712 Bacteria 16003
1209 Ga0316584_0002993 3300036712 Bacteria 10872
1210 Ga0316584_0013493 3300036712 Bacteria 5785
1211 Ga0316584_0015047 3300036712 Bacteria 5526
1212 Ga0316584_0023503 3300036712 Bacteria 4502
1213 Ga0316584_0035151 3300036712 Bacteria 3718
1214 Ga0316584_0059173 3300036712 Bacteria 2869
1215 Ga0316584_0064679 3300036712 Bacteria 2739
1216 Ga0316584_0075894 3300036712 Bacteria 2519
1217 Ga0316584_0110458 3300036712 Bacteria 2058
1218 Ga0316584_0117465 3300036712 Bacteria 1989
1219 Ga0316584_0131295 3300036712 Bacteria 1871
1220 Ga0316584_0362705 3300036712 Bacteria 1038
1221 Ga0373925_0024901 3300037068 Bacteria 4371
1222 Ga0373925_0026437 3300037068 Bacteria 4246
1223 Ga0373925_0059508 3300037068 Bacteria 2866
1224 Ga0373925_0469901 3300037068 Bacteria 1031
1225 Ga0395899_0001136 3300037312 Bacteria 23550
1226 Ga0395899_0001535 3300037312 Bacteria 19501
1227 Ga0395900_0007959 3300037418 Bacteria 10910
1228 Ga0395900_0073358 3300037418 Bacteria 3519
1229 Ga0395900_0121983 3300037418 Bacteria 2674
1230 Ga0395900_0159102 3300037418 Bacteria 2305
1231 Ga0395900_0217252 3300037418 Bacteria 1928
1232 Ga0395900_0498418 3300037418 Bacteria 1168
1233 Ga0395898_0011479 3300037466 Bacteria 9200
1234 Ga0395898_0020896 3300037466 Bacteria 6644
1235 Ga0395898_0037964 3300037466 Bacteria 4775
1236 Ga0395905_0000059 3300037471 Bacteria 198101
1237 Ga0395905_0001136 3300037471 Bacteria 33276
1238 Ga0395905_0008938 3300037471 Bacteria 9836
1239 Ga0395905_0010966 3300037471 Bacteria 8772
1240 Ga0395905_0011248 3300037471 Bacteria 8651
1241 Ga0395905_0073000 3300037471 Bacteria 3216
1242 Ga0316581_0008348 3300037588 Bacteria 2815
1243 Ga0395901_0000839 3300038443 Bacteria 33897
1244 Ga0395901_0004488 3300038443 Bacteria 14071
1245 Ga0395901_0199796 3300038443 Bacteria 2096
1246 Ga0395901_0356467 3300038443 Bacteria 1509
1247 Ga0395901_0393697 3300038443 Bacteria 1424
1248 Ga0400490_36062 3300038726 Bacteria 4457
1249 Ga0400488_28864 3300038741 Bacteria 3420
1250 Ga0400483_041619 3300039062 Bacteria 6562
1251 Ga0400483_060059 3300039062 Bacteria 2648
1252 Ga0400483_190258 3300039062 Bacteria 3589
1253 Ga0400483_199900 3300039062 Bacteria 2844
1254 Ga0400487_14099 3300039110 Bacteria 43310
1255 Ga0400487_59035 3300039110 Bacteria 5941
1256 Ga0436365_0655415 3300039437 Bacteria 3162
1257 Ga0436365_1360668 3300039437 Bacteria 4000
1258 Ga0436365_1839211 3300039437 Bacteria 1265
1259 Ga0436360_0128072 3300039438 Bacteria 2508
1260 Ga0436360_0775847 3300039438 Bacteria 1472
1261 Ga0436361_0091148 3300039447 Bacteria 7977
1262 Ga0436361_0101333 3300039447 Bacteria 28993
1263 Ga0436361_0148126 3300039447 Bacteria 2923
1264 Ga0436361_0282854 3300039447 Bacteria 12597
1265 Ga0436361_0334934 3300039447 Bacteria 33477
1266 Ga0436361_0362646 3300039447 Bacteria 6899
1267 Ga0436361_0594091 3300039447 Bacteria 35115
1268 Ga0436361_0599318 3300039447 Bacteria 1994
1269 Ga0436361_0798996 3300039447 Bacteria 3742
1270 Ga0436361_1028197 3300039447 Bacteria 31240
1271 Ga0436361_1176994 3300039447 Bacteria 7249
1272 Ga0436363_0260147 3300039450 Bacteria 15545
1273 Ga0436363_0952595 3300039450 Bacteria 5360
1274 Ga0436363_1067387 3300039450 Bacteria 2131
1275 Ga0436363_1706823 3300039450 Bacteria 1173
1276 Ga0439438_003009 3300041405 Bacteria 6954
1277 Ga0439453_0000441 3300041408 Bacteria 4520
1278 Ga0439461_0028237 3300041410 Bacteria 1154
1279 Ga0451849_0304227 3300041505 Bacteria 2153
1280 Ga0451853_1138053 3300041512 Bacteria 2613
1281 Ga0439431_0004894 3300041997 Bacteria 2953
1282 Ga0439433_0004018 3300041999 Bacteria 3164
1283 Ga0439441_001005 3300042001 Bacteria 3474
1284 Ga0439456_012227 3300042013 Bacteria 1779
1285 Ga0450923_000279 3300042125 Bacteria 5140
1286 Ga0439446_0001893 3300042156 Bacteria 4917
1287 Ga0439446_0002299 3300042156 Bacteria 4565
1288 Ga0450908_007126 3300042184 Bacteria 2112
1289 Ga0439434_0017129 3300042435 Bacteria 2167
1290 Ga0439435_0000160 3300042436 Bacteria 9262
1291 Ga0439435_0024671 3300042436 Bacteria 1588
1292 Ga0439435_0047932 3300042436 Bacteria 1215
1293 Ga0439444_0000639 3300042437 Bacteria 4055
1294 Ga0451577_0000852 3300042876 Bacteria 45450
1295 Ga0451577_0001784 3300042876 Bacteria 27608
1296 Ga0451577_0006011 3300042876 Bacteria 12221
1297 Ga0451577_0037562 3300042876 Bacteria 4358
1298 Ga0451577_0114543 3300042876 Bacteria 2414
1299 Ga0451577_0125120 3300042876 Bacteria 2303
1300 Ga0451577_0143680 3300042876 Bacteria 2145
1301 Ga0451577_0197135 3300042876 Bacteria 1817
1302 Ga0451577_0197751 3300042876 Bacteria 1815
1303 Ga0451577_0408492 3300042876 Bacteria 1232
1304 Ga0466969_0001991 3300044656 Bacteria 10915
1305 Ga0466969_0002917 3300044656 Bacteria 9122
1306 Ga0466972_0000106 3300044658 Bacteria 72246
1307 Ga0466973_0095500 3300044659 Bacteria 2542
1308 Ga0466982_0076069 3300044672 Bacteria 2076
1309 Ga0453683_0063641 3300044673 Bacteria 2306
1310 Ga0466965_0013903 3300044683 Bacteria 3804
1311 Ga0466965_0028050 3300044683 Bacteria 2733
1312 Ga0466965_0049720 3300044683 Bacteria 2078
1313 Ga0466965_0127988 3300044683 Bacteria 1315
1314 Ga0466966_0004186 3300044684 Bacteria 9527
1315 Ga0466966_0053658 3300044684 Bacteria 2556
1316 Ga0466961_0000040 3300044693 Bacteria 78691
1317 Ga0466961_0031713 3300044693 Bacteria 3398
1318 Ga0466963_0010194 3300044694 Bacteria 5682
1319 Ga0466964_0007850 3300044706 Bacteria 3995
1320 Ga0453684_0002092 3300044712 Bacteria 50519
1321 Ga0453684_0005854 3300044712 Bacteria 23899
1322 Ga0453684_0007181 3300044712 Bacteria 20698
1323 Ga0453684_0018446 3300044712 Bacteria 10709
1324 Ga0453684_0033353 3300044712 Bacteria 7181
1325 Ga0453684_0061503 3300044712 Bacteria 4820
1326 Ga0453684_0144864 3300044712 Bacteria 2831
1327 Ga0453684_0571099 3300044712 Bacteria 1243
1328 Ga0453684_0577257 3300044712 Bacteria 1235
1329 Ga0453684_0765213 3300044712 Bacteria 1044
1330 Ga0466971_0002218 3300044719 Bacteria 8217
1331 Ga0466971_0003507 3300044719 Bacteria 6700
1332 Ga0466968_0000386 3300044735 Bacteria 14481
1333 Ga0466970_0004185 3300044765 Bacteria 7096
1334 Ga0466970_0048220 3300044765 Bacteria 2271
1335 Ga0466970_0049287 3300044765 Bacteria 2246
1336 Ga0466957_0011221 3300044842 Bacteria 5161
1337 Ga0466957_0018370 3300044842 Bacteria 4106
1338 Ga0466957_0081504 3300044842 Bacteria 2015
1339 Ga0466959_0016051 3300045049 Bacteria 5466
1340 Ga0466959_0021908 3300045049 Bacteria 4719
1341 Ga0466959_0047999 3300045049 Bacteria 3139
1342 Ga0466959_0072728 3300045049 Bacteria 2488
1343 Ga0466959_0078464 3300045049 Bacteria 2381
1344 Ga0451576_0003496 3300045051 Bacteria 21499
1345 Ga0451576_0014390 3300045051 Bacteria 8809
1346 Ga0451576_0027429 3300045051 Bacteria 6116
1347 Ga0451576_0035476 3300045051 Bacteria 5290
1348 Ga0451576_0045732 3300045051 Bacteria 4609
1349 Ga0451576_0078988 3300045051 Bacteria 3423
1350 Ga0451576_0486751 3300045051 Bacteria 1296
1351 Ga0466967_0007982 3300045976 Bacteria 7704
1352 Ga0466967_0416561 3300045976 Bacteria 1309
1353 Ga0495617_047239 3300046452 Bacteria 1433
1354 Ga0495627_000006 3300046453 Bacteria 581750
1355 Ga0495627_013310 3300046453 Bacteria 2896
1356 Ga0495592_0001747 3300046454 Bacteria 15259
1357 Ga0495592_0009606 3300046454 Bacteria 7280
1358 Ga0495592_0064178 3300046454 Bacteria 2692
1359 Ga0495592_0104404 3300046454 Bacteria 2015
1360 Ga0495592_0259506 3300046454 Bacteria 1145
1361 Ga0495603_0001029 3300046455 Bacteria 16102
1362 Ga0495603_0034806 3300046455 Bacteria 3028
1363 Ga0495603_0069390 3300046455 Bacteria 2073
1364 Ga0495603_0082058 3300046455 Bacteria 1889
1365 Ga0495590_0000004 3300046457 Bacteria 402091
1366 Ga0495590_0004686 3300046457 Bacteria 5484
1367 Ga0495590_0008972 3300046457 Bacteria 3800
1368 Ga0495591_000746 3300046458 Bacteria 23531
1369 Ga0495629_0002657 3300046459 Bacteria 13702
1370 Ga0495629_0022948 3300046459 Bacteria 4447
1371 Ga0495629_0046606 3300046459 Bacteria 3040
1372 Ga0495629_0077690 3300046459 Bacteria 2317
1373 Ga0495629_0224579 3300046459 Bacteria 1295
1374 Ga0495638_0000023 3300046460 Bacteria 363063
1375 Ga0495638_0003523 3300046460 Bacteria 12286
1376 Ga0495638_0003799 3300046460 Bacteria 11734
1377 Ga0495638_0005570 3300046460 Bacteria 9311
1378 Ga0495638_0014711 3300046460 Bacteria 5277
1379 Ga0495638_0021947 3300046460 Bacteria 4196
1380 Ga0495638_0027702 3300046460 Bacteria 3666
1381 Ga0495638_0085233 3300046460 Bacteria 1911
1382 Ga0495651_0000356 3300046462 Bacteria 35210
1383 Ga0495651_0008683 3300046462 Bacteria 7797
1384 Ga0495651_0049750 3300046462 Bacteria 3235
1385 Ga0495651_0080330 3300046462 Bacteria 2464
1386 Ga0495653_0000042 3300046463 Bacteria 117284
1387 Ga0495653_0005300 3300046463 Bacteria 10489
1388 Ga0495653_0085371 3300046463 Bacteria 2322
1389 Ga0495650_0000215 3300046471 Bacteria 122533
1390 Ga0495650_0000407 3300046471 Bacteria 70819
1391 Ga0495650_0003561 3300046471 Bacteria 11262
1392 Ga0495650_0004606 3300046471 Bacteria 9361
1393 Ga0495650_0005137 3300046471 Bacteria 8636
1394 Ga0495650_0012899 3300046471 Bacteria 4462
1395 Ga0495650_0020898 3300046471 Bacteria 3179
1396 Ga0495580_0001985 3300046472 Bacteria 17990
1397 Ga0495580_0013252 3300046472 Bacteria 6301
1398 Ga0495580_0027238 3300046472 Bacteria 4159
1399 Ga0495580_0035563 3300046472 Bacteria 3581
1400 Ga0495580_0083832 3300046472 Bacteria 2220
1401 Ga0495580_0109778 3300046472 Bacteria 1915
1402 Ga0495580_0183615 3300046472 Bacteria 1444
1403 Ga0495582_0006012 3300046473 Bacteria 6767
1404 Ga0495582_0011377 3300046473 Bacteria 4903
1405 Ga0495605_0001550 3300046474 Bacteria 14938
1406 Ga0495605_0004146 3300046474 Bacteria 8541
1407 Ga0495605_0015524 3300046474 Bacteria 4139
1408 Ga0495605_0122042 3300046474 Bacteria 1180
1409 Ga0495639_0058849 3300046475 Bacteria 1758
1410 Ga0495639_0071016 3300046475 Bacteria 1608
1411 Ga0495662_0005181 3300046476 Bacteria 6534
1412 Ga0495662_0027873 3300046476 Bacteria 2728
1413 Ga0495662_0034579 3300046476 Bacteria 2439
1414 Ga0495664_0000240 3300046477 Bacteria 26394
1415 Ga0495584_0010228 3300046491 Bacteria 4819
1416 Ga0495584_0020600 3300046491 Bacteria 3349
1417 Ga0495584_0185118 3300046491 Bacteria 1058
1418 Ga0495585_0011867 3300046492 Bacteria 5147
1419 Ga0495585_0198791 3300046492 Bacteria 1022
1420 Ga0495596_0000176 3300046500 Bacteria 44544
1421 Ga0495596_0001852 3300046500 Bacteria 11732
1422 Ga0495596_0014268 3300046500 Bacteria 3348
1423 Ga0495596_0017785 3300046500 Bacteria 2939
1424 Ga0495596_0035741 3300046500 Bacteria 1969
1425 Ga0495596_0043672 3300046500 Bacteria 1766
1426 Ga0495596_0061566 3300046500 Bacteria 1461
1427 Ga0495607_0004205 3300046501 Bacteria 10682
1428 Ga0495607_0017522 3300046501 Bacteria 4594
1429 Ga0495607_0041247 3300046501 Bacteria 2743
1430 Ga0495607_0082705 3300046501 Bacteria 1760
1431 Ga0495583_0000093 3300046506 Bacteria 158708
1432 Ga0495583_0000503 3300046506 Bacteria 56256
1433 Ga0495583_0001963 3300046506 Bacteria 18871
1434 Ga0495583_0018055 3300046506 Bacteria 3726
1435 Ga0495583_0024245 3300046506 Bacteria 3052
1436 Ga0495583_0034045 3300046506 Bacteria 2444
1437 Ga0495583_0098078 3300046506 Bacteria 1253
1438 Ga0495606_0000331 3300046507 Bacteria 81871
1439 Ga0495606_0000659 3300046507 Bacteria 54217
1440 Ga0495606_0002252 3300046507 Bacteria 22956
1441 Ga0495606_0002286 3300046507 Bacteria 22645
1442 Ga0495606_0004881 3300046507 Bacteria 13135
1443 Ga0495606_0010885 3300046507 Bacteria 7489
1444 Ga0495606_0020159 3300046507 Bacteria 4928
1445 Ga0495606_0020497 3300046507 Bacteria 4871
1446 Ga0495606_0021746 3300046507 Bacteria 4692
1447 Ga0495606_0026393 3300046507 Bacteria 4141
1448 Ga0495606_0030096 3300046507 Bacteria 3798
1449 Ga0495606_0090633 3300046507 Bacteria 1881
1450 Ga0495608_0004633 3300046511 Bacteria 9817
1451 Ga0495608_0005174 3300046511 Bacteria 9322
1452 Ga0495608_0158304 3300046511 Bacteria 1441
1453 Ga0495610_0015455 3300046512 Bacteria 4433
1454 Ga0495610_0029275 3300046512 Bacteria 2902
1455 Ga0495610_0033021 3300046512 Bacteria 2680
1456 Ga0495610_0117551 3300046512 Bacteria 1170
1457 Ga0495616_0001514 3300046513 Bacteria 16018
1458 Ga0495616_0001806 3300046513 Bacteria 14514
1459 Ga0495616_0007505 3300046513 Bacteria 6528
1460 Ga0495616_0018840 3300046513 Bacteria 3776
1461 Ga0495616_0064442 3300046513 Bacteria 1788
1462 Ga0495616_0090671 3300046513 Bacteria 1447
1463 Ga0495618_0010183 3300046514 Bacteria 5687
1464 Ga0495620_0017758 3300046515 Bacteria 3539
1465 Ga0495628_0008086 3300046516 Bacteria 9045
1466 Ga0495628_0010357 3300046516 Bacteria 7927
1467 Ga0495628_0012517 3300046516 Bacteria 7149
1468 Ga0495628_0041108 3300046516 Bacteria 3691
1469 Ga0495628_0054706 3300046516 Bacteria 3145
1470 Ga0495628_0075644 3300046516 Bacteria 2622
1471 Ga0495630_0021896 3300046517 Bacteria 4720
1472 Ga0495630_0140202 3300046517 Bacteria 1838
1473 Ga0495630_0166096 3300046517 Bacteria 1680
1474 Ga0495630_0341594 3300046517 Bacteria 1146
1475 Ga0495631_0000109 3300046518 Bacteria 54778
1476 Ga0495631_0052982 3300046518 Bacteria 1771
1477 Ga0495632_0000837 3300046519 Bacteria 27084
1478 Ga0495632_0041939 3300046519 Bacteria 2297
1479 Ga0495637_0000338 3300046520 Bacteria 36248
1480 Ga0495637_0000936 3300046520 Bacteria 18657
1481 Ga0495643_0000681 3300046522 Bacteria 39588
1482 Ga0495643_0001242 3300046522 Bacteria 24461
1483 Ga0495643_0014741 3300046522 Bacteria 4642
1484 Ga0495643_0017418 3300046522 Bacteria 4200
1485 Ga0495643_0021636 3300046522 Bacteria 3686
1486 Ga0495643_0043518 3300046522 Bacteria 2443
1487 Ga0495643_0069479 3300046522 Bacteria 1851
1488 Ga0495648_0000025 3300046524 Bacteria 233415
1489 Ga0495648_0005380 3300046524 Bacteria 10646
1490 Ga0495648_0008152 3300046524 Bacteria 8270
1491 Ga0495648_0026461 3300046524 Bacteria 3904
1492 Ga0495648_0050467 3300046524 Bacteria 2541
1493 Ga0495648_0060546 3300046524 Bacteria 2252
1494 Ga0495648_0089047 3300046524 Bacteria 1733
1495 Ga0495648_0094609 3300046524 Bacteria 1663
1496 Ga0495666_0004506 3300046526 Bacteria 7037
1497 Ga0495666_0006287 3300046526 Bacteria 5981
1498 Ga0495666_0027956 3300046526 Bacteria 2776
1499 Ga0495666_0028427 3300046526 Bacteria 2751
1500 Ga0495642_0003800 3300046528 Bacteria 5915
1501 Ga0495642_0008352 3300046528 Bacteria 3963
1502 Ga0495642_0012706 3300046528 Bacteria 3249
1503 Ga0495642_0020062 3300046528 Bacteria 2622
1504 Ga0495642_0021266 3300046528 Bacteria 2552
1505 Ga0495652_0007174 3300046529 Bacteria 10286
1506 Ga0495652_0007305 3300046529 Bacteria 10188
1507 Ga0495652_0052416 3300046529 Bacteria 3480
1508 Ga0495654_0000004 3300046530 Bacteria 515304
1509 Ga0495654_0099935 3300046530 Bacteria 1336
1510 Ga0495665_0008313 3300046531 Bacteria 5626
1511 Ga0495665_0016793 3300046531 Bacteria 3940
1512 Ga0495665_0024166 3300046531 Bacteria 3264
1513 Ga0495665_0079305 3300046531 Bacteria 1727
1514 Ga0495640_0002467 3300046533 Bacteria 14867
1515 Ga0495640_0122907 3300046533 Bacteria 1685
1516 Ga0495640_0136155 3300046533 Bacteria 1586
1517 Ga0495586_0037835 3300046535 Bacteria 2590
1518 Ga0495587_0003076 3300046536 Bacteria 11143
1519 Ga0495587_0019220 3300046536 Bacteria 4231
1520 Ga0495587_0067554 3300046536 Bacteria 2084
1521 Ga0495587_0071881 3300046536 Bacteria 2012
1522 Ga0495587_0120390 3300046536 Bacteria 1504
1523 Ga0495598_0012097 3300046537 Bacteria 2108
1524 Ga0495598_0025423 3300046537 Bacteria 1615
1525 Ga0495609_0012302 3300046538 Bacteria 4059
1526 Ga0495609_0018544 3300046538 Bacteria 3223
1527 Ga0495609_0022503 3300046538 Bacteria 2902
1528 Ga0495609_0113797 3300046538 Bacteria 1166
1529 Ga0495621_0049300 3300046539 Bacteria 1502
1530 Ga0495597_0000295 3300046542 Bacteria 44823
1531 Ga0495597_0000629 3300046542 Bacteria 28799
1532 Ga0495597_0004054 3300046542 Bacteria 8198
1533 Ga0495597_0014825 3300046542 Bacteria 3705
1534 Ga0495597_0024422 3300046542 Bacteria 2790
1535 Ga0495597_0039758 3300046542 Bacteria 2104
1536 Ga0495645_0000609 3300046543 Bacteria 24694
1537 Ga0495645_0001936 3300046543 Bacteria 14058
1538 Ga0495645_0005217 3300046543 Bacteria 8901
1539 Ga0495645_0052106 3300046543 Bacteria 2978
1540 Ga0495645_0057519 3300046543 Bacteria 2822
1541 Ga0495645_0130090 3300046543 Bacteria 1765
1542 Ga0495622_0000007 3300046557 Bacteria 239352
1543 Ga0495622_0000063 3300046557 Bacteria 95713
1544 Ga0495622_0000242 3300046557 Bacteria 42591
1545 Ga0495622_0004064 3300046557 Bacteria 6831
1546 Ga0495633_0000107 3300046558 Bacteria 111541
1547 Ga0495633_0000317 3300046558 Bacteria 54706
1548 Ga0495633_0001129 3300046558 Bacteria 21463
1549 Ga0495633_0007175 3300046558 Bacteria 6460
1550 Ga0495667_0006380 3300046559 Bacteria 7994
1551 Ga0495667_0099029 3300046559 Bacteria 1887
1552 Ga0495667_0160215 3300046559 Bacteria 1447
1553 Ga0495656_0056747 3300046615 Bacteria 1693
1554 Ga0495668_0000049 3300046616 Bacteria 217657
1555 Ga0495668_0000198 3300046616 Bacteria 88730
1556 Ga0495668_0016570 3300046616 Bacteria 4282
1557 Ga0495668_0019695 3300046616 Bacteria 3886
1558 Ga0495668_0042809 3300046616 Bacteria 2520
1559 Ga0495668_0095661 3300046616 Bacteria 1625
1560 Ga0495668_0109555 3300046616 Bacteria 1510
1561 Ga0495668_0150331 3300046616 Bacteria 1275
1562 Ga0495668_0227952 3300046616 Bacteria 1020
1563 Ga0495634_0101385 3300046642 Bacteria 1859
1564 Ga0495634_0137938 3300046642 Bacteria 1550
1565 Ga0495611_0031080 3300046648 Bacteria 2349
1566 Ga0495625_0000123 3300046660 Bacteria 120958
1567 Ga0495625_0010365 3300046660 Bacteria 7720
1568 Ga0495625_0026815 3300046660 Bacteria 4346
1569 Ga0495625_0030323 3300046660 Bacteria 4037
1570 Ga0495625_0043099 3300046660 Bacteria 3275
1571 Ga0495625_0053168 3300046660 Bacteria 2898
1572 Ga0495625_0067247 3300046660 Bacteria 2522
1573 Ga0495625_0072876 3300046660 Bacteria 2408
1574 Ga0495625_0088367 3300046660 Bacteria 2147
1575 Ga0495625_0097592 3300046660 Bacteria 2022
1576 Ga0495635_0024341 3300046663 Bacteria 4220
1577 Ga0495635_0033671 3300046663 Bacteria 3554
1578 Ga0495659_0000297 3300046664 Bacteria 19750
1579 Ga0495659_0001065 3300046664 Bacteria 9582
1580 Ga0495659_0052565 3300046664 Bacteria 1487
1581 Ga0495661_0001776 3300046665 Bacteria 17331
1582 Ga0495661_0002632 3300046665 Bacteria 13745
1583 Ga0495661_0010293 3300046665 Bacteria 6387
1584 Ga0495661_0011580 3300046665 Bacteria 5980
1585 Ga0495661_0019506 3300046665 Bacteria 4442
1586 Ga0495661_0021820 3300046665 Bacteria 4168
1587 Ga0495661_0024741 3300046665 Bacteria 3887
1588 Ga0495661_0060606 3300046665 Bacteria 2247
1589 Ga0495661_0228521 3300046665 Bacteria 960
1590 Ga0495588_0108749 3300046674 Bacteria 1460
1591 Ga0495657_0128578 3300046675 Bacteria 1589
1592 Ga0495657_0145606 3300046675 Bacteria 1474
1593 Ga0495657_0161352 3300046675 Bacteria 1387
1594 Ga0495657_0227210 3300046675 Bacteria 1130
1595 Ga0495599_0001013 3300046678 Bacteria 15801
1596 Ga0495599_0018906 3300046678 Bacteria 4295
1597 Ga0495623_0003184 3300046679 Bacteria 10833
1598 Ga0495623_0019436 3300046679 Bacteria 4391
1599 Ga0495646_0008696 3300046680 Bacteria 6451
1600 Ga0495646_0014620 3300046680 Bacteria 4989
1601 Ga0495646_0022937 3300046680 Bacteria 3932
1602 Ga0495646_0026086 3300046680 Bacteria 3671
1603 Ga0495647_0004872 3300046681 Bacteria 4388
1604 Ga0495647_0011506 3300046681 Bacteria 3033
1605 Ga0495658_0008454 3300046683 Bacteria 5100
1606 Ga0495658_0069680 3300046683 Bacteria 2039
1607 Ga0495658_0080092 3300046683 Bacteria 1915
1608 Ga0495669_0004604 3300046684 Bacteria 5712
1609 Ga0495613_0030346 3300046689 Bacteria 4015
1610 Ga0495613_0042571 3300046689 Bacteria 3360
1611 Ga0495624_0007783 3300046690 Bacteria 7518
1612 Ga0495624_0018248 3300046690 Bacteria 4694
1613 Ga0495624_0031417 3300046690 Bacteria 3452
1614 Ga0495670_0021155 3300046691 Bacteria 3208
1615 Ga0495671_0001337 3300046692 Bacteria 16719
1616 Ga0495671_0007676 3300046692 Bacteria 6126
1617 Ga0495671_0009971 3300046692 Bacteria 5287
1618 Ga0495671_0011133 3300046692 Bacteria 4964
1619 Ga0495671_0015867 3300046692 Bacteria 4032
1620 Ga0495671_0022132 3300046692 Bacteria 3333
1621 Ga0495671_0137313 3300046692 Bacteria 1192
1622 Ga0495649_0002825 3300046694 Bacteria 12054
1623 Ga0495649_0003503 3300046694 Bacteria 10565
1624 Ga0495649_0003798 3300046694 Bacteria 10007
1625 Ga0495649_0014909 3300046694 Bacteria 4441
1626 Ga0495649_0021389 3300046694 Bacteria 3624
1627 Ga0495649_0037765 3300046694 Bacteria 2651
1628 Ga0495589_0000569 3300046794 Bacteria 25465
1629 Ga0495589_0004740 3300046794 Bacteria 7219
1630 Ga0495589_0029450 3300046794 Bacteria 2767
1631 Ga0495589_0061740 3300046794 Bacteria 1839
1632 Ga0495589_0077449 3300046794 Bacteria 1620
1633 Ga0495589_0084570 3300046794 Bacteria 1542
1634 Ga0495589_0085513 3300046794 Bacteria 1532
1635 Ga0495600_0006351 3300046809 Bacteria 7191
1636 Ga0495600_0026810 3300046809 Bacteria 3721
1637 Ga0495600_0086041 3300046809 Bacteria 2051
1638 Ga0495660_0000542 3300046810 Bacteria 30925
1639 Ga0495660_0001078 3300046810 Bacteria 19547
1640 Ga0495660_0009807 3300046810 Bacteria 5577
1641 Ga0495660_0010817 3300046810 Bacteria 5299
1642 Ga0495660_0013133 3300046810 Bacteria 4800
1643 Ga0495660_0035824 3300046810 Bacteria 2770
1644 Ga0495660_0057450 3300046810 Bacteria 2099
1645 Ga0495660_0063163 3300046810 Bacteria 1983
1646 Ga0495660_0110881 3300046810 Bacteria 1400
1647 Ga0495581_0009404 3300047315 Bacteria 5654
1648 Ga0495581_0014371 3300047315 Bacteria 4592
1649 Ga0495604_0178726 3300047317 Bacteria 1486
1650 Ga0495604_0251153 3300047317 Bacteria 1205
1651 Ga0495636_0029621 3300047318 Bacteria 2235
1652 Ga0495636_0085188 3300047318 Bacteria 1366
1653 Ga0495674_0008154 3300047319 Bacteria 9993
1654 Ga0495674_0015022 3300047319 Bacteria 7245
1655 Ga0495674_0049015 3300047319 Bacteria 3735
1656 Ga0495674_0201770 3300047319 Bacteria 1649
1657 Ga0495672_0000159 3300047320 Bacteria 98262
1658 Ga0495672_0017796 3300047320 Bacteria 4742
1659 Ga0495672_0024888 3300047320 Bacteria 3846
1660 Ga0495676_0021709 3300047321 Bacteria 5600
1661 Ga0495683_0004007 3300047323 Bacteria 8462
1662 Ga0495683_0175317 3300047323 Bacteria 983
1663 Ga0495687_000049 3300047443 Bacteria 205432
1664 Ga0495687_000088 3300047443 Bacteria 142499
1665 Ga0495687_004364 3300047443 Bacteria 9619
1666 Ga0495687_011253 3300047443 Bacteria 4823
1667 Ga0495687_016555 3300047443 Bacteria 3706
1668 Ga0495687_023435 3300047443 Bacteria 2948
1669 Ga0495675_0001488 3300047444 Bacteria 14179
1670 Ga0495675_0026156 3300047444 Bacteria 3720
1671 Ga0495675_0047698 3300047444 Bacteria 2725
1672 Ga0495675_0092043 3300047444 Bacteria 1903
1673 Ga0495677_0025577 3300047445 Bacteria 2141
1674 Ga0495679_000044 3300047446 Bacteria 138399
1675 Ga0495679_005164 3300047446 Bacteria 5843
1676 Ga0495679_008760 3300047446 Bacteria 4091
1677 Ga0495679_009205 3300047446 Bacteria 3969
1678 Ga0495679_030588 3300047446 Bacteria 1746
1679 Ga0495685_013452 3300047447 Bacteria 2778
1680 Ga0495673_0002725 3300047469 Bacteria 12127
1681 Ga0495681_0006863 3300047470 Bacteria 7392
1682 Ga0495681_0011866 3300047470 Bacteria 5152
1683 Ga0495681_0014148 3300047470 Bacteria 4592
1684 Ga0495684_0099674 3300047471 Bacteria 2197
1685 Ga0495684_0340291 3300047471 Bacteria 1068
1686 Ga0495686_0000838 3300047472 Bacteria 39459
1687 Ga0495686_0002406 3300047472 Bacteria 17757
1688 Ga0495686_0012772 3300047472 Bacteria 5858
1689 Ga0495686_0035681 3300047472 Bacteria 3195
1690 Ga0495593_0002710 3300047673 Bacteria 10666
1691 Ga0495602_0085499 3300048088 Bacteria 2635
1692 Ga0495602_0128335 3300048088 Bacteria 2027
1693 Ga0495614_0037819 3300048089 Bacteria 2071
1694 Ga0495614_0079491 3300048089 Bacteria 1420
1695 Ga0495626_0011661 3300048091 Bacteria 4638
1696 Ga0495626_0015200 3300048091 Bacteria 3945
1697 Ga0495626_0057747 3300048091 Bacteria 1775
1698 Ga0495626_0110096 3300048091 Bacteria 1193
1699 Ga0496100_0084443 3300048903 Bacteria 2152
1700 Ga0496100_0115389 3300048903 Bacteria 1872
1701 Ga0496100_0265162 3300048903 Bacteria 1275
1702 Ga0496101_0005218 3300048904 Bacteria 8264
1703 Ga0496101_0018089 3300048904 Bacteria 4786
1704 Ga0496101_0034658 3300048904 Bacteria 3567
1705 Ga0496101_0046403 3300048904 Bacteria 3116
1706 Ga0496102_0007133 3300048905 Bacteria 9544
1707 Ga0496102_0018478 3300048905 Bacteria 6128
1708 Ga0496102_0018878 3300048905 Bacteria 6066
1709 Ga0496102_0020468 3300048905 Bacteria 5847
1710 Ga0496102_0023495 3300048905 Bacteria 5477
1711 Ga0496102_0094375 3300048905 Bacteria 2772
1712 Ga0496103_0003856 3300048906 Bacteria 9122
1713 Ga0496103_0025210 3300048906 Bacteria 3593
1714 Ga0496103_0030423 3300048906 Bacteria 3285
1715 Ga0496103_0065050 3300048906 Bacteria 2274
1716 Ga0496103_0180066 3300048906 Bacteria 1358
1717 Ga0496104_0082539 3300048907 Bacteria 3065
1718 Ga0496104_0169089 3300048907 Bacteria 2096
1719 Ga0496104_0211420 3300048907 Bacteria 1851
1720 Ga0496105_0097074 3300048908 Bacteria 2434
1721 Ga0496105_0224954 3300048908 Bacteria 1526
1722 Ga0496106_0003418 3300048909 Bacteria 11828
1723 Ga0496106_0042385 3300048909 Bacteria 3414
1724 Ga0496106_0160236 3300048909 Bacteria 1779
1725 Ga0496106_0182554 3300048909 Bacteria 1666
1726 Ga0496106_0302861 3300048909 Bacteria 1282
1727 Ga0496107_0008872 3300048910 Bacteria 6966
1728 Ga0496107_0014432 3300048910 Bacteria 5532
1729 Ga0496108_0000870 3300048911 Bacteria 23533
1730 Ga0496108_0108136 3300048911 Bacteria 2375
1731 Ga0496109_0005839 3300048912 Bacteria 10321
1732 Ga0496109_0023427 3300048912 Bacteria 5482
1733 Ga0496109_0111543 3300048912 Bacteria 2543
1734 Ga0496109_0120186 3300048912 Bacteria 2447
1735 Ga0496109_0169013 3300048912 Bacteria 2051
1736 Ga0496109_0501593 3300048912 Bacteria 1146
1737 Ga0496110_0001741 3300048913 Bacteria 16058
1738 Ga0496110_0002899 3300048913 Bacteria 12983
1739 Ga0496110_0059733 3300048913 Bacteria 3361
1740 Ga0496111_0037619 3300048914 Bacteria 3463
1741 Ga0496111_0221310 3300048914 Bacteria 1406
1742 Ga0496111_0227825 3300048914 Bacteria 1384
1743 Ga0496111_0388518 3300048914 Bacteria 1032
1744 Ga0496112_0344594 3300048915 Bacteria 1433
1745 Ga0496112_0544014 3300048915 Bacteria 1095
1746 Ga0496112_0582328 3300048915 Bacteria 1052
1747 Ga0496113_0087979 3300048916 Bacteria 2389
1748 Ga0496113_0130720 3300048916 Bacteria 1970
1749 Ga0496113_0333523 3300048916 Bacteria 1216
1750 Ga0496114_0001908 3300048917 Bacteria 15871
1751 Ga0496114_0009802 3300048917 Bacteria 7611
1752 Ga0496114_0010918 3300048917 Bacteria 7239
1753 Ga0496114_0023986 3300048917 Bacteria 4977
1754 Ga0496114_0051121 3300048917 Bacteria 3440
1755 Ga0496114_0132819 3300048917 Bacteria 2151
1756 Ga0496114_0265535 3300048917 Bacteria 1512
1757 Ga0496115_0090752 3300048918 Bacteria 2496
1758 Ga0496115_0291436 3300048918 Bacteria 1339
1759 Ga0496116_0008971 3300048919 Bacteria 8599
1760 Ga0496116_0054965 3300048919 Bacteria 2618
1761 Ga0496116_0056200 3300048919 Bacteria 2581
1762 Ga0496117_0000001 3300048920 Bacteria 2526244
1763 Ga0496117_0000054 3300048920 Bacteria 278013
1764 Ga0496117_0077938 3300048920 Bacteria 2190
1765 Ga0496117_0081202 3300048920 Bacteria 2129
1766 Ga0496118_0000008 3300048921 Bacteria 644537
1767 Ga0496118_0000045 3300048921 Bacteria 275165
1768 Ga0496118_0028632 3300048921 Bacteria 4687
1769 Ga0496118_0035124 3300048921 Bacteria 4076
1770 Ga0496119_0000297 3300048922 Bacteria 69722
1771 Ga0496119_0015657 3300048922 Bacteria 5819
1772 Ga0496119_0079571 3300048922 Bacteria 1893
1773 Ga0496120_0001653 3300048923 Bacteria 25763
1774 Ga0496120_0024854 3300048923 Bacteria 3728
1775 Ga0496120_0100607 3300048923 Bacteria 1528
1776 Ga0496121_0002897 3300048924 Bacteria 25213
1777 Ga0496121_0005334 3300048924 Bacteria 16527
1778 Ga0496121_0011090 3300048924 Bacteria 10056
1779 Ga0496121_0011103 3300048924 Bacteria 10053
1780 Ga0496121_0015841 3300048924 Bacteria 7841
1781 Ga0496121_0022299 3300048924 Bacteria 6155
1782 Ga0496121_0135596 3300048924 Bacteria 1834
1783 Ga0496121_0142416 3300048924 Bacteria 1776
1784 Ga0496122_0000169 3300048925 Bacteria 155380
1785 Ga0496122_0000249 3300048925 Bacteria 121066
1786 Ga0496122_0000847 3300048925 Bacteria 57788
1787 Ga0496122_0008495 3300048925 Bacteria 11059
1788 Ga0496122_0013008 3300048925 Bacteria 8202
1789 Ga0496122_0117199 3300048925 Bacteria 1729
1790 Ga0496123_0000909 3300048926 Bacteria 46568
1791 Ga0496123_0002226 3300048926 Bacteria 24595
1792 Ga0496123_0002554 3300048926 Bacteria 22188
1793 Ga0496123_0005545 3300048926 Bacteria 12652
1794 Ga0496123_0012647 3300048926 Bacteria 7168
1795 Ga0496123_0029996 3300048926 Bacteria 3990
1796 Ga0496123_0103458 3300048926 Bacteria 1649
1797 Ga0496124_0021421 3300048927 Bacteria 5956
1798 Ga0496124_0129644 3300048927 Bacteria 2005
1799 Ga0496124_0130056 3300048927 Bacteria 2001
1800 Ga0496124_0145317 3300048927 Bacteria 1867
1801 Ga0496124_0209894 3300048927 Bacteria 1474
1802 Ga0496125_0000676 3300048928 Bacteria 56883
1803 Ga0496125_0000812 3300048928 Bacteria 50762
1804 Ga0496125_0001279 3300048928 Bacteria 37354
1805 Ga0496125_0006029 3300048928 Bacteria 13256
1806 Ga0496125_0007611 3300048928 Bacteria 11497
1807 Ga0496125_0011048 3300048928 Bacteria 9061
1808 Ga0496125_0019903 3300048928 Bacteria 6311
1809 Ga0496125_0059606 3300048928 Bacteria 3074
1810 Ga0496125_0248322 3300048928 Bacteria 1125
1811 Ga0496126_0022848 3300048929 Bacteria 6072
1812 Ga0496126_0029989 3300048929 Bacteria 5161
1813 Ga0496126_0075257 3300048929 Bacteria 2997
1814 Ga0496126_0232411 3300048929 Bacteria 1544
1815 Ga0495678_000013 3300049459 Bacteria 316375
1816 Ga0495678_000079 3300049459 Bacteria 122038
1817 Ga0495678_000981 3300049459 Bacteria 24425
1818 Ga0495678_002357 3300049459 Bacteria 12968
1819 Ga0495678_005844 3300049459 Bacteria 6667
1820 Ga0495678_006309 3300049459 Bacteria 6325
1821 Ga0495678_046202 3300049459 Bacteria 1712
1822 Ga0495682_0001431 3300049460 Bacteria 12906
1823 Ga0495682_0012441 3300049460 Bacteria 3263
1824 Ga0495682_0018400 3300049460 Bacteria 2631
1825 Ga0501031_0001835 3300049568 Bacteria 13353
1826 Ga0501032_0000036 3300049569 Bacteria 117044
1827 Ga0501032_0003205 3300049569 Bacteria 12580
1828 Ga0501032_0271260 3300049569 Bacteria 1099
1829 Ga0501033_0002208 3300049570 Bacteria 16778
1830 Ga0501033_0003067 3300049570 Bacteria 13882
1831 Ga0501033_0006562 3300049570 Bacteria 9103
1832 Ga0501034_0002523 3300049571 Bacteria 21945
1833 Ga0501034_0026564 3300049571 Bacteria 5895
1834 Ga0501036_0011654 3300049572 Bacteria 7287
1835 Ga0501036_0040876 3300049572 Bacteria 3923
1836 Ga0501036_0080670 3300049572 Bacteria 2750
1837 Ga0501037_0000793 3300049573 Bacteria 23702
1838 Ga0501037_0005568 3300049573 Bacteria 9183
1839 Ga0501037_0083785 3300049573 Bacteria 2310
1840 Ga0501038_0004695 3300049574 Bacteria 12711
1841 Ga0501038_0005737 3300049574 Bacteria 11505
1842 Ga0501038_0034864 3300049574 Bacteria 4422
1843 Ga0501038_0036736 3300049574 Bacteria 4299
1844 Ga0501039_0000386 3300049575 Bacteria 31668
1845 Ga0501039_0005849 3300049575 Bacteria 9314
1846 Ga0501039_0012218 3300049575 Bacteria 6546
1847 Ga0501039_0013925 3300049575 Bacteria 6153
1848 Ga0501039_0027225 3300049575 Bacteria 4396
1849 Ga0501039_0084037 3300049575 Bacteria 2479
1850 Ga0501039_0144347 3300049575 Bacteria 1870
1851 Ga0501039_0146002 3300049575 Bacteria 1859
1852 Ga0501039_0161925 3300049575 Bacteria 1759
1853 Ga0501039_0288630 3300049575 Bacteria 1290
1854 Ga0501039_0349290 3300049575 Bacteria 1162
1855 Ga0501040_0000455 3300049576 Bacteria 24277
1856 Ga0501040_0004740 3300049576 Bacteria 8825
1857 Ga0501040_0008686 3300049576 Bacteria 6598
1858 Ga0501040_0015767 3300049576 Bacteria 4996
1859 Ga0501040_0017931 3300049576 Bacteria 4699
1860 Ga0501040_0025609 3300049576 Bacteria 3967
1861 Ga0501040_0100455 3300049576 Bacteria 2017
1862 Ga0501040_0119241 3300049576 Bacteria 1850
1863 Ga0501040_0310684 3300049576 Bacteria 1127
1864 Ga0501041_0003215 3300049577 Bacteria 9390
1865 Ga0501041_0004330 3300049577 Bacteria 8207
1866 Ga0501041_0017877 3300049577 Bacteria 4219
1867 Ga0501041_0022651 3300049577 Bacteria 3762
1868 Ga0501041_0026794 3300049577 Bacteria 3470
1869 Ga0501041_0037274 3300049577 Bacteria 2946
1870 Ga0501042_0000031 3300049578 Bacteria 46017
1871 Ga0501042_0007956 3300049578 Bacteria 6975
1872 Ga0501042_0021847 3300049578 Bacteria 4465
1873 Ga0501042_0051127 3300049578 Bacteria 2948
1874 Ga0501042_0120917 3300049578 Bacteria 1885
1875 Ga0501042_0128961 3300049578 Bacteria 1822
1876 Ga0501042_0221755 3300049578 Bacteria 1364
1877 Ga0501043_0000157 3300049579 Bacteria 62190
1878 Ga0501043_0139362 3300049579 Bacteria 1900
1879 Ga0501046_0001694 3300049580 Bacteria 21062
1880 Ga0501046_0007774 3300049580 Bacteria 9406
1881 Ga0501046_0021853 3300049580 Bacteria 5274
1882 Ga0501046_0023907 3300049580 Bacteria 5019
1883 Ga0501046_0054285 3300049580 Bacteria 3153
1884 Ga0501046_0065898 3300049580 Bacteria 2824
1885 Ga0501046_0149227 3300049580 Bacteria 1764
1886 Ga0501047_0014303 3300049581 Bacteria 7547
1887 Ga0501047_0077517 3300049581 Bacteria 3197
1888 Ga0501048_0008923 3300049582 Bacteria 7549
1889 Ga0501048_0023751 3300049582 Bacteria 4477
1890 Ga0501048_0029291 3300049582 Bacteria 3993
1891 Ga0501048_0097920 3300049582 Bacteria 2069
1892 Ga0501067_0006809 3300049583 Bacteria 6339
1893 Ga0501067_0021608 3300049583 Bacteria 3561
1894 Ga0501067_0123725 3300049583 Bacteria 1440
1895 Ga0501068_0002793 3300049584 Bacteria 9287
1896 Ga0501068_0013939 3300049584 Bacteria 4585
1897 Ga0501069_0036168 3300049585 Bacteria 2722
1898 Ga0501069_0038859 3300049585 Bacteria 2628
1899 Ga0501069_0141123 3300049585 Bacteria 1382
1900 Ga0501070_0001696 3300049586 Bacteria 19515
1901 Ga0501070_0007573 3300049586 Bacteria 9227
1902 Ga0501070_0008433 3300049586 Bacteria 8705
1903 Ga0501070_0133806 3300049586 Bacteria 2047
1904 Ga0501071_0000686 3300049587 Bacteria 17688
1905 Ga0501071_0001833 3300049587 Bacteria 12604
1906 Ga0501071_0004638 3300049587 Bacteria 8724
1907 Ga0501071_0009669 3300049587 Bacteria 6436
1908 Ga0501071_0035993 3300049587 Bacteria 3529
1909 Ga0501071_0046193 3300049587 Bacteria 3128
1910 Ga0501071_0077313 3300049587 Bacteria 2431
1911 Ga0501071_0093323 3300049587 Bacteria 2213
1912 Ga0501072_0004342 3300049588 Bacteria 10759
1913 Ga0501072_0026438 3300049588 Bacteria 4525
1914 Ga0501072_0047153 3300049588 Bacteria 3393
1915 Ga0501072_0049931 3300049588 Bacteria 3293
1916 Ga0501072_0090907 3300049588 Bacteria 2423
1917 Ga0501072_0192137 3300049588 Bacteria 1628
1918 Ga0501072_0309186 3300049588 Bacteria 1256
1919 Ga0501073_0000472 3300049589 Bacteria 27853
1920 Ga0501073_0005363 3300049589 Bacteria 9608
1921 Ga0501073_0055129 3300049589 Bacteria 2782
1922 Ga0501073_0166225 3300049589 Bacteria 1528
1923 Ga0501073_0221475 3300049589 Bacteria 1307
1924 Ga0501074_0002836 3300049590 Bacteria 12136
1925 Ga0501074_0005527 3300049590 Bacteria 9093
1926 Ga0501074_0036301 3300049590 Bacteria 3571
1927 Ga0501074_0100798 3300049590 Bacteria 2067
1928 Ga0501074_0103298 3300049590 Bacteria 2040
1929 Ga0501074_0189899 3300049590 Bacteria 1465
1930 Ga0501074_0217459 3300049590 Bacteria 1361
1931 Ga0501075_0000792 3300049591 Bacteria 19767
1932 Ga0501075_0001305 3300049591 Bacteria 16161
1933 Ga0501075_0002475 3300049591 Bacteria 12319
1934 Ga0501075_0006009 3300049591 Bacteria 8319
1935 Ga0501075_0014752 3300049591 Bacteria 5600
1936 Ga0501075_0033278 3300049591 Bacteria 3835
1937 Ga0501075_0045801 3300049591 Bacteria 3284
1938 Ga0501075_0083095 3300049591 Bacteria 2426
1939 Ga0501075_0223811 3300049591 Bacteria 1435
1940 Ga0501076_0001408 3300049592 Bacteria 16105
1941 Ga0501076_0007783 3300049592 Bacteria 7809
1942 Ga0501076_0009825 3300049592 Bacteria 7072
1943 Ga0501076_0093956 3300049592 Bacteria 2414
1944 Ga0501076_0183345 3300049592 Bacteria 1707
1945 Ga0501076_0315547 3300049592 Bacteria 1282
1946 Ga0501077_0000280 3300049593 Bacteria 30354
1947 Ga0501077_0005399 3300049593 Bacteria 7771
1948 Ga0501077_0019320 3300049593 Bacteria 4310
1949 Ga0501077_0093833 3300049593 Bacteria 1902
1950 Ga0501217_049665 3300049661 Bacteria 1093
1951 Ga0501249_003204 3300049679 Bacteria 3295
1952 Ga0501079_0000811 3300049741 Bacteria 21278
1953 Ga0501079_0001080 3300049741 Bacteria 18962
1954 Ga0501079_0003255 3300049741 Bacteria 11903
1955 Ga0501079_0007587 3300049741 Bacteria 8218
1956 Ga0501079_0021711 3300049741 Bacteria 4913
1957 Ga0501079_0182909 3300049741 Bacteria 1636
1958 Ga0501080_0001568 3300049742 Bacteria 19339
1959 Ga0501080_0003790 3300049742 Bacteria 13348
1960 Ga0501080_0013669 3300049742 Bacteria 7474
1961 Ga0501080_0016016 3300049742 Bacteria 6919
1962 Ga0501080_0016298 3300049742 Bacteria 6861
1963 Ga0501080_0165362 3300049742 Bacteria 2042
1964 Ga0501080_0232048 3300049742 Bacteria 1686
1965 Ga0501080_0365415 3300049742 Bacteria 1301
1966 Ga0501081_0003604 3300049743 Bacteria 9904
1967 Ga0501081_0005175 3300049743 Bacteria 8395
1968 Ga0501081_0005236 3300049743 Bacteria 8356
1969 Ga0501081_0013740 3300049743 Bacteria 5325
1970 Ga0501083_0024949 3300049744 Bacteria 4141
1971 Ga0501083_0047057 3300049744 Bacteria 2916
1972 Ga0501083_0063656 3300049744 Bacteria 2460
1973 Ga0501269_000103 3300049766 Bacteria 26706
1974 Ga0501035_0000889 3300049822 Bacteria 31637
1975 Ga0501035_0004008 3300049822 Bacteria 14050
1976 Ga0501044_0002064 3300049823 Bacteria 23156
1977 Ga0501044_0039558 3300049823 Bacteria 4919
1978 Ga0501044_0066246 3300049823 Bacteria 3683
1979 Ga0501045_0000607 3300049824 Bacteria 22605
1980 Ga0501045_0013028 3300049824 Bacteria 5862
1981 Ga0501045_0013215 3300049824 Bacteria 5824
1982 Ga0501045_0015134 3300049824 Bacteria 5475
1983 Ga0501045_0017936 3300049824 Bacteria 5026
1984 Ga0501045_0022316 3300049824 Bacteria 4531
1985 Ga0501045_0043656 3300049824 Bacteria 3265
1986 Ga0501045_0056885 3300049824 Bacteria 2861
1987 nmdc:mga03683_13573_c2 3300050489 Bacteria 2272
1988 nmdc:mga00v17_1091_c1 3300050491 Bacteria 14290
1989 nmdc:mga0k408_221_c1 3300050493 Bacteria 30239
1990 nmdc:mga0k408_255643_c1 3300050493 Bacteria 1046
1991 nmdc:mga0k408_36994_c1 3300050493 Bacteria 2801
1992 nmdc:mga05p37_22213_c1 3300050507 Bacteria 7692
1993 nmdc:mga05p37_286680_c1 3300050507 Bacteria 1961
1994 nmdc:mga05p37_37857_c1 3300050507 Bacteria 5916
1995 nmdc:mga05p37_467917_c1 3300050507 Bacteria 1455
1996 nmdc:mga05p37_9357_c1 3300050507 Bacteria 11596
1997 nmdc:mga09592_21320_c1 3300050508 Bacteria 5341
1998 nmdc:mga09592_303696_c1 3300050508 Bacteria 1384
1999 nmdc:mga09592_315_c1 3300050508 Bacteria 35276
2000 nmdc:mga09592_58811_c1 3300050508 Bacteria 3250
2001 nmdc:mga09592_61744_c1 3300050508 Bacteria 3170
2002 nmdc:mga09592_78890_c1 3300050508 Bacteria 2803
2003 nmdc:mga0qj67_108197_c1 3300050509 Bacteria 2243
2004 nmdc:mga0qj67_17411_c1 3300050509 Bacteria 5463
2005 nmdc:mga0qj67_274657_c1 3300050509 Bacteria 1366
2006 nmdc:mga0qj67_2981_c1 3300050509 Bacteria 12149
2007 nmdc:mga0qj67_321855_c1 3300050509 Bacteria 1252
2008 nmdc:mga0qj67_39720_c1 3300050509 Bacteria 3697
2009 nmdc:mga0qj67_66701_c1 3300050509 Bacteria 2867
2010 nmdc:mga06r32_10212_c1 3300050510 Bacteria 8474
2011 nmdc:mga06r32_19839_c1 3300050510 Bacteria 6178
2012 nmdc:mga06r32_22391_c1 3300050510 Bacteria 5842
2013 nmdc:mga06r32_499338_c1 3300050510 Bacteria 1194
2014 nmdc:mga06r32_506616_c1 3300050510 Bacteria 1184
2015 nmdc:mga06r32_52552_c1 3300050510 Bacteria 3902
2016 nmdc:mga06r32_747_c1 3300050510 Bacteria 28538
2017 nmdc:mga06r32_7750_c2 3300050510 Bacteria 7874
2018 nmdc:mga08y16_121355_c1 3300050511 Bacteria 2720
2019 nmdc:mga08y16_1255_c1 3300050511 Bacteria 25165
2020 nmdc:mga08y16_14446_c1 3300050511 Bacteria 8305
2021 nmdc:mga08y16_180689_c1 3300050511 Bacteria 2191
2022 nmdc:mga08y16_204795_c1 3300050511 Bacteria 2044
2023 nmdc:mga08y16_259436_c1 3300050511 Bacteria 1795
2024 nmdc:mga08y16_385253_c1 3300050511 Bacteria 1437
2025 nmdc:mga08y16_523719_c1 3300050511 Bacteria 1202
2026 nmdc:mga08y16_646398_c1 3300050511 Bacteria 1062
2027 nmdc:mga08y16_66776_c1 3300050511 Bacteria 3754
2028 nmdc:mga08y16_7261_c1 3300050511 Bacteria 11631
2029 nmdc:mga08y16_76782_c1 3300050511 Bacteria 3482
2030 nmdc:mga0n895_426686_c1 3300050512 Bacteria 1340
2031 nmdc:mga0n895_5209_c1 3300050512 Bacteria 10825
2032 nmdc:mga0n895_60056_c1 3300050512 Bacteria 3751
2033 nmdc:mga0rr50_11716_c1 3300050513 Bacteria 5628
2034 nmdc:mga0rr50_80686_c1 3300050513 Bacteria 2509
2035 nmdc:mga08x19_147225_c1 3300050514 Bacteria 1593
2036 nmdc:mga08x19_25457_c1 3300050514 Bacteria 3685
2037 nmdc:mga0a205_312544_c1 3300050515 Bacteria 1443
2038 nmdc:mga0a205_331783_c1 3300050515 Bacteria 1391
2039 nmdc:mga0a205_3868_c1 3300050515 Bacteria 13412
2040 nmdc:mga0a205_438473_c1 3300050515 Bacteria 1167
2041 nmdc:mga0a205_8456_c1 3300050515 Bacteria 9365
2042 Ga0495601_0010336 3300053077 Bacteria 5552
2043 Ga0495601_0013881 3300053077 Bacteria 4850
2044 Ga0495601_0063437 3300053077 Bacteria 2348
2045 Ga0500610_0000737 3300053079 Bacteria 10233
2046 Ga0495595_0023181 3300053084 Bacteria 2730
2047 Ga0495619_0048350 3300053085 Bacteria 2803
2048 Ga0495619_0058679 3300053085 Bacteria 2555
2049 Ga0495619_0112164 3300053085 Bacteria 1864
2050 Ga0500641_0019869 3300053096 Bacteria 2544
2051 Ga0500556_0000442 3300053104 Bacteria 29531
2052 Ga0500594_0031812 3300053118 Bacteria 1394
2053 Ga0500595_004294 3300053119 Bacteria 6423
2054 Ga0500607_037246 3300053121 Bacteria 2652
2055 Ga0500617_076143 3300053124 Bacteria 1461
2056 Ga0500618_000965 3300053125 Bacteria 14663
2057 Ga0500618_001599 3300053125 Bacteria 9847
2058 Ga0500652_044821 3300053131 Bacteria 1791
2059 Ga0500658_0007263 3300053134 Bacteria 4092
2060 Ga0500586_000082 3300053145 Bacteria 16424
2061 Ga0500588_0004325 3300053146 Bacteria 3071
2062 Ga0500588_0011465 3300053146 Bacteria 2170
2063 Ga0500589_094792 3300053147 Bacteria 1307
2064 Ga0500622_0009746 3300053156 Bacteria 5306
2065 Ga0500634_0026773 3300053161 Bacteria 3142
2066 Ga0500636_0000369 3300053177 Bacteria 24646
2067 Ga0500637_0001512 3300053178 Bacteria 9916
2068 Ga0500637_0025044 3300053178 Bacteria 3274
2069 Ga0500656_007160 3300053732 Bacteria 1152
2070 Ga0501084_0001292 3300054114 Bacteria 19723
2071 Ga0501084_0005101 3300054114 Bacteria 10747
2072 Ga0501084_0012672 3300054114 Bacteria 6986
2073 Ga0501084_0045939 3300054114 Bacteria 3656
2074 Ga0501084_0079860 3300054114 Bacteria 2742
2075 Ga0501084_0121784 3300054114 Bacteria 2193
2076 Ga0501082_0009014 3300060353 Bacteria 8608
2077 Ga0501082_0011508 3300060353 Bacteria 7616
2078 Ga0501082_0058549 3300060353 Bacteria 3319
2079 Ga0501082_0065570 3300060353 Bacteria 3127
2080 Ga0501082_0179140 3300060353 Bacteria 1843
2081 Ga0466962_0001556 3300061719 Bacteria 10706
2082 Ga0466962_0004761 3300061719 Bacteria 6523
2083 Ga0466962_0051937 3300061719 Bacteria 1960
2084 Ga0530510_0001249 3300061734 Bacteria 16977
2085 Ga0530510_0003476 3300061734 Bacteria 10827
2086 Ga0530510_0006355 3300061734 Bacteria 8221
2087 Ga0530510_0007480 3300061734 Bacteria 7606
2088 Ga0530510_0151846 3300061734 Bacteria 1711
2089 Ga0530510_0243398 3300061734 Bacteria 1339
2090 2501071044 2501025501 Bacteria 7768574
2091 2501078765 2501025502 Bacteria 9641094
2092 2501413916 2501025504 Bacteria 8008976
2093 2509130198 2508501125 Bacteria 7208311
2094 2510252157 2510065045 Bacteria 7761063
2095 2511089410 2510917013 Bacteria 9951648
2096 2511094820 2510917014 Bacteria 8296963
2097 2511104519 2510917015 Bacteria 7950052
2098 2511248143 2511231003 Bacteria 5606035
2099 2511387018 2511231026 Bacteria 5225445
2100 2513551629 2513237082 Bacteria 8640282
2101 2513563805 2513237083 Bacteria 8410967
2102 2513954086 2513237150 Bacteria 6553639
2103 2513963084 2513237151 Bacteria 6309801
2104 2514040213 2513237165 Bacteria 6771773
2105 2514047533 2513237166 Bacteria 10373764
2106 2515682696 2515154122 Bacteria 8609520
2107 2515691270 2515154123 Bacteria 6387382
2108 2516017028 2515154189 Bacteria 9629850
2109 2519459604 2519103095 Bacteria 6629912
2110 2521556771 2521172590 Bacteria 5047645
2111 2550697282 2548876994 Bacteria 4904866
2112 2553004537 2551306416 Bacteria 6152985
2113 2585291189 2582581311 Bacteria 6763856
2114 2600814591 2600255067 Bacteria 6795583
2115 2601670644 2600255292 Bacteria 6300551
2116 2644027893 2643221603 Bacteria 6147767
2117 2644059880 2643221609 Bacteria 6756331
2118 2644074499 2643221611 Bacteria 6820941
2119 2644250888 2643221645 Bacteria 7207331
2120 2644356307 2643221664 Bacteria 7272945
2121 2644644580 2643221717 Bacteria 5676132
2122 2691331001 2690315857 Bacteria 4396207
2123 2738739051 2738541280 Bacteria 6630198
2124 2738846283 2738541300 Bacteria 6675882
2125 2739275068 2738543018 Bacteria 6718814
2126 2739344112 2738543030 Bacteria 6719714
2127 2765567963 2765235838 Bacteria 5445269
2128 2792840267 2791355137 Bacteria 9654227
2129 2808943045 2808606379 Bacteria 5022697
2130 2808983813 2808606386 Bacteria 4471946
2131 2809129485 2808606415 Bacteria 4576710
2132 2809149460 2808606419 Bacteria 4576925
2133 2817261882 2816332253 Bacteria 6764532
2134 2817279586 2816332256 Bacteria 6891714
2135 2817454338 2816332286 Bacteria 6853759
2136 2819542989 2818991436 Bacteria 5376622
2137 2819592493 2818991445 Bacteria 4955017
2138 2819618620 2818991449 Bacteria 5518009
2139 2821134042 2821131069 Bacteria 6108407
2140 2839097747 2839094727 Bacteria 5534556
2141 2846037039 2846033681 Bacteria 4377894
2142 2846040170 2846037992 Bacteria 4526407
2143 2846542968 2846540461 Bacteria 5471451
2144 2852619607 2852618963 Bacteria 4577824
2145 2856292254 2856287931 Bacteria 7223934
2146 2857365768 2857357740 Bacteria 9937880
2147 2857548011 2857547612 Bacteria 6179999
2148 2857556502 2857553236 Bacteria 6166726
2149 2858696555 2858688981 Bacteria 8184122
2150 2883094783 2883087390 Bacteria 9532701
2151 2884814660 2884811622 Bacteria 5552861
2152 2884839019 2884836552 Bacteria 5219991
2153 2884855310 2884852848 Bacteria 5221161
2154 2885080732 2885080285 Bacteria 6355622
2155 2885273964 2885270888 Bacteria 9831543
2156 2887632750 2887630918 Bacteria 3239855
2157 2894024515 2894023352 Bacteria 5167372
2158 2894510783 2894510363 Bacteria 5121143
2159 2896159183 2896154374 Bacteria 5221518
2160 2902687255 2902682994 Bacteria 8951596
2161 2904429152 2904424332 Bacteria 7633521
2162 2904440652 2904439833 Bacteria 5931679
2163 2904535756 2904530477 Bacteria 5876334
2164 2904586083 2904584206 Bacteria 6028872
2165 2904592104 2904589729 Bacteria 6113573
2166 2904601739 2904601388 Bacteria 5884906
2167 2919049575 2919046199 Bacteria 5567169
2168 2919084806 2919079590 Bacteria 5946433
2169 2919480736 2919476304 Bacteria 5888696
2170 2919493882 2919493220 Bacteria 4598500
2171 2919499364 2919497567 Bacteria 4408621
2172 2919534562 2919534386 Bacteria 4577686
2173 2919545763 2919543075 Bacteria 4728703
2174 2923515363 2923510766 Bacteria 5926163
2175 2923527471 2923525760 Bacteria 4472324
2176 2928132422 2928130867 Bacteria 5467269
2177 2932412602 2932410948 Bacteria 6312192
2178 2932420117 2932416698 Bacteria 6315112
2179 2998348351 2998344455 Bacteria 4222996
2180 639788380 639633007 Bacteria 4376040
2181 644746875 644736347 Bacteria 6476522
2182 8003960505 8003955200 Bacteria 8601927
2183 8020808261 8020807995 Bacteria 6801506
2184 8040169009 8040167225 Bacteria 6542727
2185 8040179290 8040173305 Bacteria 6827067
2186 Ga0068861_100001382
2187 SwRhRL2b_contig_637244
2188 JGI25155J39150_1000136
2189 JGI25155J39150_1000346
2190 JGI25156J39149_1000156
2191 JGI25156J39149_1010186
2192 JGI25162J39368_1000025
2193 JGI25162J39368_1006852
2194 JGI25154J39366_1000430
2195 JGI25154J39366_1000531
2196 JGI25157J39369_1000277
2197 JGI25157J39369_1008646
2198 JGI25152J39213_1000113
2199 JGI25151J46595_10045536
2200 JGI25165J46597_1000054
2201 rootH1_10044520
2202 rootL2_10003689
2203 rootH1_10039841
2204 Ga0055538_1000008
2205 Ga0055538_1000026
2206 Ga0055539_1000012
2207 Ga0055539_1000033
2208 Ga0055533_1000015
2209 Ga0055533_1000044
2210 Ga0055532_1000005
2211 Ga0055525_1000017
2212 Ga0055525_1000052
2213 Ga0055535_1004655
2214 Ga0055526_1000129
2215 Ga0055526_1008158
2216 Ga0055537_1000156
2217 Ga0055537_1000223
2218 Ga0055524_1000029
2219 Ga0055524_1000824
2220 Ga0055534_1000230
2221 Ga0055534_1000632
2222 Ga0055528_1000341
2223 Ga0055541_1000009
2224 Ga0055541_1000049
2225 Ga0055543_1002523
2226 Ga0065165_1000050
2227 Ga0065165_1001239
2228 Ga0065714_10071968
2229 Ga0065704_10100794
2230 Ga0065712_10085621
2231 Ga0065707_10000575
2232 Ga0065707_10002291
2233 Ga0065707_10190954
2234 Ga0070676_10008532
2235 Ga0070676_10025203
2236 Ga0070676_10051702
2237 Ga0070676_10110602
2238 Ga0070683_100515260
2239 Ga0070683_100604523
2240 Ga0070690_100007662
2241 Ga0070690_100013534
2242 Ga0070690_100018489
2243 Ga0070690_100020957
2244 Ga0070690_100072859
2245 Ga0070670_100000633
2246 Ga0070670_100001609
2247 Ga0070670_100016449
2248 Ga0070670_100017843
2249 Ga0070670_100020260
2250 Ga0070670_100063985
2251 Ga0070670_100120482
2252 Ga0070670_100236968
2253 Ga0070677_10016184
2254 Ga0070677_10016731
2255 Ga0070677_10053548
2256 Ga0068869_100001563
2257 Ga0068869_100153854
2258 Ga0068869_100430261
2259 Ga0070666_10007516
2260 Ga0070666_10010612
2261 Ga0070666_10042685
2262 Ga0070666_10084826
2263 Ga0070666_10101206
2264 Ga0070666_10207289
2265 Ga0070680_100055192
2266 Ga0070680_100078763
2267 Ga0070680_100168296
2268 Ga0070680_100240115
2269 Ga0070682_100092547
2270 Ga0068868_100000807
2271 Ga0068868_100001147
2272 Ga0068868_100068614
2273 Ga0068868_100333480
2274 Ga0070660_100005509
2275 Ga0070660_100027230
2276 Ga0070689_100005128
2277 Ga0070689_100417583
2278 Ga0070687_100136906
2279 Ga0070661_100002263
2280 Ga0070661_100050285
2281 Ga0070661_100062228
2282 Ga0070661_100077123
2283 Ga0070661_100383580
2284 Ga0070692_10013609
2285 Ga0070692_10019466
2286 Ga0070692_10030016
2287 Ga0070668_100003121
2288 Ga0070668_100018583
2289 Ga0070668_100063651
2290 Ga0070668_100085647
2291 Ga0070668_100135195
2292 Ga0070668_100143969
2293 Ga0070668_100328630
2294 Ga0070669_100006519
2295 Ga0070669_100023970
2296 Ga0070669_100038713
2297 Ga0070669_100164069
2298 Ga0070669_100222985
2299 Ga0070675_100000783
2300 Ga0070675_100002509
2301 Ga0070675_100008395
2302 Ga0070675_100017563
2303 Ga0070675_100018880
2304 Ga0070675_100089061
2305 Ga0070675_100117136
2306 Ga0070675_100132751
2307 Ga0070675_100163678
2308 Ga0070675_100179809
2309 Ga0070671_100000128
2310 Ga0070671_100001372
2311 Ga0070671_100005466
2312 Ga0070671_100030200
2313 Ga0070671_100068872
2314 Ga0070671_100161273
2315 Ga0070674_100037101
2316 Ga0070674_100057351
2317 Ga0070674_100078994
2318 Ga0070674_100202216
2319 Ga0070674_100316970
2320 Ga0070673_100005763
2321 Ga0070673_100014207
2322 Ga0070673_100028391
2323 Ga0070673_100222274
2324 Ga0070673_100519437
2325 Ga0070688_100083773
2326 Ga0070688_100114136
2327 Ga0070659_100005049
2328 Ga0070659_100014648
2329 Ga0070659_100027629
2330 Ga0070667_100000052
2331 Ga0070667_100048364
2332 Ga0070667_100061546
2333 Ga0070667_100071115
2334 Ga0070667_100125180
2335 Ga0070667_100205062
2336 Ga0070709_10014713
2337 Ga0070714_100011747
2338 Ga0070713_100000045
2339 Ga0070713_100020371
2340 Ga0070710_10001552
2341 Ga0070710_10100547
2342 Ga0070701_10028035
2343 Ga0070701_10051835
2344 Ga0070701_10099871
2345 Ga0070711_100000979
2346 Ga0070711_100255271
2347 Ga0070705_100025129
2348 Ga0070705_100029556
2349 Ga0070705_100046639
2350 Ga0070705_100123843
2351 Ga0070705_100160790
2352 Ga0070705_100198605
2353 Ga0070700_100000396
2354 Ga0070700_100008805
2355 Ga0070700_100075575
2356 Ga0070700_100118476
2357 Ga0070700_100170436
2358 Ga0070694_100006107
2359 Ga0070694_100011182
2360 Ga0070694_100138562
2361 Ga0070694_100288708
2362 Ga0070708_100159991
2363 Ga0070708_100214483
2364 Ga0070708_100541720
2365 Ga0070663_100098582
2366 Ga0070663_100126147
2367 Ga0070663_100134393
2368 Ga0070678_100000463
2369 Ga0070678_100074427
2370 Ga0070678_100239553
2371 Ga0070678_100271757
2372 Ga0070678_100520236
2373 Ga0070662_100035077
2374 Ga0070662_100049496
2375 Ga0070662_100069978
2376 Ga0070662_100106050
2377 Ga0070681_10000611
2378 Ga0070681_10004528
2379 Ga0070681_10070181
2380 Ga0070681_10155279
2381 Ga0070681_10160361
2382 Ga0070681_10334616
2383 Ga0068867_100013837
2384 Ga0068867_100022066
2385 Ga0068867_100027056
2386 Ga0068867_100091467
2387 Ga0068867_100166609
2388 Ga0068867_100218794
2389 Ga0068867_100251397
2390 Ga0068867_100276704
2391 Ga0070685_10135671
2392 Ga0070706_100053743
2393 Ga0070706_100148134
2394 Ga0070706_100333276
2395 Ga0070706_100395146
2396 Ga0070707_100043483
2397 Ga0070707_100458324
2398 Ga0070698_100043148
2399 Ga0070698_100209886
2400 Ga0070698_100254665
2401 Ga0070699_100162578
2402 Ga0070679_100000602
2403 Ga0070679_100011268
2404 Ga0070679_100057543
2405 Ga0070679_100084974
2406 Ga0070679_100093957
2407 Ga0070679_100205385
2408 Ga0070684_100015628
2409 Ga0070684_100023889
2410 Ga0070684_100225660
2411 Ga0070697_100012581
2412 Ga0070697_100362198
2413 Ga0068853_100089805
2414 Ga0068853_100114170
2415 Ga0068853_100142464
2416 Ga0070672_100001093
2417 Ga0070672_100007042
2418 Ga0070672_100011072
2419 Ga0070672_100073618
2420 Ga0070672_100088301
2421 Ga0070672_100090873
2422 Ga0070672_100100022
2423 Ga0070672_100121530
2424 Ga0070672_100303564
2425 Ga0070686_100026176
2426 Ga0070686_100091550
2427 Ga0070686_100315452
2428 Ga0070695_100061566
2429 Ga0070695_100062960
2430 Ga0070695_100142281
2431 Ga0070696_100040363
2432 Ga0070696_100136994
2433 Ga0070693_100169307
2434 Ga0070665_100004349
2435 Ga0070665_100007432
2436 Ga0070665_100051901
2437 Ga0070665_100080808
2438 Ga0070665_100110207
2439 Ga0070665_100220341
2440 Ga0070665_100292897
2441 Ga0070704_100000018
2442 Ga0070704_100010603
2443 Ga0070704_100024777
2444 Ga0070704_100298246
2445 Ga0070704_100335764
2446 Ga0070704_100363017
2447 Ga0068855_100001182
2448 Ga0068855_100001706
2449 Ga0068855_100002465
2450 Ga0068855_100009248
2451 Ga0068855_100014961
2452 Ga0068855_100352464
2453 Ga0070664_100000712
2454 Ga0070664_100002382
2455 Ga0070664_100005456
2456 Ga0070664_100057493
2457 Ga0070664_100095791
2458 Ga0070664_100123823
2459 Ga0070664_100218292
2460 Ga0068857_100011829
2461 Ga0068857_100163791
2462 Ga0068857_100170142
2463 Ga0068854_100001881
2464 Ga0068854_100023240
2465 Ga0068854_100076706
2466 Ga0068854_100236407
2467 Ga0068854_100237094
2468 Ga0068856_100004553
2469 Ga0068856_100025692
2470 Ga0068856_100036576
2471 Ga0068856_100040053
2472 Ga0068856_100067169
2473 Ga0068856_100094059
2474 Ga0068856_100139945
2475 Ga0068856_100307555
2476 Ga0068856_100377852
2477 Ga0070702_100000536
2478 Ga0070702_100012238
2479 Ga0070702_100026041
2480 Ga0070702_100132516
2481 Ga0068852_100001103
2482 Ga0068852_100017508
2483 Ga0068859_100003776
2484 Ga0068859_100009497
2485 Ga0068859_100023708
2486 Ga0068859_100077712
2487 Ga0068859_100120205
2488 Ga0068859_100168757
2489 Ga0068859_100271922
2490 Ga0068864_100002031
2491 Ga0068864_100010073
2492 Ga0068864_100022732
2493 Ga0068864_100023356
2494 Ga0068864_100064135
2495 Ga0068864_100121236
2496 Ga0068864_100203346
2497 Ga0068864_100217787
2498 Ga0068864_100240406
2499 Ga0068864_100245706
2500 Ga0068864_100431323
2501 Ga0068866_10000717
2502 Ga0068866_10003912
2503 Ga0068866_10051421
2504 Ga0068866_10062206
2505 Ga0068866_10187591
2506 Ga0068861_100012489
2507 Ga0068861_100015622
2508 Ga0068861_100016209
2509 Ga0068861_100029458
2510 Ga0068861_100160014
2511 Ga0068861_100195762
2512 Ga0068861_100196842
2513 Ga0068861_100287360
2514 Ga0068851_10003231
2515 Ga0068851_10038885
2516 Ga0068851_10042935
2517 Ga0068870_10037587
2518 Ga0068863_100001012
2519 Ga0068863_100002456
2520 Ga0068863_100010910
2521 Ga0068863_100021801
2522 Ga0068863_100042478
2523 Ga0068863_100069864
2524 Ga0068863_100077118
2525 Ga0068863_100088880
2526 Ga0068863_100138272
2527 Ga0068863_100187450
2528 Ga0068863_100193491
2529 Ga0068863_100422239
2530 Ga0068858_100000838
2531 Ga0068858_100001334
2532 Ga0068858_100003187
2533 Ga0068858_100049450
2534 Ga0068858_100056595
2535 Ga0068858_100123497
2536 Ga0068858_100416596
2537 Ga0068858_100473361
2538 Ga0068860_100000941
2539 Ga0068860_100002554
2540 Ga0068860_100013492
2541 Ga0068860_100028810
2542 Ga0068860_100038795
2543 Ga0068860_100040424
2544 Ga0068860_100053102
2545 Ga0068860_100107013
2546 Ga0068860_100141667
2547 Ga0068860_100213605
2548 Ga0068862_100000627
2549 Ga0068862_100003677
2550 Ga0068862_100007347
2551 Ga0068862_100008433
2552 Ga0068862_100021370
2553 Ga0068862_100025886
2554 Ga0068862_100050489
2555 Ga0068862_100096277
2556 Ga0068862_100099445
2557 Ga0068862_100166692
2558 Ga0068862_100189099
2559 Ga0068862_100240492
2560 Ga0068862_100353240
2561 Ga0081455_10013572
2562 Ga0070717_10035050
2563 Ga0075364_10000513
2564 Ga0075364_10001919
2565 Ga0075364_10015072
2566 Ga0070715_10008322
2567 Ga0070715_10073462
2568 Ga0070716_100000244
2569 Ga0070712_100030129
2570 Ga0070712_100046364
2571 Ga0070712_100207631
2572 Ga0075366_10001562
2573 Ga0075366_10024270
2574 Ga0075366_10040010
2575 Ga0097621_100003986
2576 Ga0097621_100006125
2577 Ga0097621_100036360
2578 Ga0097621_100061784
2579 Ga0097621_100084227
2580 Ga0097621_100098407
2581 Ga0097621_100285937
2582 Ga0097621_100340364
2583 Ga0068871_100000888
2584 Ga0068871_100023710
2585 Ga0068871_100032115
2586 Ga0068871_100050198
2587 Ga0068871_100155363
2588 Ga0068871_100167521
2589 Ga0068871_100311729
2590 Ga0068871_100334706
2591 Ga0075428_100001820
2592 Ga0075428_100012398
2593 Ga0075428_100013313
2594 Ga0075428_100019629
2595 Ga0075428_100019983
2596 Ga0075428_100115633
2597 Ga0075430_100002494
2598 Ga0075430_100012275
2599 Ga0075430_100018473
2600 Ga0075430_100148725
2601 Ga0075430_100180082
2602 Ga0075430_100315010
2603 Ga0075430_100332803
2604 Ga0075430_100433765
2605 Ga0075431_100000992
2606 Ga0075431_100021306
2607 Ga0075431_100042431
2608 Ga0075431_100043121
2609 Ga0075431_100098948
2610 Ga0075431_100101385
2611 Ga0075431_100125262
2612 Ga0075431_100128352
2613 Ga0075431_100523932
2614 Ga0075433_10009350
2615 Ga0075433_10017867
2616 Ga0075433_10145124
2617 Ga0075433_10310431
2618 Ga0075433_10406665
2619 Ga0075434_100000358
2620 Ga0075434_100125348
2621 Ga0075429_100000646
2622 Ga0075429_100010240
2623 Ga0075429_100041093
2624 Ga0075429_100041561
2625 Ga0075429_100208170
2626 Ga0068865_100001823
2627 Ga0068865_100006486
2628 Ga0068865_100049038
2629 Ga0068865_100101036
2630 Ga0068865_100150787
2631 Ga0068865_100330874
2632 Ga0075436_100117052
2633 Ga0075436_100264469
2634 Ga0097620_100003775
2635 Ga0097620_100009496
2636 Ga0097620_100023708
2637 Ga0097620_100077708
2638 Ga0097620_100120210
2639 Ga0097620_100168761
2640 Ga0097620_100271907
2641 Ga0099826_10000014
2642 Ga0075435_100024948
2643 Ga0075435_100167129
2644 Ga0099794_10019591
2645 Ga0099794_10033455
2646 Ga0099794_10093686
2647 Ga0105251_10016322
2648 Ga0105251_10049227
2649 Ga0105244_10000480
2650 Ga0105244_10016069
2651 Ga0105250_10000021
2652 Ga0105250_10000023
2653 Ga0105240_10001345
2654 Ga0105240_10004508
2655 Ga0105240_10008645
2656 Ga0105240_10016284
2657 Ga0105240_10072048
2658 Ga0105240_10076281
2659 Ga0105240_10143498
2660 Ga0105240_10254013
2661 Ga0105240_10269139
2662 Ga0105240_10274055
2663 Ga0105240_10316293
2664 Ga0111539_10012428
2665 Ga0111539_10023233
2666 Ga0111539_10023375
2667 Ga0111539_10030460
2668 Ga0111539_10059404
2669 Ga0111539_10071890
2670 Ga0111539_10073043
2671 Ga0111539_10081579
2672 Ga0111539_10115901
2673 Ga0111539_10154829
2674 Ga0111539_10170118
2675 Ga0105245_10010418
2676 Ga0105245_10053253
2677 Ga0105245_10068994
2678 Ga0105247_10000613
2679 Ga0105247_10008368
2680 Ga0105247_10047507
2681 Ga0114129_10000246
2682 Ga0114129_10089197
2683 Ga0114129_10110589
2684 Ga0114129_10137685
2685 Ga0114129_10164161
2686 Ga0114129_10466527
2687 Ga0105243_10126161
2688 Ga0105243_10136173
2689 Ga0105243_10166897
2690 Ga0105243_10199049
2691 Ga0105241_10043275
2692 Ga0105241_10088500
2693 Ga0105241_10090077
2694 Ga0105241_10103482
2695 Ga0105242_10000991
2696 Ga0105242_10007522
2697 Ga0105242_10040873
2698 Ga0105248_10023598
2699 Ga0105248_10131071
2700 Ga0105248_10177228
2701 Ga0105248_10227184
2702 Ga0105248_10241296
2703 Ga0105237_10075394
2704 Ga0105237_10100737
2705 Ga0105237_10184415
2706 Ga0105237_10238664
2707 Ga0105237_10274841
2708 Ga0105237_10512246
2709 Ga0105238_10000155
2710 Ga0105238_10034261
2711 Ga0105238_10144279
2712 Ga0105238_10187472
2713 Ga0105238_10196176
2714 Ga0105238_10274929
2715 Ga0105238_10504531
2716 Ga0105249_10002480
2717 Ga0105249_10008606
2718 Ga0105249_10008927
2719 Ga0105239_10044029
2720 Ga0105239_10044801
2721 Ga0105239_10091472
2722 Ga0105239_10406084
2723 Ga0105246_10379433
2724 Ga0157373_10036577
2725 Ga0157373_10226157
2726 Ga0157370_10000459
2727 Ga0157370_10014928
2728 Ga0157370_10087259
2729 Ga0157370_10108624
2730 Ga0157369_10004509
2731 Ga0157369_10097160
2732 Ga0157369_10111504
2733 Ga0157369_10173360
2734 Ga0157369_10541853
2735 Ga0157374_10000173
2736 Ga0157374_10002787
2737 Ga0157374_10089052
2738 Ga0157374_10152622
2739 Ga0157378_10001843
2740 Ga0157378_10014679
2741 Ga0157378_10021870
2742 Ga0157378_10044427
2743 Ga0157378_10094127
2744 Ga0157378_10095848
2745 Ga0157378_10099426
2746 Ga0157378_10145822
2747 Ga0157378_10214315
2748 Ga0163162_10023826
2749 Ga0163162_10069959
2750 Ga0163162_10107599
2751 Ga0163162_10179065
2752 Ga0163162_10211385
2753 Ga0163162_10230726
2754 Ga0163162_10336618
2755 Ga0163162_10361935
2756 Ga0163162_10437256
2757 Ga0157372_10402653
2758 Ga0157372_10554451
2759 Ga0157375_10005969
2760 Ga0157375_10034170
2761 Ga0157375_10070454
2762 Ga0157375_10074486
2763 Ga0157375_10150513
2764 Ga0157375_10425051
2765 Ga0157375_10441387
2766 Ga0157375_10489370
2767 Ga0157375_10497835
2768 Ga0157375_10582767
2769 Ga0157375_10612726
2770 Ga0157375_10667433
2771 Ga0163163_10001413
2772 Ga0163163_10005314
2773 Ga0163163_10015469
2774 Ga0163163_10019986
2775 Ga0163163_10021863
2776 Ga0163163_10059902
2777 Ga0163163_10348635
2778 Ga0163163_10365138
2779 Ga0163163_10603203
2780 Ga0157380_10000523
2781 Ga0157380_10001490
2782 Ga0157380_10014833
2783 Ga0157380_10033583
2784 Ga0157380_10114009
2785 Ga0157380_10262497
2786 Ga0182008_10002199
2787 Ga0157377_10061290
2788 Ga0157377_10076224
2789 Ga0157379_10000241
2790 Ga0157379_10020413
2791 Ga0157379_10023113
2792 Ga0157379_10024272
2793 Ga0157379_10033388
2794 Ga0157379_10097250
2795 Ga0157376_10065831
2796 Ga0157376_10231633
2797 Ga0157376_10252551
2798 Ga0157376_10275270
2799 Ga0157376_10276692
2800 Ga0182006_1000014
2801 Ga0182006_1001667
2802 Ga0182006_1003394
2803 Ga0182006_1011676
2804 Ga0182007_10000011
2805 Ga0182007_10000938
2806 Ga0182007_10028723
2807 Ga0182005_1000014
2808 Ga0182005_1000052
2809 Ga0182005_1002111
2810 Ga0163161_10011439
2811 Ga0163161_10045423
2812 Ga0163161_10048220
2813 Ga0163161_10059877
2814 Ga0163161_10081193
2815 Ga0163161_10084995
2816 Ga0163161_10220170
2817 Ga0206353_12058834
2818 Ga0213872_10000002
2819 Ga0213872_10000305
2820 Ga0213872_10002860
2821 Ga0213872_10003308
2822 Ga0213872_10003721
2823 Ga0213872_10006075
2824 Ga0213872_10011337
2825 Ga0213872_10022038
2826 Ga0213872_10058781
2827 Ga0213874_10017033
2828 Ga0213874_10024331
2829 Ga0213876_10034937
2830 Ga0209435_100004
2831 Ga0209435_100156
2832 Ga0209760_101646
2833 Ga0209784_100005
2834 Ga0209784_100020
2835 Ga0209566_100005
2836 Ga0209566_100020
2837 Ga0209674_100009
2838 Ga0209674_100035
2839 Ga0209147_100011
2840 Ga0209563_100012
2841 Ga0209563_100038
2842 Ga0209437_100066
2843 Ga0209437_100084
2844 Ga0209258_100264
2845 Ga0209646_1000032
2846 Ga0209646_1000047
2847 Ga0209646_1000052
2848 Ga0209026_1000062
2849 Ga0209026_1002562
2850 Ga0209026_1004402
2851 Ga0209677_100006
2852 Ga0209677_100031
2853 Ga0209759_1000054
2854 Ga0209759_1000514
2855 Ga0209233_1000060
2856 Ga0209565_1000006
2857 Ga0209455_1017960
2858 Ga0209673_1000004
2859 Ga0209130_1000065
2860 Ga0209675_1000006
2861 Ga0209025_1000554
2862 Ga0209025_1004464
2863 Ga0209025_1005334
2864 Ga0209564_1000006
2865 Ga0209564_1000064
2866 Ga0209564_1000107
2867 Ga0209256_1000179
2868 Ga0209256_1000340
2869 Ga0209051_1002451
2870 Ga0207697_10007354
2871 Ga0207656_10046611
2872 Ga0207656_10081110
2873 Ga0207696_1000503
2874 Ga0207655_1020727
2875 Ga0207653_10062323
2876 Ga0207682_10009949
2877 Ga0207682_10020031
2878 Ga0207682_10050173
2879 Ga0207692_10029108
2880 Ga0207692_10083281
2881 Ga0207642_10011043
2882 Ga0207642_10104328
2883 Ga0207710_10006077
2884 Ga0207710_10023194
2885 Ga0207688_10051364
2886 Ga0207688_10087835
2887 Ga0207680_10005870
2888 Ga0207680_10056596
2889 Ga0207680_10092999
2890 Ga0207680_10190489
2891 Ga0207685_10041984
2892 Ga0207699_10021017
2893 Ga0207645_10014503
2894 Ga0207645_10029729
2895 Ga0207645_10046562
2896 Ga0207643_10005861
2897 Ga0207643_10031159
2898 Ga0207643_10071090
2899 Ga0207684_10163867
2900 Ga0207654_10044196
2901 Ga0207654_10232776
2902 Ga0207707_10000751
2903 Ga0207707_10003844
2904 Ga0207707_10015871
2905 Ga0207707_10028726
2906 Ga0207707_10036263
2907 Ga0207707_10065401
2908 Ga0207707_10090683
2909 Ga0207707_10337987
2910 Ga0207695_10002162
2911 Ga0207695_10003096
2912 Ga0207695_10008191
2913 Ga0207695_10034230
2914 Ga0207695_10039353
2915 Ga0207695_10041549
2916 Ga0207695_10055225
2917 Ga0207695_10074319
2918 Ga0207695_10075211
2919 Ga0207695_10205611
2920 Ga0207671_10060503
2921 Ga0207671_10109642
2922 Ga0207671_10362450
2923 Ga0207693_10000007
2924 Ga0207693_10059777
2925 Ga0207693_10098082
2926 Ga0207663_10012439
2927 Ga0207663_10185948
2928 Ga0207660_10006464
2929 Ga0207660_10027511
2930 Ga0207660_10145099
2931 Ga0207662_10000269
2932 Ga0207662_10163984
2933 Ga0207657_10002609
2934 Ga0207657_10004204
2935 Ga0207657_10156509
2936 Ga0207649_10003420
2937 Ga0207649_10011243
2938 Ga0207649_10014718
2939 Ga0207649_10021407
2940 Ga0207649_10322809
2941 Ga0207652_10002171
2942 Ga0207652_10018733
2943 Ga0207652_10079629
2944 Ga0207652_10110015
2945 Ga0207652_10119674
2946 Ga0207646_10004092
2947 Ga0207681_10002856
2948 Ga0207681_10003441
2949 Ga0207681_10045535
2950 Ga0207681_10108219
2951 Ga0207681_10113427
2952 Ga0207694_10000625
2953 Ga0207694_10037116
2954 Ga0207694_10060517
2955 Ga0207694_10120994
2956 Ga0207694_10239377
2957 Ga0207694_10333148
2958 Ga0207650_10002703
2959 Ga0207650_10017166
2960 Ga0207650_10021288
2961 Ga0207650_10027729
2962 Ga0207650_10041183
2963 Ga0207650_10129502
2964 Ga0207650_10449329
2965 Ga0207659_10003461
2966 Ga0207659_10009472
2967 Ga0207659_10010547
2968 Ga0207659_10015323
2969 Ga0207659_10015760
2970 Ga0207659_10037748
2971 Ga0207659_10071833
2972 Ga0207687_10005308
2973 Ga0207687_10007028
2974 Ga0207700_10000051
2975 Ga0207700_10031633
2976 Ga0207700_10052163
2977 Ga0207700_10223002
2978 Ga0207664_10422027
2979 Ga0207644_10000403
2980 Ga0207644_10000800
2981 Ga0207644_10056591
2982 Ga0207644_10067626
2983 Ga0207644_10148933
2984 Ga0207644_10204609
2985 Ga0207690_10002750
2986 Ga0207690_10163528
2987 Ga0207706_10007576
2988 Ga0207706_10048180
2989 Ga0207706_10067627
2990 Ga0207706_10099134
2991 Ga0207706_10131311
2992 Ga0207706_10132692
2993 Ga0207706_10211941
2994 Ga0207706_10360504
2995 Ga0207686_10011209
2996 Ga0207686_10016593
2997 Ga0207709_10030619
2998 Ga0207709_10115637
2999 Ga0207709_10294419
3000 Ga0207670_10002723
3001 Ga0207670_10004796
3002 Ga0207670_10070289
3003 Ga0207670_10081959
3004 Ga0207670_10110878
3005 Ga0207670_10111361
3006 Ga0207670_10128428
3007 Ga0207669_10019154
3008 Ga0207669_10146898
3009 Ga0207669_10149897
3010 Ga0207669_10172080
3011 Ga0207704_10052197
3012 Ga0207704_10058256
3013 Ga0207704_10065397
3014 Ga0207704_10080385
3015 Ga0207704_10120645
3016 Ga0207704_10188024
3017 Ga0207665_10006297
3018 Ga0207665_10020217
3019 Ga0207665_10027185
3020 Ga0207665_10050866
3021 Ga0207691_10001621
3022 Ga0207691_10002348
3023 Ga0207691_10002646
3024 Ga0207691_10008772
3025 Ga0207691_10009236
3026 Ga0207691_10027590
3027 Ga0207691_10059569
3028 Ga0207691_10139948
3029 Ga0207691_10504776
3030 Ga0207711_10021913
3031 Ga0207711_10145710
3032 Ga0207711_10158101
3033 Ga0207711_10642058
3034 Ga0207689_10000310
3035 Ga0207689_10012716
3036 Ga0207689_10022140
3037 Ga0207689_10064597
3038 Ga0207689_10204123
3039 Ga0207661_10004522
3040 Ga0207661_10022639
3041 Ga0207661_10128755
3042 Ga0207679_10002358
3043 Ga0207679_10003296
3044 Ga0207679_10007770
3045 Ga0207679_10018376
3046 Ga0207679_10140289
3047 Ga0207679_10160835
3048 Ga0207679_10575924
3049 Ga0207667_10000019
3050 Ga0207667_10000637
3051 Ga0207667_10004938
3052 Ga0207667_10007781
3053 Ga0207667_10012690
3054 Ga0207667_10035515
3055 Ga0207667_10151395
3056 Ga0207667_10615245
3057 Ga0207651_10008002
3058 Ga0207651_10037092
3059 Ga0207651_10092708
3060 Ga0207651_10136389
3061 Ga0207651_10159781
3062 Ga0207712_10004779
3063 Ga0207712_10096474
3064 Ga0207712_10169107
3065 Ga0207712_10174577
3066 Ga0207712_10182754
3067 Ga0207668_10007417
3068 Ga0207668_10021249
3069 Ga0207668_10036814
3070 Ga0207668_10062992
3071 Ga0207668_10085593
3072 Ga0207668_10111689
3073 Ga0207668_10138774
3074 Ga0207640_10010217
3075 Ga0207640_10079111
3076 Ga0207640_10254310
3077 Ga0207640_10255473
3078 Ga0207658_10000197
3079 Ga0207658_10017504
3080 Ga0207658_10050590
3081 Ga0207658_10390411
3082 Ga0207677_10000943
3083 Ga0207677_10001689
3084 Ga0207677_10263760
3085 Ga0207677_10385404
3086 Ga0207703_10000527
3087 Ga0207703_10001924
3088 Ga0207703_10001944
3089 Ga0207703_10006799
3090 Ga0207703_10011508
3091 Ga0207703_10025444
3092 Ga0207703_10062891
3093 Ga0207703_10099188
3094 Ga0207703_10169809
3095 Ga0207703_10318622
3096 Ga0207639_10018834
3097 Ga0207639_10426315
3098 Ga0207639_10576079
3099 Ga0207678_10033565
3100 Ga0207678_10049277
3101 Ga0207678_10063471
3102 Ga0207678_10120026
3103 Ga0207678_10154389
3104 Ga0207678_10162218
3105 Ga0207708_10000736
3106 Ga0207708_10003489
3107 Ga0207708_10004110
3108 Ga0207708_10008914
3109 Ga0207708_10029484
3110 Ga0207708_10154061
3111 Ga0207708_10255149
3112 Ga0207702_10102503
3113 Ga0207702_10114892
3114 Ga0207702_10155092
3115 Ga0207702_10174799
3116 Ga0207702_10323913
3117 Ga0207641_10000604
3118 Ga0207641_10005610
3119 Ga0207641_10006006
3120 Ga0207641_10013697
3121 Ga0207641_10019332
3122 Ga0207641_10025786
3123 Ga0207641_10089203
3124 Ga0207641_10117158
3125 Ga0207641_10249778
3126 Ga0207648_10004465
3127 Ga0207648_10005674
3128 Ga0207648_10022643
3129 Ga0207648_10024077
3130 Ga0207648_10059271
3131 Ga0207648_10060255
3132 Ga0207648_10135010
3133 Ga0207648_10168935
3134 Ga0207648_10171019
3135 Ga0207648_10420907
3136 Ga0207676_10027004
3137 Ga0207676_10029276
3138 Ga0207676_10033816
3139 Ga0207676_10259985
3140 Ga0207676_10321638
3141 Ga0207674_10002650
3142 Ga0207674_10006753
3143 Ga0207674_10008122
3144 Ga0207674_10035125
3145 Ga0207674_10111069
3146 Ga0207674_10658064
3147 Ga0207675_100002123
3148 Ga0207675_100010044
3149 Ga0207675_100014526
3150 Ga0207675_100021498
3151 Ga0207675_100030104
3152 Ga0207675_100032847
3153 Ga0207675_100038209
3154 Ga0207675_100185737
3155 Ga0207683_10000817
3156 Ga0207683_10002350
3157 Ga0207683_10031427
3158 Ga0207683_10031673
3159 Ga0207683_10112081
3160 Ga0207683_10138474
3161 Ga0207683_10220808
3162 Ga0207698_10001140
3163 Ga0207698_10015798
3164 Ga0207698_10033350
3165 Ga0207698_10174114
3166 Ga0209281_1002645
3167 Ga0209967_1002770
3168 Ga0209981_1009413
3169 Ga0209999_1004154
3170 Ga0209970_1002765
3171 Ga0210002_1019511
3172 Ga0209983_1004835
3173 Ga0209282_1000046
3174 Ga0209588_1032041
3175 Ga0209974_10029239
3176 Ga0207428_10004796
3177 Ga0207428_10014528
3178 Ga0207428_10041023
3179 Ga0207428_10074137
3180 Ga0268266_10000796
3181 Ga0268266_10038457
3182 Ga0268266_10070210
3183 Ga0268266_10267124
3184 Ga0268266_10469587
3185 Ga0268265_10000932
3186 Ga0268265_10001937
3187 Ga0268265_10002340
3188 Ga0268265_10006026
3189 Ga0268265_10007525
3190 Ga0268265_10020235
3191 Ga0268265_10079250
3192 Ga0268265_10183200
3193 Ga0268265_10293712
3194 Ga0268264_10000176
3195 Ga0268264_10030223
3196 Ga0268264_10044621
3197 Ga0268264_10128460
3198 Ga0265323_10006325
3199 Ga0307515_10166593
3200 Ga0307515_10243509
3201 Ga0265338_10000057
3202 Ga0265338_10005002
3203 Ga0307511_10003352
3204 Ga0316181_1231393
3205 Ga0265766_1001995
3206 Ga0265330_10000033
3207 Ga0265330_10000827
3208 Ga0265332_10000001
3209 Ga0265332_10000742
3210 Ga0265328_10002285
3211 Ga0265328_10018006
3212 Ga0265325_10017896
3213 Ga0265329_10006654
3214 Ga0265340_10032736
3215 Ga0265331_10001605
3216 Ga0265331_10002179
3217 Ga0265331_10009384
3218 Ga0265327_10000103
3219 Ga0265327_10010155
3220 Ga0265327_10020157
3221 Ga0265327_10124707
3222 Ga0265316_10010545
3223 Ga0265316_10013150
3224 Ga0265316_10030556
3225 Ga0265316_10034228
3226 Ga0307513_10008177
3227 Ga0307513_10014609
3228 Ga0307513_10116719
3229 Ga0307509_10000021
3230 Ga0307408_100000331
3231 Ga0307408_100030530
3232 Ga0307408_100043547
3233 Ga0307408_100045527
3234 Ga0307408_100048376
3235 Ga0307408_100227248
3236 Ga0307408_100346077
3237 Ga0316575_10002733
3238 Ga0316575_10015078
3239 Ga0316575_10025792
3240 Ga0316579_10002332
3241 Ga0316579_10014957
3242 Ga0316579_10053611
3243 Ga0316579_10070788
3244 Ga0316579_10072978
3245 Ga0265314_10000022
3246 Ga0265314_10009479
3247 Ga0265314_10044351
3248 Ga0265314_10158797
3249 Ga0316576_10000007
3250 Ga0316576_10002013
3251 Ga0316576_10014172
3252 Ga0316576_10023318
3253 Ga0316576_10106015
3254 Ga0316576_10115129
3255 Ga0316578_10000247
3256 Ga0316578_10011051
3257 Ga0316578_10029415
3258 Ga0316578_10032042
3259 Ga0316578_10042096
3260 Ga0316578_10080392
3261 Ga0307516_10005678
3262 Ga0307405_10009974
3263 Ga0307405_10047459
3264 Ga0307405_10287436
3265 Ga0316577_10000060
3266 Ga0316577_10002401
3267 Ga0316577_10011270
3268 Ga0316577_10021225
3269 Ga0316577_10054363
3270 Ga0316577_10137759
3271 Ga0316577_10193824
3272 Ga0307413_10035667
3273 Ga0307413_10130081
3274 Ga0307410_10023462
3275 Ga0307410_10052426
3276 Ga0307410_10086703
3277 Ga0307410_10132131
3278 Ga0307406_10022966
3279 Ga0307406_10181664
3280 Ga0307407_10020497
3281 Ga0307407_10025997
3282 Ga0307412_10019389
3283 Ga0307412_10482665
3284 Ga0307409_100003265
3285 Ga0307409_100005682
3286 Ga0307409_100085062
3287 Ga0307409_100244334
3288 Ga0307416_100007278
3289 Ga0307416_100022471
3290 Ga0307416_100053714
3291 Ga0307416_100188320
3292 Ga0307416_100196331
3293 Ga0307416_100869372
3294 Ga0307414_10162918
3295 Ga0307414_10393846
3296 Ga0307411_10012815
3297 Ga0307411_10018834
3298 Ga0307415_100009761
3299 Ga0307415_100129907
3300 Ga0307415_100132924
3301 Ga0316585_10000120
3302 Ga0316580_10004843
3303 Ga0316580_10012007
3304 Ga0316580_10014310
3305 Ga0316580_10040740
3306 Ga0307510_10000002
3307 Ga0307510_10038803
3308 Ga0307510_10121453
3309 Ga0316588_1015333
3310 Ga0316587_1021171
3311 Ga0316596_1018730
3312 Ga0373958_0005256
3313 Ga0373926_0017403
3314 Ga0373934_0004781
3315 Ga0373934_0008021
3316 Ga0373936_0030899
3317 Ga0373941_0032107
3318 Ga0373945_0014449
3319 Ga0373945_0136109
3320 Ga0373953_0065061
3321 Ga0373954_0121962
3322 Ga0373956_0000029
3323 Ga0373956_0030613
3324 Ga0373956_0125656
3325 Ga0373957_0000474
3326 Ga0373957_0008879
3327 Ga0373957_0061048
3328 Ga0373943_0157862
3329 Ga0373943_0227747
3330 Ga0373955_0000731
3331 Ga0373955_0011087
3332 Ga0373955_0075734
3333 Ga0373955_0178468
3334 Ga0373961_0009521
3335 Ga0373962_0042496
3336 Ga0316574_0001501
3337 Ga0316574_0002787
3338 Ga0316574_0004096
3339 Ga0316574_0005003
3340 Ga0316574_0005513
3341 Ga0316574_0006846
3342 Ga0316574_0009834
3343 Ga0316574_0010793
3344 Ga0316574_0012984
3345 Ga0316574_0020895
3346 Ga0316574_0032015
3347 Ga0316574_0032977
3348 Ga0316574_0059360
3349 Ga0316574_0083734
3350 Ga0316574_0205946
3351 Ga0373931_0015441
3352 Ga0373931_0029386
3353 Ga0373935_0008593
3354 Ga0373935_0048854
3355 Ga0373935_0104491
3356 Ga0373927_0039972
3357 Ga0373927_0054434
3358 Ga0373927_0087643
3359 Ga0373933_0000579
3360 Ga0373933_0017867
3361 Ga0373933_0053057
3362 Ga0373933_0080850
3363 Ga0373933_0091165
3364 Ga0373933_0128412
3365 Ga0373933_0202774
3366 Ga0373947_0172461
3367 Ga0373937_0000441
3368 Ga0373937_0003520
3369 Ga0373937_0014512
3370 Ga0373937_0048250
3371 Ga0373937_0049409
3372 Ga0373937_0055776
3373 Ga0373937_0061527
3374 Ga0373937_0156332
3375 Ga0373937_0184536
3376 Ga0373937_0202246
3377 Ga0373937_0213959
3378 Ga0373937_0292077
3379 Ga0373937_0295974
3380 Ga0316582_0000395
3381 Ga0316582_0003675
3382 Ga0316582_0005547
3383 Ga0316582_0006878
3384 Ga0316582_0008980
3385 Ga0316582_0018329
3386 Ga0316582_0022562
3387 Ga0316582_0036087
3388 Ga0316582_0059008
3389 Ga0316582_0063949
3390 Ga0316582_0070281
3391 Ga0316584_0000351
3392 Ga0316584_0001066
3393 Ga0316584_0002993
3394 Ga0316584_0013493
3395 Ga0316584_0015047
3396 Ga0316584_0023503
3397 Ga0316584_0035151
3398 Ga0316584_0059173
3399 Ga0316584_0064679
3400 Ga0316584_0075894
3401 Ga0316584_0110458
3402 Ga0316584_0117465
3403 Ga0316584_0131295
3404 Ga0316584_0362705
3405 Ga0373925_0024901
3406 Ga0373925_0026437
3407 Ga0373925_0059508
3408 Ga0373925_0469901
3409 Ga0395899_0001136
3410 Ga0395899_0001535
3411 Ga0395900_0007959
3412 Ga0395900_0073358
3413 Ga0395900_0121983
3414 Ga0395900_0159102
3415 Ga0395900_0217252
3416 Ga0395900_0498418
3417 Ga0395898_0011479
3418 Ga0395898_0020896
3419 Ga0395898_0037964
3420 Ga0395905_0000059
3421 Ga0395905_0001136
3422 Ga0395905_0008938
3423 Ga0395905_0010966
3424 Ga0395905_0011248
3425 Ga0395905_0073000
3426 Ga0316581_0008348
3427 Ga0395901_0000839
3428 Ga0395901_0004488
3429 Ga0395901_0199796
3430 Ga0395901_0356467
3431 Ga0395901_0393697
3432 Ga0400490_36062
3433 Ga0400488_28864
3434 Ga0400483_041619
3435 Ga0400483_060059
3436 Ga0400483_190258
3437 Ga0400483_199900
3438 Ga0400487_14099
3439 Ga0400487_59035
3440 Ga0436365_0655415
3441 Ga0436365_1360668
3442 Ga0436365_1839211
3443 Ga0436360_0128072
3444 Ga0436360_0775847
3445 Ga0436361_0091148
3446 Ga0436361_0101333
3447 Ga0436361_0148126
3448 Ga0436361_0282854
3449 Ga0436361_0334934
3450 Ga0436361_0362646
3451 Ga0436361_0594091
3452 Ga0436361_0599318
3453 Ga0436361_0798996
3454 Ga0436361_1028197
3455 Ga0436361_1176994
3456 Ga0436363_0260147
3457 Ga0436363_0952595
3458 Ga0436363_1067387
3459 Ga0436363_1706823
3460 Ga0439438_003009
3461 Ga0439453_0000441
3462 Ga0439461_0028237
3463 Ga0451849_0304227
3464 Ga0451853_1138053
3465 Ga0439431_0004894
3466 Ga0439433_0004018
3467 Ga0439441_001005
3468 Ga0439456_012227
3469 Ga0450923_000279
3470 Ga0439446_0001893
3471 Ga0439446_0002299
3472 Ga0450908_007126
3473 Ga0439434_0017129
3474 Ga0439435_0000160
3475 Ga0439435_0024671
3476 Ga0439435_0047932
3477 Ga0439444_0000639
3478 Ga0451577_0000852
3479 Ga0451577_0001784
3480 Ga0451577_0006011
3481 Ga0451577_0037562
3482 Ga0451577_0114543
3483 Ga0451577_0125120
3484 Ga0451577_0143680
3485 Ga0451577_0197135
3486 Ga0451577_0197751
3487 Ga0451577_0408492
3488 Ga0466969_0001991
3489 Ga0466969_0002917
3490 Ga0466972_0000106
3491 Ga0466973_0095500
3492 Ga0466982_0076069
3493 Ga0453683_0063641
3494 Ga0466965_0013903
3495 Ga0466965_0028050
3496 Ga0466965_0049720
3497 Ga0466965_0127988
3498 Ga0466966_0004186
3499 Ga0466966_0053658
3500 Ga0466961_0000040
3501 Ga0466961_0031713
3502 Ga0466963_0010194
3503 Ga0466964_0007850
3504 Ga0453684_0002092
3505 Ga0453684_0005854
3506 Ga0453684_0007181
3507 Ga0453684_0018446
3508 Ga0453684_0033353
3509 Ga0453684_0061503
3510 Ga0453684_0144864
3511 Ga0453684_0571099
3512 Ga0453684_0577257
3513 Ga0453684_0765213
3514 Ga0466971_0002218
3515 Ga0466971_0003507
3516 Ga0466968_0000386
3517 Ga0466970_0004185
3518 Ga0466970_0048220
3519 Ga0466970_0049287
3520 Ga0466957_0011221
3521 Ga0466957_0018370
3522 Ga0466957_0081504
3523 Ga0466959_0016051
3524 Ga0466959_0021908
3525 Ga0466959_0047999
3526 Ga0466959_0072728
3527 Ga0466959_0078464
3528 Ga0451576_0003496
3529 Ga0451576_0014390
3530 Ga0451576_0027429
3531 Ga0451576_0035476
3532 Ga0451576_0045732
3533 Ga0451576_0078988
3534 Ga0451576_0486751
3535 Ga0466967_0007982
3536 Ga0466967_0416561
3537 Ga0495617_047239
3538 Ga0495627_000006
3539 Ga0495627_013310
3540 Ga0495592_0001747
3541 Ga0495592_0009606
3542 Ga0495592_0064178
3543 Ga0495592_0104404
3544 Ga0495592_0259506
3545 Ga0495603_0001029
3546 Ga0495603_0034806
3547 Ga0495603_0069390
3548 Ga0495603_0082058
3549 Ga0495590_0000004
3550 Ga0495590_0004686
3551 Ga0495590_0008972
3552 Ga0495591_000746
3553 Ga0495629_0002657
3554 Ga0495629_0022948
3555 Ga0495629_0046606
3556 Ga0495629_0077690
3557 Ga0495629_0224579
3558 Ga0495638_0000023
3559 Ga0495638_0003523
3560 Ga0495638_0003799
3561 Ga0495638_0005570
3562 Ga0495638_0014711
3563 Ga0495638_0021947
3564 Ga0495638_0027702
3565 Ga0495638_0085233
3566 Ga0495651_0000356
3567 Ga0495651_0008683
3568 Ga0495651_0049750
3569 Ga0495651_0080330
3570 Ga0495653_0000042
3571 Ga0495653_0005300
3572 Ga0495653_0085371
3573 Ga0495650_0000215
3574 Ga0495650_0000407
3575 Ga0495650_0003561
3576 Ga0495650_0004606
3577 Ga0495650_0005137
3578 Ga0495650_0012899
3579 Ga0495650_0020898
3580 Ga0495580_0001985
3581 Ga0495580_0013252
3582 Ga0495580_0027238
3583 Ga0495580_0035563
3584 Ga0495580_0083832
3585 Ga0495580_0109778
3586 Ga0495580_0183615
3587 Ga0495582_0006012
3588 Ga0495582_0011377
3589 Ga0495605_0001550
3590 Ga0495605_0004146
3591 Ga0495605_0015524
3592 Ga0495605_0122042
3593 Ga0495639_0058849
3594 Ga0495639_0071016
3595 Ga0495662_0005181
3596 Ga0495662_0027873
3597 Ga0495662_0034579
3598 Ga0495664_0000240
3599 Ga0495584_0010228
3600 Ga0495584_0020600
3601 Ga0495584_0185118
3602 Ga0495585_0011867
3603 Ga0495585_0198791
3604 Ga0495596_0000176
3605 Ga0495596_0001852
3606 Ga0495596_0014268
3607 Ga0495596_0017785
3608 Ga0495596_0035741
3609 Ga0495596_0043672
3610 Ga0495596_0061566
3611 Ga0495607_0004205
3612 Ga0495607_0017522
3613 Ga0495607_0041247
3614 Ga0495607_0082705
3615 Ga0495583_0000093
3616 Ga0495583_0000503
3617 Ga0495583_0001963
3618 Ga0495583_0018055
3619 Ga0495583_0024245
3620 Ga0495583_0034045
3621 Ga0495583_0098078
3622 Ga0495606_0000331
3623 Ga0495606_0000659
3624 Ga0495606_0002252
3625 Ga0495606_0002286
3626 Ga0495606_0004881
3627 Ga0495606_0010885
3628 Ga0495606_0020159
3629 Ga0495606_0020497
3630 Ga0495606_0021746
3631 Ga0495606_0026393
3632 Ga0495606_0030096
3633 Ga0495606_0090633
3634 Ga0495608_0004633
3635 Ga0495608_0005174
3636 Ga0495608_0158304
3637 Ga0495610_0015455
3638 Ga0495610_0029275
3639 Ga0495610_0033021
3640 Ga0495610_0117551
3641 Ga0495616_0001514
3642 Ga0495616_0001806
3643 Ga0495616_0007505
3644 Ga0495616_0018840
3645 Ga0495616_0064442
3646 Ga0495616_0090671
3647 Ga0495618_0010183
3648 Ga0495620_0017758
3649 Ga0495628_0008086
3650 Ga0495628_0010357
3651 Ga0495628_0012517
3652 Ga0495628_0041108
3653 Ga0495628_0054706
3654 Ga0495628_0075644
3655 Ga0495630_0021896
3656 Ga0495630_0140202
3657 Ga0495630_0166096
3658 Ga0495630_0341594
3659 Ga0495631_0000109
3660 Ga0495631_0052982
3661 Ga0495632_0000837
3662 Ga0495632_0041939
3663 Ga0495637_0000338
3664 Ga0495637_0000936
3665 Ga0495643_0000681
3666 Ga0495643_0001242
3667 Ga0495643_0014741
3668 Ga0495643_0017418
3669 Ga0495643_0021636
3670 Ga0495643_0043518
3671 Ga0495643_0069479
3672 Ga0495648_0000025
3673 Ga0495648_0005380
3674 Ga0495648_0008152
3675 Ga0495648_0026461
3676 Ga0495648_0050467
3677 Ga0495648_0060546
3678 Ga0495648_0089047
3679 Ga0495648_0094609
3680 Ga0495666_0004506
3681 Ga0495666_0006287
3682 Ga0495666_0027956
3683 Ga0495666_0028427
3684 Ga0495642_0003800
3685 Ga0495642_0008352
3686 Ga0495642_0012706
3687 Ga0495642_0020062
3688 Ga0495642_0021266
3689 Ga0495652_0007174
3690 Ga0495652_0007305
3691 Ga0495652_0052416
3692 Ga0495654_0000004
3693 Ga0495654_0099935
3694 Ga0495665_0008313
3695 Ga0495665_0016793
3696 Ga0495665_0024166
3697 Ga0495665_0079305
3698 Ga0495640_0002467
3699 Ga0495640_0122907
3700 Ga0495640_0136155
3701 Ga0495586_0037835
3702 Ga0495587_0003076
3703 Ga0495587_0019220
3704 Ga0495587_0067554
3705 Ga0495587_0071881
3706 Ga0495587_0120390
3707 Ga0495598_0012097
3708 Ga0495598_0025423
3709 Ga0495609_0012302
3710 Ga0495609_0018544
3711 Ga0495609_0022503
3712 Ga0495609_0113797
3713 Ga0495621_0049300
3714 Ga0495597_0000295
3715 Ga0495597_0000629
3716 Ga0495597_0004054
3717 Ga0495597_0014825
3718 Ga0495597_0024422
3719 Ga0495597_0039758
3720 Ga0495645_0000609
3721 Ga0495645_0001936
3722 Ga0495645_0005217
3723 Ga0495645_0052106
3724 Ga0495645_0057519
3725 Ga0495645_0130090
3726 Ga0495622_0000007
3727 Ga0495622_0000063
3728 Ga0495622_0000242
3729 Ga0495622_0004064
3730 Ga0495633_0000107
3731 Ga0495633_0000317
3732 Ga0495633_0001129
3733 Ga0495633_0007175
3734 Ga0495667_0006380
3735 Ga0495667_0099029
3736 Ga0495667_0160215
3737 Ga0495656_0056747
3738 Ga0495668_0000049
3739 Ga0495668_0000198
3740 Ga0495668_0016570
3741 Ga0495668_0019695
3742 Ga0495668_0042809
3743 Ga0495668_0095661
3744 Ga0495668_0109555
3745 Ga0495668_0150331
3746 Ga0495668_0227952
3747 Ga0495634_0101385
3748 Ga0495634_0137938
3749 Ga0495611_0031080
3750 Ga0495625_0000123
3751 Ga0495625_0010365
3752 Ga0495625_0026815
3753 Ga0495625_0030323
3754 Ga0495625_0043099
3755 Ga0495625_0053168
3756 Ga0495625_0067247
3757 Ga0495625_0072876
3758 Ga0495625_0088367
3759 Ga0495625_0097592
3760 Ga0495635_0024341
3761 Ga0495635_0033671
3762 Ga0495659_0000297
3763 Ga0495659_0001065
3764 Ga0495659_0052565
3765 Ga0495661_0001776
3766 Ga0495661_0002632
3767 Ga0495661_0010293
3768 Ga0495661_0011580
3769 Ga0495661_0019506
3770 Ga0495661_0021820
3771 Ga0495661_0024741
3772 Ga0495661_0060606
3773 Ga0495661_0228521
3774 Ga0495588_0108749
3775 Ga0495657_0128578
3776 Ga0495657_0145606
3777 Ga0495657_0161352
3778 Ga0495657_0227210
3779 Ga0495599_0001013
3780 Ga0495599_0018906
3781 Ga0495623_0003184
3782 Ga0495623_0019436
3783 Ga0495646_0008696
3784 Ga0495646_0014620
3785 Ga0495646_0022937
3786 Ga0495646_0026086
3787 Ga0495647_0004872
3788 Ga0495647_0011506
3789 Ga0495658_0008454
3790 Ga0495658_0069680
3791 Ga0495658_0080092
3792 Ga0495669_0004604
3793 Ga0495613_0030346
3794 Ga0495613_0042571
3795 Ga0495624_0007783
3796 Ga0495624_0018248
3797 Ga0495624_0031417
3798 Ga0495670_0021155
3799 Ga0495671_0001337
3800 Ga0495671_0007676
3801 Ga0495671_0009971
3802 Ga0495671_0011133
3803 Ga0495671_0015867
3804 Ga0495671_0022132
3805 Ga0495671_0137313
3806 Ga0495649_0002825
3807 Ga0495649_0003503
3808 Ga0495649_0003798
3809 Ga0495649_0014909
3810 Ga0495649_0021389
3811 Ga0495649_0037765
3812 Ga0495589_0000569
3813 Ga0495589_0004740
3814 Ga0495589_0029450
3815 Ga0495589_0061740
3816 Ga0495589_0077449
3817 Ga0495589_0084570
3818 Ga0495589_0085513
3819 Ga0495600_0006351
3820 Ga0495600_0026810
3821 Ga0495600_0086041
3822 Ga0495660_0000542
3823 Ga0495660_0001078
3824 Ga0495660_0009807
3825 Ga0495660_0010817
3826 Ga0495660_0013133
3827 Ga0495660_0035824
3828 Ga0495660_0057450
3829 Ga0495660_0063163
3830 Ga0495660_0110881
3831 Ga0495581_0009404
3832 Ga0495581_0014371
3833 Ga0495604_0178726
3834 Ga0495604_0251153
3835 Ga0495636_0029621
3836 Ga0495636_0085188
3837 Ga0495674_0008154
3838 Ga0495674_0015022
3839 Ga0495674_0049015
3840 Ga0495674_0201770
3841 Ga0495672_0000159
3842 Ga0495672_0017796
3843 Ga0495672_0024888
3844 Ga0495676_0021709
3845 Ga0495683_0004007
3846 Ga0495683_0175317
3847 Ga0495687_000049
3848 Ga0495687_000088
3849 Ga0495687_004364
3850 Ga0495687_011253
3851 Ga0495687_016555
3852 Ga0495687_023435
3853 Ga0495675_0001488
3854 Ga0495675_0026156
3855 Ga0495675_0047698
3856 Ga0495675_0092043
3857 Ga0495677_0025577
3858 Ga0495679_000044
3859 Ga0495679_005164
3860 Ga0495679_008760
3861 Ga0495679_009205
3862 Ga0495679_030588
3863 Ga0495685_013452
3864 Ga0495673_0002725
3865 Ga0495681_0006863
3866 Ga0495681_0011866
3867 Ga0495681_0014148
3868 Ga0495684_0099674
3869 Ga0495684_0340291
3870 Ga0495686_0000838
3871 Ga0495686_0002406
3872 Ga0495686_0012772
3873 Ga0495686_0035681
3874 Ga0495593_0002710
3875 Ga0495602_0085499
3876 Ga0495602_0128335
3877 Ga0495614_0037819
3878 Ga0495614_0079491
3879 Ga0495626_0011661
3880 Ga0495626_0015200
3881 Ga0495626_0057747
3882 Ga0495626_0110096
3883 Ga0496100_0084443
3884 Ga0496100_0115389
3885 Ga0496100_0265162
3886 Ga0496101_0005218
3887 Ga0496101_0018089
3888 Ga0496101_0034658
3889 Ga0496101_0046403
3890 Ga0496102_0007133
3891 Ga0496102_0018478
3892 Ga0496102_0018878
3893 Ga0496102_0020468
3894 Ga0496102_0023495
3895 Ga0496102_0094375
3896 Ga0496103_0003856
3897 Ga0496103_0025210
3898 Ga0496103_0030423
3899 Ga0496103_0065050
3900 Ga0496103_0180066
3901 Ga0496104_0082539
3902 Ga0496104_0169089
3903 Ga0496104_0211420
3904 Ga0496105_0097074
3905 Ga0496105_0224954
3906 Ga0496106_0003418
3907 Ga0496106_0042385
3908 Ga0496106_0160236
3909 Ga0496106_0182554
3910 Ga0496106_0302861
3911 Ga0496107_0008872
3912 Ga0496107_0014432
3913 Ga0496108_0000870
3914 Ga0496108_0108136
3915 Ga0496109_0005839
3916 Ga0496109_0023427
3917 Ga0496109_0111543
3918 Ga0496109_0120186
3919 Ga0496109_0169013
3920 Ga0496109_0501593
3921 Ga0496110_0001741
3922 Ga0496110_0002899
3923 Ga0496110_0059733
3924 Ga0496111_0037619
3925 Ga0496111_0221310
3926 Ga0496111_0227825
3927 Ga0496111_0388518
3928 Ga0496112_0344594
3929 Ga0496112_0544014
3930 Ga0496112_0582328
3931 Ga0496113_0087979
3932 Ga0496113_0130720
3933 Ga0496113_0333523
3934 Ga0496114_0001908
3935 Ga0496114_0009802
3936 Ga0496114_0010918
3937 Ga0496114_0023986
3938 Ga0496114_0051121
3939 Ga0496114_0132819
3940 Ga0496114_0265535
3941 Ga0496115_0090752
3942 Ga0496115_0291436
3943 Ga0496116_0008971
3944 Ga0496116_0054965
3945 Ga0496116_0056200
3946 Ga0496117_0000001
3947 Ga0496117_0000054
3948 Ga0496117_0077938
3949 Ga0496117_0081202
3950 Ga0496118_0000008
3951 Ga0496118_0000045
3952 Ga0496118_0028632
3953 Ga0496118_0035124
3954 Ga0496119_0000297
3955 Ga0496119_0015657
3956 Ga0496119_0079571
3957 Ga0496120_0001653
3958 Ga0496120_0024854
3959 Ga0496120_0100607
3960 Ga0496121_0002897
3961 Ga0496121_0005334
3962 Ga0496121_0011090
3963 Ga0496121_0011103
3964 Ga0496121_0015841
3965 Ga0496121_0022299
3966 Ga0496121_0135596
3967 Ga0496121_0142416
3968 Ga0496122_0000169
3969 Ga0496122_0000249
3970 Ga0496122_0000847
3971 Ga0496122_0008495
3972 Ga0496122_0013008
3973 Ga0496122_0117199
3974 Ga0496123_0000909
3975 Ga0496123_0002226
3976 Ga0496123_0002554
3977 Ga0496123_0005545
3978 Ga0496123_0012647
3979 Ga0496123_0029996
3980 Ga0496123_0103458
3981 Ga0496124_0021421
3982 Ga0496124_0129644
3983 Ga0496124_0130056
3984 Ga0496124_0145317
3985 Ga0496124_0209894
3986 Ga0496125_0000676
3987 Ga0496125_0000812
3988 Ga0496125_0001279
3989 Ga0496125_0006029
3990 Ga0496125_0007611
3991 Ga0496125_0011048
3992 Ga0496125_0019903
3993 Ga0496125_0059606
3994 Ga0496125_0248322
3995 Ga0496126_0022848
3996 Ga0496126_0029989
3997 Ga0496126_0075257
3998 Ga0496126_0232411
3999 Ga0495678_000013
4000 Ga0495678_000079
4001 Ga0495678_000981
4002 Ga0495678_002357
4003 Ga0495678_005844
4004 Ga0495678_006309
4005 Ga0495678_046202
4006 Ga0495682_0001431
4007 Ga0495682_0012441
4008 Ga0495682_0018400
4009 Ga0501031_0001835
4010 Ga0501032_0000036
4011 Ga0501032_0003205
4012 Ga0501032_0271260
4013 Ga0501033_0002208
4014 Ga0501033_0003067
4015 Ga0501033_0006562
4016 Ga0501034_0002523
4017 Ga0501034_0026564
4018 Ga0501036_0011654
4019 Ga0501036_0040876
4020 Ga0501036_0080670
4021 Ga0501037_0000793
4022 Ga0501037_0005568
4023 Ga0501037_0083785
4024 Ga0501038_0004695
4025 Ga0501038_0005737
4026 Ga0501038_0034864
4027 Ga0501038_0036736
4028 Ga0501039_0000386
4029 Ga0501039_0005849
4030 Ga0501039_0012218
4031 Ga0501039_0013925
4032 Ga0501039_0027225
4033 Ga0501039_0084037
4034 Ga0501039_0144347
4035 Ga0501039_0146002
4036 Ga0501039_0161925
4037 Ga0501039_0288630
4038 Ga0501039_0349290
4039 Ga0501040_0000455
4040 Ga0501040_0004740
4041 Ga0501040_0008686
4042 Ga0501040_0015767
4043 Ga0501040_0017931
4044 Ga0501040_0025609
4045 Ga0501040_0100455
4046 Ga0501040_0119241
4047 Ga0501040_0310684
4048 Ga0501041_0003215
4049 Ga0501041_0004330
4050 Ga0501041_0017877
4051 Ga0501041_0022651
4052 Ga0501041_0026794
4053 Ga0501041_0037274
4054 Ga0501042_0000031
4055 Ga0501042_0007956
4056 Ga0501042_0021847
4057 Ga0501042_0051127
4058 Ga0501042_0120917
4059 Ga0501042_0128961
4060 Ga0501042_0221755
4061 Ga0501043_0000157
4062 Ga0501043_0139362
4063 Ga0501046_0001694
4064 Ga0501046_0007774
4065 Ga0501046_0021853
4066 Ga0501046_0023907
4067 Ga0501046_0054285
4068 Ga0501046_0065898
4069 Ga0501046_0149227
4070 Ga0501047_0014303
4071 Ga0501047_0077517
4072 Ga0501048_0008923
4073 Ga0501048_0023751
4074 Ga0501048_0029291
4075 Ga0501048_0097920
4076 Ga0501067_0006809
4077 Ga0501067_0021608
4078 Ga0501067_0123725
4079 Ga0501068_0002793
4080 Ga0501068_0013939
4081 Ga0501069_0036168
4082 Ga0501069_0038859
4083 Ga0501069_0141123
4084 Ga0501070_0001696
4085 Ga0501070_0007573
4086 Ga0501070_0008433
4087 Ga0501070_0133806
4088 Ga0501071_0000686
4089 Ga0501071_0001833
4090 Ga0501071_0004638
4091 Ga0501071_0009669
4092 Ga0501071_0035993
4093 Ga0501071_0046193
4094 Ga0501071_0077313
4095 Ga0501071_0093323
4096 Ga0501072_0004342
4097 Ga0501072_0026438
4098 Ga0501072_0047153
4099 Ga0501072_0049931
4100 Ga0501072_0090907
4101 Ga0501072_0192137
4102 Ga0501072_0309186
4103 Ga0501073_0000472
4104 Ga0501073_0005363
4105 Ga0501073_0055129
4106 Ga0501073_0166225
4107 Ga0501073_0221475
4108 Ga0501074_0002836
4109 Ga0501074_0005527
4110 Ga0501074_0036301
4111 Ga0501074_0100798
4112 Ga0501074_0103298
4113 Ga0501074_0189899
4114 Ga0501074_0217459
4115 Ga0501075_0000792
4116 Ga0501075_0001305
4117 Ga0501075_0002475
4118 Ga0501075_0006009
4119 Ga0501075_0014752
4120 Ga0501075_0033278
4121 Ga0501075_0045801
4122 Ga0501075_0083095
4123 Ga0501075_0223811
4124 Ga0501076_0001408
4125 Ga0501076_0007783
4126 Ga0501076_0009825
4127 Ga0501076_0093956
4128 Ga0501076_0183345
4129 Ga0501076_0315547
4130 Ga0501077_0000280
4131 Ga0501077_0005399
4132 Ga0501077_0019320
4133 Ga0501077_0093833
4134 Ga0501217_049665
4135 Ga0501249_003204
4136 Ga0501079_0000811
4137 Ga0501079_0001080
4138 Ga0501079_0003255
4139 Ga0501079_0007587
4140 Ga0501079_0021711
4141 Ga0501079_0182909
4142 Ga0501080_0001568
4143 Ga0501080_0003790
4144 Ga0501080_0013669
4145 Ga0501080_0016016
4146 Ga0501080_0016298
4147 Ga0501080_0165362
4148 Ga0501080_0232048
4149 Ga0501080_0365415
4150 Ga0501081_0003604
4151 Ga0501081_0005175
4152 Ga0501081_0005236
4153 Ga0501081_0013740
4154 Ga0501083_0024949
4155 Ga0501083_0047057
4156 Ga0501083_0063656
4157 Ga0501269_000103
4158 Ga0501035_0000889
4159 Ga0501035_0004008
4160 Ga0501044_0002064
4161 Ga0501044_0039558
4162 Ga0501044_0066246
4163 Ga0501045_0000607
4164 Ga0501045_0013028
4165 Ga0501045_0013215
4166 Ga0501045_0015134
4167 Ga0501045_0017936
4168 Ga0501045_0022316
4169 Ga0501045_0043656
4170 Ga0501045_0056885
4171 nmdc:mga03683_13573_c2
4172 nmdc:mga00v17_1091_c1
4173 nmdc:mga0k408_221_c1
4174 nmdc:mga0k408_255643_c1
4175 nmdc:mga0k408_36994_c1
4176 nmdc:mga05p37_22213_c1
4177 nmdc:mga05p37_286680_c1
4178 nmdc:mga05p37_37857_c1
4179 nmdc:mga05p37_467917_c1
4180 nmdc:mga05p37_9357_c1
4181 nmdc:mga09592_21320_c1
4182 nmdc:mga09592_303696_c1
4183 nmdc:mga09592_315_c1
4184 nmdc:mga09592_58811_c1
4185 nmdc:mga09592_61744_c1
4186 nmdc:mga09592_78890_c1
4187 nmdc:mga0qj67_108197_c1
4188 nmdc:mga0qj67_17411_c1
4189 nmdc:mga0qj67_274657_c1
4190 nmdc:mga0qj67_2981_c1
4191 nmdc:mga0qj67_321855_c1
4192 nmdc:mga0qj67_39720_c1
4193 nmdc:mga0qj67_66701_c1
4194 nmdc:mga06r32_10212_c1
4195 nmdc:mga06r32_19839_c1
4196 nmdc:mga06r32_22391_c1
4197 nmdc:mga06r32_499338_c1
4198 nmdc:mga06r32_506616_c1
4199 nmdc:mga06r32_52552_c1
4200 nmdc:mga06r32_747_c1
4201 nmdc:mga06r32_7750_c2
4202 nmdc:mga08y16_121355_c1
4203 nmdc:mga08y16_1255_c1
4204 nmdc:mga08y16_14446_c1
4205 nmdc:mga08y16_180689_c1
4206 nmdc:mga08y16_204795_c1
4207 nmdc:mga08y16_259436_c1
4208 nmdc:mga08y16_385253_c1
4209 nmdc:mga08y16_523719_c1
4210 nmdc:mga08y16_646398_c1
4211 nmdc:mga08y16_66776_c1
4212 nmdc:mga08y16_7261_c1
4213 nmdc:mga08y16_76782_c1
4214 nmdc:mga0n895_426686_c1
4215 nmdc:mga0n895_5209_c1
4216 nmdc:mga0n895_60056_c1
4217 nmdc:mga0rr50_11716_c1
4218 nmdc:mga0rr50_80686_c1
4219 nmdc:mga08x19_147225_c1
4220 nmdc:mga08x19_25457_c1
4221 nmdc:mga0a205_312544_c1
4222 nmdc:mga0a205_331783_c1
4223 nmdc:mga0a205_3868_c1
4224 nmdc:mga0a205_438473_c1
4225 nmdc:mga0a205_8456_c1
4226 Ga0495601_0010336
4227 Ga0495601_0013881
4228 Ga0495601_0063437
4229 Ga0500610_0000737
4230 Ga0495595_0023181
4231 Ga0495619_0048350
4232 Ga0495619_0058679
4233 Ga0495619_0112164
4234 Ga0500641_0019869
4235 Ga0500556_0000442
4236 Ga0500594_0031812
4237 Ga0500595_004294
4238 Ga0500607_037246
4239 Ga0500617_076143
4240 Ga0500618_000965
4241 Ga0500618_001599
4242 Ga0500652_044821
4243 Ga0500658_0007263
4244 Ga0500586_000082
4245 Ga0500588_0004325
4246 Ga0500588_0011465
4247 Ga0500589_094792
4248 Ga0500622_0009746
4249 Ga0500634_0026773
4250 Ga0500636_0000369
4251 Ga0500637_0001512
4252 Ga0500637_0025044
4253 Ga0500656_007160
4254 Ga0501084_0001292
4255 Ga0501084_0005101
4256 Ga0501084_0012672
4257 Ga0501084_0045939
4258 Ga0501084_0079860
4259 Ga0501084_0121784
4260 Ga0501082_0009014
4261 Ga0501082_0011508
4262 Ga0501082_0058549
4263 Ga0501082_0065570
4264 Ga0501082_0179140
4265 Ga0466962_0001556
4266 Ga0466962_0004761
4267 Ga0466962_0051937
4268 Ga0530510_0001249
4269 Ga0530510_0003476
4270 Ga0530510_0006355
4271 Ga0530510_0007480
4272 Ga0530510_0151846
4273 Ga0530510_0243398
4274 2501071044
4275 2501078765
4276 2501413916
4277 2509130198
4278 2510252157
4279 2511089410
4280 2511094820
4281 2511104519
4282 2511248143
4283 2511387018
4284 2513551629
4285 2513563805
4286 2513954086
4287 2513963084
4288 2514040213
4289 2514047533
4290 2515682696
4291 2515691270
4292 2516017028
4293 2519459604
4294 2521556771
4295 2550697282
4296 2553004537
4297 2585291189
4298 2600814591
4299 2601670644
4300 2644027893
4301 2644059880
4302 2644074499
4303 2644250888
4304 2644356307
4305 2644644580
4306 2691331001
4307 2738739051
4308 2738846283
4309 2739275068
4310 2739344112
4311 2765567963
4312 2792840267
4313 2808943045
4314 2808983813
4315 2809129485
4316 2809149460
4317 2817261882
4318 2817279586
4319 2817454338
4320 2819542989
4321 2819592493
4322 2819618620
4323 2821134042
4324 2839097747
4325 2846037039
4326 2846040170
4327 2846542968
4328 2852619607
4329 2856292254
4330 2857365768
4331 2857548011
4332 2857556502
4333 2858696555
4334 2883094783
4335 2884814660
4336 2884839019
4337 2884855310
4338 2885080732
4339 2885273964
4340 2887632750
4341 2894024515
4342 2894510783
4343 2896159183
4344 2902687255
4345 2904429152
4346 2904440652
4347 2904535756
4348 2904586083
4349 2904592104
4350 2904601739
4351 2919049575
4352 2919084806
4353 2919480736
4354 2919493882
4355 2919499364
4356 2919534562
4357 2919545763
4358 2923515363
4359 2923527471
4360 2928132422
4361 2932412602
4362 2932420117
4363 2998348351
4364 639788380
4365 644746875
4366 8003960505
4367 8020808261
4368 8040169009
4369 8040179290

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02899

Phage_int_SAM_1

Phage integrase, N-terminal SAM-like domain

66

148

0.99

PF00589

Phage_integrase

Phage integrase family

169

343

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nrw-assembly1.cif.gz_A crystal structure of the n-terminal domain of phage integrase/site-specific recombinase (tnp) from haloarcula marismortui, northeast structural genomics consortium target hmr208a 0.8855 29 125
6wat-assembly14.cif.gz_NC complex structure of phf1 0.8218 163 184
3nrw-assembly1.cif.gz_A crystal structure of the n-terminal domain of phage integrase/site-specific recombinase (tnp) from haloarcula marismortui, northeast structural genomics consortium target hmr208a 0.8154 29 125
2kd1-assembly1.cif.gz_A solution nmr structure of the integrase-like domain from bacillus cereus ordered locus bc_1272. northeast structural genomics consortium target bcr268f 0.8133 29 130
8h43-assembly3.cif.gz_C crystal structure of phf1 tudor domain in complex with hit 1 0.8066 163 184
ID Description Score Start End Superfamily
af_P0A8P6_5_99_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9579 29 119 1.10.150.130
af_Q2FY74_2_96_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9375 27 119 1.10.150.130
af_P9WF35_2_96_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9295 27 121 1.10.150.130
af_Q2FZ30_3_95_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9277 29 119 1.10.150.130
1a0pA01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9229 29 122 1.10.150.130
ID Description Score Start End GO Terms
AF-A0A448QXK0-F1-model_v4 deleted 0.9874 133 198
AF-A0A3B8PAE6-F1-model_v4 deleted 0.9835 29 119
AF-A0A090SYA2-F1-model_v4 Tyrosine recombinase XerD 0.9514 28 128 GO:0003677
GO:0015074
AF-A0A846KK45-F1-model_v4 deleted 0.9331 130 227
AF-X1IKC8-F1-model_v4 Tyr recombinase domain-containing protein 0.9317 134 238 GO:0003677
GO:0006310
GO:0015074

Map