F496529

General Info

Members Datasets Scaffolds Average Seq Length
2190 921 1831 313

Family's Representative Sequence

Representative Sequence 3300046664|Ga0495659_0030392|Ga0495659_0030392_398_1462
Length 354
Sequence MRSIEPGISRFPDAQLRIFGLVLAHHPGMTKGSDAQMTKLTAQAAGTFAIAPTPFHDDGRIDEKSIDRLTDFYAEVGCDGVTVLGILGEAPKLDAAEAEQVAVRFVKRAKNMQIIVGVSAPGFATMRSLAKASMDAGAAGVMIAPPPHLRTDDQITGYFKQAQEAIGDEIPWVLQDYPLTLNVIFTPAVIRKIVMDSPSCVMLKHEDWPGLEKISTLRGFQKDGSLKPMSILVGNGGLFLDFEMERGADGAMTGYAFPELLIDVVKLSKAGKRDAAHDLFDAHLPLIRYEQQPGAGLAVRKHVLQKRGIISSSAQRKPGATITATAKAEVDYLLSRVARVDRRANLQPQSSAAG

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
6 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
7 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
8 2511231024 Pseudomonas sp. GM84 Isolate Nodule
9 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
10 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
11 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
12 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
13 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
14 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
15 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
16 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
17 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
18 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
19 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
20 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
21 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
22 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
23 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
24 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
25 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
26 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
27 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
28 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
29 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
30 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
31 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
32 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
33 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
34 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
35 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
36 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
37 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
38 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
39 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
40 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
41 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
42 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
43 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
44 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
45 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
46 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
47 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
48 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
49 2643221557 Ensifer sp. Root558 Isolate Unclassified
50 2643221558 Rhizobium sp. Root149 Isolate Unclassified
51 2643221569 Achromobacter sp. Root565 Isolate Unclassified
52 2643221599 Rhizobium sp. Root708 Isolate Unclassified
53 2643221610 Ensifer sp. Root74 Isolate Unclassified
54 2643221618 Ensifer sp. Root231 Isolate Unclassified
55 2643221621 Achromobacter sp. Root83 Isolate Unclassified
56 2643221651 Afipia sp. Root123D2 Isolate Unclassified
57 2643221655 Ensifer sp. Root1252 Isolate Unclassified
58 2643221668 Ensifer sp. Root423 Isolate Unclassified
59 2643221675 Ensifer sp. Root1298 Isolate Unclassified
60 2643221680 Ensifer sp. Root1312 Isolate Unclassified
61 2643221712 Ensifer sp. Root258 Isolate Unclassified
62 2643221723 Ensifer sp. Root278 Isolate Unclassified
63 2643221726 Ensifer sp. Root954 Isolate Unclassified
64 2643221733 Bosea sp. Root381 Isolate Unclassified
65 2643221734 Bosea sp. Root670 Isolate Unclassified
66 2643221736 Bosea sp. Root483D1 Isolate Unclassified
67 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
68 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
69 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
70 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
71 2738541277 Variovorax sp. GV051 Isolate Unclassified
72 2738541293 Rhizobium sp. GV031 Isolate Unclassified
73 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
74 2738543019 Variovorax sp. GV040 Isolate Unclassified
75 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
76 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
77 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
78 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
79 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
80 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
81 2791355199
82 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
83 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
84 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
85 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
86 2818991467 Bosea vestrisii 3192 Isolate Unclassified
87 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
88 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
89 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
90 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
91 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
92 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
93 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
94 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
95 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
96 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
97 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
98 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
99 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
100 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
101 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
102 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
103 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
104 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
105 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
106 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
107 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
108 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
109 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
110 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
111 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
112 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
113 2841760612 Bosea sp. Tri-49 Isolate Nodule
114 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
115 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
116 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
117 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
118 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
119 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
120 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
121 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
122 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
123 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
124 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
125 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
126 2842694124 Methylopila sp. R-72369 Isolate Unclassified
127 2844104063 Bosea sp. Tri-39 Isolate Nodule
128 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
129 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
130 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
131 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
132 2851182111 Bosea sp. Tri-44 Isolate Nodule
133 2851246043 Bosea sp. Tri-54 Isolate Nodule
134 2855730933 Achromobacter sp. HZ28 Isolate Nodule
135 2855767633 Achromobacter sp. HZ34 Isolate Nodule
136 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
137 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
138 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
139 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
140 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
141 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
142 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
143 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
144 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
145 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
146 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
147 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
148 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
149 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
150 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
151 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
152 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
153 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
154 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
155 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
156 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
157 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
158 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
159 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
160 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
161 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
162 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
163 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
164 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
165 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
166 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
167 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
168 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
169 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
170 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
171 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
172 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
173 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
174 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
175 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
176 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
177 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
178 2904699407
179 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
180 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
181 2906610324
182 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
183 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
184 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
185 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
186 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
187 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
188 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
189 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
190 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
191 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
192 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
193 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
194 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
195 2922368715
196 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
197 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
198 2922425934
199 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
200 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
201 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
202 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
203 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
204 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
205 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
206 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
207 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
208 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
209 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
210 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
211 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
212 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
213 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
214 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
215 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
216 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
217 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
218 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
219 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
220 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
221 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
222 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
223 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
224 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
225 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
226 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
227 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
228 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
229 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
230 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
231 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
232 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
233 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
234 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
235 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
236 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
237 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
238 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
239 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
240 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
241 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
242 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
243 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
244 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
245 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
246 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
247 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
248 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
249 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
250 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
251 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
252 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
253 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
254 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
255 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
256 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
257 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
258 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
259 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
260 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
261 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
262 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
263 2941479691
264 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
265 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
266 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
267 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
268 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
269 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
270 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
271 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
272 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
273 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
274 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
275 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
276 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
277 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
278 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
279 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
280 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
281 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
282 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
283 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
284 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
285 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
286 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
287 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
288 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
289 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
290 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
291 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
292 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
293 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
294 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
295 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
296 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
297 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
298 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
299 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
300 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
301 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
302 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
303 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
304 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
305 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
306 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
307 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
308 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
309 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
310 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
311 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
312 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
313 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
314 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
315 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
316 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
317 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
318 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
319 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
320 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
321 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
322 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
323 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
324 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
325 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
326 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
327 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
328 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
329 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
330 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
331 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
332 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
333 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
334 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
335 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
336 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
337 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
338 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
339 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
340 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
341 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
342 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
343 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
344 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
345 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
346 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
347 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
348 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
349 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
350 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
351 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
352 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
353 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
354 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
355 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
356 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
357 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
358 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
359 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
360 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
361 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
362 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
363 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
364 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
365 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
366 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
367 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
368 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
369 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
370 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
371 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
372 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
373 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
374 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
375 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
376 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
377 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
378 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
379 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
380 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
381 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
382 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
383 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
384 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
385 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
386 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
387 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
388 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
389 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
390 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
391 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
392 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
393 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
394 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
395 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
396 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
397 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
398 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
399 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
400 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
401 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
402 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
403 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
404 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
405 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
406 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
407 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
408 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
409 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
410 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
411 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
412 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
413 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
414 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
415 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
416 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
417 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
418 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
419 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
420 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
421 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
422 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
423 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
424 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
425 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
426 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
427 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
428 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
429 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
430 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
431 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
432 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
433 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
434 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
435 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
436 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
437 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
438 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
439 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
440 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
441 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
442 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
443 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
444 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
445 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
446 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
447 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
448 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
449 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
450 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
451 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
452 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
453 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
454 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
455 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
456 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
457 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
458 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
459 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
460 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
461 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
462 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
463 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
464 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
465 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
466 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
467 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
468 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
469 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
470 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
471 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
472 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
473 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
474 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
475 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
476 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
477 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
478 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
479 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
480 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
481 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
482 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
483 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
484 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
485 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
486 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
487 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
488 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
489 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
490 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
491 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
492 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
493 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
494 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
495 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
496 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
497 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
498 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
499 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
500 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
501 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
502 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
503 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
504 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
505 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
506 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
507 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
508 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
509 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
510 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
511 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
512 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
513 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
514 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
515 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
516 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
517 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
518 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
519 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
520 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
521 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
522 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
523 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
524 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
525 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
526 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
527 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
528 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
529 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
530 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
531 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
532 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
533 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
534 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
535 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
536 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
537 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
538 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
539 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
540 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
541 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
542 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
543 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
544 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
545 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
546 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
547 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
548 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
549 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
550 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
551 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
553 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
554 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
555 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
556 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
557 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
558 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
559 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
560 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
561 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
562 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
563 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
564 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
565 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
566 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
567 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
568 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
569 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
570 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
571 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
572 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
573 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
574 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
575 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
576 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
577 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
578 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
579 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
580 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
581 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
582 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
583 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
584 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
585 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
586 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
587 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
588 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
589 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
590 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
591 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
592 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
593 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
594 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
595 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
596 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
597 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
598 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
599 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
600 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
601 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
602 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
603 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
604 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
605 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
606 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
607 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
608 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
609 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
610 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
611 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
612 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
613 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
614 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
615 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
616 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
617 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
618 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
619 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
620 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
621 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
622 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
623 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
624 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
625 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
626 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
627 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
628 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
629 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
630 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
631 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
632 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
633 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
634 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
635 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
636 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
637 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
638 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
639 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
640 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
641 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
642 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
643 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
644 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
645 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
646 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
647 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
648 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
649 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
650 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
651 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
652 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
653 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
654 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
655 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
656 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
657 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
658 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
659 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
660 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
661 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
662 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
663 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
664 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
665 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
666 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
667 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
668 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
669 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
670 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
671 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
672 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
673 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
674 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
675 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
676 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
677 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
678 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
679 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
680 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
681 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
682 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
683 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
684 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
685 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
686 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
687 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
688 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
689 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
690 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
691 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
692 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
693 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
694 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
695 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
696 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
697 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
698 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
699 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
700 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
701 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
702 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
703 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
704 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
705 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
706 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
707 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
708 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
709 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
710 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
711 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
712 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
713 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
714 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
715 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
716 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
717 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
718 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
719 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
720 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
721 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
722 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
723 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
724 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
725 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
726 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
727 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
728 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
729 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
730 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
731 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
732 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
733 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
734 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
735 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
736 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
737 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
738 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
739 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
740 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
741 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
742 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
743 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
744 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
745 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
746 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
747 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
748 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
749 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
750 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
751 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
752 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
753 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
754 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
755 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
756 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
757 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
758 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
759 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
760 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
761 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
762 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
763 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
764 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
765 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
766 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
767 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
768 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
769 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
770 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
771 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
772 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
773 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
774 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
775 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
776 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
777 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
778 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
779 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
780 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
781 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
782 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
783 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
784 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
785 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
786 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
787 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
788 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
789 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
790 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
791 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
792 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
793 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
794 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
795 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
796 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
797 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
798 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
799 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
800 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
801 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
802 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
803 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
804 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
805 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
806 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
807 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
808 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
809 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
810 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
811 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
812 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
813 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
814 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
815 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
816 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
817 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
818 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
819 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
820 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
821 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
822 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
823 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
824 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
825 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
826 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
827 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
828 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
829 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
830 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
831 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
832 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
833 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
834 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
835 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
836 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
837 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
838 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
839 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
840 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
841 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
842 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
843 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
844 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
845 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
846 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
847 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
848 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
849 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
850 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
851 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
852 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
853 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
854 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
855 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
856 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
857 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
858 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
859 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
860 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
861 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
862 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
863 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
864 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
865 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
866 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
867 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
868 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
869 641522639 Methylobacterium sp. 4-46 Isolate Nodule
870 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
871 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
872 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
873 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
874 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
875 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
876 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
877 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
878 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
879 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
880 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
881 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
882 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
883 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
884 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
885 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
886 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
887 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
888 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
889 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
890 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
891 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
892 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
893 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
894 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
895 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
896 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
897 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
898 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
899 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
900 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
901 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
902 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
903 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
904 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
905 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
906 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
907 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
908 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
909 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
910 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
911 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
912 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
913 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
914 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
915 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
916 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
917 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
918 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
919 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
920 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
921 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.48
Metatranscriptomes 0.32
Isolates 16.2

Biome Distribution

Category Percentage (%)
Aerial Root 0.05
Bulb 0
Endosphere 15.8
Nodule 10.64
Rhizoplane 3.7
Rhizosphere 56.3
Stem 0
Stem Tuber 0
Unclassified 13.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C2224 2010549000 Bacteria 1121
2 JGI25152J39213_1000093 3300002773 Bacteria 62826
3 JGI25152J39213_1004057 3300002773 Bacteria 4765
4 JGI25152J39213_1004574 3300002773 Bacteria 4311
5 JGI25150J39212_1000045 3300002774 Bacteria 80164
6 JGI25159J45721_1014777 3300002987 Bacteria 1742
7 JGI25151J46595_10000023 3300003187 Bacteria 221548
8 JGI25151J46595_10000072 3300003187 Bacteria 136769
9 JGI25151J46595_10001720 3300003187 Bacteria 14296
10 JGI25151J46595_10004869 3300003187 Bacteria 7013
11 JGI25406J46586_10001179 3300003203 Bacteria 12300
12 JGI25406J46586_10004585 3300003203 Bacteria 6433
13 JGI25406J46586_10021358 3300003203 Bacteria 2599
14 JGI25165J46597_1000020 3300003214 Bacteria 370477
15 JGI25165J46597_1005560 3300003214 Bacteria 2406
16 JGI25153J46596_10000964 3300003215 Bacteria 17430
17 JGI25153J46596_10004272 3300003215 Bacteria 7726
18 JGI25153J46596_10014750 3300003215 Bacteria 3229
19 JGI25153J46596_10028068 3300003215 Bacteria 1959
20 rootH1_10111778 3300003316 Bacteria 2916
21 rootL2_10130353 3300003322 Bacteria 2078
22 rootH1_10252891 3300003323 Bacteria 1581
23 JGI25160J50197_1006435 3300003354 Bacteria 4755
24 JGI25160J50197_1009006 3300003354 Bacteria 3744
25 JGI25161J50226_1000294 3300003374 Bacteria 28171
26 JGI25161J50226_1000364 3300003374 Bacteria 23227
27 JGI25404J52841_10006257 3300003659 Bacteria 2485
28 JGI25404J52841_10022839 3300003659 Bacteria 1351
29 JGI25404J52841_10023380 3300003659 Bacteria 1334
30 JGI25404J52841_10024164 3300003659 Bacteria 1310
31 Ga0055526_1000062 3300003771 Bacteria 104151
32 Ga0055526_1000090 3300003771 Bacteria 83051
33 Ga0055526_1002908 3300003771 Bacteria 11255
34 Ga0055526_1014612 3300003771 Bacteria 3214
35 Ga0055524_1000011 3300003775 Bacteria 261442
36 Ga0055524_1000096 3300003775 Bacteria 108231
37 Ga0055524_1005532 3300003775 Bacteria 5617
38 Ga0055524_1007856 3300003775 Bacteria 4488
39 Ga0055524_1016057 3300003775 Bacteria 2703
40 Ga0055524_1025756 3300003775 Bacteria 1834
41 Ga0055536_1004861 3300003781 Bacteria 6710
42 Ga0055534_1012482 3300003784 Bacteria 1675
43 Ga0055528_1000273 3300003790 Bacteria 43784
44 Ga0055528_1002163 3300003790 Bacteria 10793
45 Ga0055530_10018243 3300003791 Bacteria 2171
46 Ga0055540_1000705 3300003792 Bacteria 23016
47 Ga0055540_1007605 3300003792 Bacteria 4050
48 Ga0055540_1011777 3300003792 Bacteria 2793
49 Ga0055531_10007706 3300003794 Bacteria 5816
50 Ga0055531_10024694 3300003794 Bacteria 2207
51 Ga0058692_1000083 3300003856 Bacteria 66222
52 Ga0058692_1000334 3300003856 Bacteria 23353
53 Ga0055543_1000031 3300004625 Bacteria 130583
54 Ga0055543_1005787 3300004625 Bacteria 3099
55 Ga0065165_1000146 3300005262 Bacteria 122774
56 Ga0065165_1000384 3300005262 Bacteria 71731
57 Ga0065165_1001478 3300005262 Bacteria 25070
58 Ga0065165_1015769 3300005262 Bacteria 2865
59 Ga0065165_1049491 3300005262 Bacteria 1201
60 Ga0065712_10101729 3300005290 Bacteria 2026
61 Ga0065707_10083063 3300005295 Bacteria 10637
62 Ga0070658_10046430 3300005327 Bacteria 3514
63 Ga0070658_10077434 3300005327 Bacteria 2728
64 Ga0070658_10460442 3300005327 Bacteria 1096
65 Ga0070683_100141803 3300005329 Bacteria 2277
66 Ga0070683_100348744 3300005329 Bacteria 1410
67 Ga0070670_100020910 3300005331 Bacteria 5629
68 Ga0070670_100054773 3300005331 Bacteria 3424
69 Ga0070670_100059448 3300005331 Bacteria 3281
70 Ga0068869_100116788 3300005334 Bacteria 2036
71 Ga0070680_100003612 3300005336 Bacteria 11550
72 Ga0070680_100006838 3300005336 Bacteria 8693
73 Ga0070680_100290426 3300005336 Bacteria 1386
74 Ga0068868_100027083 3300005338 Bacteria 4371
75 Ga0068868_100051682 3300005338 Bacteria 3234
76 Ga0068868_100095597 3300005338 Bacteria 2399
77 Ga0068868_100181172 3300005338 Bacteria 1748
78 Ga0070660_100000712 3300005339 Bacteria 22019
79 Ga0070660_100105000 3300005339 Bacteria 2241
80 Ga0070660_100406332 3300005339 Bacteria 1126
81 Ga0070661_100040992 3300005344 Bacteria 3378
82 Ga0070668_100126453 3300005347 Bacteria 2048
83 Ga0070668_100323250 3300005347 Bacteria 1299
84 Ga0070675_100004539 3300005354 Bacteria 10598
85 Ga0070675_100004711 3300005354 Bacteria 10413
86 Ga0070671_100373939 3300005355 Unclassified 1217
87 Ga0070674_100002295 3300005356 Bacteria 10558
88 Ga0070674_100045491 3300005356 Bacteria 2999
89 Ga0070674_100069140 3300005356 Bacteria 2490
90 Ga0070673_100002654 3300005364 Bacteria 10944
91 Ga0070659_100032961 3300005366 Bacteria 4023
92 Ga0070659_100176657 3300005366 Bacteria 1751
93 Ga0070667_100046864 3300005367 Bacteria 3637
94 Ga0070667_100097327 3300005367 Bacteria 2538
95 Ga0070667_100154440 3300005367 Bacteria 2018
96 Ga0070667_100450903 3300005367 Bacteria 1175
97 Ga0070709_10000551 3300005434 Bacteria 21925
98 Ga0070709_10039200 3300005434 Bacteria 2906
99 Ga0070709_10145883 3300005434 Bacteria 1631
100 Ga0070714_100006459 3300005435 Bacteria 9056
101 Ga0070714_100078545 3300005435 Bacteria 2868
102 Ga0070714_100138246 3300005435 Bacteria 2184
103 Ga0070714_100331329 3300005435 Bacteria 1426
104 Ga0070714_100520002 3300005435 Bacteria 1137
105 Ga0070713_100012869 3300005436 Bacteria 6154
106 Ga0070713_100024691 3300005436 Bacteria 4687
107 Ga0070713_100048830 3300005436 Bacteria 3487
108 Ga0070713_100071444 3300005436 Bacteria 2933
109 Ga0070713_100215848 3300005436 Bacteria 1739
110 Ga0070713_100320719 3300005436 Bacteria 1431
111 Ga0070710_10001238 3300005437 Bacteria 12107
112 Ga0070710_10001820 3300005437 Bacteria 10067
113 Ga0070710_10014322 3300005437 Bacteria 3990
114 Ga0070711_100002350 3300005439 Bacteria 10755
115 Ga0070711_100003473 3300005439 Bacteria 9187
116 Ga0070711_100161009 3300005439 Bacteria 1701
117 Ga0070700_100226215 3300005441 Bacteria 1329
118 Ga0070708_100040043 3300005445 Bacteria 4103
119 Ga0070708_100098574 3300005445 Bacteria 2672
120 Ga0070708_100199091 3300005445 Bacteria 1875
121 Ga0070663_100020630 3300005455 Bacteria 4365
122 Ga0070663_100100803 3300005455 Bacteria 2154
123 Ga0070663_100129121 3300005455 Bacteria 1917
124 Ga0070663_100132501 3300005455 Bacteria 1894
125 Ga0070663_100173848 3300005455 Bacteria 1666
126 Ga0070678_100084994 3300005456 Bacteria 2410
127 Ga0070662_100118532 3300005457 Bacteria 2026
128 Ga0070662_100425940 3300005457 Bacteria 1098
129 Ga0070681_10069947 3300005458 Bacteria 3475
130 Ga0070681_10103948 3300005458 Bacteria 2783
131 Ga0068867_100001776 3300005459 Bacteria 14990
132 Ga0068867_100002021 3300005459 Bacteria 14179
133 Ga0068867_100021615 3300005459 Bacteria 4592
134 Ga0070706_100099702 3300005467 Bacteria 2699
135 Ga0070707_100009136 3300005468 Bacteria 9192
136 Ga0070698_100036324 3300005471 Bacteria 5090
137 Ga0070699_100269399 3300005518 Bacteria 1524
138 Ga0070699_100374399 3300005518 Unclassified 1285
139 Ga0070679_100022733 3300005530 Bacteria 6131
140 Ga0070679_100038790 3300005530 Bacteria 4736
141 Ga0070679_100089045 3300005530 Bacteria 3073
142 Ga0070679_100121386 3300005530 Unclassified 2598
143 Ga0070679_100407730 3300005530 Bacteria 1305
144 Ga0070684_100054319 3300005535 Bacteria 3490
145 Ga0070684_100328729 3300005535 Bacteria 1405
146 Ga0070697_100002285 3300005536 Bacteria 14708
147 Ga0068853_100057773 3300005539 Bacteria 3349
148 Ga0068853_100072650 3300005539 Bacteria 2998
149 Ga0068853_100139930 3300005539 Bacteria 2172
150 Ga0068853_100494938 3300005539 Bacteria 1154
151 Ga0070672_100001907 3300005543 Bacteria 13071
152 Ga0070672_100005394 3300005543 Bacteria 8468
153 Ga0070672_100114902 3300005543 Bacteria 2198
154 Ga0070672_100151643 3300005543 Bacteria 1918
155 Ga0070696_100142431 3300005546 Bacteria 1753
156 Ga0070665_100044294 3300005548 Bacteria 4469
157 Ga0070665_100046013 3300005548 Bacteria 4383
158 Ga0070665_100082828 3300005548 Bacteria 3213
159 Ga0070665_100272492 3300005548 Bacteria 1694
160 Ga0070665_100368380 3300005548 Bacteria 1443
161 Ga0070665_100380040 3300005548 Bacteria 1420
162 Ga0068855_100015850 3300005563 Bacteria 9067
163 Ga0068855_100021411 3300005563 Bacteria 7753
164 Ga0068855_100032479 3300005563 Bacteria 6232
165 Ga0068855_100064535 3300005563 Bacteria 4270
166 Ga0068855_100130991 3300005563 Bacteria 2864
167 Ga0068855_100155871 3300005563 Bacteria 2595
168 Ga0068855_100183174 3300005563 Bacteria 2367
169 Ga0068855_100228906 3300005563 Bacteria 2082
170 Ga0068855_100653046 3300005563 Bacteria 1129
171 Ga0070664_100202560 3300005564 Bacteria 1771
172 Ga0068857_100117621 3300005577 Bacteria 2392
173 Ga0068856_100000680 3300005614 Bacteria 36872
174 Ga0068856_100416396 3300005614 Bacteria 1364
175 Ga0070702_100094948 3300005615 Bacteria 1816
176 Ga0068852_100000134 3300005616 Bacteria 49788
177 Ga0068852_100002663 3300005616 Bacteria 12346
178 Ga0068852_100334862 3300005616 Bacteria 1473
179 Ga0068859_100024084 3300005617 Bacteria 6109
180 Ga0068859_100184886 3300005617 Bacteria 2167
181 Ga0068859_100255239 3300005617 Bacteria 1844
182 Ga0068859_100313387 3300005617 Bacteria 1663
183 Ga0068859_100346401 3300005617 Bacteria 1580
184 Ga0068864_100080180 3300005618 Bacteria 2859
185 Ga0068861_100043821 3300005719 Bacteria 3361
186 Ga0068861_100196607 3300005719 Bacteria 1690
187 Ga0068861_100239575 3300005719 Bacteria 1542
188 Ga0068861_100286196 3300005719 Bacteria 1421
189 Ga0068861_100428911 3300005719 Bacteria 1180
190 Ga0068851_10014696 3300005834 Bacteria 3720
191 Ga0068851_10098127 3300005834 Bacteria 1551
192 Ga0068863_100067022 3300005841 Bacteria 3396
193 Ga0068863_100230221 3300005841 Bacteria 1787
194 Ga0068863_100285967 3300005841 Bacteria 1598
195 Ga0068863_100572368 3300005841 Bacteria 1116
196 Ga0068858_100045095 3300005842 Bacteria 4085
197 Ga0068858_100050616 3300005842 Bacteria 3845
198 Ga0068858_100073406 3300005842 Bacteria 3175
199 Ga0068858_100104515 3300005842 Bacteria 2642
200 Ga0068860_100000258 3300005843 Bacteria 77761
201 Ga0068860_100003477 3300005843 Bacteria 16211
202 Ga0068860_100270797 3300005843 Bacteria 1657
203 Ga0068860_100463404 3300005843 Unclassified 1261
204 Ga0068862_100032793 3300005844 Bacteria 4387
205 Ga0068862_100063701 3300005844 Bacteria 3172
206 Ga0081455_10000992 3300005937 Bacteria 36052
207 Ga0081455_10014642 3300005937 Bacteria 7670
208 Ga0081455_10077075 3300005937 Bacteria 2744
209 Ga0081455_10113926 3300005937 Bacteria 2143
210 Ga0081538_10043613 3300005981 Bacteria 2812
211 Ga0081538_10054608 3300005981 Bacteria 2361
212 Ga0081540_1001447 3300005983 Bacteria 20522
213 Ga0081540_1003602 3300005983 Bacteria 12156
214 Ga0081540_1010266 3300005983 Bacteria 6358
215 Ga0081540_1013011 3300005983 Bacteria 5435
216 Ga0081540_1017968 3300005983 Bacteria 4358
217 Ga0081540_1029167 3300005983 Bacteria 3080
218 Ga0081540_1042958 3300005983 Bacteria 2325
219 Ga0081540_1050922 3300005983 Bacteria 2052
220 Ga0081540_1058311 3300005983 Bacteria 1860
221 Ga0081540_1067104 3300005983 Bacteria 1678
222 Ga0081540_1089783 3300005983 Bacteria 1355
223 Ga0081539_10000140 3300005985 Bacteria 166746
224 Ga0081539_10000259 3300005985 Bacteria 121997
225 Ga0081539_10000897 3300005985 Bacteria 56772
226 Ga0081539_10008354 3300005985 Bacteria 9047
227 Ga0081539_10087407 3300005985 Bacteria 1619
228 Ga0070717_10012420 3300006028 Bacteria 6494
229 Ga0070717_10038867 3300006028 Bacteria 3869
230 Ga0070717_10225358 3300006028 Bacteria 1649
231 Ga0070717_10286247 3300006028 Bacteria 1462
232 Ga0070717_10386289 3300006028 Bacteria 1256
233 Ga0075365_10006531 3300006038 Bacteria 6424
234 Ga0075365_10020374 3300006038 Bacteria 4111
235 Ga0075365_10023183 3300006038 Bacteria 3901
236 Ga0075365_10032401 3300006038 Bacteria 3359
237 Ga0075365_10042363 3300006038 Bacteria 2976
238 Ga0075365_10079692 3300006038 Bacteria 2216
239 Ga0075365_10085484 3300006038 Bacteria 2143
240 Ga0075365_10098835 3300006038 Bacteria 1997
241 Ga0075365_10171676 3300006038 Bacteria 1513
242 Ga0075365_10240706 3300006038 Bacteria 1271
243 Ga0075368_10016033 3300006042 Bacteria 2787
244 Ga0075368_10028860 3300006042 Bacteria 2144
245 Ga0075368_10031789 3300006042 Bacteria 2048
246 Ga0075368_10092647 3300006042 Bacteria 1236
247 Ga0075363_100045141 3300006048 Bacteria 2336
248 Ga0075363_100090159 3300006048 Bacteria 1686
249 Ga0075364_10000193 3300006051 Bacteria 28203
250 Ga0075364_10008004 3300006051 Bacteria 6299
251 Ga0075364_10010568 3300006051 Bacteria 5581
252 Ga0075364_10034528 3300006051 Bacteria 3264
253 Ga0075364_10046887 3300006051 Bacteria 2814
254 Ga0075364_10108093 3300006051 Bacteria 1855
255 Ga0075364_10137155 3300006051 Bacteria 1644
256 Ga0075364_10267926 3300006051 Bacteria 1161
257 Ga0070715_10054192 3300006163 Bacteria 1736
258 Ga0070712_100027212 3300006175 Bacteria 3816
259 Ga0070712_100028983 3300006175 Bacteria 3708
260 Ga0075362_10013075 3300006177 Bacteria 3313
261 Ga0075367_10002507 3300006178 Bacteria 8416
262 Ga0075367_10162643 3300006178 Bacteria 1388
263 Ga0075369_10005702 3300006186 Bacteria 4671
264 Ga0075369_10009035 3300006186 Bacteria 3857
265 Ga0075369_10021073 3300006186 Bacteria 2675
266 Ga0075369_10037856 3300006186 Bacteria 2056
267 Ga0075366_10015710 3300006195 Bacteria 4344
268 Ga0097621_100006967 3300006237 Bacteria 8050
269 Ga0097621_100008135 3300006237 Bacteria 7541
270 Ga0097621_100068270 3300006237 Bacteria 2931
271 Ga0097621_100188828 3300006237 Bacteria 1783
272 Ga0075370_10051959 3300006353 Bacteria 2325
273 Ga0075370_10053554 3300006353 Bacteria 2290
274 Ga0075370_10085010 3300006353 Bacteria 1821
275 Ga0075370_10209295 3300006353 Bacteria 1151
276 Ga0068871_100055704 3300006358 Bacteria 3211
277 Ga0068871_100185980 3300006358 Bacteria 1787
278 Ga0068871_100309432 3300006358 Bacteria 1388
279 Ga0075428_100003153 3300006844 Bacteria 18000
280 Ga0075428_100318846 3300006844 Bacteria 1670
281 Ga0075430_100007426 3300006846 Bacteria 9257
282 Ga0075430_100075877 3300006846 Bacteria 2818
283 Ga0075430_100100344 3300006846 Bacteria 2418
284 Ga0075430_100280033 3300006846 Bacteria 1380
285 Ga0075431_100002020 3300006847 Bacteria 19367
286 Ga0075431_100003055 3300006847 Bacteria 16202
287 Ga0075431_100018467 3300006847 Bacteria 7102
288 Ga0075431_100045239 3300006847 Bacteria 4538
289 Ga0075431_100140002 3300006847 Bacteria 2494
290 Ga0075433_10000430 3300006852 Bacteria 26976
291 Ga0075434_100027927 3300006871 Bacteria 5539
292 Ga0075434_100249559 3300006871 Bacteria 1794
293 Ga0075429_100003574 3300006880 Bacteria 13245
294 Ga0075429_100003704 3300006880 Bacteria 13027
295 Ga0075429_100004847 3300006880 Bacteria 11594
296 Ga0075429_100149183 3300006880 Bacteria 2047
297 Ga0075429_100211156 3300006880 Bacteria 1701
298 Ga0068865_100002268 3300006881 Bacteria 11318
299 Ga0068865_100032138 3300006881 Bacteria 3504
300 Ga0068865_100119716 3300006881 Bacteria 1955
301 Ga0068865_100195342 3300006881 Bacteria 1568
302 Ga0075436_100000875 3300006914 Bacteria 19991
303 Ga0097620_100024082 3300006931 Bacteria 6109
304 Ga0097620_100184881 3300006931 Bacteria 2167
305 Ga0097620_100255245 3300006931 Bacteria 1844
306 Ga0097620_100313373 3300006931 Bacteria 1663
307 Ga0097620_100346440 3300006931 Bacteria 1580
308 Ga0099825_1025546 3300006941 Bacteria 3272
309 Ga0099825_1034052 3300006941 Bacteria 1925
310 Ga0099824_1007709 3300006942 Bacteria 14129
311 Ga0099824_1009535 3300006942 Bacteria 11905
312 Ga0099822_1037622 3300006943 Bacteria 2930
313 Ga0099822_1044439 3300006943 Bacteria 2196
314 Ga0099794_10019289 3300007265 Bacteria 3069
315 Ga0099794_10033765 3300007265 Bacteria 2406
316 Ga0105240_10002310 3300009093 Bacteria 30856
317 Ga0105240_10005407 3300009093 Bacteria 19043
318 Ga0105240_10027925 3300009093 Bacteria 7381
319 Ga0105240_10030542 3300009093 Bacteria 7002
320 Ga0105240_10105135 3300009093 Bacteria 3427
321 Ga0105240_10201312 3300009093 Bacteria 2333
322 Ga0111539_10114563 3300009094 Bacteria 3162
323 Ga0111539_10195008 3300009094 Bacteria 2362
324 Ga0105245_10011198 3300009098 Bacteria 7806
325 Ga0105245_10087602 3300009098 Bacteria 2858
326 Ga0114129_10000065 3300009147 Bacteria 94355
327 Ga0114129_10001450 3300009147 Bacteria 32002
328 Ga0114129_10006174 3300009147 Bacteria 16999
329 Ga0114129_10016131 3300009147 Bacteria 10629
330 Ga0114129_10025555 3300009147 Bacteria 8367
331 Ga0114129_10078313 3300009147 Bacteria 4598
332 Ga0114129_11134639 3300009147 Bacteria 977
333 Ga0105243_10000028 3300009148 Bacteria 190789
334 Ga0105243_10000106 3300009148 Bacteria 95432
335 Ga0105243_10094929 3300009148 Bacteria 2464
336 Ga0105241_10041926 3300009174 Bacteria 3460
337 Ga0105241_10094937 3300009174 Bacteria 2360
338 Ga0105241_10373718 3300009174 Bacteria 1243
339 Ga0105242_10000184 3300009176 Bacteria 47750
340 Ga0105242_10012090 3300009176 Bacteria 6641
341 Ga0105242_10026716 3300009176 Bacteria 4577
342 Ga0105242_10635877 3300009176 Bacteria 1036
343 Ga0105248_10065071 3300009177 Bacteria 4093
344 Ga0105248_10337987 3300009177 Bacteria 1695
345 Ga0105237_10002162 3300009545 Bacteria 24710
346 Ga0105237_10025732 3300009545 Bacteria 6017
347 Ga0105237_10042104 3300009545 Bacteria 4606
348 Ga0105237_10179615 3300009545 Bacteria 2117
349 Ga0105237_10309025 3300009545 Bacteria 1584
350 Ga0105238_10008143 3300009551 Bacteria 10484
351 Ga0105238_10108633 3300009551 Bacteria 2755
352 Ga0105238_10231024 3300009551 Bacteria 1826
353 Ga0105238_10265679 3300009551 Bacteria 1696
354 Ga0105249_10144156 3300009553 Bacteria 2287
355 Ga0099796_10007451 3300010159 Bacteria 2862
356 Ga0105239_10088786 3300010375 Bacteria 3409
357 Ga0105239_10227156 3300010375 Bacteria 2094
358 Ga0105239_10326162 3300010375 Bacteria 1732
359 Ga0105239_10612587 3300010375 Bacteria 1242
360 Ga0105246_10017489 3300011119 Bacteria 4557
361 Ga0105246_10155346 3300011119 Bacteria 1737
362 Ga0157371_10099208 3300013102 Bacteria 2065
363 Ga0157370_10077059 3300013104 Bacteria 3141
364 Ga0157370_10381827 3300013104 Bacteria 1298
365 Ga0157369_10009732 3300013105 Bacteria 10992
366 Ga0157369_10025423 3300013105 Bacteria 6575
367 Ga0157369_10151909 3300013105 Bacteria 2447
368 Ga0157369_10223225 3300013105 Bacteria 1971
369 Ga0157369_10282041 3300013105 Bacteria 1730
370 Ga0157369_10403329 3300013105 Bacteria 1418
371 Ga0171462_1023 3300013250 Bacteria 136797
372 Ga0171462_1029 3300013250 Bacteria 110139
373 Ga0157374_10049880 3300013296 Bacteria 3888
374 Ga0157374_10065342 3300013296 Bacteria 3416
375 Ga0157378_10011636 3300013297 Bacteria 7703
376 Ga0157378_10026868 3300013297 Bacteria 5076
377 Ga0157378_10039107 3300013297 Bacteria 4206
378 Ga0157378_10211465 3300013297 Bacteria 1839
379 Ga0163162_10003566 3300013306 Bacteria 14886
380 Ga0163162_10415528 3300013306 Bacteria 1477
381 Ga0163162_10584292 3300013306 Bacteria 1244
382 Ga0157372_10044988 3300013307 Bacteria 4894
383 Ga0157372_10137753 3300013307 Bacteria 2811
384 Ga0157372_10318761 3300013307 Bacteria 1810
385 Ga0157372_10414317 3300013307 Unclassified 1570
386 Ga0157372_10785337 3300013307 Bacteria 1107
387 Ga0157375_10026229 3300013308 Bacteria 5427
388 Ga0157375_10058420 3300013308 Bacteria 3816
389 Ga0157375_10066362 3300013308 Bacteria 3602
390 Ga0157375_10156434 3300013308 Bacteria 2418
391 Ga0157375_10332188 3300013308 Bacteria 1685
392 Ga0163163_10002136 3300014325 Bacteria 16698
393 Ga0163163_10010953 3300014325 Bacteria 8192
394 Ga0157380_10287449 3300014326 Bacteria 1508
395 Ga0182008_10001849 3300014497 Bacteria 13776
396 Ga0182008_10092916 3300014497 Bacteria 1488
397 Ga0157377_10227428 3300014745 Bacteria 1197
398 Ga0157379_10002228 3300014968 Bacteria 16141
399 Ga0157379_10034241 3300014968 Bacteria 4527
400 Ga0157379_10055612 3300014968 Bacteria 3535
401 Ga0182006_1018279 3300015261 Bacteria 2964
402 Ga0182007_10000577 3300015262 Bacteria 21601
403 Ga0182005_1029514 3300015265 Bacteria 1496
404 Ga0163161_10006805 3300017792 Bacteria 7904
405 Ga0163161_10311765 3300017792 Bacteria 1242
406 Ga0197907_11327166 3300020069 Bacteria 1519
407 Ga0197907_11489271 3300020069 Bacteria 1547
408 Ga0206356_11264946 3300020070 Bacteria 1912
409 Ga0206354_10438044 3300020081 Bacteria 1732
410 Ga0206353_11048710 3300020082 Bacteria 1938
411 Ga0214544_1000006 3300021320 Bacteria 380728
412 Ga0214542_1000002 3300021321 Bacteria 720798
413 Ga0214545_1000002 3300021324 Bacteria 727485
414 Ga0214543_1000017 3300021327 Bacteria 290109
415 Ga0213872_10036241 3300021361 Bacteria 2255
416 Ga0213874_10000725 3300021377 Bacteria 6660
417 Ga0213874_10003303 3300021377 Bacteria 3566
418 Ga0213874_10035511 3300021377 Bacteria 1465
419 Ga0213876_10015756 3300021384 Bacteria 4001
420 Ga0213875_10004342 3300021388 Bacteria 7809
421 Ga0213875_10015983 3300021388 Bacteria 3646
422 Ga0213875_10019342 3300021388 Bacteria 3276
423 Ga0213875_10063752 3300021388 Bacteria 1722
424 Ga0213871_10007482 3300021441 Bacteria 2364
425 Ga0213871_10011645 3300021441 Bacteria 2025
426 Ga0224712_10002521 3300022467 Bacteria 4538
427 Ga0228711_1010044 3300022739 Bacteria 12584
428 Ga0228710_1010269 3300022740 Bacteria 12585
429 Ga0228598_1014149 3300024227 Bacteria 1579
430 Ga0209436_100043 3300025208 Bacteria 71870
431 Ga0209563_101440 3300025230 Bacteria 6314
432 Ga0207427_102270 3300025231 Bacteria 5372
433 Ga0207425_1000038 3300025245 Bacteria 221600
434 Ga0207425_1005641 3300025245 Bacteria 3536
435 Ga0207425_1012329 3300025245 Bacteria 2010
436 Ga0209677_100615 3300025253 Bacteria 19096
437 Ga0209677_108121 3300025253 Bacteria 2090
438 Ga0209148_1000354 3300025254 Bacteria 59155
439 Ga0209148_1004815 3300025254 Bacteria 3223
440 Ga0209129_1000016 3300025258 Bacteria 485491
441 Ga0209129_1000036 3300025258 Bacteria 328331
442 Ga0209129_1000529 3300025258 Bacteria 26631
443 Ga0209129_1005013 3300025258 Bacteria 4875
444 Ga0209129_1006246 3300025258 Bacteria 3930
445 Ga0209233_1000047 3300025261 Bacteria 459614
446 Ga0209233_1000360 3300025261 Bacteria 41483
447 Ga0209233_1002313 3300025261 Bacteria 7104
448 Ga0209233_1007318 3300025261 Bacteria 3503
449 Ga0209455_1003303 3300025272 Bacteria 5789
450 Ga0209455_1008176 3300025272 Bacteria 2871
451 Ga0209455_1009508 3300025272 Bacteria 2548
452 Ga0209673_1000691 3300025273 Bacteria 48251
453 Ga0209673_1005907 3300025273 Bacteria 6049
454 Ga0209673_1007005 3300025273 Bacteria 5306
455 Ga0209673_1026127 3300025273 Bacteria 1925
456 Ga0209673_1027557 3300025273 Bacteria 1846
457 Ga0209673_1038826 3300025273 Bacteria 1381
458 Ga0209130_1000023 3300025284 Bacteria 359355
459 Ga0209130_1000393 3300025284 Bacteria 47764
460 Ga0209130_1001383 3300025284 Bacteria 16323
461 Ga0209675_1000274 3300025291 Bacteria 49492
462 Ga0209675_1001067 3300025291 Bacteria 16975
463 Ga0209675_1005572 3300025291 Bacteria 5241
464 Ga0209676_1001299 3300025292 Bacteria 25543
465 Ga0209676_1007558 3300025292 Bacteria 5063
466 Ga0209676_1011038 3300025292 Bacteria 3690
467 Ga0209676_1053345 3300025292 Bacteria 1049
468 Ga0209025_1000003 3300025294 Bacteria 1366495
469 Ga0209025_1000018 3300025294 Bacteria 686898
470 Ga0209025_1000108 3300025294 Bacteria 221600
471 Ga0209025_1000187 3300025294 Bacteria 154788
472 Ga0209025_1002393 3300025294 Bacteria 20037
473 Ga0209025_1004739 3300025294 Bacteria 11582
474 Ga0209025_1010347 3300025294 Bacteria 6331
475 Ga0209025_1014903 3300025294 Bacteria 4737
476 Ga0209564_1000043 3300025295 Bacteria 388153
477 Ga0209564_1000052 3300025295 Bacteria 356578
478 Ga0209564_1000143 3300025295 Bacteria 177136
479 Ga0209564_1000405 3300025295 Bacteria 76803
480 Ga0209564_1000537 3300025295 Bacteria 61336
481 Ga0209564_1000558 3300025295 Bacteria 59623
482 Ga0209564_1002222 3300025295 Bacteria 16072
483 Ga0209564_1012523 3300025295 Bacteria 3690
484 Ga0209564_1025787 3300025295 Bacteria 1965
485 Ga0209758_1000104 3300025297 Bacteria 221600
486 Ga0209758_1000164 3300025297 Bacteria 151759
487 Ga0209758_1000170 3300025297 Bacteria 149476
488 Ga0209758_1000216 3300025297 Bacteria 125352
489 Ga0209758_1000375 3300025297 Bacteria 77872
490 Ga0209758_1001489 3300025297 Bacteria 27341
491 Ga0209758_1003095 3300025297 Bacteria 15755
492 Ga0209758_1003612 3300025297 Bacteria 13840
493 Ga0209758_1004652 3300025297 Bacteria 11240
494 Ga0209758_1007900 3300025297 Bacteria 7065
495 Ga0209758_1012118 3300025297 Bacteria 4875
496 Ga0209758_1015538 3300025297 Bacteria 3930
497 Ga0209758_1029665 3300025297 Bacteria 2281
498 Ga0209050_1002087 3300025298 Bacteria 18309
499 Ga0209050_1007449 3300025298 Bacteria 6132
500 Ga0209256_1000099 3300025299 Bacteria 203782
501 Ga0209256_1000111 3300025299 Bacteria 178442
502 Ga0209256_1000374 3300025299 Bacteria 71875
503 Ga0209256_1000648 3300025299 Bacteria 47343
504 Ga0209256_1000709 3300025299 Bacteria 44332
505 Ga0209256_1006841 3300025299 Bacteria 5867
506 Ga0209256_1011392 3300025299 Bacteria 3564
507 Ga0209256_1022459 3300025299 Bacteria 1909
508 Ga0207426_1000087 3300025302 Bacteria 288870
509 Ga0207426_1000580 3300025302 Bacteria 48953
510 Ga0207426_1004590 3300025302 Bacteria 6664
511 Ga0207426_1015864 3300025302 Bacteria 2722
512 Ga0209051_1000114 3300025303 Bacteria 152303
513 Ga0209051_1000350 3300025303 Bacteria 68654
514 Ga0209051_1000600 3300025303 Bacteria 42450
515 Ga0209051_1000641 3300025303 Bacteria 40092
516 Ga0209051_1001025 3300025303 Bacteria 26597
517 Ga0209051_1005829 3300025303 Bacteria 7090
518 Ga0209051_1013123 3300025303 Bacteria 3961
519 Ga0209051_1028281 3300025303 Bacteria 2217
520 Ga0209257_1000015 3300025304 Bacteria 908141
521 Ga0209257_1000782 3300025304 Bacteria 46895
522 Ga0209257_1007708 3300025304 Bacteria 6419
523 Ga0209257_1022231 3300025304 Bacteria 2269
524 Ga0207697_10013127 3300025315 Bacteria 3460
525 Ga0207656_10004899 3300025321 Bacteria 4700
526 Ga0207656_10020027 3300025321 Bacteria 2653
527 Ga0207656_10045341 3300025321 Bacteria 1881
528 Ga0207692_10000660 3300025898 Bacteria 12148
529 Ga0207692_10008365 3300025898 Bacteria 4277
530 Ga0207692_10035057 3300025898 Bacteria 2435
531 Ga0207692_10050786 3300025898 Bacteria 2099
532 Ga0207688_10048076 3300025901 Bacteria 2383
533 Ga0207688_10092199 3300025901 Bacteria 1741
534 Ga0207688_10135731 3300025901 Bacteria 1445
535 Ga0207647_10027278 3300025904 Bacteria 3724
536 Ga0207699_10000526 3300025906 Bacteria 18963
537 Ga0207699_10042054 3300025906 Bacteria 2644
538 Ga0207699_10047801 3300025906 Bacteria 2510
539 Ga0207645_10069942 3300025907 Bacteria 2245
540 Ga0207645_10079533 3300025907 Bacteria 2101
541 Ga0207645_10283424 3300025907 Bacteria 1100
542 Ga0207643_10127481 3300025908 Bacteria 1512
543 Ga0207705_10058570 3300025909 Bacteria 2779
544 Ga0207705_10121261 3300025909 Bacteria 1940
545 Ga0207705_10187932 3300025909 Bacteria 1561
546 Ga0207705_10349959 3300025909 Bacteria 1138
547 Ga0207684_10000920 3300025910 Bacteria 33379
548 Ga0207684_10033381 3300025910 Bacteria 4376
549 Ga0207654_10052914 3300025911 Bacteria 2342
550 Ga0207707_10001083 3300025912 Bacteria 26026
551 Ga0207707_10001941 3300025912 Bacteria 18821
552 Ga0207707_10014916 3300025912 Bacteria 6767
553 Ga0207707_10117767 3300025912 Bacteria 2322
554 Ga0207707_10308854 3300025912 Bacteria 1367
555 Ga0207707_10337195 3300025912 Bacteria 1300
556 Ga0207695_10000599 3300025913 Bacteria 72238
557 Ga0207695_10055983 3300025913 Bacteria 4106
558 Ga0207695_10070312 3300025913 Bacteria 3579
559 Ga0207695_10087929 3300025913 Bacteria 3129
560 Ga0207695_10177015 3300025913 Bacteria 2055
561 Ga0207671_10001926 3300025914 Bacteria 23032
562 Ga0207671_10090005 3300025914 Bacteria 2310
563 Ga0207671_10137820 3300025914 Bacteria 1878
564 Ga0207671_10211906 3300025914 Bacteria 1516
565 Ga0207693_10004729 3300025915 Bacteria 11452
566 Ga0207693_10032143 3300025915 Bacteria 4143
567 Ga0207693_10115388 3300025915 Bacteria 2108
568 Ga0207663_10000334 3300025916 Bacteria 20607
569 Ga0207663_10004028 3300025916 Bacteria 7281
570 Ga0207663_10045957 3300025916 Bacteria 2688
571 Ga0207660_10003821 3300025917 Bacteria 9815
572 Ga0207660_10207136 3300025917 Bacteria 1534
573 Ga0207660_10222708 3300025917 Bacteria 1481
574 Ga0207662_10278473 3300025918 Bacteria 1106
575 Ga0207657_10003922 3300025919 Bacteria 15790
576 Ga0207657_10187748 3300025919 Bacteria 1668
577 Ga0207657_10424667 3300025919 Bacteria 1044
578 Ga0207649_10064772 3300025920 Bacteria 2312
579 Ga0207649_10068489 3300025920 Bacteria 2257
580 Ga0207652_10003147 3300025921 Bacteria 13749
581 Ga0207652_10012449 3300025921 Bacteria 6875
582 Ga0207652_10099773 3300025921 Bacteria 2563
583 Ga0207652_10151739 3300025921 Unclassified 2075
584 Ga0207646_10013186 3300025922 Bacteria 7911
585 Ga0207681_10001984 3300025923 Bacteria 13141
586 Ga0207694_10072960 3300025924 Bacteria 2684
587 Ga0207694_10137892 3300025924 Bacteria 1960
588 Ga0207650_10000274 3300025925 Bacteria 54226
589 Ga0207650_10154557 3300025925 Bacteria 1813
590 Ga0207659_10004273 3300025926 Bacteria 8637
591 Ga0207687_10019272 3300025927 Bacteria 4519
592 Ga0207687_10022862 3300025927 Bacteria 4164
593 Ga0207687_10192768 3300025927 Bacteria 1587
594 Ga0207700_10001731 3300025928 Bacteria 12395
595 Ga0207700_10222552 3300025928 Bacteria 1601
596 Ga0207700_10294979 3300025928 Bacteria 1398
597 Ga0207700_10379438 3300025928 Bacteria 1236
598 Ga0207664_10020781 3300025929 Bacteria 4872
599 Ga0207664_10087270 3300025929 Bacteria 2550
600 Ga0207664_10346699 3300025929 Bacteria 1314
601 Ga0207664_10403233 3300025929 Bacteria 1216
602 Ga0207690_10210850 3300025932 Bacteria 1481
603 Ga0207690_10410026 3300025932 Bacteria 1082
604 Ga0207706_10137699 3300025933 Bacteria 2147
605 Ga0207706_10205778 3300025933 Bacteria 1726
606 Ga0207686_10000019 3300025934 Bacteria 187616
607 Ga0207686_10094415 3300025934 Bacteria 1983
608 Ga0207709_10000064 3300025935 Bacteria 191119
609 Ga0207709_10000077 3300025935 Bacteria 169923
610 Ga0207709_10048569 3300025935 Bacteria 2586
611 Ga0207709_10081886 3300025935 Bacteria 2082
612 Ga0207670_10207327 3300025936 Bacteria 1493
613 Ga0207669_10158436 3300025937 Bacteria 1595
614 Ga0207704_10001539 3300025938 Bacteria 10349
615 Ga0207704_10283522 3300025938 Bacteria 1260
616 Ga0207665_10005331 3300025939 Bacteria 8593
617 Ga0207691_10000494 3300025940 Bacteria 39257
618 Ga0207691_10003618 3300025940 Bacteria 14996
619 Ga0207691_10016790 3300025940 Bacteria 6947
620 Ga0207691_10085938 3300025940 Bacteria 2823
621 Ga0207691_10266214 3300025940 Bacteria 1477
622 Ga0207711_10108304 3300025941 Bacteria 2468
623 Ga0207711_10398695 3300025941 Bacteria 1278
624 Ga0207689_10074630 3300025942 Bacteria 2786
625 Ga0207689_10182636 3300025942 Bacteria 1730
626 Ga0207689_10213323 3300025942 Bacteria 1595
627 Ga0207689_10449430 3300025942 Bacteria 1077
628 Ga0207661_10009663 3300025944 Bacteria 6926
629 Ga0207661_10034064 3300025944 Bacteria 3958
630 Ga0207661_10036733 3300025944 Bacteria 3826
631 Ga0207661_10323168 3300025944 Bacteria 1387
632 Ga0207667_10007523 3300025949 Bacteria 13074
633 Ga0207667_10070582 3300025949 Bacteria 3635
634 Ga0207667_10100325 3300025949 Bacteria 2986
635 Ga0207667_10161364 3300025949 Bacteria 2305
636 Ga0207667_10163755 3300025949 Bacteria 2287
637 Ga0207667_10192815 3300025949 Bacteria 2091
638 Ga0207667_10450555 3300025949 Bacteria 1308
639 Ga0207667_10686114 3300025949 Bacteria 1027
640 Ga0207651_10001168 3300025960 Bacteria 11757
641 Ga0207651_10358612 3300025960 Bacteria 1230
642 Ga0207712_10046934 3300025961 Bacteria 2997
643 Ga0207668_10108904 3300025972 Bacteria 2074
644 Ga0207668_10267903 3300025972 Bacteria 1395
645 Ga0207640_10204677 3300025981 Bacteria 1498
646 Ga0207658_10029968 3300025986 Bacteria 3849
647 Ga0207658_10052349 3300025986 Bacteria 3012
648 Ga0207658_10076590 3300025986 Bacteria 2549
649 Ga0207658_10147770 3300025986 Bacteria 1911
650 Ga0207677_10007171 3300026023 Bacteria 6139
651 Ga0207677_10087375 3300026023 Bacteria 2257
652 Ga0207703_10049718 3300026035 Bacteria 3390
653 Ga0207703_10066822 3300026035 Bacteria 2958
654 Ga0207703_10284261 3300026035 Bacteria 1503
655 Ga0207703_10294793 3300026035 Bacteria 1477
656 Ga0207703_10388895 3300026035 Bacteria 1292
657 Ga0207639_10034571 3300026041 Bacteria 3736
658 Ga0207639_10048023 3300026041 Bacteria 3229
659 Ga0207639_10103211 3300026041 Bacteria 2309
660 Ga0207678_10028024 3300026067 Bacteria 4919
661 Ga0207678_10036080 3300026067 Bacteria 4303
662 Ga0207678_10226012 3300026067 Bacteria 1602
663 Ga0207678_10270612 3300026067 Bacteria 1457
664 Ga0207708_10085820 3300026075 Bacteria 2422
665 Ga0207708_10258452 3300026075 Bacteria 1405
666 Ga0207702_10000433 3300026078 Bacteria 47747
667 Ga0207702_10085951 3300026078 Bacteria 2742
668 Ga0207702_10147778 3300026078 Bacteria 2135
669 Ga0207648_10020558 3300026089 Bacteria 5943
670 Ga0207648_10031150 3300026089 Bacteria 4716
671 Ga0207648_10035092 3300026089 Bacteria 4421
672 Ga0207648_10113756 3300026089 Bacteria 2377
673 Ga0207648_10138768 3300026089 Bacteria 2142
674 Ga0207648_10452876 3300026089 Bacteria 1169
675 Ga0207674_10024060 3300026116 Bacteria 6514
676 Ga0207674_10032073 3300026116 Bacteria 5511
677 Ga0207675_100002430 3300026118 Bacteria 18452
678 Ga0207675_100198698 3300026118 Bacteria 1925
679 Ga0207683_10275203 3300026121 Bacteria 1538
680 Ga0207698_10001165 3300026142 Bacteria 15335
681 Ga0207698_10121499 3300026142 Bacteria 2212
682 Ga0207698_10145426 3300026142 Bacteria 2049
683 Ga0207698_10288402 3300026142 Bacteria 1522
684 Ga0209389_1000155 3300027296 Bacteria 57647
685 Ga0209389_1000640 3300027296 Bacteria 21616
686 Ga0209371_1000251 3300027312 Bacteria 66325
687 Ga0209371_1000425 3300027312 Bacteria 43402
688 Ga0209589_1000030 3300027357 Bacteria 147457
689 Ga0209589_1005433 3300027357 Bacteria 21616
690 Ga0209489_100056 3300027361 Bacteria 147457
691 Ga0209489_105575 3300027361 Bacteria 21616
692 Ga0209489_114795 3300027361 Bacteria 5218
693 Ga0209700_100059 3300027363 Bacteria 147457
694 Ga0209700_104170 3300027363 Bacteria 26475
695 Ga0209588_1017461 3300027671 Bacteria 2225
696 Ga0209813_10010901 3300027866 Bacteria 2363
697 Ga0209813_10033520 3300027866 Bacteria 1527
698 Ga0268266_10000988 3300028379 Bacteria 35821
699 Ga0268266_10002854 3300028379 Bacteria 18005
700 Ga0268266_10006878 3300028379 Bacteria 10351
701 Ga0268266_10102980 3300028379 Bacteria 2519
702 Ga0268266_10291164 3300028379 Bacteria 1521
703 Ga0268265_10109639 3300028380 Bacteria 2250
704 Ga0268265_10112099 3300028380 Bacteria 2229
705 Ga0268264_10000245 3300028381 Bacteria 102529
706 Ga0268264_10020744 3300028381 Bacteria 5369
707 Ga0268264_10103682 3300028381 Bacteria 2477
708 Ga0268264_10315132 3300028381 Bacteria 1477
709 Ga0268264_10356976 3300028381 Bacteria 1393
710 Ga0265326_10032338 3300028558 Bacteria 1489
711 Ga0265319_1015385 3300028563 Bacteria 2969
712 Ga0265334_10005352 3300028573 Bacteria 5605
713 Ga0265334_10029191 3300028573 Bacteria 2212
714 Ga0265318_10037845 3300028577 Bacteria 1846
715 Ga0265323_10000916 3300028653 Bacteria 15563
716 Ga0265336_10000298 3300028666 Bacteria 33834
717 Ga0307517_10000125 3300028786 Bacteria 115466
718 Ga0307515_10034944 3300028794 Bacteria 8200
719 Ga0307515_10184653 3300028794 Bacteria 2020
720 Ga0265338_10000131 3300028800 Bacteria 137627
721 Ga0268256_1000475 3300030500 Bacteria 34521
722 Ga0268256_1001004 3300030500 Bacteria 19148
723 Ga0307511_10018563 3300030521 Bacteria 6637
724 Ga0265760_10007459 3300031090 Bacteria 3124
725 Ga0265330_10015078 3300031235 Bacteria 3579
726 Ga0265325_10002689 3300031241 Bacteria 11892
727 Ga0265340_10038625 3300031247 Bacteria 2360
728 Ga0265339_10003134 3300031249 Bacteria 11644
729 Ga0265339_10046241 3300031249 Bacteria 2394
730 Ga0265339_10079522 3300031249 Bacteria 1735
731 Ga0265339_10107197 3300031249 Bacteria 1449
732 Ga0265339_10143280 3300031249 Bacteria 1214
733 Ga0265331_10057805 3300031250 Bacteria 1838
734 Ga0265316_10087509 3300031344 Bacteria 2380
735 Ga0307513_10081546 3300031456 Bacteria 3333
736 Ga0307513_10108571 3300031456 Bacteria 2775
737 Ga0307509_10061588 3300031507 Bacteria 3959
738 Ga0307509_10150315 3300031507 Bacteria 2245
739 Ga0307509_10302912 3300031507 Bacteria 1345
740 Ga0307509_10321450 3300031507 Bacteria 1284
741 Ga0307408_100001144 3300031548 Bacteria 20165
742 Ga0307408_100269328 3300031548 Bacteria 1413
743 Ga0307408_100327522 3300031548 Bacteria 1292
744 Ga0265313_10024533 3300031595 Bacteria 3219
745 Ga0265313_10026971 3300031595 Bacteria 3015
746 Ga0307508_10001153 3300031616 Bacteria 30369
747 Ga0265314_10020390 3300031711 Bacteria 5117
748 Ga0265314_10025270 3300031711 Bacteria 4485
749 Ga0265314_10198913 3300031711 Unclassified 1186
750 Ga0265342_10002981 3300031712 Bacteria 14213
751 Ga0265342_10032697 3300031712 Bacteria 3206
752 Ga0316576_10116137 3300031727 Bacteria 2008
753 Ga0316578_10107579 3300031728 Bacteria 1674
754 Ga0307516_10008305 3300031730 Bacteria 11768
755 Ga0307516_10020167 3300031730 Bacteria 6894
756 Ga0307516_10022528 3300031730 Bacteria 6466
757 Ga0307516_10202268 3300031730 Bacteria 1705
758 Ga0307516_10268774 3300031730 Bacteria 1392
759 Ga0307405_10042455 3300031731 Bacteria 2768
760 Ga0307405_10204202 3300031731 Bacteria 1438
761 Ga0307413_10023153 3300031824 Bacteria 3362
762 Ga0307413_10027937 3300031824 Bacteria 3134
763 Ga0307410_10012854 3300031852 Bacteria 4860
764 Ga0307410_10053148 3300031852 Bacteria 2740
765 Ga0307410_10083034 3300031852 Bacteria 2255
766 Ga0307410_10157424 3300031852 Bacteria 1698
767 Ga0307406_10000141 3300031901 Bacteria 43017
768 Ga0307406_10009687 3300031901 Bacteria 5417
769 Ga0307406_10011607 3300031901 Bacteria 5004
770 Ga0307407_10010347 3300031903 Bacteria 4394
771 Ga0307407_10115289 3300031903 Bacteria 1694
772 Ga0307412_10000563 3300031911 Bacteria 21947
773 Ga0307412_10005563 3300031911 Bacteria 7074
774 Ga0307412_10037202 3300031911 Bacteria 3125
775 Ga0307412_10054934 3300031911 Bacteria 2646
776 Ga0307409_100015688 3300031995 Bacteria 4982
777 Ga0307409_100050870 3300031995 Bacteria 3167
778 Ga0307416_100025154 3300032002 Bacteria 4360
779 Ga0307416_100068001 3300032002 Bacteria 2941
780 Ga0307416_100700864 3300032002 Bacteria 1102
781 Ga0307414_10021590 3300032004 Bacteria 4045
782 Ga0307414_10037909 3300032004 Bacteria 3232
783 Ga0307414_10262379 3300032004 Bacteria 1442
784 Ga0307414_10388290 3300032004 Bacteria 1209
785 Ga0307411_10017180 3300032005 Bacteria 4113
786 Ga0307411_10053380 3300032005 Bacteria 2648
787 Ga0307415_100385468 3300032126 Bacteria 1192
788 Ga0307507_10061386 3300033179 Bacteria 3500
789 Ga0307507_10085665 3300033179 Bacteria 2739
790 Ga0307510_10010190 3300033180 Bacteria 11174
791 Ga0307510_10234916 3300033180 Bacteria 1333
792 Ga0307510_10244496 3300033180 Bacteria 1286
793 Ga0315911_1000009 3300033442 Bacteria 379354
794 Ga0373934_0001668 3300035086 Bacteria 8155
795 Ga0373934_0052699 3300035086 Bacteria 1614
796 Ga0373944_0019024 3300035089 Bacteria 1967
797 Ga0373936_0028477 3300035113 Bacteria 2196
798 Ga0373936_0074852 3300035113 Bacteria 1401
799 Ga0373953_0000108 3300035117 Bacteria 20124
800 Ga0373953_0001849 3300035117 Bacteria 6262
801 Ga0373954_0000085 3300035118 Bacteria 31872
802 Ga0373954_0015553 3300035118 Bacteria 3401
803 Ga0373954_0060946 3300035118 Bacteria 1780
804 Ga0373956_0000272 3300035119 Bacteria 20783
805 Ga0373956_0030598 3300035119 Bacteria 2354
806 Ga0373957_0000129 3300035120 Bacteria 18551
807 Ga0373960_0077538 3300035121 Bacteria 1040
808 Ga0373943_0027519 3300035170 Bacteria 2672
809 Ga0373943_0087956 3300035170 Bacteria 1604
810 Ga0373943_0158659 3300035170 Bacteria 1230
811 Ga0373946_0001563 3300035171 Bacteria 7976
812 Ga0373955_0000288 3300035172 Bacteria 20919
813 Ga0373955_0007868 3300035172 Bacteria 4917
814 Ga0373955_0079671 3300035172 Bacteria 1848
815 Ga0316574_0306155 3300035398 Bacteria 1010
816 Ga0373924_0005705 3300035410 Bacteria 4419
817 Ga0373931_0274666 3300035691 Bacteria 1033
818 Ga0373935_0002679 3300035692 Bacteria 10244
819 Ga0373935_0277441 3300035692 Bacteria 1179
820 Ga0373927_0001471 3300035695 Bacteria 17726
821 Ga0373927_0002486 3300035695 Bacteria 13456
822 Ga0373927_0074697 3300035695 Bacteria 2194
823 Ga0373927_0078916 3300035695 Bacteria 2132
824 Ga0373927_0141375 3300035695 Bacteria 1574
825 Ga0373933_0000059 3300035724 Bacteria 65716
826 Ga0373933_0000913 3300035724 Bacteria 18054
827 Ga0373933_0084955 3300035724 Bacteria 1945
828 Ga0373933_0119667 3300035724 Bacteria 1648
829 Ga0373947_0003788 3300035725 Bacteria 8912
830 Ga0373947_0009239 3300035725 Bacteria 5666
831 Ga0373947_0009876 3300035725 Bacteria 5480
832 Ga0373947_0029949 3300035725 Bacteria 3195
833 Ga0373947_0050555 3300035725 Bacteria 2500
834 Ga0373937_0005718 3300036401 Bacteria 10679
835 Ga0373937_0027472 3300036401 Bacteria 5146
836 Ga0373937_0073857 3300036401 Bacteria 3146
837 Ga0373937_0117322 3300036401 Bacteria 2479
838 Ga0373937_0317447 3300036401 Bacteria 1474
839 Ga0373937_0336467 3300036401 Bacteria 1429
840 Ga0316584_0027739 3300036712 Bacteria 4169
841 Ga0373925_0113006 3300037068 Bacteria 2100
842 Ga0373925_0128671 3300037068 Bacteria 1972
843 Ga0395899_0001144 3300037312 Bacteria 23503
844 Ga0395899_0002482 3300037312 Bacteria 14968
845 Ga0395899_0013792 3300037312 Bacteria 6177
846 Ga0395899_0050258 3300037312 Bacteria 3096
847 Ga0395899_0257482 3300037312 Bacteria 1195
848 Ga0395899_0287338 3300037312 Bacteria 1117
849 Ga0395900_0004339 3300037418 Bacteria 15044
850 Ga0395900_0007142 3300037418 Bacteria 11572
851 Ga0395900_0027248 3300037418 Bacteria 5851
852 Ga0395900_0062423 3300037418 Bacteria 3830
853 Ga0395900_0068312 3300037418 Bacteria 3652
854 Ga0395900_0109149 3300037418 Bacteria 2842
855 Ga0395900_0144131 3300037418 Bacteria 2437
856 Ga0395900_0163053 3300037418 Bacteria 2273
857 Ga0395900_0290808 3300037418 Bacteria 1623
858 Ga0395900_0423143 3300037418 Bacteria 1292
859 Ga0395898_0004409 3300037466 Bacteria 15400
860 Ga0395898_0005265 3300037466 Bacteria 13987
861 Ga0395898_0030072 3300037466 Bacteria 5439
862 Ga0395898_0037146 3300037466 Bacteria 4834
863 Ga0395898_0037278 3300037466 Bacteria 4824
864 Ga0395898_0443330 3300037466 Bacteria 1237
865 Ga0395898_0535317 3300037466 Bacteria 1113
866 Ga0395905_0005945 3300037471 Bacteria 12364
867 Ga0395905_0056296 3300037471 Bacteria 3679
868 Ga0395905_0157417 3300037471 Bacteria 2136
869 Ga0436364_0017639 3300037853 Bacteria 1305
870 Ga0436364_0249115 3300037853 Bacteria 14135
871 Ga0436364_0250721 3300037853 Bacteria 9532
872 Ga0436364_0719526 3300037853 Bacteria 3689
873 Ga0436364_1273230 3300037853 Bacteria 1465
874 Ga0395901_0014750 3300038443 Bacteria 7942
875 Ga0395901_0016140 3300038443 Bacteria 7606
876 Ga0395901_0028762 3300038443 Bacteria 5717
877 Ga0395901_0072555 3300038443 Bacteria 3589
878 Ga0395901_0188466 3300038443 Bacteria 2163
879 Ga0395901_0267726 3300038443 Bacteria 1778
880 Ga0395901_0358708 3300038443 Bacteria 1503
881 Ga0395901_0613777 3300038443 Bacteria 1095
882 Ga0400483_016022 3300039062 Bacteria 1190
883 Ga0400483_132723 3300039062 Bacteria 9120
884 Ga0400483_191502 3300039062 Bacteria 1289
885 Ga0400483_226394 3300039062 Bacteria 2447
886 Ga0400483_244580 3300039062 Bacteria 6857
887 Ga0436365_0356394 3300039437 Bacteria 1177
888 Ga0436365_0656380 3300039437 Bacteria 1757
889 Ga0436365_1507572 3300039437 Bacteria 1585
890 Ga0436360_0872516 3300039438 Bacteria 5005
891 Ga0436361_0736352 3300039447 Bacteria 2181
892 Ga0436361_0898793 3300039447 Bacteria 17943
893 Ga0436361_1018297 3300039447 Bacteria 1164
894 Ga0436363_0628780 3300039450 Bacteria 1828
895 Ga0436363_1138394 3300039450 Bacteria 9676
896 Ga0436362_0372017 3300039453 Bacteria 1086
897 Ga0436362_1134067 3300039453 Bacteria 12134
898 Ga0439466_0028978 3300041411 Bacteria 1907
899 Ga0439465_0000965 3300041413 Bacteria 9142
900 Ga0451791_1031212 3300041451 Bacteria 1113
901 Ga0451795_0239567 3300041456 Bacteria 1118
902 Ga0451807_2348294 3300041486 Bacteria 1202
903 Ga0451853_4020387 3300041512 Bacteria 1141
904 Ga0439442_001123 3300042002 Bacteria 5340
905 Ga0439448_0008188 3300042005 Bacteria 3055
906 Ga0439449_0015407 3300042007 Bacteria 2873
907 Ga0450920_000242 3300042122 Bacteria 8128
908 Ga0450903_000099 3300042138 Bacteria 18213
909 Ga0450907_004183 3300042146 Bacteria 2500
910 Ga0439434_0000853 3300042435 Bacteria 8795
911 Ga0451577_0423127 3300042876 Bacteria 1209
912 Ga0466969_0054525 3300044656 Bacteria 1958
913 Ga0466972_0000156 3300044658 Bacteria 55040
914 Ga0466972_0002340 3300044658 Bacteria 9337
915 Ga0453683_0039263 3300044673 Bacteria 2975
916 Ga0466965_0005513 3300044683 Bacteria 5705
917 Ga0466965_0224212 3300044683 Bacteria 1002
918 Ga0466966_0000726 3300044684 Bacteria 20952
919 Ga0466961_0000568 3300044693 Bacteria 23491
920 Ga0466963_0018028 3300044694 Bacteria 4406
921 Ga0466963_0030469 3300044694 Bacteria 3482
922 Ga0466963_0080911 3300044694 Bacteria 2200
923 Ga0453684_0097814 3300044712 Bacteria 3601
924 Ga0466971_0050003 3300044719 Bacteria 1881
925 Ga0466971_0059768 3300044719 Bacteria 1722
926 Ga0466968_0016076 3300044735 Bacteria 2975
927 Ga0466960_0008725 3300044901 Bacteria 4159
928 Ga0466960_0138920 3300044901 Bacteria 1289
929 Ga0466959_0033944 3300045049 Bacteria 3775
930 Ga0466959_0064143 3300045049 Bacteria 2667
931 Ga0466959_0199311 3300045049 Bacteria 1394
932 Ga0451576_0011400 3300045051 Bacteria 10104
933 Ga0451576_0443228 3300045051 Bacteria 1363
934 Ga0466967_0009784 3300045976 Bacteria 7147
935 Ga0466967_0049840 3300045976 Bacteria 3665
936 Ga0466967_0105800 3300045976 Bacteria 2578
937 Ga0466967_0116005 3300045976 Bacteria 2467
938 Ga0466967_0162412 3300045976 Bacteria 2098
939 Ga0495627_000007 3300046453 Bacteria 575915
940 Ga0495592_0000795 3300046454 Bacteria 21828
941 Ga0495592_0017948 3300046454 Bacteria 5376
942 Ga0495592_0043205 3300046454 Bacteria 3373
943 Ga0495592_0049186 3300046454 Bacteria 3134
944 Ga0495592_0073730 3300046454 Bacteria 2481
945 Ga0495603_0000387 3300046455 Bacteria 24105
946 Ga0495603_0016135 3300046455 Bacteria 4516
947 Ga0495603_0040158 3300046455 Bacteria 2801
948 Ga0495603_0067622 3300046455 Bacteria 2103
949 Ga0495603_0109321 3300046455 Bacteria 1613
950 Ga0495591_003223 3300046458 Bacteria 8588
951 Ga0495629_0000582 3300046459 Bacteria 29684
952 Ga0495629_0001668 3300046459 Bacteria 17432
953 Ga0495629_0004581 3300046459 Bacteria 10343
954 Ga0495629_0109406 3300046459 Bacteria 1927
955 Ga0495638_0000632 3300046460 Bacteria 38873
956 Ga0495638_0021945 3300046460 Bacteria 4196
957 Ga0495638_0031663 3300046460 Bacteria 3397
958 Ga0495638_0172847 3300046460 Bacteria 1238
959 Ga0495641_0010227 3300046461 Bacteria 5462
960 Ga0495641_0042318 3300046461 Bacteria 2112
961 Ga0495651_0002961 3300046462 Bacteria 13121
962 Ga0495651_0004548 3300046462 Bacteria 10603
963 Ga0495651_0013772 3300046462 Bacteria 6253
964 Ga0495651_0151312 3300046462 Bacteria 1672
965 Ga0495651_0155481 3300046462 Bacteria 1644
966 Ga0495653_0002685 3300046463 Bacteria 14171
967 Ga0495653_0050466 3300046463 Bacteria 3200
968 Ga0495653_0082672 3300046463 Bacteria 2370
969 Ga0495650_0001505 3300046471 Bacteria 22211
970 Ga0495650_0006708 3300046471 Bacteria 7128
971 Ga0495650_0078515 3300046471 Bacteria 1278
972 Ga0495580_0001175 3300046472 Bacteria 23040
973 Ga0495580_0037235 3300046472 Bacteria 3492
974 Ga0495580_0121050 3300046472 Bacteria 1817
975 Ga0495582_0005799 3300046473 Bacteria 6880
976 Ga0495582_0005882 3300046473 Bacteria 6835
977 Ga0495582_0062261 3300046473 Bacteria 2061
978 Ga0495605_0000658 3300046474 Bacteria 26313
979 Ga0495605_0043068 3300046474 Bacteria 2240
980 Ga0495639_0000739 3300046475 Bacteria 14934
981 Ga0495662_0000148 3300046476 Bacteria 27496
982 Ga0495662_0020563 3300046476 Bacteria 3194
983 Ga0495664_0014537 3300046477 Bacteria 4464
984 Ga0495664_0042937 3300046477 Bacteria 2679
985 Ga0495664_0054520 3300046477 Bacteria 2377
986 Ga0495585_0016215 3300046492 Bacteria 4317
987 Ga0495594_0000312 3300046499 Bacteria 23910
988 Ga0495594_0090319 3300046499 Bacteria 1716
989 Ga0495594_0154240 3300046499 Bacteria 1304
990 Ga0495596_0003637 3300046500 Bacteria 7745
991 Ga0495596_0066393 3300046500 Bacteria 1403
992 Ga0495607_0000024 3300046501 Bacteria 159904
993 Ga0495607_0005882 3300046501 Bacteria 8714
994 Ga0495607_0064859 3300046501 Bacteria 2061
995 Ga0495607_0080348 3300046501 Unclassified 1793
996 Ga0495606_0004206 3300046507 Bacteria 14566
997 Ga0495606_0012913 3300046507 Bacteria 6647
998 Ga0495606_0035300 3300046507 Bacteria 3419
999 Ga0495606_0096906 3300046507 Bacteria 1803
1000 Ga0495606_0130004 3300046507 Bacteria 1498
1001 Ga0495606_0161826 3300046507 Bacteria 1305
1002 Ga0495608_0000569 3300046511 Bacteria 25372
1003 Ga0495608_0001782 3300046511 Bacteria 15382
1004 Ga0495608_0024234 3300046511 Bacteria 4151
1005 Ga0495608_0030766 3300046511 Bacteria 3632
1006 Ga0495608_0145227 3300046511 Bacteria 1513
1007 Ga0495610_0009082 3300046512 Bacteria 6335
1008 Ga0495610_0020992 3300046512 Bacteria 3604
1009 Ga0495610_0021886 3300046512 Bacteria 3508
1010 Ga0495610_0031592 3300046512 Bacteria 2761
1011 Ga0495610_0076902 3300046512 Bacteria 1543
1012 Ga0495616_0003258 3300046513 Bacteria 10438
1013 Ga0495616_0011852 3300046513 Bacteria 4969
1014 Ga0495616_0055101 3300046513 Bacteria 1970
1015 Ga0495618_0015858 3300046514 Bacteria 4599
1016 Ga0495618_0047475 3300046514 Bacteria 2710
1017 Ga0495618_0069671 3300046514 Bacteria 2236
1018 Ga0495618_0111286 3300046514 Bacteria 1753
1019 Ga0495620_0025454 3300046515 Bacteria 2799
1020 Ga0495620_0026177 3300046515 Bacteria 2746
1021 Ga0495628_0000179 3300046516 Bacteria 55815
1022 Ga0495628_0010360 3300046516 Bacteria 7926
1023 Ga0495628_0028278 3300046516 Bacteria 4556
1024 Ga0495628_0038197 3300046516 Bacteria 3844
1025 Ga0495628_0078122 3300046516 Bacteria 2574
1026 Ga0495628_0091601 3300046516 Bacteria 2353
1027 Ga0495630_0021991 3300046517 Bacteria 4711
1028 Ga0495630_0028578 3300046517 Bacteria 4143
1029 Ga0495630_0048283 3300046517 Bacteria 3185
1030 Ga0495630_0151306 3300046517 Bacteria 1765
1031 Ga0495631_0064306 3300046518 Bacteria 1588
1032 Ga0495632_0000078 3300046519 Bacteria 100643
1033 Ga0495632_0000392 3300046519 Bacteria 41102
1034 Ga0495632_0101151 3300046519 Bacteria 1358
1035 Ga0495637_0000279 3300046520 Bacteria 40327
1036 Ga0495637_0082309 3300046520 Bacteria 1282
1037 Ga0495643_0000757 3300046522 Bacteria 36364
1038 Ga0495643_0031491 3300046522 Bacteria 2951
1039 Ga0495643_0039945 3300046522 Bacteria 2564
1040 Ga0495643_0048366 3300046522 Bacteria 2299
1041 Ga0495643_0057135 3300046522 Bacteria 2080
1042 Ga0495643_0081349 3300046522 Bacteria 1684
1043 Ga0495643_0092256 3300046522 Bacteria 1561
1044 Ga0495648_0000855 3300046524 Bacteria 32117
1045 Ga0495648_0001231 3300046524 Bacteria 25613
1046 Ga0495648_0004816 3300046524 Bacteria 11388
1047 Ga0495648_0007196 3300046524 Bacteria 8941
1048 Ga0495648_0017191 3300046524 Bacteria 5180
1049 Ga0495648_0022316 3300046524 Bacteria 4361
1050 Ga0495648_0068816 3300046524 Bacteria 2063
1051 Ga0495648_0092062 3300046524 Bacteria 1694
1052 Ga0495648_0093130 3300046524 Bacteria 1681
1053 Ga0495666_0003127 3300046526 Bacteria 8320
1054 Ga0495666_0003603 3300046526 Bacteria 7826
1055 Ga0495642_0060718 3300046528 Bacteria 1568
1056 Ga0495652_0002837 3300046529 Bacteria 17453
1057 Ga0495652_0003775 3300046529 Bacteria 14784
1058 Ga0495652_0030800 3300046529 Bacteria 4702
1059 Ga0495652_0142277 3300046529 Bacteria 1885
1060 Ga0495654_0000152 3300046530 Bacteria 70943
1061 Ga0495654_0010946 3300046530 Bacteria 4928
1062 Ga0495665_0000248 3300046531 Bacteria 27116
1063 Ga0495665_0019828 3300046531 Bacteria 3616
1064 Ga0495665_0081361 3300046531 Bacteria 1703
1065 Ga0495665_0131765 3300046531 Bacteria 1308
1066 Ga0495640_0004111 3300046533 Bacteria 11641
1067 Ga0495640_0011322 3300046533 Bacteria 6868
1068 Ga0495640_0052202 3300046533 Bacteria 2809
1069 Ga0495640_0052535 3300046533 Bacteria 2798
1070 Ga0495640_0075248 3300046533 Bacteria 2255
1071 Ga0495640_0204190 3300046533 Bacteria 1251
1072 Ga0495587_0001588 3300046536 Bacteria 15129
1073 Ga0495587_0007583 3300046536 Bacteria 7020
1074 Ga0495587_0017552 3300046536 Bacteria 4445
1075 Ga0495587_0034998 3300046536 Bacteria 3026
1076 Ga0495587_0140324 3300046536 Bacteria 1379
1077 Ga0495587_0144334 3300046536 Bacteria 1357
1078 Ga0495609_0000055 3300046538 Bacteria 146808
1079 Ga0495609_0034031 3300046538 Bacteria 2311
1080 Ga0495609_0076648 3300046538 Bacteria 1465
1081 Ga0495621_0008537 3300046539 Bacteria 3077
1082 Ga0495597_0000067 3300046542 Bacteria 90183
1083 Ga0495645_0016916 3300046543 Bacteria 5219
1084 Ga0495645_0073011 3300046543 Bacteria 2472
1085 Ga0495622_0002046 3300046557 Bacteria 9854
1086 Ga0495633_0024938 3300046558 Bacteria 2950
1087 Ga0495633_0051932 3300046558 Bacteria 1931
1088 Ga0495667_0000128 3300046559 Bacteria 54804
1089 Ga0495667_0012503 3300046559 Bacteria 5756
1090 Ga0495667_0075699 3300046559 Bacteria 2190
1091 Ga0495667_0089013 3300046559 Bacteria 2001
1092 Ga0495656_0015749 3300046615 Bacteria 2860
1093 Ga0495656_0039529 3300046615 Bacteria 1960
1094 Ga0495656_0085056 3300046615 Bacteria 1435
1095 Ga0495656_0176301 3300046615 Bacteria 1048
1096 Ga0495668_0062032 3300046616 Bacteria 2060
1097 Ga0495634_0023145 3300046642 Bacteria 4369
1098 Ga0495634_0025613 3300046642 Bacteria 4122
1099 Ga0495634_0173839 3300046642 Bacteria 1352
1100 Ga0495625_0003310 3300046660 Bacteria 16253
1101 Ga0495625_0233903 3300046660 Bacteria 1199
1102 Ga0495635_0001128 3300046663 Bacteria 17791
1103 Ga0495635_0006917 3300046663 Bacteria 7923
1104 Ga0495635_0008480 3300046663 Bacteria 7178
1105 Ga0495635_0105169 3300046663 Bacteria 1928
1106 Ga0495635_0124386 3300046663 Bacteria 1759
1107 Ga0495635_0437632 3300046663 Bacteria 865
1108 Ga0495659_0030392 3300046664 Bacteria 1880
1109 Ga0495661_0004742 3300046665 Bacteria 9766
1110 Ga0495661_0029524 3300046665 Bacteria 3498
1111 Ga0495661_0070878 3300046665 Bacteria 2038
1112 Ga0495661_0098104 3300046665 Bacteria 1654
1113 Ga0495661_0121186 3300046665 Bacteria 1445
1114 Ga0495588_0004100 3300046674 Bacteria 6412
1115 Ga0495588_0034945 3300046674 Bacteria 2545
1116 Ga0495588_0100939 3300046674 Bacteria 1516
1117 Ga0495657_0003126 3300046675 Bacteria 13671
1118 Ga0495657_0019735 3300046675 Bacteria 4859
1119 Ga0495599_0002733 3300046678 Bacteria 10293
1120 Ga0495599_0007297 3300046678 Bacteria 6695
1121 Ga0495599_0010870 3300046678 Bacteria 5579
1122 Ga0495599_0181872 3300046678 Bacteria 1295
1123 Ga0495623_0006786 3300046679 Bacteria 7448
1124 Ga0495623_0017410 3300046679 Bacteria 4643
1125 Ga0495623_0022836 3300046679 Bacteria 4039
1126 Ga0495623_0098492 3300046679 Bacteria 1784
1127 Ga0495623_0168690 3300046679 Bacteria 1280
1128 Ga0495646_0000412 3300046680 Bacteria 22576
1129 Ga0495646_0014066 3300046680 Bacteria 5088
1130 Ga0495646_0022116 3300046680 Bacteria 4013
1131 Ga0495646_0036082 3300046680 Bacteria 3065
1132 Ga0495646_0046613 3300046680 Bacteria 2642
1133 Ga0495646_0205430 3300046680 Bacteria 1071
1134 Ga0495647_0000541 3300046681 Bacteria 11104
1135 Ga0495647_0053660 3300046681 Bacteria 1573
1136 Ga0495658_0002607 3300046683 Bacteria 9063
1137 Ga0495613_0062657 3300046689 Bacteria 2721
1138 Ga0495613_0195181 3300046689 Bacteria 1429
1139 Ga0495613_0231293 3300046689 Bacteria 1295
1140 Ga0495624_0001790 3300046690 Bacteria 16446
1141 Ga0495624_0009857 3300046690 Bacteria 6605
1142 Ga0495624_0034248 3300046690 Bacteria 3286
1143 Ga0495624_0102532 3300046690 Bacteria 1761
1144 Ga0495670_0000775 3300046691 Bacteria 15311
1145 Ga0495670_0003510 3300046691 Bacteria 7696
1146 Ga0495671_0007355 3300046692 Bacteria 6285
1147 Ga0495671_0089719 3300046692 Bacteria 1505
1148 Ga0495649_0031993 3300046694 Bacteria 2900
1149 Ga0495649_0100456 3300046694 Bacteria 1538
1150 Ga0495649_0109360 3300046694 Bacteria 1466
1151 Ga0495600_0000630 3300046809 Bacteria 18197
1152 Ga0495600_0001270 3300046809 Bacteria 13925
1153 Ga0495600_0005826 3300046809 Bacteria 7449
1154 Ga0495600_0078397 3300046809 Bacteria 2157
1155 Ga0495660_0000639 3300046810 Bacteria 27219
1156 Ga0495660_0005079 3300046810 Bacteria 7907
1157 Ga0495660_0055865 3300046810 Bacteria 2136
1158 Ga0495581_0001004 3300047315 Bacteria 15232
1159 Ga0495581_0028284 3300047315 Bacteria 3250
1160 Ga0495581_0029693 3300047315 Bacteria 3168
1161 Ga0495604_0003361 3300047317 Bacteria 12760
1162 Ga0495604_0007172 3300047317 Bacteria 8829
1163 Ga0495604_0015742 3300047317 Bacteria 6036
1164 Ga0495604_0023467 3300047317 Bacteria 4921
1165 Ga0495604_0033682 3300047317 Bacteria 4054
1166 Ga0495604_0041977 3300047317 Bacteria 3586
1167 Ga0495604_0051018 3300047317 Bacteria 3210
1168 Ga0495604_0193677 3300047317 Bacteria 1415
1169 Ga0495636_0017842 3300047318 Bacteria 2843
1170 Ga0495674_0002207 3300047319 Bacteria 19142
1171 Ga0495674_0010840 3300047319 Bacteria 8620
1172 Ga0495674_0011690 3300047319 Bacteria 8282
1173 Ga0495674_0026886 3300047319 Bacteria 5263
1174 Ga0495674_0029042 3300047319 Bacteria 5037
1175 Ga0495674_0081886 3300047319 Bacteria 2768
1176 Ga0495672_0002625 3300047320 Bacteria 16239
1177 Ga0495672_0011801 3300047320 Bacteria 6138
1178 Ga0495672_0045229 3300047320 Bacteria 2636
1179 Ga0495672_0065297 3300047320 Bacteria 2081
1180 Ga0495672_0151782 3300047320 Bacteria 1201
1181 Ga0495676_0036490 3300047321 Bacteria 4104
1182 Ga0495676_0045710 3300047321 Bacteria 3561
1183 Ga0495676_0090598 3300047321 Bacteria 2288
1184 Ga0495680_0000424 3300047322 Bacteria 47310
1185 Ga0495680_0001973 3300047322 Bacteria 21554
1186 Ga0495680_0016955 3300047322 Bacteria 6238
1187 Ga0495680_0030826 3300047322 Bacteria 4372
1188 Ga0495680_0108550 3300047322 Bacteria 2059
1189 Ga0495683_0005297 3300047323 Bacteria 7166
1190 Ga0495683_0062512 3300047323 Bacteria 1842
1191 Ga0495687_008477 3300047443 Bacteria 5881
1192 Ga0495675_0000012 3300047444 Bacteria 146748
1193 Ga0495675_0000345 3300047444 Bacteria 32608
1194 Ga0495675_0004966 3300047444 Bacteria 8098
1195 Ga0495675_0097120 3300047444 Bacteria 1846
1196 Ga0495679_007570 3300047446 Bacteria 4512
1197 Ga0495679_012872 3300047446 Bacteria 3164
1198 Ga0495679_030186 3300047446 Bacteria 1762
1199 Ga0495673_0000530 3300047469 Bacteria 39656
1200 Ga0495673_0014011 3300047469 Bacteria 4185
1201 Ga0495673_0036088 3300047469 Bacteria 2271
1202 Ga0495681_0000443 3300047470 Bacteria 31697
1203 Ga0495681_0005328 3300047470 Bacteria 8630
1204 Ga0495681_0061535 3300047470 Bacteria 1729
1205 Ga0495684_0000152 3300047471 Bacteria 51013
1206 Ga0495684_0000650 3300047471 Bacteria 27935
1207 Ga0495684_0023995 3300047471 Bacteria 4692
1208 Ga0495684_0026007 3300047471 Bacteria 4498
1209 Ga0495684_0071430 3300047471 Bacteria 2638
1210 Ga0495684_0227102 3300047471 Bacteria 1366
1211 Ga0495686_0010693 3300047472 Bacteria 6515
1212 Ga0495686_0018987 3300047472 Bacteria 4600
1213 Ga0495686_0027943 3300047472 Bacteria 3677
1214 Ga0495686_0073951 3300047472 Bacteria 2092
1215 Ga0495593_0000312 3300047673 Bacteria 26693
1216 Ga0495593_0058804 3300047673 Bacteria 2015
1217 Ga0495602_0003796 3300048088 Bacteria 15712
1218 Ga0495602_0005890 3300048088 Bacteria 12875
1219 Ga0495602_0010425 3300048088 Bacteria 9646
1220 Ga0495602_0040539 3300048088 Bacteria 4267
1221 Ga0495602_0059530 3300048088 Bacteria 3333
1222 Ga0495602_0064539 3300048088 Bacteria 3165
1223 Ga0495602_0081111 3300048088 Bacteria 2729
1224 Ga0495614_0002892 3300048089 Bacteria 7646
1225 Ga0495614_0041269 3300048089 Bacteria 1979
1226 Ga0495626_0000412 3300048091 Bacteria 43929
1227 Ga0496100_0044702 3300048903 Bacteria 2838
1228 Ga0496100_0099648 3300048903 Bacteria 2000
1229 Ga0496100_0147242 3300048903 Bacteria 1676
1230 Ga0496100_0178180 3300048903 Bacteria 1536
1231 Ga0496101_0002458 3300048904 Bacteria 11379
1232 Ga0496101_0062275 3300048904 Bacteria 2712
1233 Ga0496101_0300851 3300048904 Bacteria 1256
1234 Ga0496101_0325577 3300048904 Bacteria 1206
1235 Ga0496101_0392766 3300048904 Bacteria 1092
1236 Ga0496102_0007740 3300048905 Bacteria 9181
1237 Ga0496102_0058983 3300048905 Bacteria 3508
1238 Ga0496102_0069817 3300048905 Bacteria 3225
1239 Ga0496102_0229272 3300048905 Bacteria 1751
1240 Ga0496103_0097643 3300048906 Bacteria 1857
1241 Ga0496103_0171094 3300048906 Bacteria 1395
1242 Ga0496103_0184669 3300048906 Bacteria 1340
1243 Ga0496103_0209957 3300048906 Bacteria 1252
1244 Ga0496104_0001994 3300048907 Bacteria 17714
1245 Ga0496104_0075355 3300048907 Bacteria 3212
1246 Ga0496104_0077974 3300048907 Bacteria 3157
1247 Ga0496104_0137566 3300048907 Bacteria 2346
1248 Ga0496104_0284182 3300048907 Bacteria 1567
1249 Ga0496104_0365080 3300048907 Bacteria 1356
1250 Ga0496105_0001254 3300048908 Bacteria 17716
1251 Ga0496105_0002533 3300048908 Bacteria 13261
1252 Ga0496105_0043339 3300048908 Bacteria 3711
1253 Ga0496105_0100971 3300048908 Bacteria 2382
1254 Ga0496105_0119133 3300048908 Bacteria 2177
1255 Ga0496105_0224771 3300048908 Bacteria 1527
1256 Ga0496105_0310946 3300048908 Unclassified 1265
1257 Ga0496106_0000001 3300048909 Bacteria 497458
1258 Ga0496106_0001555 3300048909 Bacteria 17284
1259 Ga0496106_0002423 3300048909 Bacteria 13907
1260 Ga0496106_0093536 3300048909 Bacteria 2323
1261 Ga0496107_0126110 3300048910 Bacteria 1888
1262 Ga0496107_0147709 3300048910 Bacteria 1738
1263 Ga0496108_0001200 3300048911 Bacteria 20310
1264 Ga0496108_0007201 3300048911 Bacteria 9016
1265 Ga0496108_0082301 3300048911 Bacteria 2729
1266 Ga0496108_0175535 3300048911 Bacteria 1855
1267 Ga0496109_0017496 3300048912 Bacteria 6284
1268 Ga0496109_0077295 3300048912 Bacteria 3063
1269 Ga0496109_0116944 3300048912 Bacteria 2481
1270 Ga0496109_0202773 3300048912 Bacteria 1865
1271 Ga0496110_0006609 3300048913 Bacteria 9210
1272 Ga0496110_0016649 3300048913 Bacteria 6141
1273 Ga0496110_0017235 3300048913 Bacteria 6041
1274 Ga0496110_0124895 3300048913 Bacteria 2321
1275 Ga0496110_0203472 3300048913 Bacteria 1799
1276 Ga0496110_0204316 3300048913 Bacteria 1795
1277 Ga0496110_0251259 3300048913 Bacteria 1609
1278 Ga0496111_0001890 3300048914 Bacteria 12398
1279 Ga0496111_0056382 3300048914 Bacteria 2843
1280 Ga0496111_0246191 3300048914 Bacteria 1327
1281 Ga0496112_0000004 3300048915 Bacteria 553294
1282 Ga0496112_0001865 3300048915 Bacteria 16603
1283 Ga0496112_0004442 3300048915 Bacteria 11884
1284 Ga0496112_0017703 3300048915 Bacteria 6704
1285 Ga0496112_0045152 3300048915 Bacteria 4319
1286 Ga0496112_0067255 3300048915 Bacteria 3536
1287 Ga0496112_0127936 3300048915 Bacteria 2511
1288 Ga0496112_0130508 3300048915 Bacteria 2484
1289 Ga0496112_0146867 3300048915 Bacteria 2326
1290 Ga0496112_0401379 3300048915 Bacteria 1311
1291 Ga0496113_0000167 3300048916 Bacteria 29216
1292 Ga0496113_0137186 3300048916 Bacteria 1923
1293 Ga0496113_0180894 3300048916 Bacteria 1671
1294 Ga0496114_0028876 3300048917 Bacteria 4556
1295 Ga0496115_0007883 3300048918 Bacteria 7857
1296 Ga0496115_0044765 3300048918 Bacteria 3532
1297 Ga0496115_0065352 3300048918 Bacteria 2938
1298 Ga0496115_0092659 3300048918 Bacteria 2470
1299 Ga0496115_0438548 3300048918 Bacteria 1056
1300 Ga0496116_0000583 3300048919 Bacteria 48822
1301 Ga0496116_0002160 3300048919 Bacteria 20948
1302 Ga0496116_0012189 3300048919 Bacteria 7034
1303 Ga0496116_0031220 3300048919 Bacteria 3818
1304 Ga0496116_0051150 3300048919 Bacteria 2746
1305 Ga0496116_0078209 3300048919 Bacteria 2064
1306 Ga0496116_0095280 3300048919 Bacteria 1797
1307 Ga0496116_0097437 3300048919 Bacteria 1768
1308 Ga0496116_0132979 3300048919 Bacteria 1414
1309 Ga0496117_0001578 3300048920 Bacteria 32349
1310 Ga0496117_0003177 3300048920 Bacteria 19535
1311 Ga0496117_0005820 3300048920 Bacteria 12770
1312 Ga0496117_0019052 3300048920 Bacteria 5654
1313 Ga0496117_0019106 3300048920 Bacteria 5642
1314 Ga0496117_0033438 3300048920 Bacteria 3887
1315 Ga0496117_0041847 3300048920 Bacteria 3350
1316 Ga0496117_0043610 3300048920 Bacteria 3259
1317 Ga0496117_0047973 3300048920 Bacteria 3056
1318 Ga0496118_0001250 3300048921 Bacteria 39043
1319 Ga0496118_0001550 3300048921 Bacteria 34182
1320 Ga0496118_0003916 3300048921 Bacteria 18225
1321 Ga0496118_0007940 3300048921 Bacteria 11103
1322 Ga0496118_0010621 3300048921 Bacteria 9089
1323 Ga0496118_0018142 3300048921 Bacteria 6363
1324 Ga0496118_0018819 3300048921 Bacteria 6202
1325 Ga0496118_0022210 3300048921 Bacteria 5557
1326 Ga0496118_0074733 3300048921 Bacteria 2421
1327 Ga0496118_0095666 3300048921 Bacteria 2026
1328 Ga0496119_0000478 3300048922 Bacteria 54715
1329 Ga0496119_0003724 3300048922 Bacteria 15612
1330 Ga0496119_0018131 3300048922 Bacteria 5256
1331 Ga0496119_0044797 3300048922 Bacteria 2781
1332 Ga0496119_0047345 3300048922 Bacteria 2676
1333 Ga0496119_0106791 3300048922 Bacteria 1562
1334 Ga0496119_0128198 3300048922 Bacteria 1386
1335 Ga0496119_0140555 3300048922 Bacteria 1304
1336 Ga0496119_0154324 3300048922 Bacteria 1227
1337 Ga0496119_0175957 3300048922 Bacteria 1126
1338 Ga0496120_0004181 3300048923 Bacteria 12366
1339 Ga0496120_0032516 3300048923 Bacteria 3145
1340 Ga0496120_0072457 3300048923 Bacteria 1888
1341 Ga0496120_0091942 3300048923 Bacteria 1619
1342 Ga0496120_0118123 3300048923 Bacteria 1375
1343 Ga0496121_0000077 3300048924 Bacteria 235293
1344 Ga0496121_0000138 3300048924 Bacteria 163543
1345 Ga0496121_0000240 3300048924 Bacteria 117890
1346 Ga0496121_0000508 3300048924 Bacteria 74420
1347 Ga0496121_0005416 3300048924 Bacteria 16386
1348 Ga0496121_0009567 3300048924 Bacteria 11105
1349 Ga0496121_0011095 3300048924 Bacteria 10054
1350 Ga0496121_0020142 3300048924 Bacteria 6622
1351 Ga0496121_0022123 3300048924 Bacteria 6185
1352 Ga0496121_0049017 3300048924 Bacteria 3587
1353 Ga0496121_0057423 3300048924 Bacteria 3226
1354 Ga0496121_0063125 3300048924 Bacteria 3029
1355 Ga0496121_0067138 3300048924 Bacteria 2908
1356 Ga0496121_0073281 3300048924 Bacteria 2745
1357 Ga0496121_0086614 3300048924 Bacteria 2461
1358 Ga0496121_0097775 3300048924 Bacteria 2273
1359 Ga0496121_0101104 3300048924 Bacteria 2224
1360 Ga0496121_0103679 3300048924 Bacteria 2187
1361 Ga0496121_0112567 3300048924 Bacteria 2073
1362 Ga0496121_0124232 3300048924 Bacteria 1943
1363 Ga0496121_0159667 3300048924 Bacteria 1650
1364 Ga0496121_0171067 3300048924 Bacteria 1578
1365 Ga0496121_0197239 3300048924 Bacteria 1438
1366 Ga0496121_0199321 3300048924 Bacteria 1428
1367 Ga0496122_0000214 3300048925 Bacteria 129132
1368 Ga0496122_0000634 3300048925 Bacteria 71553
1369 Ga0496122_0000889 3300048925 Bacteria 55661
1370 Ga0496122_0003070 3300048925 Bacteria 22517
1371 Ga0496122_0007213 3300048925 Bacteria 12440
1372 Ga0496122_0008693 3300048925 Bacteria 10880
1373 Ga0496122_0010631 3300048925 Bacteria 9454
1374 Ga0496122_0020439 3300048925 Bacteria 5982
1375 Ga0496122_0021407 3300048925 Bacteria 5790
1376 Ga0496122_0022345 3300048925 Bacteria 5626
1377 Ga0496122_0035330 3300048925 Bacteria 4068
1378 Ga0496122_0040105 3300048925 Bacteria 3726
1379 Ga0496122_0075500 3300048925 Bacteria 2377
1380 Ga0496122_0076791 3300048925 Bacteria 2349
1381 Ga0496122_0112977 3300048925 Bacteria 1776
1382 Ga0496122_0143621 3300048925 Bacteria 1488
1383 Ga0496123_0000289 3300048926 Bacteria 98253
1384 Ga0496123_0000736 3300048926 Bacteria 53090
1385 Ga0496123_0003134 3300048926 Bacteria 18968
1386 Ga0496123_0005560 3300048926 Bacteria 12623
1387 Ga0496123_0007007 3300048926 Bacteria 10749
1388 Ga0496123_0007137 3300048926 Bacteria 10613
1389 Ga0496123_0018413 3300048926 Bacteria 5559
1390 Ga0496123_0018897 3300048926 Bacteria 5457
1391 Ga0496123_0033027 3300048926 Bacteria 3732
1392 Ga0496123_0080981 3300048926 Bacteria 1975
1393 Ga0496123_0110235 3300048926 Bacteria 1575
1394 Ga0496123_0145662 3300048926 Bacteria 1287
1395 Ga0496124_0000023 3300048927 Bacteria 415226
1396 Ga0496124_0000139 3300048927 Bacteria 149873
1397 Ga0496124_0002954 3300048927 Bacteria 21347
1398 Ga0496124_0005342 3300048927 Bacteria 14501
1399 Ga0496124_0008253 3300048927 Bacteria 10922
1400 Ga0496124_0017130 3300048927 Bacteria 6848
1401 Ga0496124_0021305 3300048927 Bacteria 5974
1402 Ga0496124_0022423 3300048927 Bacteria 5788
1403 Ga0496124_0086064 3300048927 Bacteria 2573
1404 Ga0496124_0089120 3300048927 Bacteria 2519
1405 Ga0496124_0098614 3300048927 Bacteria 2370
1406 Ga0496124_0133193 3300048927 Bacteria 1972
1407 Ga0496124_0168714 3300048927 Bacteria 1698
1408 Ga0496125_0000125 3300048928 Bacteria 169979
1409 Ga0496125_0000182 3300048928 Bacteria 137747
1410 Ga0496125_0004131 3300048928 Bacteria 16954
1411 Ga0496125_0008255 3300048928 Bacteria 10936
1412 Ga0496125_0022162 3300048928 Bacteria 5903
1413 Ga0496125_0050765 3300048928 Bacteria 3430
1414 Ga0496125_0053684 3300048928 Bacteria 3301
1415 Ga0496125_0080288 3300048928 Bacteria 2497
1416 Ga0496125_0088454 3300048928 Bacteria 2334
1417 Ga0496126_0014174 3300048929 Bacteria 8069
1418 Ga0496126_0018962 3300048929 Bacteria 6795
1419 Ga0496126_0023164 3300048929 Bacteria 6020
1420 Ga0496126_0025338 3300048929 Bacteria 5707
1421 Ga0496126_0037600 3300048929 Bacteria 4515
1422 Ga0496126_0047500 3300048929 Bacteria 3929
1423 Ga0496126_0057800 3300048929 Bacteria 3499
1424 Ga0496126_0074477 3300048929 Bacteria 3015
1425 Ga0496126_0100821 3300048929 Bacteria 2526
1426 Ga0496126_0102228 3300048929 Bacteria 2506
1427 Ga0496126_0107087 3300048929 Bacteria 2438
1428 Ga0496126_0167438 3300048929 Bacteria 1874
1429 Ga0496126_0257743 3300048929 Bacteria 1451
1430 Ga0496126_0259561 3300048929 Bacteria 1445
1431 Ga0496126_0308974 3300048929 Bacteria 1302
1432 Ga0496126_0359078 3300048929 Bacteria 1190
1433 Ga0495678_000143 3300049459 Bacteria 86601
1434 Ga0495678_010019 3300049459 Bacteria 4633
1435 Ga0495682_0015217 3300049460 Bacteria 2915
1436 Ga0495682_0026635 3300049460 Bacteria 2145
1437 Ga0501031_0002561 3300049568 Bacteria 11583
1438 Ga0501031_0028662 3300049568 Bacteria 3630
1439 Ga0501031_0094997 3300049568 Bacteria 1945
1440 Ga0501031_0351448 3300049568 Bacteria 954
1441 Ga0501032_0000345 3300049569 Bacteria 38831
1442 Ga0501032_0004619 3300049569 Bacteria 10359
1443 Ga0501032_0014407 3300049569 Bacteria 5601
1444 Ga0501032_0043053 3300049569 Bacteria 3060
1445 Ga0501032_0094655 3300049569 Bacteria 1980
1446 Ga0501032_0113716 3300049569 Bacteria 1790
1447 Ga0501032_0221444 3300049569 Bacteria 1231
1448 Ga0501033_0000094 3300049570 Bacteria 84669
1449 Ga0501033_0071416 3300049570 Bacteria 2550
1450 Ga0501033_0075574 3300049570 Bacteria 2473
1451 Ga0501034_0000021 3300049571 Bacteria 266023
1452 Ga0501034_0001365 3300049571 Bacteria 32928
1453 Ga0501034_0003055 3300049571 Bacteria 19328
1454 Ga0501034_0022443 3300049571 Bacteria 6432
1455 Ga0501034_0034037 3300049571 Bacteria 5166
1456 Ga0501034_0069730 3300049571 Bacteria 3526
1457 Ga0501034_0089924 3300049571 Bacteria 3068
1458 Ga0501034_0125451 3300049571 Bacteria 2552
1459 Ga0501034_0434183 3300049571 Bacteria 1233
1460 Ga0501036_0000115 3300049572 Bacteria 49866
1461 Ga0501036_0001315 3300049572 Bacteria 19056
1462 Ga0501036_0045657 3300049572 Bacteria 3711
1463 Ga0501036_0046107 3300049572 Bacteria 3691
1464 Ga0501036_0100560 3300049572 Bacteria 2446
1465 Ga0501036_0237736 3300049572 Bacteria 1528
1466 Ga0501036_0390838 3300049572 Bacteria 1160
1467 Ga0501037_0000174 3300049573 Bacteria 60960
1468 Ga0501037_0004241 3300049573 Bacteria 10400
1469 Ga0501037_0041694 3300049573 Bacteria 3375
1470 Ga0501037_0100343 3300049573 Bacteria 2090
1471 Ga0501037_0102588 3300049573 Bacteria 2063
1472 Ga0501037_0166634 3300049573 Bacteria 1568
1473 Ga0501037_0360432 3300049573 Bacteria 1002
1474 Ga0501038_0000052 3300049574 Bacteria 94841
1475 Ga0501038_0002280 3300049574 Bacteria 17849
1476 Ga0501038_0072671 3300049574 Bacteria 2914
1477 Ga0501038_0154527 3300049574 Bacteria 1869
1478 Ga0501038_0175509 3300049574 Bacteria 1732
1479 Ga0501038_0177594 3300049574 Bacteria 1720
1480 Ga0501038_0182308 3300049574 Bacteria 1693
1481 Ga0501038_0231026 3300049574 Bacteria 1472
1482 Ga0501038_0298123 3300049574 Bacteria 1266
1483 Ga0501038_0303181 3300049574 Bacteria 1253
1484 Ga0501038_0305539 3300049574 Bacteria 1247
1485 Ga0501039_0000156 3300049575 Bacteria 47049
1486 Ga0501039_0002927 3300049575 Bacteria 12775
1487 Ga0501039_0035313 3300049575 Bacteria 3858
1488 Ga0501039_0053328 3300049575 Bacteria 3129
1489 Ga0501039_0089917 3300049575 Bacteria 2393
1490 Ga0501039_0126434 3300049575 Bacteria 2005
1491 Ga0501039_0415884 3300049575 Bacteria 1056
1492 Ga0501040_0007819 3300049576 Bacteria 6924
1493 Ga0501040_0156679 3300049576 Bacteria 1608
1494 Ga0501040_0210466 3300049576 Bacteria 1382
1495 Ga0501041_0031853 3300049577 Bacteria 3187
1496 Ga0501041_0144812 3300049577 Bacteria 1482
1497 Ga0501041_0163440 3300049577 Bacteria 1392
1498 Ga0501042_0003824 3300049578 Bacteria 9518
1499 Ga0501042_0038784 3300049578 Bacteria 3383
1500 Ga0501042_0191035 3300049578 Unclassified 1477
1501 Ga0501043_0003891 3300049579 Bacteria 12258
1502 Ga0501043_0007149 3300049579 Bacteria 8880
1503 Ga0501043_0016367 3300049579 Bacteria 5815
1504 Ga0501043_0074640 3300049579 Bacteria 2664
1505 Ga0501043_0126694 3300049579 Bacteria 2002
1506 Ga0501043_0222221 3300049579 Bacteria 1461
1507 Ga0501043_0281092 3300049579 Bacteria 1276
1508 Ga0501046_0000133 3300049580 Bacteria 79467
1509 Ga0501046_0002355 3300049580 Bacteria 17801
1510 Ga0501046_0028960 3300049580 Bacteria 4507
1511 Ga0501046_0031080 3300049580 Bacteria 4332
1512 Ga0501046_0060481 3300049580 Bacteria 2964
1513 Ga0501046_0077958 3300049580 Bacteria 2564
1514 Ga0501046_0205588 3300049580 Bacteria 1464
1515 Ga0501047_0000440 3300049581 Bacteria 46007
1516 Ga0501047_0003444 3300049581 Bacteria 14966
1517 Ga0501047_0003515 3300049581 Bacteria 14801
1518 Ga0501047_0007345 3300049581 Bacteria 10359
1519 Ga0501047_0015373 3300049581 Bacteria 7289
1520 Ga0501047_0045708 3300049581 Bacteria 4233
1521 Ga0501047_0090883 3300049581 Bacteria 2930
1522 Ga0501047_0106562 3300049581 Bacteria 2684
1523 Ga0501047_0128951 3300049581 Bacteria 2410
1524 Ga0501047_0132255 3300049581 Bacteria 2375
1525 Ga0501048_0000072 3300049582 Bacteria 51953
1526 Ga0501048_0001333 3300049582 Bacteria 18714
1527 Ga0501048_0057148 3300049582 Bacteria 2767
1528 Ga0501048_0123404 3300049582 Bacteria 1831
1529 Ga0501067_0000076 3300049583 Bacteria 56529
1530 Ga0501067_0023326 3300049583 Bacteria 3429
1531 Ga0501067_0045029 3300049583 Bacteria 2451
1532 Ga0501067_0086204 3300049583 Bacteria 1743
1533 Ga0501068_0001765 3300049584 Bacteria 11496
1534 Ga0501068_0008449 3300049584 Bacteria 5730
1535 Ga0501068_0258118 3300049584 Bacteria 1111
1536 Ga0501069_0013671 3300049585 Bacteria 4331
1537 Ga0501069_0106904 3300049585 Bacteria 1591
1538 Ga0501069_0174958 3300049585 Bacteria 1239
1539 Ga0501070_0001529 3300049586 Bacteria 20585
1540 Ga0501070_0006975 3300049586 Bacteria 9611
1541 Ga0501070_0011558 3300049586 Bacteria 7452
1542 Ga0501070_0031178 3300049586 Bacteria 4466
1543 Ga0501070_0079684 3300049586 Bacteria 2710
1544 Ga0501070_0090655 3300049586 Bacteria 2530
1545 Ga0501070_0385348 3300049586 Bacteria 1135
1546 Ga0501071_0002932 3300049587 Bacteria 10537
1547 Ga0501071_0077841 3300049587 Bacteria 2423
1548 Ga0501071_0088864 3300049587 Bacteria 2267
1549 Ga0501071_0122632 3300049587 Bacteria 1927
1550 Ga0501072_0001658 3300049588 Bacteria 16605
1551 Ga0501072_0033267 3300049588 Bacteria 4040
1552 Ga0501072_0056563 3300049588 Bacteria 3091
1553 Ga0501072_0101669 3300049588 Bacteria 2285
1554 Ga0501072_0229988 3300049588 Bacteria 1477
1555 Ga0501073_0000065 3300049589 Bacteria 65736
1556 Ga0501073_0000099 3300049589 Bacteria 55207
1557 Ga0501073_0007507 3300049589 Bacteria 8099
1558 Ga0501073_0011276 3300049589 Bacteria 6539
1559 Ga0501073_0042714 3300049589 Bacteria 3199
1560 Ga0501073_0050453 3300049589 Bacteria 2916
1561 Ga0501074_0002696 3300049590 Bacteria 12434
1562 Ga0501074_0044377 3300049590 Bacteria 3219
1563 Ga0501074_0054018 3300049590 Bacteria 2897
1564 Ga0501074_0055023 3300049590 Bacteria 2869
1565 Ga0501074_0071192 3300049590 Bacteria 2500
1566 Ga0501074_0137314 3300049590 Bacteria 1749
1567 Ga0501074_0184445 3300049590 Bacteria 1488
1568 Ga0501075_0045988 3300049591 Bacteria 3278
1569 Ga0501075_0373331 3300049591 Bacteria 1087
1570 Ga0501076_0030980 3300049592 Bacteria 4168
1571 Ga0501076_0031880 3300049592 Bacteria 4113
1572 Ga0501077_0037985 3300049593 Bacteria 3066
1573 Ga0501077_0039610 3300049593 Bacteria 3002
1574 Ga0501077_0130878 3300049593 Bacteria 1591
1575 Ga0501079_0004389 3300049741 Bacteria 10442
1576 Ga0501079_0005301 3300049741 Bacteria 9593
1577 Ga0501079_0026282 3300049741 Bacteria 4463
1578 Ga0501079_0074304 3300049741 Bacteria 2628
1579 Ga0501079_0171779 3300049741 Bacteria 1690
1580 Ga0501079_0341865 3300049741 Bacteria 1172
1581 Ga0501080_0000658 3300049742 Bacteria 27440
1582 Ga0501080_0002779 3300049742 Bacteria 15373
1583 Ga0501080_0106418 3300049742 Bacteria 2599
1584 Ga0501083_0000604 3300049744 Bacteria 23119
1585 Ga0501083_0001450 3300049744 Bacteria 16195
1586 Ga0501083_0012684 3300049744 Bacteria 5896
1587 Ga0501083_0014028 3300049744 Bacteria 5601
1588 Ga0501083_0016470 3300049744 Bacteria 5174
1589 Ga0501280_001117 3300049776 Bacteria 5384
1590 Ga0501035_0000255 3300049822 Bacteria 63841
1591 Ga0501035_0003219 3300049822 Bacteria 15648
1592 Ga0501035_0007115 3300049822 Bacteria 10458
1593 Ga0501035_0011601 3300049822 Bacteria 8169
1594 Ga0501035_0022569 3300049822 Bacteria 5780
1595 Ga0501035_0032578 3300049822 Bacteria 4740
1596 Ga0501035_0046753 3300049822 Bacteria 3892
1597 Ga0501035_0090286 3300049822 Bacteria 2697
1598 Ga0501035_0163509 3300049822 Bacteria 1926
1599 Ga0501035_0165171 3300049822 Bacteria 1915
1600 Ga0501035_0292287 3300049822 Bacteria 1375
1601 Ga0501035_0293900 3300049822 Bacteria 1371
1602 Ga0501044_0000141 3300049823 Bacteria 88569
1603 Ga0501044_0002860 3300049823 Bacteria 19649
1604 Ga0501044_0031151 3300049823 Bacteria 5616
1605 Ga0501044_0032771 3300049823 Bacteria 5461
1606 Ga0501044_0046301 3300049823 Bacteria 4504
1607 Ga0501044_0063135 3300049823 Bacteria 3785
1608 Ga0501044_0131610 3300049823 Bacteria 2495
1609 Ga0501044_0143343 3300049823 Bacteria 2377
1610 Ga0501044_0153413 3300049823 Bacteria 2284
1611 Ga0501044_0313589 3300049823 Bacteria 1494
1612 Ga0501044_0347259 3300049823 Bacteria 1404
1613 Ga0501044_0528425 3300049823 Bacteria 1079
1614 Ga0501045_0003550 3300049824 Bacteria 10707
1615 Ga0501045_0030185 3300049824 Bacteria 3922
1616 Ga0501045_0037949 3300049824 Bacteria 3504
1617 nmdc:mga03n38_113048_c1 3300050490 Bacteria 1325
1618 nmdc:mga00v17_112602_c1 3300050491 Bacteria 1727
1619 nmdc:mga00v17_11836_c1 3300050491 Bacteria 4800
1620 nmdc:mga00v17_122319_c1 3300050491 Bacteria 1658
1621 nmdc:mga00v17_178_c1 3300050491 Bacteria 37572
1622 nmdc:mga00v17_26284_c1 3300050491 Bacteria 3391
1623 nmdc:mga00v17_33021_c1 3300050491 Bacteria 3063
1624 nmdc:mga00v17_63931_c1 3300050491 Bacteria 2267
1625 nmdc:mga00v17_91223_c1 3300050491 Bacteria 1914
1626 nmdc:mga0yw44_117362_c1 3300050492 Bacteria 1357
1627 nmdc:mga0yw44_170150_c1 3300050492 Bacteria 1430
1628 nmdc:mga0yw44_197982_c1 3300050492 Bacteria 1326
1629 nmdc:mga0yw44_24041_c1 3300050492 Bacteria 3442
1630 nmdc:mga0yw44_289666_c1 3300050492 Bacteria 1095
1631 nmdc:mga0yw44_347507_c1 3300050492 Bacteria 998
1632 nmdc:mga0yw44_71422_c1 3300050492 Bacteria 2155
1633 nmdc:mga0k408_107321_c1 3300050493 Bacteria 1649
1634 nmdc:mga0k408_21847_c1 3300050493 Bacteria 3599
1635 nmdc:mga06z11_25288_c1 3300050494 Bacteria 2812
1636 nmdc:mga06z11_5600_c1 3300050494 Bacteria 5052
1637 nmdc:mga04h51_62746_c1 3300050495 Bacteria 1278
1638 nmdc:mga04h51_76776_c1 3300050495 Bacteria 1178
1639 nmdc:mga07m45_104095_c1 3300050496 Bacteria 1632
1640 nmdc:mga07m45_1811_c1 3300050496 Bacteria 9847
1641 nmdc:mga07m45_72816_c1 3300050496 Bacteria 1956
1642 nmdc:mga07m45_86591_c2 3300050496 Bacteria 1469
1643 nmdc:mga05p37_150931_c1 3300050507 Bacteria 2472
1644 nmdc:mga05p37_156848_c1 3300050507 Bacteria 2781
1645 nmdc:mga05p37_185331_c1 3300050507 Bacteria 2530
1646 nmdc:mga05p37_2636_c1 3300050507 Bacteria 20883
1647 nmdc:mga05p37_3032_c1 3300050507 Bacteria 19509
1648 nmdc:mga05p37_967_c1 3300050507 Bacteria 32558
1649 nmdc:mga09592_25520_c1 3300050508 Bacteria 4892
1650 nmdc:mga09592_3458_c1 3300050508 Bacteria 12754
1651 nmdc:mga09592_41226_c1 3300050508 Bacteria 3881
1652 nmdc:mga09592_858_c1 3300050508 Bacteria 23710
1653 nmdc:mga09592_9739_c1 3300050508 Bacteria 7805
1654 nmdc:mga0qj67_68379_c1 3300050509 Bacteria 2831
1655 nmdc:mga0qj67_82897_c1 3300050509 Bacteria 2571
1656 nmdc:mga06r32_11440_c1 3300050510 Bacteria 7992
1657 nmdc:mga06r32_34004_c1 3300050510 Bacteria 4805
1658 nmdc:mga06r32_6916_c1 3300050510 Bacteria 10198
1659 nmdc:mga06r32_7062_c1 3300050510 Bacteria 10103
1660 nmdc:mga08y16_92726_c1 3300050511 Bacteria 3147
1661 nmdc:mga0n895_2596_c1 3300050512 Bacteria 14193
1662 nmdc:mga0rr50_26740_c1 3300050513 Bacteria 4031
1663 nmdc:mga0rr50_429_c1 3300050513 Bacteria 22601
1664 nmdc:mga08x19_132698_c1 3300050514 Bacteria 1676
1665 nmdc:mga08x19_767_c1 3300050514 Bacteria 20471
1666 nmdc:mga08x19_92852_c1 3300050514 Bacteria 1994
1667 nmdc:mga0a205_38067_c1 3300050515 Bacteria 4627
1668 nmdc:mga0sz30_10577_c1 3300050516 Bacteria 3539
1669 nmdc:mga0sz30_35523_c1 3300050516 Bacteria 2080
1670 nmdc:mga0sz30_41570_c1 3300050516 Bacteria 1933
1671 nmdc:mga0sz30_92061_c1 3300050516 Bacteria 1320
1672 Ga0495601_0144464 3300053077 Bacteria 1552
1673 Ga0495612_0072117 3300053078 Bacteria 1441
1674 Ga0495612_0127770 3300053078 Bacteria 1097
1675 Ga0500635_0014595 3300053080 Bacteria 2305
1676 Ga0500635_0022450 3300053080 Bacteria 1956
1677 Ga0500635_0031115 3300053080 Bacteria 1725
1678 Ga0495595_0000309 3300053084 Bacteria 19034
1679 Ga0495595_0007183 3300053084 Bacteria 4552
1680 Ga0495619_0004295 3300053085 Bacteria 9087
1681 Ga0495619_0035622 3300053085 Bacteria 3237
1682 Ga0495619_0145203 3300053085 Bacteria 1635
1683 Ga0500643_000114 3300053087 Bacteria 84221
1684 Ga0500643_048642 3300053087 Bacteria 1218
1685 Ga0500644_0000490 3300053088 Bacteria 17289
1686 Ga0500644_0160845 3300053088 Bacteria 907
1687 Ga0500646_0002275 3300053090 Bacteria 5001
1688 Ga0500646_0015271 3300053090 Bacteria 1999
1689 Ga0500583_0044731 3300053092 Bacteria 2029
1690 Ga0500583_0128496 3300053092 Bacteria 1256
1691 Ga0500651_0006211 3300053093 Bacteria 6870
1692 Ga0500651_0024276 3300053093 Bacteria 3801
1693 Ga0500651_0092970 3300053093 Bacteria 1855
1694 Ga0500651_0252962 3300053093 Bacteria 1024
1695 Ga0500566_0000100 3300053094 Bacteria 43788
1696 Ga0500566_0000220 3300053094 Bacteria 30427
1697 Ga0500566_0001885 3300053094 Bacteria 12343
1698 Ga0500566_0050801 3300053094 Bacteria 2373
1699 Ga0500640_005859 3300053095 Bacteria 4634
1700 Ga0500641_0002654 3300053096 Bacteria 6320
1701 Ga0500641_0005082 3300053096 Bacteria 4662
1702 Ga0500641_0044249 3300053096 Bacteria 1810
1703 Ga0500650_0001074 3300053098 Bacteria 7853
1704 Ga0500650_0003775 3300053098 Bacteria 5349
1705 Ga0500554_003133 3300053102 Bacteria 3346
1706 Ga0500554_074459 3300053102 Bacteria 1110
1707 Ga0500556_0000002 3300053104 Bacteria 773626
1708 Ga0500556_0000023 3300053104 Bacteria 168755
1709 Ga0500556_0000052 3300053104 Bacteria 117825
1710 Ga0500556_0008488 3300053104 Bacteria 2966
1711 Ga0500557_000010 3300053105 Bacteria 118251
1712 Ga0500560_000134 3300053107 Bacteria 8027
1713 Ga0500560_002379 3300053107 Bacteria 3575
1714 Ga0500562_006887 3300053108 Bacteria 2868
1715 Ga0500562_011668 3300053108 Bacteria 2231
1716 Ga0500562_026751 3300053108 Bacteria 1513
1717 Ga0500569_035121 3300053109 Bacteria 1435
1718 Ga0500572_000176 3300053111 Bacteria 22627
1719 Ga0500572_000235 3300053111 Bacteria 19688
1720 Ga0500572_001926 3300053111 Bacteria 5211
1721 Ga0500572_020475 3300053111 Bacteria 1741
1722 Ga0500592_006824 3300053116 Bacteria 1817
1723 Ga0500592_010240 3300053116 Bacteria 1492
1724 Ga0500593_093092 3300053117 Bacteria 1272
1725 Ga0500594_0000814 3300053118 Bacteria 6664
1726 Ga0500594_0012754 3300053118 Bacteria 1987
1727 Ga0500595_000450 3300053119 Bacteria 25570
1728 Ga0500595_008586 3300053119 Bacteria 4169
1729 Ga0500595_033524 3300053119 Bacteria 1704
1730 Ga0500607_016108 3300053121 Bacteria 4294
1731 Ga0500608_000720 3300053122 Bacteria 12152
1732 Ga0500608_014667 3300053122 Bacteria 3504
1733 Ga0500608_065882 3300053122 Bacteria 1728
1734 Ga0500614_000141 3300053123 Bacteria 17860
1735 Ga0500614_021538 3300053123 Bacteria 1496
1736 Ga0500618_000348 3300053125 Bacteria 32595
1737 Ga0500642_0000005 3300053130 Bacteria 422725
1738 Ga0500642_0000012 3300053130 Bacteria 206424
1739 Ga0500642_0000334 3300053130 Bacteria 16200
1740 Ga0500642_0033939 3300053130 Bacteria 2155
1741 Ga0500642_0137836 3300053130 Bacteria 1144
1742 Ga0500652_001569 3300053131 Bacteria 6987
1743 Ga0500652_055115 3300053131 Bacteria 1628
1744 Ga0500658_0000786 3300053134 Bacteria 13133
1745 Ga0500658_0001722 3300053134 Bacteria 8655
1746 Ga0500658_0055711 3300053134 Bacteria 1628
1747 Ga0500559_0000509 3300053136 Bacteria 27329
1748 Ga0500559_0003396 3300053136 Bacteria 7846
1749 Ga0500559_0005407 3300053136 Bacteria 5882
1750 Ga0500559_0010805 3300053136 Bacteria 3914
1751 Ga0500559_0086638 3300053136 Bacteria 1430
1752 Ga0500568_0000001 3300053139 Bacteria 988705
1753 Ga0500568_0000019 3300053139 Bacteria 195696
1754 Ga0500568_0000246 3300053139 Bacteria 46161
1755 Ga0500568_0000440 3300053139 Bacteria 31182
1756 Ga0500568_0001219 3300053139 Bacteria 17157
1757 Ga0500568_0001959 3300053139 Bacteria 12590
1758 Ga0500568_0004746 3300053139 Bacteria 7204
1759 Ga0500573_0003907 3300053140 Bacteria 7784
1760 Ga0500573_0047509 3300053140 Bacteria 2472
1761 Ga0500573_0088519 3300053140 Bacteria 1751
1762 Ga0500577_0000078 3300053142 Bacteria 22529
1763 Ga0500577_0000149 3300053142 Bacteria 17206
1764 Ga0500577_0084835 3300053142 Bacteria 1270
1765 Ga0500577_0099490 3300053142 Bacteria 1187
1766 Ga0500586_000724 3300053145 Bacteria 6766
1767 Ga0500603_000017 3300053150 Bacteria 56324
1768 Ga0500603_000889 3300053150 Bacteria 7110
1769 Ga0500604_0000324 3300053151 Bacteria 13292
1770 Ga0500604_0001078 3300053151 Bacteria 7625
1771 Ga0500604_0003561 3300053151 Bacteria 4195
1772 Ga0500616_0000085 3300053153 Bacteria 193192
1773 Ga0500616_0000351 3300053153 Bacteria 65787
1774 Ga0500616_0000508 3300053153 Bacteria 49451
1775 Ga0500616_0000681 3300053153 Bacteria 39796
1776 Ga0500616_0076057 3300053153 Bacteria 1698
1777 Ga0500616_0095923 3300053153 Bacteria 1459
1778 Ga0500619_000086 3300053154 Bacteria 26088
1779 Ga0500619_029693 3300053154 Bacteria 1656
1780 Ga0500622_0000206 3300053156 Bacteria 62842
1781 Ga0500622_0000613 3300053156 Bacteria 32349
1782 Ga0500622_0001984 3300053156 Bacteria 15344
1783 Ga0500622_0005324 3300053156 Bacteria 7756
1784 Ga0500622_0006594 3300053156 Bacteria 6694
1785 Ga0500622_0012145 3300053156 Bacteria 4673
1786 Ga0500624_000452 3300053157 Bacteria 12326
1787 Ga0500630_033993 3300053159 Bacteria 2500
1788 Ga0500634_0000073 3300053161 Bacteria 39695
1789 Ga0500634_0002205 3300053161 Bacteria 8108
1790 Ga0500634_0021157 3300053161 Bacteria 3522
1791 Ga0500638_008035 3300053162 Bacteria 4467
1792 Ga0500638_023327 3300053162 Bacteria 2941
1793 Ga0500638_111345 3300053162 Bacteria 1264
1794 Ga0500639_000525 3300053163 Bacteria 19105
1795 Ga0500639_062463 3300053163 Bacteria 1917
1796 Ga0500636_0000695 3300053177 Bacteria 18042
1797 Ga0500636_0001446 3300053177 Bacteria 12929
1798 Ga0500636_0001744 3300053177 Bacteria 11921
1799 Ga0500636_0014958 3300053177 Bacteria 4568
1800 Ga0500636_0033194 3300053177 Bacteria 3057
1801 Ga0500637_0004182 3300053178 Bacteria 6802
1802 Ga0500637_0009251 3300053178 Bacteria 5007
1803 Ga0500637_0115909 3300053178 Bacteria 1554
1804 Ga0500637_0158620 3300053178 Bacteria 1304
1805 Ga0500611_012117 3300053727 Bacteria 1446
1806 Ga0500625_003061 3300053729 Bacteria 6484
1807 Ga0500645_011357 3300053730 Bacteria 2912
1808 Ga0500645_015458 3300053730 Bacteria 2417
1809 Ga0500645_017977 3300053730 Bacteria 2212
1810 Ga0500645_052976 3300053730 Bacteria 1181
1811 Ga0500596_003815 3300053735 Bacteria 2825
1812 Ga0500596_005554 3300053735 Bacteria 2204
1813 Ga0500599_004800 3300053736 Bacteria 1681
1814 Ga0500601_000775 3300053737 Bacteria 4088
1815 Ga0501084_0006070 3300054114 Bacteria 9938
1816 Ga0501084_0034876 3300054114 Bacteria 4208
1817 Ga0501084_0086043 3300054114 Bacteria 2639
1818 Ga0501084_0115422 3300054114 Bacteria 2257
1819 Ga0501084_0357249 3300054114 Bacteria 1234
1820 Ga0500661_013504 3300055283 Bacteria 1472
1821 Ga0500661_024384 3300055283 Bacteria 1069
1822 Ga0501082_0004101 3300060353 Bacteria 12720
1823 Ga0501082_0041087 3300060353 Bacteria 3987
1824 Ga0501082_0097758 3300060353 Bacteria 2538
1825 Ga0501082_0117174 3300060353 Bacteria 2307
1826 Ga0501082_0153091 3300060353 Bacteria 2003
1827 Ga0501082_0170403 3300060353 Bacteria 1893
1828 Ga0466962_0027657 3300061719 Bacteria 2721
1829 Ga0530510_0030439 3300061734 Bacteria 3877
1830 Ga0530510_0048029 3300061734 Bacteria 3085
1831 Ga0530510_0242412 3300061734 Bacteria 1342

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053088 Ga0500644_0160845 Ga0500644_0160845_136_894 245
2 3300049741 Ga0501079_0341865 Ga0501079_0341865_337_1158 259
3 3300050495 nmdc:mga04h51_76776_c1 nmdc:mga04h51_76776_c1_11_820 260
4 3300049573 Ga0501037_0360432 Ga0501037_0360432_185_976 261
5 3300046663 Ga0495635_0437632 Ga0495635_0437632_39_842 264
6 3300037853 Ga0436364_0017639 Ga0436364_0017639_463_1278 267
7 3300049577 Ga0501041_0163440 Ga0501041_0163440_31_957 271
8 3300049584 Ga0501068_0258118 Ga0501068_0258118_136_1062 271
9 3300049587 Ga0501071_0088864 Ga0501071_0088864_789_1715 271
10 3300049588 Ga0501072_0033267 Ga0501072_0033267_789_1715 271
11 3300049593 Ga0501077_0039610 Ga0501077_0039610_1030_1956 271
12 3300049741 Ga0501079_0005301 Ga0501079_0005301_787_1713 271
13 3300054114 Ga0501084_0086043 Ga0501084_0086043_554_1480 271
14 3300053092 Ga0500583_0128496 Ga0500583_0128496_18_842 272
15 3300025922 Ga0207646_10013186 Ga0207646_100131868 273
16 3300039447 Ga0436361_1018297 Ga0436361_1018297_310_1146 274
17 3300048929 Ga0496126_0259561 Ga0496126_0259561_17_847 274
18 3300049578 Ga0501042_0191035 Ga0501042_0191035_515_1441 275
19 3300037312 Ga0395899_0257482 Ga0395899_0257482_330_1175 276
20 3300050496 nmdc:mga07m45_104095_c1 nmdc:mga07m45_104095_c1_25_885 277
21 3300049569 Ga0501032_0221444 Ga0501032_0221444_368_1213 281
22 3300021441 Ga0213871_10011645 Ga0213871_100116451 282
23 3300039438 Ga0436360_0872516 Ga0436360_0872516_2321_3250 282
24 3300006846 Ga0075430_100075877 Ga0075430_1000758774 283
25 3300006847 Ga0075431_100140002 Ga0075431_1001400022 283
26 3300006880 Ga0075429_100004847 Ga0075429_10000484715 283
27 3300009147 Ga0114129_10078313 Ga0114129_100783136 283
28 3300050507 nmdc:mga05p37_150931_c1 nmdc:mga05p37_150931_c1_1141_2067 283
29 3300050508 nmdc:mga09592_858_c1 nmdc:mga09592_858_c1_939_1865 283
30 3300050509 nmdc:mga0qj67_68379_c1 nmdc:mga0qj67_68379_c1_1251_2177 283
31 3300050510 nmdc:mga06r32_34004_c1 nmdc:mga06r32_34004_c1_1032_1958 283
32 3300037853 Ga0436364_1273230 Ga0436364_1273230_553_1437 284
33 3300049583 Ga0501067_0086204 Ga0501067_0086204_382_1308 284
34 3300049585 Ga0501069_0106904 Ga0501069_0106904_61_987 284
35 3300061734 Ga0530510_0242412 Ga0530510_0242412_161_1087 284
36 3300046536 Ga0495587_0001588 Ga0495587_0001588_91_996 285
37 3300031456 Ga0307513_10108571 Ga0307513_101085712 290
38 3300013297 Ga0157378_10039107 Ga0157378_100391071 291
39 iso_pu_bacteria 8002392321 8002392677 291
40 3300031852 Ga0307410_10053148 Ga0307410_100531483 292
41 3300032126 Ga0307415_100385468 Ga0307415_1003854682 292
42 3300049591 Ga0501075_0373331 Ga0501075_0373331_71_949 292
43 3300006847 Ga0075431_100045239 Ga0075431_1000452396 293
44 3300009147 Ga0114129_10006174 Ga0114129_100061745 293
45 3300050508 nmdc:mga09592_41226_c1 nmdc:mga09592_41226_c1_417_1349 293
46 3300046453 Ga0495627_000007 Ga0495627_000007_310119_311084 294
47 3300046522 Ga0495643_0039945 Ga0495643_0039945_69_1046 294
48 3300046538 Ga0495609_0000055 Ga0495609_0000055_123058_124035 294
49 3300047470 Ga0495681_0000443 Ga0495681_0000443_21728_22681 294
50 3300049572 Ga0501036_0045657 Ga0501036_0045657_2764_3690 294
51 3300061734 Ga0530510_0030439 Ga0530510_0030439_2258_3184 294
52 3300037418 Ga0395900_0004339 Ga0395900_0004339_9554_10459 295
53 3300042876 Ga0451577_0423127 Ga0451577_0423127_97_1005 295
54 3300046810 Ga0495660_0000639 Ga0495660_0000639_13346_14323 295
55 3300046454 Ga0495592_0043205 Ga0495592_0043205_2421_3362 297
56 3300049575 Ga0501039_0035313 Ga0501039_0035313_2517_3428 297
57 3300049576 Ga0501040_0156679 Ga0501040_0156679_169_1080 297
58 3300049587 Ga0501071_0122632 Ga0501071_0122632_638_1549 297
59 3300049588 Ga0501072_0056563 Ga0501072_0056563_1338_2249 297
60 3300049590 Ga0501074_0071192 Ga0501074_0071192_1061_1972 297
61 3300049592 Ga0501076_0030980 Ga0501076_0030980_2186_3097 297
62 3300054114 Ga0501084_0115422 Ga0501084_0115422_574_1485 297
63 3300060353 Ga0501082_0170403 Ga0501082_0170403_450_1361 297
64 3300009147 Ga0114129_10016131 Ga0114129_100161315 298
65 3300049568 Ga0501031_0028662 Ga0501031_0028662_2300_3304 298
66 3300049569 Ga0501032_0014407 Ga0501032_0014407_1059_2012 298
67 3300049572 Ga0501036_0390838 Ga0501036_0390838_43_1047 298
68 3300049574 Ga0501038_0072671 Ga0501038_0072671_962_1966 299
69 3300049822 Ga0501035_0011601 Ga0501035_0011601_1200_2204 299
70 3300053139 Ga0500568_0000019 Ga0500568_0000019_83034_83954 299
71 iso_pu_bacteria 2894772417 2894772619 299
72 3300050493 nmdc:mga0k408_107321_c1 nmdc:mga0k408_107321_c1_554_1456 300
73 3300039062 Ga0400483_016022 Ga0400483_016022_210_1127 301
74 3300039062 Ga0400483_226394 Ga0400483_226394_1262_2179 301
75 3300046507 Ga0495606_0096906 Ga0495606_0096906_751_1677 301
76 3300049568 Ga0501031_0351448 Ga0501031_0351448_11_916 301
77 3300049571 Ga0501034_0069730 Ga0501034_0069730_576_1514 301
78 iso_pu_bacteria 2585427590 2585824954 301
79 iso_pu_bacteria 2602042107 2603862115 301
80 iso_pu_bacteria 2738541317 2738944760 301
81 iso_pu_bacteria 2913308742 2913309381 301
82 iso_pu_bacteria 2919073203 2919077421 301
83 3300003214 JGI25165J46597_1005560 JGI25165J46597_10055603 302
84 3300025231 Ga0207427_102270 Ga0207427_1022704 302
85 3300025261 Ga0209233_1000360 Ga0209233_10003603 302
86 3300025928 Ga0207700_10222552 Ga0207700_102225522 302
87 3300031249 Ga0265339_10079522 Ga0265339_100795223 302
88 3300031595 Ga0265313_10026971 Ga0265313_100269714 302
89 3300031711 Ga0265314_10198913 Ga0265314_101989132 302
90 3300031712 Ga0265342_10032697 Ga0265342_100326972 302
91 3300039062 Ga0400483_244580 Ga0400483_244580_1373_2293 302
92 3300049572 Ga0501036_0046107 Ga0501036_0046107_60_1004 302
93 3300049579 Ga0501043_0074640 Ga0501043_0074640_514_1458 302
94 3300049822 Ga0501035_0293900 Ga0501035_0293900_167_1105 302
95 iso_pu_bacteria 2510917026 2511170302 302
96 iso_pu_bacteria 2517487022 2517567910 302
97 iso_pu_bacteria 2537561587 2537872810 302
98 iso_pu_bacteria 2582581294 2585202651 302
99 iso_pu_bacteria 2582581294 2585204995 302
100 iso_pu_bacteria 2582581298 2585221918 302
101 iso_pu_bacteria 2582581304 2585258440 302
102 iso_pu_bacteria 2582581304 2585259070 302
103 iso_pu_bacteria 2582581315 2585326800 302
104 iso_pu_bacteria 2585427529 2585543912 302
105 iso_pu_bacteria 2585427633 2585998154 302
106 iso_pu_bacteria 2585427634 2586002731 302
107 iso_pu_bacteria 2599185210 2599606141 302
108 iso_pu_bacteria 2643221558 2643814231 302
109 iso_pu_bacteria 2643221599 2644006856 302
110 iso_pu_bacteria 2643221618 2644104989 302
111 iso_pu_bacteria 2643221655 2644307532 302
112 iso_pu_bacteria 2643221712 2644613618 302
113 iso_pu_bacteria 2738541293 2738801863 302
114 iso_pu_bacteria 2738541317 2738944897 302
115 iso_pu_bacteria 2802428861 2802740879 302
116 iso_pu_bacteria 2802428863 2802751984 302
117 iso_pu_bacteria 2837678835 2837680715 302
118 iso_pu_bacteria 2842333319 2842333839 302
119 iso_pu_bacteria 2891048133 2891049441 302
120 iso_pu_bacteria 2904434214 2904439381 302
121 iso_pu_bacteria 2913308742 2913309520 302
122 iso_pu_bacteria 2919100787 2919103129 302
123 iso_pu_bacteria 2929138655 2929143580 302
124 iso_pu_bacteria 2937036028 2937039307 302
125 iso_pu_bacteria 2957437181 2957437960 302
126 iso_pu_bacteria 2960591022 2960591538 302
127 iso_pu_bacteria 2960631154 2960632279 302
128 iso_pu_bacteria 2967728569 2967731437 302
129 iso_pu_bacteria 2977530762 2977536111 302
130 iso_pu_bacteria 2978969890 2978970381 302
131 iso_pu_bacteria 2984587000 2984587402 302
132 iso_pu_bacteria 2995392953 2995396714 302
133 iso_pu_bacteria 3005452660 3005458225 302
134 iso_pu_bacteria 8018150411 8018152901 302
135 iso_pu_bacteria 8054460903 8054464177 302
136 3300005563 Ga0068855_100183174 Ga0068855_1001831741 303
137 3300009148 Ga0105243_10000028 Ga0105243_1000002818 303
138 3300009176 Ga0105242_10000184 Ga0105242_1000018417 303
139 3300025934 Ga0207686_10000019 Ga0207686_1000001920 303
140 3300025935 Ga0207709_10000064 Ga0207709_1000006420 303
141 3300026142 Ga0207698_10288402 Ga0207698_102884022 303
142 3300031456 Ga0307513_10081546 Ga0307513_100815463 303
143 3300031730 Ga0307516_10202268 Ga0307516_102022682 303
144 3300033180 Ga0307510_10234916 Ga0307510_102349161 303
145 3300039062 Ga0400483_132723 Ga0400483_132723_3437_4357 303
146 3300044683 Ga0466965_0005513 Ga0466965_0005513_3406_4323 303
147 3300044683 Ga0466965_0224212 Ga0466965_0224212_25_942 303
148 3300046460 Ga0495638_0021945 Ga0495638_0021945_529_1461 303
149 3300049573 Ga0501037_0100343 Ga0501037_0100343_940_1860 303
150 3300049574 Ga0501038_0154527 Ga0501038_0154527_55_975 303
151 3300049823 Ga0501044_0347259 Ga0501044_0347259_465_1385 303
152 iso_pu_bacteria 2671180139 2671692991 303
153 iso_pu_bacteria 2881412998 2881417966 303
154 iso_pu_bacteria 2899803654 2899806855 303
155 iso_pu_bacteria 2917699015 2917703365 303
156 iso_pu_bacteria 8048746797 8048748964 303
157 iso_pu_bacteria 8054563764 8054565887 303
158 iso_pu_bacteria 8057529695 8057533826 303
159 3300003187 JGI25151J46595_10001720 JGI25151J46595_100017202 304
160 3300006051 Ga0075364_10010568 Ga0075364_100105685 304
161 3300006846 Ga0075430_100007426 Ga0075430_1000074269 304
162 3300009147 Ga0114129_10025555 Ga0114129_100255553 304
163 3300025291 Ga0209675_1005572 Ga0209675_10055723 304
164 3300025294 Ga0209025_1000018 Ga0209025_1000018277 304
165 3300039450 Ga0436363_0628780 Ga0436363_0628780_180_1106 304
166 3300046474 Ga0495605_0043068 Ga0495605_0043068_628_1554 304
167 3300046512 Ga0495610_0020992 Ga0495610_0020992_103_1029 304
168 3300046522 Ga0495643_0057135 Ga0495643_0057135_863_1789 304
169 3300046524 Ga0495648_0007196 Ga0495648_0007196_6553_7467 304
170 3300050491 nmdc:mga00v17_112602_c1 nmdc:mga00v17_112602_c1_420_1424 304
171 3300050507 nmdc:mga05p37_156848_c1 nmdc:mga05p37_156848_c1_887_1813 304
172 3300053125 Ga0500618_000348 Ga0500618_000348_18752_19675 304
173 3300053142 Ga0500577_0000078 Ga0500577_0000078_18369_19283 304
174 3300053156 Ga0500622_0000613 Ga0500622_0000613_28642_29568 304
175 iso_pu_bacteria 2510917030 2511197483 304
176 iso_pu_bacteria 2582581298 2585225081 304
177 iso_pu_bacteria 2585427529 2585547637 304
178 iso_pu_bacteria 2585427634 2585998717 304
179 iso_pu_bacteria 2643221557 2643808908 304
180 iso_pu_bacteria 2643221610 2644068011 304
181 iso_pu_bacteria 2643221668 2644378432 304
182 iso_pu_bacteria 2643221675 2644418966 304
183 iso_pu_bacteria 2643221680 2644453421 304
184 iso_pu_bacteria 2643221723 2644672386 304
185 iso_pu_bacteria 2643221726 2644688304 304
186 iso_pu_bacteria 2775507049 2776910904 304
187 iso_pu_bacteria 2841734538 2841738856 304
188 iso_pu_bacteria 2855730933 2855731040 304
189 iso_pu_bacteria 2855767633 2855770359 304
190 iso_pu_bacteria 2871474448 2871476845 304
191 iso_pu_bacteria 2878788777 2878789151 304
192 iso_pu_bacteria 2919100787 2919105765 304
193 iso_pu_bacteria 2919171160 2919172236 304
194 iso_pu_bacteria 2924733363 2924739732 304
195 iso_pu_bacteria 2937836603 2937842925 304
196 iso_pu_bacteria 2958071322 2958072263 304
197 iso_pu_bacteria 3003665799 3003666842 304
198 iso_pu_bacteria 3004268573 3004274748 304
199 iso_pu_bacteria 3005409236 3005413616 304
200 iso_pu_bacteria 3005445848 3005448996 304
201 iso_pu_bacteria 8001845381 8001847308 304
202 iso_pu_bacteria 8004633249 8004634324 304
203 iso_pu_bacteria 8005301065 8005301833 304
204 iso_pu_bacteria 8045864390 8045866933 304
205 3300002773 JGI25152J39213_1000093 JGI25152J39213_100009324 305
206 3300002774 JGI25150J39212_1000045 JGI25150J39212_100004542 305
207 3300003187 JGI25151J46595_10000023 JGI25151J46595_10000023183 305
208 3300003203 JGI25406J46586_10021358 JGI25406J46586_100213582 305
209 3300003215 JGI25153J46596_10004272 JGI25153J46596_100042724 305
210 3300003323 rootH1_10252891 rootH1_102528912 305
211 3300003856 Ga0058692_1000083 Ga0058692_100008334 305
212 3300003856 Ga0058692_1000334 Ga0058692_10003345 305
213 3300005436 Ga0070713_100024691 Ga0070713_1000246912 305
214 3300005445 Ga0070708_100040043 Ga0070708_1000400432 305
215 3300005468 Ga0070707_100009136 Ga0070707_1000091365 305
216 3300005518 Ga0070699_100374399 Ga0070699_1003743992 305
217 3300005536 Ga0070697_100002285 Ga0070697_10000228513 305
218 3300005546 Ga0070696_100142431 Ga0070696_1001424312 305
219 3300005985 Ga0081539_10000259 Ga0081539_10000259100 305
220 3300006038 Ga0075365_10032401 Ga0075365_100324012 305
221 3300006038 Ga0075365_10042363 Ga0075365_100423632 305
222 3300006051 Ga0075364_10000193 Ga0075364_100001935 305
223 3300006051 Ga0075364_10008004 Ga0075364_100080042 305
224 3300006051 Ga0075364_10034528 Ga0075364_100345283 305
225 3300006186 Ga0075369_10009035 Ga0075369_100090352 305
226 3300006186 Ga0075369_10037856 Ga0075369_100378563 305
227 3300006844 Ga0075428_100003153 Ga0075428_10000315316 305
228 3300006847 Ga0075431_100002020 Ga0075431_10000202013 305
229 3300006847 Ga0075431_100003055 Ga0075431_1000030555 305
230 3300006852 Ga0075433_10000430 Ga0075433_1000043016 305
231 3300006871 Ga0075434_100027927 Ga0075434_1000279277 305
232 3300006880 Ga0075429_100003574 Ga0075429_1000035747 305
233 3300006880 Ga0075429_100003704 Ga0075429_10000370410 305
234 3300006914 Ga0075436_100000875 Ga0075436_1000008756 305
235 3300009093 Ga0105240_10201312 Ga0105240_102013122 305
236 3300009147 Ga0114129_10000065 Ga0114129_1000006533 305
237 3300009147 Ga0114129_10001450 Ga0114129_1000145018 305
238 3300009147 Ga0114129_11134639 Ga0114129_111346391 305
239 3300013105 Ga0157369_10025423 Ga0157369_100254232 305
240 3300013105 Ga0157369_10223225 Ga0157369_102232252 305
241 3300021361 Ga0213872_10036241 Ga0213872_100362412 305
242 3300021377 Ga0213874_10035511 Ga0213874_100355112 305
243 3300022739 Ga0228711_1010044 Ga0228711_101004412 305
244 3300022740 Ga0228710_1010269 Ga0228710_10102696 305
245 3300025245 Ga0207425_1000038 Ga0207425_100003847 305
246 3300025258 Ga0209129_1000036 Ga0209129_100003647 305
247 3300025273 Ga0209673_1026127 Ga0209673_10261271 305
248 3300025294 Ga0209025_1000108 Ga0209025_100010847 305
249 3300025295 Ga0209564_1025787 Ga0209564_10257872 305
250 3300025297 Ga0209758_1000104 Ga0209758_1000104180 305
251 3300025303 Ga0209051_1028281 Ga0209051_10282812 305
252 3300025910 Ga0207684_10000920 Ga0207684_100009205 305
253 3300025944 Ga0207661_10036733 Ga0207661_100367332 305
254 3300025949 Ga0207667_10450555 Ga0207667_104505551 305
255 3300027312 Ga0209371_1000251 Ga0209371_100025148 305
256 3300027312 Ga0209371_1000425 Ga0209371_100042543 305
257 3300030500 Ga0268256_1000475 Ga0268256_100047519 305
258 3300030500 Ga0268256_1001004 Ga0268256_10010045 305
259 3300031727 Ga0316576_10116137 Ga0316576_101161371 305
260 3300031901 Ga0307406_10009687 Ga0307406_100096872 305
261 3300031911 Ga0307412_10005563 Ga0307412_100055636 305
262 3300032004 Ga0307414_10037909 Ga0307414_100379093 305
263 3300037418 Ga0395900_0068312 Ga0395900_0068312_2162_3088 305
264 3300037466 Ga0395898_0030072 Ga0395898_0030072_3797_4723 305
265 3300039062 Ga0400483_191502 Ga0400483_191502_246_1172 305
266 3300044694 Ga0466963_0080911 Ga0466963_0080911_1112_2038 305
267 3300044719 Ga0466971_0059768 Ga0466971_0059768_95_1087 305
268 3300045049 Ga0466959_0064143 Ga0466959_0064143_1506_2498 305
269 3300046460 Ga0495638_0000632 Ga0495638_0000632_35214_36140 305
270 3300046471 Ga0495650_0078515 Ga0495650_0078515_339_1265 305
271 3300046501 Ga0495607_0005882 Ga0495607_0005882_208_1134 305
272 3300046507 Ga0495606_0130004 Ga0495606_0130004_67_984 305
273 3300046512 Ga0495610_0009082 Ga0495610_0009082_128_1054 305
274 3300046512 Ga0495610_0031592 Ga0495610_0031592_657_1574 305
275 3300046512 Ga0495610_0076902 Ga0495610_0076902_586_1512 305
276 3300046513 Ga0495616_0011852 Ga0495616_0011852_455_1372 305
277 3300046515 Ga0495620_0025454 Ga0495620_0025454_953_1879 305
278 3300046518 Ga0495631_0064306 Ga0495631_0064306_544_1461 305
279 3300046519 Ga0495632_0000078 Ga0495632_0000078_67858_68784 305
280 3300046519 Ga0495632_0000392 Ga0495632_0000392_25120_26046 305
281 3300046522 Ga0495643_0031491 Ga0495643_0031491_437_1354 305
282 3300046524 Ga0495648_0004816 Ga0495648_0004816_7838_8755 305
283 3300046524 Ga0495648_0068816 Ga0495648_0068816_307_1224 305
284 3300046530 Ga0495654_0000152 Ga0495654_0000152_5122_6048 305
285 3300046530 Ga0495654_0010946 Ga0495654_0010946_258_1175 305
286 3300046558 Ga0495633_0024938 Ga0495633_0024938_1264_2190 305
287 3300046558 Ga0495633_0051932 Ga0495633_0051932_63_989 305
288 3300046615 Ga0495656_0039529 Ga0495656_0039529_939_1865 305
289 3300046660 Ga0495625_0003310 Ga0495625_0003310_6513_7430 305
290 3300046665 Ga0495661_0029524 Ga0495661_0029524_2386_3303 305
291 3300046674 Ga0495588_0004100 Ga0495588_0004100_664_1590 305
292 3300046691 Ga0495670_0000775 Ga0495670_0000775_13524_14441 305
293 3300046692 Ga0495671_0007355 Ga0495671_0007355_4825_5742 305
294 3300046694 Ga0495649_0031993 Ga0495649_0031993_867_1841 305
295 3300046810 Ga0495660_0055865 Ga0495660_0055865_895_1812 305
296 3300047318 Ga0495636_0017842 Ga0495636_0017842_611_1537 305
297 3300047320 Ga0495672_0011801 Ga0495672_0011801_3463_4389 305
298 3300047470 Ga0495681_0005328 Ga0495681_0005328_474_1400 305
299 3300047470 Ga0495681_0061535 Ga0495681_0061535_219_1145 305
300 3300047472 Ga0495686_0027943 Ga0495686_0027943_1349_2275 305
301 3300048904 Ga0496101_0062275 Ga0496101_0062275_1650_2576 305
302 3300048919 Ga0496116_0000583 Ga0496116_0000583_11575_12501 305
303 3300048919 Ga0496116_0002160 Ga0496116_0002160_7511_8428 305
304 3300048919 Ga0496116_0031220 Ga0496116_0031220_1053_1979 305
305 3300048920 Ga0496117_0001578 Ga0496117_0001578_18686_19612 305
306 3300048920 Ga0496117_0003177 Ga0496117_0003177_4252_5178 305
307 3300048920 Ga0496117_0019052 Ga0496117_0019052_2189_3118 305
308 3300048920 Ga0496117_0041847 Ga0496117_0041847_1938_2864 305
309 3300048920 Ga0496117_0047973 Ga0496117_0047973_12_929 305
310 3300048921 Ga0496118_0001250 Ga0496118_0001250_36467_37393 305
311 3300048921 Ga0496118_0010621 Ga0496118_0010621_5983_6912 305
312 3300048921 Ga0496118_0018142 Ga0496118_0018142_2427_3353 305
313 3300048921 Ga0496118_0018819 Ga0496118_0018819_3431_4357 305
314 3300048921 Ga0496118_0095666 Ga0496118_0095666_606_1532 305
315 3300048922 Ga0496119_0000478 Ga0496119_0000478_10823_11755 305
316 3300048922 Ga0496119_0154324 Ga0496119_0154324_86_1012 305
317 3300048923 Ga0496120_0091942 Ga0496120_0091942_483_1409 305
318 3300048924 Ga0496121_0000138 Ga0496121_0000138_43192_44118 305
319 3300048924 Ga0496121_0000240 Ga0496121_0000240_82843_83769 305
320 3300048924 Ga0496121_0009567 Ga0496121_0009567_9266_10195 305
321 3300048924 Ga0496121_0067138 Ga0496121_0067138_196_1122 305
322 3300048925 Ga0496122_0000634 Ga0496122_0000634_25242_26174 305
323 3300048925 Ga0496122_0000889 Ga0496122_0000889_1845_2771 305
324 3300048925 Ga0496122_0010631 Ga0496122_0010631_6092_7021 305
325 3300048925 Ga0496122_0035330 Ga0496122_0035330_2231_3157 305
326 3300048925 Ga0496122_0075500 Ga0496122_0075500_1000_1917 305
327 3300048925 Ga0496122_0112977 Ga0496122_0112977_174_1100 305
328 3300048925 Ga0496122_0143621 Ga0496122_0143621_53_979 305
329 3300048926 Ga0496123_0000736 Ga0496123_0000736_20686_21618 305
330 3300048926 Ga0496123_0005560 Ga0496123_0005560_812_1738 305
331 3300048926 Ga0496123_0018413 Ga0496123_0018413_2231_3148 305
332 3300048926 Ga0496123_0018897 Ga0496123_0018897_3400_4329 305
333 3300048926 Ga0496123_0080981 Ga0496123_0080981_262_1188 305
334 3300048926 Ga0496123_0110235 Ga0496123_0110235_169_1095 305
335 3300048927 Ga0496124_0000023 Ga0496124_0000023_297895_298821 305
336 3300048927 Ga0496124_0000139 Ga0496124_0000139_125651_126625 305
337 3300048927 Ga0496124_0005342 Ga0496124_0005342_9005_9931 305
338 3300048927 Ga0496124_0022423 Ga0496124_0022423_1285_2211 305
339 3300048927 Ga0496124_0098614 Ga0496124_0098614_994_1920 305
340 3300048928 Ga0496125_0000182 Ga0496125_0000182_117051_117977 305
341 3300048928 Ga0496125_0004131 Ga0496125_0004131_8341_9270 305
342 3300048929 Ga0496126_0102228 Ga0496126_0102228_941_1867 305
343 3300048929 Ga0496126_0167438 Ga0496126_0167438_310_1236 305
344 3300049569 Ga0501032_0043053 Ga0501032_0043053_995_1921 305
345 3300049571 Ga0501034_0001365 Ga0501034_0001365_16319_17245 305
346 3300049580 Ga0501046_0031080 Ga0501046_0031080_3320_4246 305
347 3300049581 Ga0501047_0106562 Ga0501047_0106562_896_1822 305
348 3300049744 Ga0501083_0012684 Ga0501083_0012684_1705_2673 305
349 3300049822 Ga0501035_0007115 Ga0501035_0007115_888_1814 305
350 3300049823 Ga0501044_0063135 Ga0501044_0063135_1060_1986 305
351 3300050491 nmdc:mga00v17_11836_c1 nmdc:mga00v17_11836_c1_2714_3640 305
352 3300050491 nmdc:mga00v17_178_c1 nmdc:mga00v17_178_c1_31252_32178 305
353 3300050491 nmdc:mga00v17_26284_c1 nmdc:mga00v17_26284_c1_695_1612 305
354 3300050496 nmdc:mga07m45_72816_c1 nmdc:mga07m45_72816_c1_671_1588 305
355 3300050507 nmdc:mga05p37_2636_c1 nmdc:mga05p37_2636_c1_145_1074 305
356 3300050507 nmdc:mga05p37_3032_c1 nmdc:mga05p37_3032_c1_12758_13690 305
357 3300050507 nmdc:mga05p37_967_c1 nmdc:mga05p37_967_c1_28470_29402 305
358 3300050508 nmdc:mga09592_3458_c1 nmdc:mga09592_3458_c1_4929_5858 305
359 3300050508 nmdc:mga09592_9739_c1 nmdc:mga09592_9739_c1_1388_2320 305
360 3300050510 nmdc:mga06r32_6916_c1 nmdc:mga06r32_6916_c1_6262_7191 305
361 3300050510 nmdc:mga06r32_7062_c1 nmdc:mga06r32_7062_c1_3502_4440 305
362 3300050512 nmdc:mga0n895_2596_c1 nmdc:mga0n895_2596_c1_12530_13462 305
363 3300050513 nmdc:mga0rr50_429_c1 nmdc:mga0rr50_429_c1_8053_8985 305
364 3300050514 nmdc:mga08x19_767_c1 nmdc:mga08x19_767_c1_12133_13065 305
365 3300050515 nmdc:mga0a205_38067_c1 nmdc:mga0a205_38067_c1_3157_4089 305
366 3300053087 Ga0500643_048642 Ga0500643_048642_203_1120 305
367 3300053088 Ga0500644_0000490 Ga0500644_0000490_366_1283 305
368 3300053093 Ga0500651_0024276 Ga0500651_0024276_439_1356 305
369 3300053093 Ga0500651_0092970 Ga0500651_0092970_336_1253 305
370 3300053096 Ga0500641_0005082 Ga0500641_0005082_2585_3502 305
371 3300053098 Ga0500650_0001074 Ga0500650_0001074_4606_5523 305
372 3300053104 Ga0500556_0000023 Ga0500556_0000023_122828_123760 305
373 3300053107 Ga0500560_000134 Ga0500560_000134_28_954 305
374 3300053107 Ga0500560_002379 Ga0500560_002379_974_1900 305
375 3300053108 Ga0500562_006887 Ga0500562_006887_196_1113 305
376 3300053108 Ga0500562_026751 Ga0500562_026751_10_936 305
377 3300053111 Ga0500572_001926 Ga0500572_001926_3863_4789 305
378 3300053111 Ga0500572_020475 Ga0500572_020475_274_1200 305
379 3300053116 Ga0500592_010240 Ga0500592_010240_153_1070 305
380 3300053117 Ga0500593_093092 Ga0500593_093092_248_1165 305
381 3300053118 Ga0500594_0000814 Ga0500594_0000814_5473_6390 305
382 3300053130 Ga0500642_0000005 Ga0500642_0000005_314444_315361 305
383 3300053134 Ga0500658_0000786 Ga0500658_0000786_10776_11693 305
384 3300053139 Ga0500568_0000246 Ga0500568_0000246_35507_36424 305
385 3300053139 Ga0500568_0000440 Ga0500568_0000440_1588_2514 305
386 3300053140 Ga0500573_0003907 Ga0500573_0003907_987_1913 305
387 3300053142 Ga0500577_0084835 Ga0500577_0084835_153_1070 305
388 3300053142 Ga0500577_0099490 Ga0500577_0099490_108_1034 305
389 3300053151 Ga0500604_0000324 Ga0500604_0000324_9610_10527 305
390 3300053153 Ga0500616_0000351 Ga0500616_0000351_53156_54082 305
391 3300053153 Ga0500616_0000681 Ga0500616_0000681_12171_13097 305
392 3300053156 Ga0500622_0001984 Ga0500622_0001984_13208_14137 305
393 3300053157 Ga0500624_000452 Ga0500624_000452_5010_5936 305
394 3300053161 Ga0500634_0000073 Ga0500634_0000073_12953_13879 305
395 3300053161 Ga0500634_0002205 Ga0500634_0002205_1720_2646 305
396 3300053161 Ga0500634_0021157 Ga0500634_0021157_243_1265 305
397 3300053177 Ga0500636_0001446 Ga0500636_0001446_5905_6831 305
398 3300053730 Ga0500645_015458 Ga0500645_015458_832_1749 305
399 3300053730 Ga0500645_017977 Ga0500645_017977_1154_2086 305
400 3300060353 Ga0501082_0041087 Ga0501082_0041087_1903_2958 305
401 iso_pu_bacteria 2511231024 2511373572 305
402 iso_pu_bacteria 2643221734 2644737969 305
403 iso_pu_bacteria 2643221736 2644743974 305
404 iso_pu_bacteria 2818991467 2819720666 305
405 iso_pu_bacteria 2828305725 2828310309 305
406 iso_pu_bacteria 2841760612 2841764200 305
407 iso_pu_bacteria 2841911363 2841913837 305
408 iso_pu_bacteria 2841917233 2841919554 305
409 iso_pu_bacteria 2842521101 2842526983 305
410 iso_pu_bacteria 2842694124 2842695851 305
411 iso_pu_bacteria 2844104063 2844108345 305
412 iso_pu_bacteria 2851182111 2851185518 305
413 iso_pu_bacteria 2851246043 2851250635 305
414 iso_pu_bacteria 2881161766 2881163622 305
415 iso_pu_bacteria 2917699015 2917702753 305
416 iso_pu_bacteria 643348564 643605132 305
417 iso_pu_bacteria 8057529695 8057533717 305
418 3300003771 Ga0055526_1000062 Ga0055526_100006224 306
419 3300003775 Ga0055524_1000011 Ga0055524_100001166 306
420 3300003784 Ga0055534_1012482 Ga0055534_10124822 306
421 3300005355 Ga0070671_100373939 Ga0070671_1003739392 306
422 3300005445 Ga0070708_100199091 Ga0070708_1001990912 306
423 3300013250 Ga0171462_1023 Ga0171462_1023115 306
424 3300025273 Ga0209673_1007005 Ga0209673_10070054 306
425 3300025291 Ga0209675_1000274 Ga0209675_100027435 306
426 3300025295 Ga0209564_1000143 Ga0209564_100014365 306
427 3300025299 Ga0209256_1000111 Ga0209256_100011191 306
428 3300031090 Ga0265760_10007459 Ga0265760_100074592 306
429 3300031548 Ga0307408_100001144 Ga0307408_10000114417 306
430 3300031731 Ga0307405_10204202 Ga0307405_102042021 306
431 3300031901 Ga0307406_10000141 Ga0307406_1000014112 306
432 3300037418 Ga0395900_0163053 Ga0395900_0163053_1021_1983 306
433 3300044712 Ga0453684_0097814 Ga0453684_0097814_2421_3359 306
434 3300046462 Ga0495651_0155481 Ga0495651_0155481_120_1073 306
435 3300046474 Ga0495605_0000658 Ga0495605_0000658_22906_23835 306
436 3300046501 Ga0495607_0000024 Ga0495607_0000024_11050_11979 306
437 3300046501 Ga0495607_0080348 Ga0495607_0080348_516_1445 306
438 3300046513 Ga0495616_0003258 Ga0495616_0003258_7027_7956 306
439 3300046513 Ga0495616_0055101 Ga0495616_0055101_621_1550 306
440 3300046520 Ga0495637_0000279 Ga0495637_0000279_1794_2723 306
441 3300046522 Ga0495643_0000757 Ga0495643_0000757_16012_16941 306
442 3300046810 Ga0495660_0005079 Ga0495660_0005079_1004_1933 306
443 3300047469 Ga0495673_0000530 Ga0495673_0000530_22967_23896 306
444 3300048091 Ga0495626_0000412 Ga0495626_0000412_19294_20223 306
445 3300048908 Ga0496105_0310946 Ga0496105_0310946_255_1175 306
446 3300049459 Ga0495678_000143 Ga0495678_000143_37267_38196 306
447 3300049459 Ga0495678_010019 Ga0495678_010019_2061_2990 306
448 3300049571 Ga0501034_0022443 Ga0501034_0022443_114_1043 306
449 3300049571 Ga0501034_0125451 Ga0501034_0125451_567_1517 306
450 3300049571 Ga0501034_0434183 Ga0501034_0434183_185_1114 306
451 3300049573 Ga0501037_0041694 Ga0501037_0041694_2226_3155 306
452 3300049574 Ga0501038_0298123 Ga0501038_0298123_155_1075 306
453 3300049581 Ga0501047_0003444 Ga0501047_0003444_8827_9756 306
454 3300049776 Ga0501280_001117 Ga0501280_001117_2016_2945 306
455 3300050491 nmdc:mga00v17_63931_c1 nmdc:mga00v17_63931_c1_973_1893 306
456 iso_pu_bacteria 2513237146 2513928748 306
457 iso_pu_bacteria 2599185170 2599415043 306
458 iso_pu_bacteria 2643221651 2644288012 306
459 iso_pu_bacteria 2643221733 2644729597 306
460 iso_pu_bacteria 2738541277 2738723897 306
461 iso_pu_bacteria 2738543019 2739284628 306
462 iso_pu_bacteria 2784132148 2784593075 306
463 iso_pu_bacteria 2786546132 2786666553 306
464 iso_pu_bacteria 2838035591 2838039232 306
465 iso_pu_bacteria 2838661181 2838667656 306
466 iso_pu_bacteria 2933016740 2933018519 306
467 iso_pu_bacteria 2954673503 2954681640 306
468 iso_pu_bacteria 2954731030 2954732045 306
469 iso_pu_bacteria 8055225921 8055226586 306
470 3300003214 JGI25165J46597_1000020 JGI25165J46597_1000020212 307
471 3300003792 Ga0055540_1000705 Ga0055540_10007054 307
472 3300003792 Ga0055540_1011777 Ga0055540_10117772 307
473 3300003794 Ga0055531_10007706 Ga0055531_100077062 307
474 3300005719 Ga0068861_100196607 Ga0068861_1001966072 307
475 3300005843 Ga0068860_100463404 Ga0068860_1004634042 307
476 3300005981 Ga0081538_10054608 Ga0081538_100546082 307
477 3300006038 Ga0075365_10079692 Ga0075365_100796923 307
478 3300006038 Ga0075365_10171676 Ga0075365_101716761 307
479 3300006353 Ga0075370_10053554 Ga0075370_100535541 307
480 3300006846 Ga0075430_100280033 Ga0075430_1002800332 307
481 3300006880 Ga0075429_100211156 Ga0075429_1002111562 307
482 3300009148 Ga0105243_10000106 Ga0105243_1000010650 307
483 3300014325 Ga0163163_10010953 Ga0163163_100109534 307
484 3300021377 Ga0213874_10000725 Ga0213874_100007254 307
485 3300021377 Ga0213874_10003303 Ga0213874_100033031 307
486 3300021388 Ga0213875_10004342 Ga0213875_100043422 307
487 3300025261 Ga0209233_1000047 Ga0209233_1000047123 307
488 3300025273 Ga0209673_1038826 Ga0209673_10388262 307
489 3300025292 Ga0209676_1053345 Ga0209676_10533451 307
490 3300025303 Ga0209051_1000114 Ga0209051_1000114137 307
491 3300025303 Ga0209051_1000350 Ga0209051_100035043 307
492 3300025304 Ga0209257_1000015 Ga0209257_1000015764 307
493 3300025909 Ga0207705_10121261 Ga0207705_101212612 307
494 3300025928 Ga0207700_10294979 Ga0207700_102949792 307
495 3300025935 Ga0207709_10000077 Ga0207709_10000077117 307
496 3300026118 Ga0207675_100198698 Ga0207675_1001986983 307
497 3300028381 Ga0268264_10356976 Ga0268264_103569761 307
498 3300028794 Ga0307515_10034944 Ga0307515_100349448 307
499 3300031728 Ga0316578_10107579 Ga0316578_101075793 307
500 3300032004 Ga0307414_10262379 Ga0307414_102623792 307
501 3300032004 Ga0307414_10388290 Ga0307414_103882901 307
502 3300032005 Ga0307411_10053380 Ga0307411_100533802 307
503 3300035398 Ga0316574_0306155 Ga0316574_0306155_42_995 307
504 3300036712 Ga0316584_0027739 Ga0316584_0027739_1474_2427 307
505 3300037312 Ga0395899_0002482 Ga0395899_0002482_6207_7148 307
506 3300037418 Ga0395900_0027248 Ga0395900_0027248_2969_3904 307
507 3300037418 Ga0395900_0109149 Ga0395900_0109149_1159_2097 307
508 3300037418 Ga0395900_0423143 Ga0395900_0423143_201_1142 307
509 3300037466 Ga0395898_0005265 Ga0395898_0005265_11478_12416 307
510 3300037466 Ga0395898_0037278 Ga0395898_0037278_3234_4169 307
511 3300037471 Ga0395905_0005945 Ga0395905_0005945_5641_6582 307
512 3300037471 Ga0395905_0056296 Ga0395905_0056296_327_1262 307
513 3300037853 Ga0436364_0250721 Ga0436364_0250721_487_1437 307
514 3300038443 Ga0395901_0014750 Ga0395901_0014750_4856_5791 307
515 3300038443 Ga0395901_0028762 Ga0395901_0028762_3713_4651 307
516 3300039453 Ga0436362_1134067 Ga0436362_1134067_4343_5293 307
517 3300044673 Ga0453683_0039263 Ga0453683_0039263_118_1122 307
518 3300045051 Ga0451576_0011400 Ga0451576_0011400_3982_4986 307
519 3300045051 Ga0451576_0443228 Ga0451576_0443228_253_1185 307
520 3300046454 Ga0495592_0017948 Ga0495592_0017948_4225_5163 307
521 3300046455 Ga0495603_0016135 Ga0495603_0016135_2825_3763 307
522 3300046458 Ga0495591_003223 Ga0495591_003223_5250_6188 307
523 3300046462 Ga0495651_0004548 Ga0495651_0004548_879_1817 307
524 3300046471 Ga0495650_0001505 Ga0495650_0001505_17676_18614 307
525 3300046471 Ga0495650_0006708 Ga0495650_0006708_4014_4952 307
526 3300046472 Ga0495580_0037235 Ga0495580_0037235_754_1692 307
527 3300046473 Ga0495582_0005799 Ga0495582_0005799_4586_5524 307
528 3300046476 Ga0495662_0020563 Ga0495662_0020563_1967_2905 307
529 3300046477 Ga0495664_0014537 Ga0495664_0014537_1683_2621 307
530 3300046477 Ga0495664_0054520 Ga0495664_0054520_587_1525 307
531 3300046499 Ga0495594_0090319 Ga0495594_0090319_155_1093 307
532 3300046500 Ga0495596_0003637 Ga0495596_0003637_4165_5103 307
533 3300046507 Ga0495606_0035300 Ga0495606_0035300_591_1529 307
534 3300046511 Ga0495608_0001782 Ga0495608_0001782_10539_11477 307
535 3300046514 Ga0495618_0111286 Ga0495618_0111286_589_1527 307
536 3300046516 Ga0495628_0038197 Ga0495628_0038197_60_998 307
537 3300046517 Ga0495630_0021991 Ga0495630_0021991_1684_2622 307
538 3300046524 Ga0495648_0017191 Ga0495648_0017191_2727_3665 307
539 3300046526 Ga0495666_0003127 Ga0495666_0003127_4698_5636 307
540 3300046526 Ga0495666_0003603 Ga0495666_0003603_2877_3815 307
541 3300046528 Ga0495642_0060718 Ga0495642_0060718_299_1234 307
542 3300046531 Ga0495665_0019828 Ga0495665_0019828_1137_2075 307
543 3300046531 Ga0495665_0131765 Ga0495665_0131765_290_1228 307
544 3300046533 Ga0495640_0011322 Ga0495640_0011322_4447_5385 307
545 3300046536 Ga0495587_0017552 Ga0495587_0017552_2910_3848 307
546 3300046536 Ga0495587_0140324 Ga0495587_0140324_107_1045 307
547 3300046539 Ga0495621_0008537 Ga0495621_0008537_328_1272 307
548 3300046542 Ga0495597_0000067 Ga0495597_0000067_77841_78782 307
549 3300046642 Ga0495634_0025613 Ga0495634_0025613_1672_2610 307
550 3300046665 Ga0495661_0004742 Ga0495661_0004742_7040_7978 307
551 3300046665 Ga0495661_0098104 Ga0495661_0098104_458_1396 307
552 3300046674 Ga0495588_0034945 Ga0495588_0034945_585_1523 307
553 3300046678 Ga0495599_0010870 Ga0495599_0010870_3230_4168 307
554 3300046679 Ga0495623_0022836 Ga0495623_0022836_2658_3596 307
555 3300046679 Ga0495623_0098492 Ga0495623_0098492_267_1205 307
556 3300046680 Ga0495646_0014066 Ga0495646_0014066_1102_2040 307
557 3300046680 Ga0495646_0022116 Ga0495646_0022116_2259_3197 307
558 3300046690 Ga0495624_0009857 Ga0495624_0009857_5587_6525 307
559 3300046692 Ga0495671_0089719 Ga0495671_0089719_401_1339 307
560 3300046694 Ga0495649_0100456 Ga0495649_0100456_492_1430 307
561 3300046809 Ga0495600_0001270 Ga0495600_0001270_12338_13276 307
562 3300047315 Ga0495581_0028284 Ga0495581_0028284_1605_2543 307
563 3300047315 Ga0495581_0029693 Ga0495581_0029693_227_1165 307
564 3300047317 Ga0495604_0023467 Ga0495604_0023467_3149_4087 307
565 3300047317 Ga0495604_0033682 Ga0495604_0033682_290_1228 307
566 3300047317 Ga0495604_0041977 Ga0495604_0041977_1014_1952 307
567 3300047322 Ga0495680_0108550 Ga0495680_0108550_577_1515 307
568 3300047323 Ga0495683_0005297 Ga0495683_0005297_846_1784 307
569 3300047443 Ga0495687_008477 Ga0495687_008477_4872_5807 307
570 3300047444 Ga0495675_0004966 Ga0495675_0004966_5061_5999 307
571 3300047446 Ga0495679_007570 Ga0495679_007570_1502_2440 307
572 3300047446 Ga0495679_012872 Ga0495679_012872_1554_2492 307
573 3300047469 Ga0495673_0014011 Ga0495673_0014011_3222_4160 307
574 3300047471 Ga0495684_0071430 Ga0495684_0071430_1057_1995 307
575 3300048088 Ga0495602_0010425 Ga0495602_0010425_6811_7749 307
576 3300048088 Ga0495602_0064539 Ga0495602_0064539_1474_2412 307
577 3300048089 Ga0495614_0002892 Ga0495614_0002892_1535_2473 307
578 3300048904 Ga0496101_0300851 Ga0496101_0300851_155_1093 307
579 3300048906 Ga0496103_0097643 Ga0496103_0097643_398_1342 307
580 3300048907 Ga0496104_0284182 Ga0496104_0284182_537_1481 307
581 3300048909 Ga0496106_0000001 Ga0496106_0000001_272560_273498 307
582 3300048912 Ga0496109_0202773 Ga0496109_0202773_827_1771 307
583 3300048914 Ga0496111_0056382 Ga0496111_0056382_1145_2089 307
584 3300048924 Ga0496121_0011095 Ga0496121_0011095_7089_8027 307
585 3300048925 Ga0496122_0021407 Ga0496122_0021407_4528_5460 307
586 3300049460 Ga0495682_0026635 Ga0495682_0026635_492_1430 307
587 3300049575 Ga0501039_0126434 Ga0501039_0126434_635_1561 307
588 3300049576 Ga0501040_0210466 Ga0501040_0210466_28_966 307
589 3300049577 Ga0501041_0144812 Ga0501041_0144812_296_1234 307
590 3300049579 Ga0501043_0281092 Ga0501043_0281092_82_1017 307
591 3300049580 Ga0501046_0205588 Ga0501046_0205588_459_1427 307
592 3300049581 Ga0501047_0128951 Ga0501047_0128951_1094_2029 307
593 3300049586 Ga0501070_0090655 Ga0501070_0090655_481_1422 307
594 3300049587 Ga0501071_0077841 Ga0501071_0077841_451_1389 307
595 3300049588 Ga0501072_0101669 Ga0501072_0101669_991_1929 307
596 3300049592 Ga0501076_0031880 Ga0501076_0031880_205_1173 307
597 3300049822 Ga0501035_0090286 Ga0501035_0090286_1370_2305 307
598 3300049822 Ga0501035_0163509 Ga0501035_0163509_791_1753 307
599 3300049823 Ga0501044_0032771 Ga0501044_0032771_4283_5215 307
600 3300049823 Ga0501044_0143343 Ga0501044_0143343_156_1097 307
601 3300049823 Ga0501044_0153413 Ga0501044_0153413_1147_2082 307
602 3300049824 Ga0501045_0037949 Ga0501045_0037949_990_1958 307
603 3300050492 nmdc:mga0yw44_170150_c1 nmdc:mga0yw44_170150_c1_112_1047 307
604 3300050492 nmdc:mga0yw44_289666_c1 nmdc:mga0yw44_289666_c1_112_1047 307
605 3300050514 nmdc:mga08x19_132698_c1 nmdc:mga08x19_132698_c1_333_1295 307
606 3300053108 Ga0500562_011668 Ga0500562_011668_432_1373 307
607 3300053122 Ga0500608_000720 Ga0500608_000720_3652_4590 307
608 3300053131 Ga0500652_055115 Ga0500652_055115_562_1485 307
609 3300053139 Ga0500568_0004746 Ga0500568_0004746_1859_2797 307
610 3300054114 Ga0501084_0357249 Ga0501084_0357249_190_1158 307
611 3300060353 Ga0501082_0097758 Ga0501082_0097758_1261_2229 307
612 3300061734 Ga0530510_0048029 Ga0530510_0048029_149_1117 307
613 iso_pu_bacteria 2643221569 2643859822 307
614 iso_pu_bacteria 2643221621 2644124984 307
615 iso_pu_bacteria 2941479691 2941484591 307
616 3300002773 JGI25152J39213_1004057 JGI25152J39213_10040573 308
617 3300002773 JGI25152J39213_1004574 JGI25152J39213_10045743 308
618 3300003187 JGI25151J46595_10004869 JGI25151J46595_100048692 308
619 3300003354 JGI25160J50197_1009006 JGI25160J50197_10090063 308
620 3300003374 JGI25161J50226_1000294 JGI25161J50226_100029419 308
621 3300003374 JGI25161J50226_1000364 JGI25161J50226_10003643 308
622 3300003775 Ga0055524_1005532 Ga0055524_10055322 308
623 3300003775 Ga0055524_1007856 Ga0055524_10078564 308
624 3300003790 Ga0055528_1000273 Ga0055528_100027318 308
625 3300003790 Ga0055528_1002163 Ga0055528_10021639 308
626 3300003791 Ga0055530_10018243 Ga0055530_100182432 308
627 3300003792 Ga0055540_1007605 Ga0055540_10076052 308
628 3300003794 Ga0055531_10024694 Ga0055531_100246942 308
629 3300004625 Ga0055543_1000031 Ga0055543_100003171 308
630 3300005262 Ga0065165_1015769 Ga0065165_10157692 308
631 3300005329 Ga0070683_100348744 Ga0070683_1003487441 308
632 3300005338 Ga0068868_100181172 Ga0068868_1001811722 308
633 3300005458 Ga0070681_10103948 Ga0070681_101039483 308
634 3300005539 Ga0068853_100494938 Ga0068853_1004949381 308
635 3300005563 Ga0068855_100015850 Ga0068855_1000158504 308
636 3300005563 Ga0068855_100021411 Ga0068855_1000214119 308
637 3300005614 Ga0068856_100416396 Ga0068856_1004163962 308
638 3300005616 Ga0068852_100000134 Ga0068852_10000013416 308
639 3300005617 Ga0068859_100184886 Ga0068859_1001848862 308
640 3300005842 Ga0068858_100073406 Ga0068858_1000734063 308
641 3300006163 Ga0070715_10054192 Ga0070715_100541922 308
642 3300006186 Ga0075369_10021073 Ga0075369_100210732 308
643 3300006195 Ga0075366_10015710 Ga0075366_100157103 308
644 3300006237 Ga0097621_100006967 Ga0097621_1000069672 308
645 3300006237 Ga0097621_100008135 Ga0097621_1000081356 308
646 3300006353 Ga0075370_10051959 Ga0075370_100519593 308
647 3300006358 Ga0068871_100185980 Ga0068871_1001859802 308
648 3300006881 Ga0068865_100195342 Ga0068865_1001953422 308
649 3300006931 Ga0097620_100184881 Ga0097620_1001848812 308
650 3300009093 Ga0105240_10005407 Ga0105240_100054074 308
651 3300009176 Ga0105242_10012090 Ga0105242_100120902 308
652 3300009176 Ga0105242_10026716 Ga0105242_100267163 308
653 3300009177 Ga0105248_10065071 Ga0105248_100650711 308
654 3300013105 Ga0157369_10403329 Ga0157369_104033292 308
655 3300013307 Ga0157372_10044988 Ga0157372_100449886 308
656 3300025208 Ga0209436_100043 Ga0209436_10004316 308
657 3300025245 Ga0207425_1005641 Ga0207425_10056412 308
658 3300025245 Ga0207425_1012329 Ga0207425_10123292 308
659 3300025258 Ga0209129_1000016 Ga0209129_100001673 308
660 3300025258 Ga0209129_1000529 Ga0209129_10005293 308
661 3300025258 Ga0209129_1005013 Ga0209129_10050133 308
662 3300025258 Ga0209129_1006246 Ga0209129_10062463 308
663 3300025273 Ga0209673_1000691 Ga0209673_100069128 308
664 3300025273 Ga0209673_1005907 Ga0209673_10059075 308
665 3300025284 Ga0209130_1000023 Ga0209130_1000023306 308
666 3300025292 Ga0209676_1007558 Ga0209676_10075582 308
667 3300025292 Ga0209676_1011038 Ga0209676_10110383 308
668 3300025294 Ga0209025_1002393 Ga0209025_10023932 308
669 3300025294 Ga0209025_1010347 Ga0209025_10103472 308
670 3300025295 Ga0209564_1000558 Ga0209564_100055853 308
671 3300025295 Ga0209564_1002222 Ga0209564_10022222 308
672 3300025297 Ga0209758_1000170 Ga0209758_100017015 308
673 3300025297 Ga0209758_1003095 Ga0209758_10030957 308
674 3300025297 Ga0209758_1012118 Ga0209758_10121183 308
675 3300025297 Ga0209758_1015538 Ga0209758_10155383 308
676 3300025298 Ga0209050_1007449 Ga0209050_10074491 308
677 3300025299 Ga0209256_1000648 Ga0209256_100064830 308
678 3300025299 Ga0209256_1000709 Ga0209256_100070945 308
679 3300025299 Ga0209256_1006841 Ga0209256_10068413 308
680 3300025302 Ga0207426_1000087 Ga0207426_100008756 308
681 3300025303 Ga0209051_1000600 Ga0209051_100060044 308
682 3300025303 Ga0209051_1000641 Ga0209051_100064139 308
683 3300025303 Ga0209051_1001025 Ga0209051_10010258 308
684 3300025303 Ga0209051_1005829 Ga0209051_10058295 308
685 3300025303 Ga0209051_1013123 Ga0209051_10131233 308
686 3300025304 Ga0209257_1007708 Ga0209257_10077088 308
687 3300025304 Ga0209257_1022231 Ga0209257_10222313 308
688 3300025321 Ga0207656_10004899 Ga0207656_100048992 308
689 3300025912 Ga0207707_10337195 Ga0207707_103371952 308
690 3300025913 Ga0207695_10055983 Ga0207695_100559832 308
691 3300025921 Ga0207652_10099773 Ga0207652_100997733 308
692 3300025924 Ga0207694_10137892 Ga0207694_101378922 308
693 3300025927 Ga0207687_10022862 Ga0207687_100228626 308
694 3300025938 Ga0207704_10283522 Ga0207704_102835222 308
695 3300025949 Ga0207667_10007523 Ga0207667_1000752312 308
696 3300025949 Ga0207667_10070582 Ga0207667_100705825 308
697 3300026035 Ga0207703_10066822 Ga0207703_100668222 308
698 3300026142 Ga0207698_10001165 Ga0207698_1000116511 308
699 3300028381 Ga0268264_10103682 Ga0268264_101036823 308
700 3300033179 Ga0307507_10061386 Ga0307507_100613862 308
701 3300039447 Ga0436361_0898793 Ga0436361_0898793_1434_2360 308
702 3300041411 Ga0439466_0028978 Ga0439466_0028978_504_1442 308
703 3300041413 Ga0439465_0000965 Ga0439465_0000965_5210_6148 308
704 3300042002 Ga0439442_001123 Ga0439442_001123_1074_2006 308
705 3300042122 Ga0450920_000242 Ga0450920_000242_6597_7529 308
706 3300042146 Ga0450907_004183 Ga0450907_004183_100_1032 308
707 3300042435 Ga0439434_0000853 Ga0439434_0000853_1712_2644 308
708 3300046512 Ga0495610_0021886 Ga0495610_0021886_2554_3480 308
709 3300046522 Ga0495643_0081349 Ga0495643_0081349_310_1236 308
710 3300047472 Ga0495686_0073951 Ga0495686_0073951_734_1660 308
711 3300048904 Ga0496101_0392766 Ga0496101_0392766_13_942 308
712 3300048907 Ga0496104_0365080 Ga0496104_0365080_413_1339 308
713 3300048908 Ga0496105_0119133 Ga0496105_0119133_712_1638 308
714 3300048913 Ga0496110_0124895 Ga0496110_0124895_964_1890 308
715 3300048919 Ga0496116_0012189 Ga0496116_0012189_3962_4888 308
716 3300048921 Ga0496118_0003916 Ga0496118_0003916_7966_8892 308
717 3300048922 Ga0496119_0128198 Ga0496119_0128198_97_1026 308
718 3300048924 Ga0496121_0057423 Ga0496121_0057423_2048_2974 308
719 3300048924 Ga0496121_0063125 Ga0496121_0063125_1521_2447 308
720 3300048924 Ga0496121_0124232 Ga0496121_0124232_466_1392 308
721 3300048925 Ga0496122_0007213 Ga0496122_0007213_8405_9331 308
722 3300048925 Ga0496122_0008693 Ga0496122_0008693_4525_5451 308
723 3300048926 Ga0496123_0007137 Ga0496123_0007137_5715_6641 308
724 3300048926 Ga0496123_0033027 Ga0496123_0033027_2518_3444 308
725 3300048927 Ga0496124_0008253 Ga0496124_0008253_2851_3777 308
726 3300048927 Ga0496124_0021305 Ga0496124_0021305_1543_2469 308
727 3300048928 Ga0496125_0080288 Ga0496125_0080288_528_1454 308
728 3300049568 Ga0501031_0094997 Ga0501031_0094997_467_1393 308
729 3300049574 Ga0501038_0303181 Ga0501038_0303181_221_1168 308
730 3300049575 Ga0501039_0415884 Ga0501039_0415884_86_1033 308
731 3300049581 Ga0501047_0003515 Ga0501047_0003515_12767_13693 308
732 3300049581 Ga0501047_0045708 Ga0501047_0045708_194_1123 308
733 3300049586 Ga0501070_0006975 Ga0501070_0006975_1109_2035 308
734 3300049589 Ga0501073_0000065 Ga0501073_0000065_8378_9304 308
735 3300049590 Ga0501074_0002696 Ga0501074_0002696_6421_7347 308
736 3300049741 Ga0501079_0026282 Ga0501079_0026282_57_983 308
737 3300049742 Ga0501080_0106418 Ga0501080_0106418_1109_2035 308
738 3300049744 Ga0501083_0000604 Ga0501083_0000604_19848_20774 308
739 3300049744 Ga0501083_0016470 Ga0501083_0016470_3365_4312 308
740 3300049823 Ga0501044_0528425 Ga0501044_0528425_27_953 308
741 3300050492 nmdc:mga0yw44_347507_c1 nmdc:mga0yw44_347507_c1_40_969 308
742 3300050496 nmdc:mga07m45_86591_c2 nmdc:mga07m45_86591_c2_344_1270 308
743 3300050516 nmdc:mga0sz30_92061_c1 nmdc:mga0sz30_92061_c1_165_1091 308
744 3300053093 Ga0500651_0252962 Ga0500651_0252962_23_949 308
745 3300053118 Ga0500594_0012754 Ga0500594_0012754_679_1635 308
746 3300053134 Ga0500658_0001722 Ga0500658_0001722_7655_8581 308
747 3300053139 Ga0500568_0000001 Ga0500568_0000001_639963_640889 308
748 3300053139 Ga0500568_0001959 Ga0500568_0001959_2718_3644 308
749 3300053140 Ga0500573_0047509 Ga0500573_0047509_241_1167 308
750 3300053153 Ga0500616_0076057 Ga0500616_0076057_699_1625 308
751 3300053156 Ga0500622_0000206 Ga0500622_0000206_20075_21001 308
752 iso_pu_bacteria 2513237087 2513592919 308
753 iso_pu_bacteria 2545555834 2545672700 308
754 iso_pu_bacteria 2855730933 2855734405 308
755 iso_pu_bacteria 2855767633 2855769995 308
756 iso_pu_bacteria 2881412998 2881414245 308
757 iso_pu_bacteria 2990059506 2990065154 308
758 iso_pu_bacteria 641522639 641643487 308
759 3300002987 JGI25159J45721_1014777 JGI25159J45721_10147772 309
760 3300003187 JGI25151J46595_10000072 JGI25151J46595_1000007254 309
761 3300003316 rootH1_10111778 rootH1_101117784 309
762 3300003322 rootL2_10130353 rootL2_101303532 309
763 3300003771 Ga0055526_1000090 Ga0055526_100009021 309
764 3300003771 Ga0055526_1002908 Ga0055526_10029089 309
765 3300003775 Ga0055524_1000096 Ga0055524_100009614 309
766 3300003775 Ga0055524_1025756 Ga0055524_10257562 309
767 3300005262 Ga0065165_1000146 Ga0065165_100014643 309
768 3300005262 Ga0065165_1000384 Ga0065165_100038433 309
769 3300005327 Ga0070658_10077434 Ga0070658_100774343 309
770 3300005331 Ga0070670_100020910 Ga0070670_1000209107 309
771 3300005354 Ga0070675_100004711 Ga0070675_1000047117 309
772 3300005435 Ga0070714_100138246 Ga0070714_1001382462 309
773 3300005518 Ga0070699_100269399 Ga0070699_1002693991 309
774 3300005841 Ga0068863_100285967 Ga0068863_1002859672 309
775 3300005844 Ga0068862_100032793 Ga0068862_1000327933 309
776 3300005844 Ga0068862_100063701 Ga0068862_1000637012 309
777 3300006038 Ga0075365_10006531 Ga0075365_100065315 309
778 3300006038 Ga0075365_10023183 Ga0075365_100231832 309
779 3300006038 Ga0075365_10085484 Ga0075365_100854841 309
780 3300006042 Ga0075368_10031789 Ga0075368_100317892 309
781 3300006042 Ga0075368_10092647 Ga0075368_100926472 309
782 3300006048 Ga0075363_100045141 Ga0075363_1000451412 309
783 3300006051 Ga0075364_10108093 Ga0075364_101080932 309
784 3300006186 Ga0075369_10005702 Ga0075369_100057022 309
785 3300006846 Ga0075430_100100344 Ga0075430_1001003444 309
786 3300006847 Ga0075431_100018467 Ga0075431_1000184676 309
787 3300006880 Ga0075429_100149183 Ga0075429_1001491834 309
788 3300009094 Ga0111539_10114563 Ga0111539_101145633 309
789 3300013250 Ga0171462_1029 Ga0171462_102953 309
790 3300013307 Ga0157372_10785337 Ga0157372_107853371 309
791 3300014497 Ga0182008_10001849 Ga0182008_100018497 309
792 3300015261 Ga0182006_1018279 Ga0182006_10182792 309
793 3300015262 Ga0182007_10000577 Ga0182007_1000057710 309
794 3300015265 Ga0182005_1029514 Ga0182005_10295142 309
795 3300025284 Ga0209130_1000393 Ga0209130_100039355 309
796 3300025284 Ga0209130_1001383 Ga0209130_100138318 309
797 3300025291 Ga0209675_1001067 Ga0209675_10010674 309
798 3300025294 Ga0209025_1000187 Ga0209025_100018713 309
799 3300025294 Ga0209025_1004739 Ga0209025_10047398 309
800 3300025294 Ga0209025_1014903 Ga0209025_10149036 309
801 3300025295 Ga0209564_1000043 Ga0209564_1000043277 309
802 3300025295 Ga0209564_1000052 Ga0209564_1000052220 309
803 3300025299 Ga0209256_1000099 Ga0209256_100009969 309
804 3300025299 Ga0209256_1000374 Ga0209256_100037441 309
805 3300025907 Ga0207645_10079533 Ga0207645_100795332 309
806 3300025909 Ga0207705_10058570 Ga0207705_100585703 309
807 3300025925 Ga0207650_10154557 Ga0207650_101545572 309
808 3300025929 Ga0207664_10020781 Ga0207664_100207812 309
809 3300025935 Ga0207709_10081886 Ga0207709_100818862 309
810 3300025940 Ga0207691_10085938 Ga0207691_100859382 309
811 3300025986 Ga0207658_10147770 Ga0207658_101477702 309
812 3300026089 Ga0207648_10113756 Ga0207648_101137562 309
813 3300026089 Ga0207648_10138768 Ga0207648_101387682 309
814 3300027866 Ga0209813_10010901 Ga0209813_100109014 309
815 3300027866 Ga0209813_10033520 Ga0209813_100335202 309
816 3300028380 Ga0268265_10109639 Ga0268265_101096392 309
817 3300030521 Ga0307511_10018563 Ga0307511_100185636 309
818 3300031852 Ga0307410_10083034 Ga0307410_100830342 309
819 3300037312 Ga0395899_0001144 Ga0395899_0001144_12681_13610 309
820 3300037312 Ga0395899_0013792 Ga0395899_0013792_5020_5949 309
821 3300037418 Ga0395900_0007142 Ga0395900_0007142_138_1067 309
822 3300037466 Ga0395898_0004409 Ga0395898_0004409_3238_4167 309
823 3300038443 Ga0395901_0072555 Ga0395901_0072555_720_1649 309
824 3300038443 Ga0395901_0188466 Ga0395901_0188466_863_1792 309
825 3300038443 Ga0395901_0358708 Ga0395901_0358708_112_1041 309
826 3300041512 Ga0451853_4020387 Ga0451853_4020387_181_1110 309
827 3300042005 Ga0439448_0008188 Ga0439448_0008188_2005_2940 309
828 3300042138 Ga0450903_000099 Ga0450903_000099_11948_12883 309
829 3300044694 Ga0466963_0030469 Ga0466963_0030469_235_1167 309
830 3300044735 Ga0466968_0016076 Ga0466968_0016076_395_1324 309
831 3300044901 Ga0466960_0138920 Ga0466960_0138920_246_1181 309
832 3300046522 Ga0495643_0092256 Ga0495643_0092256_571_1500 309
833 3300048910 Ga0496107_0126110 Ga0496107_0126110_601_1530 309
834 3300048920 Ga0496117_0033438 Ga0496117_0033438_24_953 309
835 3300048921 Ga0496118_0074733 Ga0496118_0074733_556_1485 309
836 3300048923 Ga0496120_0118123 Ga0496120_0118123_36_965 309
837 3300048924 Ga0496121_0101104 Ga0496121_0101104_601_1530 309
838 3300048924 Ga0496121_0199321 Ga0496121_0199321_407_1336 309
839 3300048925 Ga0496122_0003070 Ga0496122_0003070_16370_17299 309
840 3300048925 Ga0496122_0040105 Ga0496122_0040105_2303_3232 309
841 3300048926 Ga0496123_0003134 Ga0496123_0003134_14790_15719 309
842 3300048927 Ga0496124_0017130 Ga0496124_0017130_2863_3804 309
843 3300048928 Ga0496125_0050765 Ga0496125_0050765_332_1261 309
844 3300048929 Ga0496126_0308974 Ga0496126_0308974_188_1117 309
845 3300049569 Ga0501032_0094655 Ga0501032_0094655_484_1413 309
846 3300049570 Ga0501033_0075574 Ga0501033_0075574_1479_2408 309
847 3300049571 Ga0501034_0034037 Ga0501034_0034037_2447_3376 309
848 3300049571 Ga0501034_0089924 Ga0501034_0089924_970_1899 309
849 3300049572 Ga0501036_0100560 Ga0501036_0100560_911_1876 309
850 3300049573 Ga0501037_0102588 Ga0501037_0102588_531_1460 309
851 3300049574 Ga0501038_0177594 Ga0501038_0177594_133_1062 309
852 3300049574 Ga0501038_0231026 Ga0501038_0231026_180_1109 309
853 3300049579 Ga0501043_0016367 Ga0501043_0016367_1265_2194 309
854 3300049580 Ga0501046_0077958 Ga0501046_0077958_833_1762 309
855 3300049581 Ga0501047_0015373 Ga0501047_0015373_762_1691 309
856 3300049582 Ga0501048_0057148 Ga0501048_0057148_1373_2302 309
857 3300049589 Ga0501073_0011276 Ga0501073_0011276_1736_2677 309
858 3300049822 Ga0501035_0003219 Ga0501035_0003219_12053_12982 309
859 3300049823 Ga0501044_0046301 Ga0501044_0046301_2455_3384 309
860 3300050491 nmdc:mga00v17_122319_c1 nmdc:mga00v17_122319_c1_272_1213 309
861 3300050495 nmdc:mga04h51_62746_c1 nmdc:mga04h51_62746_c1_78_1007 309
862 3300050508 nmdc:mga09592_25520_c1 nmdc:mga09592_25520_c1_1432_2361 309
863 3300050509 nmdc:mga0qj67_82897_c1 nmdc:mga0qj67_82897_c1_583_1512 309
864 3300050510 nmdc:mga06r32_11440_c1 nmdc:mga06r32_11440_c1_4420_5349 309
865 3300053090 Ga0500646_0002275 Ga0500646_0002275_1823_2785 309
866 3300053092 Ga0500583_0044731 Ga0500583_0044731_751_1713 309
867 3300053093 Ga0500651_0006211 Ga0500651_0006211_294_1247 309
868 3300053104 Ga0500556_0000052 Ga0500556_0000052_111577_112506 309
869 3300053151 Ga0500604_0001078 Ga0500604_0001078_4191_5153 309
870 3300053153 Ga0500616_0095923 Ga0500616_0095923_76_1005 309
871 3300053156 Ga0500622_0005324 Ga0500622_0005324_2126_3055 309
872 3300053177 Ga0500636_0014958 Ga0500636_0014958_622_1551 309
873 3300053730 Ga0500645_052976 Ga0500645_052976_98_1027 309
874 iso_pu_bacteria 2599185292 2599903531 309
875 3300005436 Ga0070713_100320719 Ga0070713_1003207192 310
876 3300005441 Ga0070700_100226215 Ga0070700_1002262152 310
877 3300005530 Ga0070679_100121386 Ga0070679_1001213862 310
878 3300006028 Ga0070717_10225358 Ga0070717_102253582 310
879 3300009093 Ga0105240_10030542 Ga0105240_100305426 310
880 3300009545 Ga0105237_10042104 Ga0105237_100421044 310
881 3300013306 Ga0163162_10584292 Ga0163162_105842921 310
882 3300013307 Ga0157372_10414317 Ga0157372_104143172 310
883 3300025919 Ga0207657_10424667 Ga0207657_104246671 310
884 3300025921 Ga0207652_10151739 Ga0207652_101517392 310
885 3300026075 Ga0207708_10258452 Ga0207708_102584521 310
886 3300031595 Ga0265313_10024533 Ga0265313_100245331 310
887 3300031731 Ga0307405_10042455 Ga0307405_100424553 310
888 3300031824 Ga0307413_10023153 Ga0307413_100231532 310
889 3300031852 Ga0307410_10012854 Ga0307410_100128542 310
890 3300031903 Ga0307407_10010347 Ga0307407_100103475 310
891 3300032002 Ga0307416_100068001 Ga0307416_1000680012 310
892 3300042007 Ga0439449_0015407 Ga0439449_0015407_1306_2238 310
893 3300048924 Ga0496121_0171067 Ga0496121_0171067_205_1149 310
894 3300049580 Ga0501046_0028960 Ga0501046_0028960_1685_2620 310
895 3300049582 Ga0501048_0123404 Ga0501048_0123404_780_1715 310
896 3300049586 Ga0501070_0385348 Ga0501070_0385348_37_1032 310
897 3300049590 Ga0501074_0137314 Ga0501074_0137314_668_1672 310
898 3300049591 Ga0501075_0045988 Ga0501075_0045988_1932_2867 310
899 3300049593 Ga0501077_0037985 Ga0501077_0037985_662_1597 310
900 3300049741 Ga0501079_0171779 Ga0501079_0171779_179_1183 310
901 3300049822 Ga0501035_0292287 Ga0501035_0292287_43_975 310
902 3300053153 Ga0500616_0000085 Ga0500616_0000085_173449_174381 310
903 3300054114 Ga0501084_0034876 Ga0501084_0034876_3014_3949 310
904 3300060353 Ga0501082_0153091 Ga0501082_0153091_393_1328 310
905 3300005367 Ga0070667_100046864 Ga0070667_1000468642 311
906 3300005543 Ga0070672_100005394 Ga0070672_1000053944 311
907 3300005617 Ga0068859_100024084 Ga0068859_1000240843 311
908 3300005842 Ga0068858_100045095 Ga0068858_1000450953 311
909 3300006881 Ga0068865_100032138 Ga0068865_1000321383 311
910 3300006931 Ga0097620_100024082 Ga0097620_1000240823 311
911 3300013102 Ga0157371_10099208 Ga0157371_100992082 311
912 3300013308 Ga0157375_10026229 Ga0157375_100262296 311
913 3300014745 Ga0157377_10227428 Ga0157377_102274281 311
914 3300014968 Ga0157379_10002228 Ga0157379_100022288 311
915 3300017792 Ga0163161_10311765 Ga0163161_103117652 311
916 3300025298 Ga0209050_1002087 Ga0209050_100208710 311
917 3300025940 Ga0207691_10003618 Ga0207691_1000361810 311
918 3300025986 Ga0207658_10052349 Ga0207658_100523493 311
919 3300026035 Ga0207703_10284261 Ga0207703_102842612 311
920 3300026041 Ga0207639_10048023 Ga0207639_100480232 311
921 3300028381 Ga0268264_10315132 Ga0268264_103151322 311
922 3300031911 Ga0307412_10000563 Ga0307412_1000056313 311
923 3300032002 Ga0307416_100700864 Ga0307416_1007008641 311
924 3300039437 Ga0436365_0656380 Ga0436365_0656380_147_1085 311
925 3300048905 Ga0496102_0069817 Ga0496102_0069817_2044_2979 311
926 3300048908 Ga0496105_0043339 Ga0496105_0043339_1095_2030 311
927 3300048915 Ga0496112_0401379 Ga0496112_0401379_104_1039 311
928 3300048916 Ga0496113_0137186 Ga0496113_0137186_918_1853 311
929 3300048919 Ga0496116_0051150 Ga0496116_0051150_462_1397 311
930 3300048919 Ga0496116_0132979 Ga0496116_0132979_368_1312 311
931 3300048921 Ga0496118_0007940 Ga0496118_0007940_9205_10140 311
932 3300048922 Ga0496119_0018131 Ga0496119_0018131_4260_5195 311
933 3300048923 Ga0496120_0004181 Ga0496120_0004181_629_1564 311
934 3300048924 Ga0496121_0000508 Ga0496121_0000508_22314_23249 311
935 3300048924 Ga0496121_0086614 Ga0496121_0086614_829_1773 311
936 3300048925 Ga0496122_0000214 Ga0496122_0000214_64311_65255 311
937 3300048926 Ga0496123_0000289 Ga0496123_0000289_32999_33943 311
938 3300048927 Ga0496124_0086064 Ga0496124_0086064_825_1760 311
939 3300048927 Ga0496124_0089120 Ga0496124_0089120_830_1774 311
940 3300048927 Ga0496124_0168714 Ga0496124_0168714_174_1124 311
941 3300048928 Ga0496125_0053684 Ga0496125_0053684_1062_2006 311
942 3300048929 Ga0496126_0037600 Ga0496126_0037600_2407_3342 311
943 3300049572 Ga0501036_0237736 Ga0501036_0237736_534_1469 311
944 3300049575 Ga0501039_0053328 Ga0501039_0053328_1401_2336 311
945 3300049577 Ga0501041_0031853 Ga0501041_0031853_104_1039 311
946 3300049590 Ga0501074_0055023 Ga0501074_0055023_1204_2139 311
947 3300049593 Ga0501077_0130878 Ga0501077_0130878_542_1477 311
948 3300049822 Ga0501035_0165171 Ga0501035_0165171_620_1555 311
949 3300049824 Ga0501045_0030185 Ga0501045_0030185_18_953 311
950 3300060353 Ga0501082_0117174 Ga0501082_0117174_800_1735 311
951 3300005290 Ga0065712_10101729 Ga0065712_101017292 312
952 3300005295 Ga0065707_10083063 Ga0065707_100830633 312
953 3300005331 Ga0070670_100054773 Ga0070670_1000547731 312
954 3300005334 Ga0068869_100116788 Ga0068869_1001167882 312
955 3300005338 Ga0068868_100095597 Ga0068868_1000955972 312
956 3300005347 Ga0070668_100126453 Ga0070668_1001264531 312
957 3300005354 Ga0070675_100004539 Ga0070675_1000045398 312
958 3300005356 Ga0070674_100002295 Ga0070674_1000022957 312
959 3300005364 Ga0070673_100002654 Ga0070673_1000026546 312
960 3300005367 Ga0070667_100154440 Ga0070667_1001544403 312
961 3300005456 Ga0070678_100084994 Ga0070678_1000849943 312
962 3300005459 Ga0068867_100001776 Ga0068867_1000017766 312
963 3300005459 Ga0068867_100002021 Ga0068867_10000202113 312
964 3300005543 Ga0070672_100001907 Ga0070672_1000019077 312
965 3300005543 Ga0070672_100114902 Ga0070672_1001149022 312
966 3300005563 Ga0068855_100155871 Ga0068855_1001558712 312
967 3300005617 Ga0068859_100255239 Ga0068859_1002552392 312
968 3300005719 Ga0068861_100043821 Ga0068861_1000438212 312
969 3300005834 Ga0068851_10098127 Ga0068851_100981272 312
970 3300005841 Ga0068863_100067022 Ga0068863_1000670222 312
971 3300005843 Ga0068860_100003477 Ga0068860_10000347713 312
972 3300005937 Ga0081455_10113926 Ga0081455_101139262 312
973 3300006051 Ga0075364_10046887 Ga0075364_100468873 312
974 3300006177 Ga0075362_10013075 Ga0075362_100130752 312
975 3300006237 Ga0097621_100068270 Ga0097621_1000682702 312
976 3300006358 Ga0068871_100055704 Ga0068871_1000557042 312
977 3300006881 Ga0068865_100002268 Ga0068865_1000022686 312
978 3300006931 Ga0097620_100255245 Ga0097620_1002552452 312
979 3300009093 Ga0105240_10105135 Ga0105240_101051351 312
980 3300009148 Ga0105243_10094929 Ga0105243_100949291 312
981 3300009553 Ga0105249_10144156 Ga0105249_101441563 312
982 3300010375 Ga0105239_10612587 Ga0105239_106125872 312
983 3300013297 Ga0157378_10011636 Ga0157378_100116363 312
984 3300013306 Ga0163162_10003566 Ga0163162_1000356611 312
985 3300013308 Ga0157375_10066362 Ga0157375_100663622 312
986 3300013308 Ga0157375_10332188 Ga0157375_103321882 312
987 3300014326 Ga0157380_10287449 Ga0157380_102874492 312
988 3300014968 Ga0157379_10034241 Ga0157379_100342413 312
989 3300017792 Ga0163161_10006805 Ga0163161_100068057 312
990 3300021388 Ga0213875_10015983 Ga0213875_100159832 312
991 3300021388 Ga0213875_10063752 Ga0213875_100637522 312
992 3300025294 Ga0209025_1000003 Ga0209025_1000003522 312
993 3300025315 Ga0207697_10013127 Ga0207697_100131274 312
994 3300025321 Ga0207656_10045341 Ga0207656_100453412 312
995 3300025907 Ga0207645_10069942 Ga0207645_100699422 312
996 3300025913 Ga0207695_10087929 Ga0207695_100879292 312
997 3300025923 Ga0207681_10001984 Ga0207681_100019846 312
998 3300025925 Ga0207650_10000274 Ga0207650_1000027440 312
999 3300025926 Ga0207659_10004273 Ga0207659_100042732 312
1000 3300025934 Ga0207686_10094415 Ga0207686_100944153 312
1001 3300025935 Ga0207709_10048569 Ga0207709_100485692 312
1002 3300025937 Ga0207669_10158436 Ga0207669_101584362 312
1003 3300025938 Ga0207704_10001539 Ga0207704_100015394 312
1004 3300025940 Ga0207691_10000494 Ga0207691_1000049430 312
1005 3300025940 Ga0207691_10016790 Ga0207691_100167906 312
1006 3300025942 Ga0207689_10182636 Ga0207689_101826362 312
1007 3300025942 Ga0207689_10449430 Ga0207689_104494301 312
1008 3300025949 Ga0207667_10163755 Ga0207667_101637553 312
1009 3300025960 Ga0207651_10001168 Ga0207651_100011682 312
1010 3300025961 Ga0207712_10046934 Ga0207712_100469343 312
1011 3300025986 Ga0207658_10029968 Ga0207658_100299683 312
1012 3300026023 Ga0207677_10087375 Ga0207677_100873752 312
1013 3300026035 Ga0207703_10049718 Ga0207703_100497182 312
1014 3300026041 Ga0207639_10103211 Ga0207639_101032112 312
1015 3300026075 Ga0207708_10085820 Ga0207708_100858202 312
1016 3300026089 Ga0207648_10020558 Ga0207648_100205585 312
1017 3300026089 Ga0207648_10035092 Ga0207648_100350923 312
1018 3300026118 Ga0207675_100002430 Ga0207675_1000024308 312
1019 3300026121 Ga0207683_10275203 Ga0207683_102752032 312
1020 3300028379 Ga0268266_10291164 Ga0268266_102911642 312
1021 3300028380 Ga0268265_10112099 Ga0268265_101120993 312
1022 3300028381 Ga0268264_10020744 Ga0268264_100207443 312
1023 3300031548 Ga0307408_100327522 Ga0307408_1003275222 312
1024 3300031824 Ga0307413_10027937 Ga0307413_100279373 312
1025 3300031852 Ga0307410_10157424 Ga0307410_101574243 312
1026 3300031901 Ga0307406_10011607 Ga0307406_100116074 312
1027 3300031911 Ga0307412_10037202 Ga0307412_100372023 312
1028 3300031995 Ga0307409_100015688 Ga0307409_1000156883 312
1029 3300032002 Ga0307416_100025154 Ga0307416_1000251544 312
1030 3300032004 Ga0307414_10021590 Ga0307414_100215903 312
1031 3300032005 Ga0307411_10017180 Ga0307411_100171803 312
1032 3300037853 Ga0436364_0249115 Ga0436364_0249115_11614_12552 312
1033 3300049568 Ga0501031_0002561 Ga0501031_0002561_226_1170 312
1034 3300049569 Ga0501032_0004619 Ga0501032_0004619_9190_10134 312
1035 3300049571 Ga0501034_0003055 Ga0501034_0003055_9195_10139 312
1036 3300049572 Ga0501036_0001315 Ga0501036_0001315_9190_10134 312
1037 3300049573 Ga0501037_0004241 Ga0501037_0004241_6851_7795 312
1038 3300049574 Ga0501038_0002280 Ga0501038_0002280_9195_10139 312
1039 3300049575 Ga0501039_0002927 Ga0501039_0002927_7429_8373 312
1040 3300049576 Ga0501040_0007819 Ga0501040_0007819_533_1477 312
1041 3300049578 Ga0501042_0003824 Ga0501042_0003824_4016_4960 312
1042 3300049579 Ga0501043_0007149 Ga0501043_0007149_226_1170 312
1043 3300049580 Ga0501046_0002355 Ga0501046_0002355_6775_7719 312
1044 3300049581 Ga0501047_0007345 Ga0501047_0007345_9190_10134 312
1045 3300049582 Ga0501048_0001333 Ga0501048_0001333_9310_10254 312
1046 3300049583 Ga0501067_0045029 Ga0501067_0045029_216_1160 312
1047 3300049584 Ga0501068_0001765 Ga0501068_0001765_10005_10949 312
1048 3300049585 Ga0501069_0174958 Ga0501069_0174958_187_1131 312
1049 3300049586 Ga0501070_0001529 Ga0501070_0001529_9951_10895 312
1050 3300049587 Ga0501071_0002932 Ga0501071_0002932_6353_7297 312
1051 3300049588 Ga0501072_0229988 Ga0501072_0229988_372_1316 312
1052 3300049589 Ga0501073_0007507 Ga0501073_0007507_1300_2244 312
1053 3300049590 Ga0501074_0054018 Ga0501074_0054018_899_1843 312
1054 3300049742 Ga0501080_0002779 Ga0501080_0002779_10005_10949 312
1055 3300049744 Ga0501083_0014028 Ga0501083_0014028_3344_4288 312
1056 3300049823 Ga0501044_0002860 Ga0501044_0002860_11530_12474 312
1057 3300049824 Ga0501045_0003550 Ga0501045_0003550_226_1170 312
1058 3300050491 nmdc:mga00v17_91223_c1 nmdc:mga00v17_91223_c1_313_1251 312
1059 3300053154 Ga0500619_000086 Ga0500619_000086_18778_19716 312
1060 3300003781 Ga0055536_1004861 Ga0055536_10048617 313
1061 3300025292 Ga0209676_1001299 Ga0209676_100129927 313
1062 3300025295 Ga0209564_1000537 Ga0209564_100053728 313
1063 3300025297 Ga0209758_1029665 Ga0209758_10296653 313
1064 3300025299 Ga0209256_1022459 Ga0209256_10224592 313
1065 iso_pu_bacteria 2507262055 2507509718 313
1066 iso_pu_bacteria 2508501009 2508543735 313
1067 iso_pu_bacteria 2508501042 2508698478 313
1068 iso_pu_bacteria 2511231028 2511401320 313
1069 iso_pu_bacteria 2513237092 2513629168 313
1070 iso_pu_bacteria 2513237094 2513644825 313
1071 iso_pu_bacteria 2513237095 2513646220 313
1072 iso_pu_bacteria 2513237102 2513701786 313
1073 iso_pu_bacteria 2513237104 2513721448 313
1074 iso_pu_bacteria 2513237137 2513857455 313
1075 iso_pu_bacteria 2513237139 2513875799 313
1076 iso_pu_bacteria 2513237161 2514011538 313
1077 iso_pu_bacteria 2515154112 2515629166 313
1078 iso_pu_bacteria 2517093001 2517103586 313
1079 iso_pu_bacteria 2524023205 2524442175 313
1080 iso_pu_bacteria 2528768022 2528854142 313
1081 iso_pu_bacteria 2602042107 2603857090 313
1082 iso_pu_bacteria 2617270735 2617349240 313
1083 iso_pu_bacteria 2617270741 2617378234 313
1084 iso_pu_bacteria 2667528175 2671118061 313
1085 iso_pu_bacteria 2721755755 2723846085 313
1086 iso_pu_bacteria 2744054633 2745079440 313
1087 iso_pu_bacteria 2791355196 2793060310 313
1088 iso_pu_bacteria 2802429603 2805917671 313
1089 iso_pu_bacteria 2816332527 2818241441 313
1090 iso_pu_bacteria 2824600985 2824602177 313
1091 iso_pu_bacteria 2824609381 2824610165 313
1092 iso_pu_bacteria 2824617872 2824623822 313
1093 iso_pu_bacteria 2824626560 2824627764 313
1094 iso_pu_bacteria 2824635225 2824639300 313
1095 iso_pu_bacteria 2824644064 2824646871 313
1096 iso_pu_bacteria 2824653114 2824656143 313
1097 iso_pu_bacteria 2824661429 2824669095 313
1098 iso_pu_bacteria 2824671348 2824672858 313
1099 iso_pu_bacteria 2824679649 2824683986 313
1100 iso_pu_bacteria 2824687955 2824691009 313
1101 iso_pu_bacteria 2824696289 2824698417 313
1102 iso_pu_bacteria 2824704595 2824711605 313
1103 iso_pu_bacteria 2824714736 2824717922 313
1104 iso_pu_bacteria 2824723954 2824727655 313
1105 iso_pu_bacteria 2824732956 2824736720 313
1106 iso_pu_bacteria 2824746037 2824746873 313
1107 iso_pu_bacteria 2824753945 2824761663 313
1108 iso_pu_bacteria 2824763712 2824771278 313
1109 iso_pu_bacteria 2824773399 2824773974 313
1110 iso_pu_bacteria 2838122688 2838130026 313
1111 iso_pu_bacteria 2841941048 2841941181 313
1112 iso_pu_bacteria 2841949485 2841952792 313
1113 iso_pu_bacteria 2841957949 2841962303 313
1114 iso_pu_bacteria 2841966195 2841967336 313
1115 iso_pu_bacteria 2841974524 2841979267 313
1116 iso_pu_bacteria 2841983080 2841990840 313
1117 iso_pu_bacteria 2842038055 2842038682 313
1118 iso_pu_bacteria 2842045827 2842048373 313
1119 iso_pu_bacteria 2844315083 2844318080 313
1120 iso_pu_bacteria 2847930680 2847934889 313
1121 iso_pu_bacteria 2847939898 2847945456 313
1122 iso_pu_bacteria 2849076700 2849080358 313
1123 iso_pu_bacteria 2857509624 2857510292 313
1124 iso_pu_bacteria 2874590934 2874595172 313
1125 iso_pu_bacteria 2874612657 2874613138 313
1126 iso_pu_bacteria 2874620515 2874621616 313
1127 iso_pu_bacteria 2874628541 2874636590 313
1128 iso_pu_bacteria 2874645413 2874651033 313
1129 iso_pu_bacteria 2876761206 2876762494 313
1130 iso_pu_bacteria 2876771140 2876775108 313
1131 iso_pu_bacteria 2876818435 2876823923 313
1132 iso_pu_bacteria 2879074833 2879080551 313
1133 iso_pu_bacteria 2879083081 2879086279 313
1134 iso_pu_bacteria 2879099564 2879109402 313
1135 iso_pu_bacteria 2879127579 2879134843 313
1136 iso_pu_bacteria 2879142872 2879149154 313
1137 iso_pu_bacteria 2881364244 2881366283 313
1138 iso_pu_bacteria 2881665667 2881666224 313
1139 iso_pu_bacteria 2885366525 2885372877 313
1140 iso_pu_bacteria 2885409591 2885413003 313
1141 iso_pu_bacteria 2888378607 2888382883 313
1142 iso_pu_bacteria 2888388044 2888394920 313
1143 iso_pu_bacteria 2888419890 2888423357 313
1144 iso_pu_bacteria 2903727486 2903729613 313
1145 iso_pu_bacteria 2904666416 2904668668 313
1146 iso_pu_bacteria 2904711408 2904716720 313
1147 iso_pu_bacteria 2906602504 2906605759 313
1148 iso_pu_bacteria 2906626472 2906628213 313
1149 iso_pu_bacteria 2906643746 2906649434 313
1150 iso_pu_bacteria 2908739725 2908743817 313
1151 iso_pu_bacteria 2908775508 2908778998 313
1152 iso_pu_bacteria 2919073203 2919075597 313
1153 iso_pu_bacteria 2922368715 2922373089 313
1154 iso_pu_bacteria 2922393267 2922395288 313
1155 iso_pu_bacteria 2929615660 2929615846 313
1156 iso_pu_bacteria 2929624759 2929630459 313
1157 iso_pu_bacteria 2932784394 2932792511 313
1158 iso_pu_bacteria 2932794094 2932800343 313
1159 iso_pu_bacteria 2932801729 2932804517 313
1160 iso_pu_bacteria 2932809354 2932814032 313
1161 iso_pu_bacteria 2932818245 2932819477 313
1162 iso_pu_bacteria 2932828146 2932833815 313
1163 iso_pu_bacteria 2933577622 2933578868 313
1164 iso_pu_bacteria 2935608549 2935611422 313
1165 iso_pu_bacteria 2935616580 2935618659 313
1166 iso_pu_bacteria 2935638405 2935644502 313
1167 iso_pu_bacteria 2935648319 2935648806 313
1168 iso_pu_bacteria 2935656913 2935657111 313
1169 iso_pu_bacteria 2935665750 2935673607 313
1170 iso_pu_bacteria 2935675223 2935678501 313
1171 iso_pu_bacteria 2935684952 2935688002 313
1172 iso_pu_bacteria 2935694250 2935701386 313
1173 iso_pu_bacteria 2935703347 2935708359 313
1174 iso_pu_bacteria 2935713505 2935715022 313
1175 iso_pu_bacteria 2935722832 2935726413 313
1176 iso_pu_bacteria 2935732158 2935733840 313
1177 iso_pu_bacteria 2935741537 2935743219 313
1178 iso_pu_bacteria 2935750917 2935754742 313
1179 iso_pu_bacteria 2935760218 2935765449 313
1180 iso_pu_bacteria 2935769743 2935776273 313
1181 iso_pu_bacteria 2935777560 2935779597 313
1182 iso_pu_bacteria 2935785616 2935790262 313
1183 iso_pu_bacteria 2935793552 2935798845 313
1184 iso_pu_bacteria 2935801545 2935805403 313
1185 iso_pu_bacteria 2935810662 2935816696 313
1186 iso_pu_bacteria 2935819856 2935820899 313
1187 iso_pu_bacteria 2935827899 2935833749 313
1188 iso_pu_bacteria 2935837841 2935839565 313
1189 iso_pu_bacteria 2935847175 2935850841 313
1190 iso_pu_bacteria 2935855204 2935857024 313
1191 iso_pu_bacteria 2935864058 2935871152 313
1192 iso_pu_bacteria 2935873716 2935876345 313
1193 iso_pu_bacteria 2935883170 2935889711 313
1194 iso_pu_bacteria 2935908558 2935913791 313
1195 iso_pu_bacteria 2935916978 2935920219 313
1196 iso_pu_bacteria 2935926038 2935930558 313
1197 iso_pu_bacteria 2935934488 2935939469 313
1198 iso_pu_bacteria 2935942939 2935946418 313
1199 iso_pu_bacteria 2935951376 2935955743 313
1200 iso_pu_bacteria 2935959822 2935964665 313
1201 iso_pu_bacteria 2935967501 2935972547 313
1202 iso_pu_bacteria 2935975950 2935981620 313
1203 iso_pu_bacteria 2935984226 2935992047 313
1204 iso_pu_bacteria 2935992306 2935997686 313
1205 iso_pu_bacteria 2936002035 2936007204 313
1206 iso_pu_bacteria 2936011229 2936011716 313
1207 iso_pu_bacteria 2936019824 2936020311 313
1208 iso_pu_bacteria 2936028420 2936029006 313
1209 iso_pu_bacteria 2936037263 2936043042 313
1210 iso_pu_bacteria 2936046547 2936047034 313
1211 iso_pu_bacteria 2936055302 2936058086 313
1212 iso_pu_bacteria 2940556831 2940559881 313
1213 iso_pu_bacteria 2941531003 2941536026 313
1214 iso_pu_bacteria 2941538514 2941540254 313
1215 iso_pu_bacteria 3005506211 3005512648 313
1216 iso_pu_bacteria 3005587118 3005590411 313
1217 iso_pu_bacteria 3005594810 3005598131 313
1218 iso_pu_bacteria 3005710791 3005713809 313
1219 iso_pu_bacteria 3005718088 3005721318 313
1220 iso_pu_bacteria 8006926726 8006932791 313
1221 iso_pu_bacteria 8006933436 8006942137 313
1222 iso_pu_bacteria 8006973647 8006981873 313
1223 iso_pu_bacteria 8016511872 8016514618 313
1224 iso_pu_bacteria 8016522445 8016530723 313
1225 iso_pu_bacteria 8016530956 8016536009 313
1226 iso_pu_bacteria 8016539877 8016540289 313
1227 iso_pu_bacteria 8016548790 8016552941 313
1228 iso_pu_bacteria 8016557553 8016561318 313
1229 iso_pu_bacteria 8016575299 8016578455 313
1230 iso_pu_bacteria 8016595262 8016599176 313
1231 iso_pu_bacteria 8016603502 8016611870 313
1232 iso_pu_bacteria 8016613128 8016621935 313
1233 iso_pu_bacteria 8016622563 8016627915 313
1234 iso_pu_bacteria 8016630954 8016632240 313
1235 iso_pu_bacteria 8017057580 8017061812 313
1236 iso_pu_bacteria 8019530166 8019535736 313
1237 iso_pu_bacteria 8019538911 8019543745 313
1238 iso_pu_bacteria 8019547302 8019555026 313
1239 iso_pu_bacteria 8019576017 8019581341 313
1240 iso_pu_bacteria 8019597564 8019602268 313
1241 iso_pu_bacteria 8019608314 8019616294 313
1242 iso_pu_bacteria 8019619141 8019626898 313
1243 iso_pu_bacteria 8019629233 8019635620 313
1244 iso_pu_bacteria 8019638758 8019644065 313
1245 iso_pu_bacteria 8019659431 8019663417 313
1246 iso_pu_bacteria 8019668869 8019673032 313
1247 iso_pu_bacteria 8019678201 8019683111 313
1248 iso_pu_bacteria 8019687851 8019688802 313
1249 iso_pu_bacteria 8055742211 8055747493 313
1250 iso_pu_bacteria 8056673599 8056680548 313
1251 iso_pu_bacteria 8056681323 8056683888 313
1252 iso_pu_bacteria 8056967851 8056972433 313
1253 3300005535 Ga0070684_100328729 Ga0070684_1003287292 314
1254 3300005615 Ga0070702_100094948 Ga0070702_1000949481 314
1255 3300014325 Ga0163163_10002136 Ga0163163_1000213610 314
1256 3300024227 Ga0228598_1014149 Ga0228598_10141492 314
1257 3300025986 Ga0207658_10076590 Ga0207658_100765902 314
1258 3300035725 Ga0373947_0009876 Ga0373947_0009876_322_1296 314
1259 3300038443 Ga0395901_0613777 Ga0395901_0613777_52_1011 314
1260 3300047321 Ga0495676_0045710 Ga0495676_0045710_32_1006 314
1261 3300048905 Ga0496102_0058983 Ga0496102_0058983_1172_2146 314
1262 3300048907 Ga0496104_0001994 Ga0496104_0001994_3071_4045 314
1263 3300048908 Ga0496105_0002533 Ga0496105_0002533_2345_3319 314
1264 3300048911 Ga0496108_0007201 Ga0496108_0007201_3268_4242 314
1265 3300048912 Ga0496109_0017496 Ga0496109_0017496_3678_4652 314
1266 3300048914 Ga0496111_0001890 Ga0496111_0001890_6138_7112 314
1267 3300048915 Ga0496112_0001865 Ga0496112_0001865_3414_4388 314
1268 3300048916 Ga0496113_0000167 Ga0496113_0000167_12011_12985 314
1269 3300048917 Ga0496114_0028876 Ga0496114_0028876_3181_4155 314
1270 3300048918 Ga0496115_0044765 Ga0496115_0044765_993_1967 314
1271 iso_pu_bacteria 2508501128 2509149566 314
1272 iso_pu_bacteria 2513237096 2513661081 314
1273 iso_pu_bacteria 2513237098 2513673717 314
1274 iso_pu_bacteria 2513237101 2513691462 314
1275 iso_pu_bacteria 2513237141 2513893904 314
1276 iso_pu_bacteria 2513237145 2513922766 314
1277 iso_pu_bacteria 2517572143 2517893412 314
1278 iso_pu_bacteria 2524023210 2524470072 314
1279 iso_pu_bacteria 2524023228 2524537918 314
1280 iso_pu_bacteria 2728368998 2728747818 314
1281 iso_pu_bacteria 2791355197 2793071826 314
1282 iso_pu_bacteria 2791355199 2793076744 314
1283 iso_pu_bacteria 2857524615 2857528169 314
1284 iso_pu_bacteria 2874604998 2874608974 314
1285 iso_pu_bacteria 2876808645 2876809550 314
1286 iso_pu_bacteria 2879110137 2879110614 314
1287 iso_pu_bacteria 2885374607 2885377294 314
1288 iso_pu_bacteria 2885383462 2885389901 314
1289 iso_pu_bacteria 2889033259 2889041030 314
1290 iso_pu_bacteria 2893066018 2893068612 314
1291 iso_pu_bacteria 2903748898 2903755595 314
1292 iso_pu_bacteria 2903768456 2903774911 314
1293 iso_pu_bacteria 2904690495 2904696750 314
1294 iso_pu_bacteria 2904699407 2904701743 314
1295 iso_pu_bacteria 2906610324 2906617386 314
1296 iso_pu_bacteria 2906635258 2906640630 314
1297 iso_pu_bacteria 2906660503 2906665850 314
1298 iso_pu_bacteria 2908756301 2908761537 314
1299 iso_pu_bacteria 2922361189 2922368008 314
1300 iso_pu_bacteria 2922386360 2922392112 314
1301 iso_pu_bacteria 2922425934 2922429057 314
1302 iso_pu_bacteria 8006964411 8006964445 314
1303 iso_pu_bacteria 8006984368 8006986949 314
1304 iso_pu_bacteria 8006994254 8006996166 314
1305 iso_pu_bacteria 8019555841 8019557868 314
1306 iso_pu_bacteria 8019565922 8019567422 314
1307 iso_pu_bacteria 8056689827 8056694238 314
1308 3300005336 Ga0070680_100003612 Ga0070680_1000036124 315
1309 3300005530 Ga0070679_100038790 Ga0070679_1000387903 315
1310 3300005539 Ga0068853_100057773 Ga0068853_1000577733 315
1311 3300006038 Ga0075365_10098835 Ga0075365_100988352 315
1312 3300006178 Ga0075367_10002507 Ga0075367_100025076 315
1313 3300013307 Ga0157372_10137753 Ga0157372_101377532 315
1314 3300013308 Ga0157375_10156434 Ga0157375_101564342 315
1315 3300025912 Ga0207707_10001941 Ga0207707_1000194111 315
1316 3300025921 Ga0207652_10012449 Ga0207652_100124497 315
1317 3300025949 Ga0207667_10161364 Ga0207667_101613641 315
1318 3300039453 Ga0436362_0372017 Ga0436362_0372017_35_1063 315
1319 3300050494 nmdc:mga06z11_5600_c1 nmdc:mga06z11_5600_c1_1955_2902 315
1320 3300005329 Ga0070683_100141803 Ga0070683_1001418032 316
1321 3300005338 Ga0068868_100027083 Ga0068868_1000270835 316
1322 3300005356 Ga0070674_100069140 Ga0070674_1000691402 316
1323 3300005435 Ga0070714_100331329 Ga0070714_1003313291 316
1324 3300005455 Ga0070663_100100803 Ga0070663_1001008032 316
1325 3300005548 Ga0070665_100272492 Ga0070665_1002724922 316
1326 3300005614 Ga0068856_100000680 Ga0068856_10000068014 316
1327 3300005981 Ga0081538_10043613 Ga0081538_100436132 316
1328 3300006028 Ga0070717_10012420 Ga0070717_100124205 316
1329 3300006028 Ga0070717_10386289 Ga0070717_103862892 316
1330 3300006038 Ga0075365_10240706 Ga0075365_102407061 316
1331 3300006358 Ga0068871_100309432 Ga0068871_1003094322 316
1332 3300009098 Ga0105245_10087602 Ga0105245_100876022 316
1333 3300009177 Ga0105248_10337987 Ga0105248_103379872 316
1334 3300009545 Ga0105237_10309025 Ga0105237_103090252 316
1335 3300009551 Ga0105238_10008143 Ga0105238_100081432 316
1336 3300010375 Ga0105239_10326162 Ga0105239_103261622 316
1337 3300011119 Ga0105246_10017489 Ga0105246_100174896 316
1338 3300013296 Ga0157374_10049880 Ga0157374_100498804 316
1339 3300013297 Ga0157378_10026868 Ga0157378_100268683 316
1340 3300013308 Ga0157375_10058420 Ga0157375_100584202 316
1341 3300021388 Ga0213875_10019342 Ga0213875_100193422 316
1342 3300025297 Ga0209758_1004652 Ga0209758_10046523 316
1343 3300025908 Ga0207643_10127481 Ga0207643_101274812 316
1344 3300025914 Ga0207671_10090005 Ga0207671_100900052 316
1345 3300025927 Ga0207687_10192768 Ga0207687_101927682 316
1346 3300025928 Ga0207700_10001731 Ga0207700_100017315 316
1347 3300025929 Ga0207664_10403233 Ga0207664_104032331 316
1348 3300025940 Ga0207691_10266214 Ga0207691_102662142 316
1349 3300025941 Ga0207711_10108304 Ga0207711_101083043 316
1350 3300025944 Ga0207661_10034064 Ga0207661_100340644 316
1351 3300026067 Ga0207678_10028024 Ga0207678_100280244 316
1352 3300026078 Ga0207702_10000433 Ga0207702_1000043314 316
1353 3300028379 Ga0268266_10102980 Ga0268266_101029802 316
1354 3300031548 Ga0307408_100269328 Ga0307408_1002693282 316
1355 3300035724 Ga0373933_0000059 Ga0373933_0000059_22898_23851 316
1356 3300036401 Ga0373937_0317447 Ga0373937_0317447_447_1436 316
1357 3300037471 Ga0395905_0157417 Ga0395905_0157417_32_985 316
1358 3300037853 Ga0436364_0719526 Ga0436364_0719526_1977_2957 316
1359 3300046455 Ga0495603_0067622 Ga0495603_0067622_589_1542 316
1360 3300046463 Ga0495653_0050466 Ga0495653_0050466_58_1056 316
1361 3300046477 Ga0495664_0042937 Ga0495664_0042937_1125_2123 316
1362 3300046507 Ga0495606_0161826 Ga0495606_0161826_74_1024 316
1363 3300046511 Ga0495608_0030766 Ga0495608_0030766_2182_3171 316
1364 3300046511 Ga0495608_0145227 Ga0495608_0145227_363_1361 316
1365 3300046514 Ga0495618_0047475 Ga0495618_0047475_1448_2446 316
1366 3300046516 Ga0495628_0000179 Ga0495628_0000179_2194_3192 316
1367 3300046517 Ga0495630_0048283 Ga0495630_0048283_1018_2016 316
1368 3300046524 Ga0495648_0001231 Ga0495648_0001231_4508_5461 316
1369 3300046529 Ga0495652_0003775 Ga0495652_0003775_2108_3106 316
1370 3300046543 Ga0495645_0073011 Ga0495645_0073011_31_1029 316
1371 3300046663 Ga0495635_0105169 Ga0495635_0105169_746_1744 316
1372 3300046675 Ga0495657_0019735 Ga0495657_0019735_2867_3865 316
1373 3300046678 Ga0495599_0007297 Ga0495599_0007297_110_1108 316
1374 3300046680 Ga0495646_0046613 Ga0495646_0046613_1632_2630 316
1375 3300046681 Ga0495647_0053660 Ga0495647_0053660_513_1466 316
1376 3300047317 Ga0495604_0015742 Ga0495604_0015742_2627_3625 316
1377 3300047319 Ga0495674_0011690 Ga0495674_0011690_2201_3199 316
1378 3300047319 Ga0495674_0081886 Ga0495674_0081886_508_1497 316
1379 3300047320 Ga0495672_0002625 Ga0495672_0002625_7760_8719 316
1380 3300047320 Ga0495672_0065297 Ga0495672_0065297_10_960 316
1381 3300047322 Ga0495680_0016955 Ga0495680_0016955_3085_4083 316
1382 3300047444 Ga0495675_0000012 Ga0495675_0000012_20613_21611 316
1383 3300047471 Ga0495684_0000152 Ga0495684_0000152_38274_39263 316
1384 3300047471 Ga0495684_0026007 Ga0495684_0026007_232_1230 316
1385 3300047472 Ga0495686_0010693 Ga0495686_0010693_3703_4713 316
1386 3300048088 Ga0495602_0003796 Ga0495602_0003796_9138_10136 316
1387 3300048088 Ga0495602_0081111 Ga0495602_0081111_965_1954 316
1388 3300048903 Ga0496100_0044702 Ga0496100_0044702_1285_2250 316
1389 3300048904 Ga0496101_0002458 Ga0496101_0002458_3782_4747 316
1390 3300048905 Ga0496102_0007740 Ga0496102_0007740_1555_2520 316
1391 3300048907 Ga0496104_0075355 Ga0496104_0075355_913_1878 316
1392 3300048907 Ga0496104_0137566 Ga0496104_0137566_729_1682 316
1393 3300048908 Ga0496105_0100971 Ga0496105_0100971_1105_2070 316
1394 3300048908 Ga0496105_0224771 Ga0496105_0224771_128_1081 316
1395 3300048909 Ga0496106_0001555 Ga0496106_0001555_11667_12620 316
1396 3300048909 Ga0496106_0093536 Ga0496106_0093536_240_1205 316
1397 3300048910 Ga0496107_0147709 Ga0496107_0147709_77_1042 316
1398 3300048911 Ga0496108_0001200 Ga0496108_0001200_19059_20012 316
1399 3300048911 Ga0496108_0082301 Ga0496108_0082301_686_1651 316
1400 3300048912 Ga0496109_0116944 Ga0496109_0116944_285_1238 316
1401 3300048913 Ga0496110_0006609 Ga0496110_0006609_7818_8783 316
1402 3300048913 Ga0496110_0017235 Ga0496110_0017235_2872_3825 316
1403 3300048915 Ga0496112_0004442 Ga0496112_0004442_4911_5864 316
1404 3300048915 Ga0496112_0067255 Ga0496112_0067255_1195_2160 316
1405 3300048916 Ga0496113_0180894 Ga0496113_0180894_279_1244 316
1406 3300048918 Ga0496115_0007883 Ga0496115_0007883_358_1323 316
1407 3300048922 Ga0496119_0044797 Ga0496119_0044797_1058_2011 316
1408 3300048924 Ga0496121_0103679 Ga0496121_0103679_984_1937 316
1409 3300049822 Ga0501035_0022569 Ga0501035_0022569_1912_2865 316
1410 3300053094 Ga0500566_0050801 Ga0500566_0050801_823_1776 316
1411 3300053102 Ga0500554_074459 Ga0500554_074459_110_1063 316
1412 3300053119 Ga0500595_000450 Ga0500595_000450_24571_25524 316
1413 3300053162 Ga0500638_008035 Ga0500638_008035_53_1006 316
1414 3300053178 Ga0500637_0004182 Ga0500637_0004182_5802_6755 316
1415 3300055283 Ga0500661_024384 Ga0500661_024384_50_1003 316
1416 2010549000 RicEn_C2224 RicEn_40840 317
1417 3300003203 JGI25406J46586_10001179 JGI25406J46586_100011793 317
1418 3300003203 JGI25406J46586_10004585 JGI25406J46586_100045855 317
1419 3300003215 JGI25153J46596_10000964 JGI25153J46596_1000096421 317
1420 3300003215 JGI25153J46596_10014750 JGI25153J46596_100147502 317
1421 3300003215 JGI25153J46596_10028068 JGI25153J46596_100280682 317
1422 3300003354 JGI25160J50197_1006435 JGI25160J50197_10064354 317
1423 3300003659 JGI25404J52841_10006257 JGI25404J52841_100062572 317
1424 3300003659 JGI25404J52841_10022839 JGI25404J52841_100228391 317
1425 3300003659 JGI25404J52841_10023380 JGI25404J52841_100233801 317
1426 3300003659 JGI25404J52841_10024164 JGI25404J52841_100241642 317
1427 3300003771 Ga0055526_1014612 Ga0055526_10146123 317
1428 3300003775 Ga0055524_1016057 Ga0055524_10160572 317
1429 3300004625 Ga0055543_1005787 Ga0055543_10057872 317
1430 3300005262 Ga0065165_1001478 Ga0065165_100147828 317
1431 3300005262 Ga0065165_1049491 Ga0065165_10494912 317
1432 3300005327 Ga0070658_10046430 Ga0070658_100464303 317
1433 3300005327 Ga0070658_10460442 Ga0070658_104604421 317
1434 3300005331 Ga0070670_100059448 Ga0070670_1000594483 317
1435 3300005336 Ga0070680_100006838 Ga0070680_1000068384 317
1436 3300005336 Ga0070680_100290426 Ga0070680_1002904261 317
1437 3300005338 Ga0068868_100051682 Ga0068868_1000516821 317
1438 3300005339 Ga0070660_100000712 Ga0070660_10000071221 317
1439 3300005339 Ga0070660_100105000 Ga0070660_1001050002 317
1440 3300005339 Ga0070660_100406332 Ga0070660_1004063321 317
1441 3300005344 Ga0070661_100040992 Ga0070661_1000409922 317
1442 3300005347 Ga0070668_100323250 Ga0070668_1003232501 317
1443 3300005356 Ga0070674_100045491 Ga0070674_1000454913 317
1444 3300005366 Ga0070659_100032961 Ga0070659_1000329613 317
1445 3300005366 Ga0070659_100176657 Ga0070659_1001766571 317
1446 3300005367 Ga0070667_100097327 Ga0070667_1000973272 317
1447 3300005367 Ga0070667_100450903 Ga0070667_1004509031 317
1448 3300005434 Ga0070709_10000551 Ga0070709_100005519 317
1449 3300005434 Ga0070709_10039200 Ga0070709_100392002 317
1450 3300005434 Ga0070709_10145883 Ga0070709_101458831 317
1451 3300005435 Ga0070714_100006459 Ga0070714_1000064599 317
1452 3300005435 Ga0070714_100078545 Ga0070714_1000785453 317
1453 3300005435 Ga0070714_100520002 Ga0070714_1005200021 317
1454 3300005436 Ga0070713_100012869 Ga0070713_1000128691 317
1455 3300005436 Ga0070713_100048830 Ga0070713_1000488303 317
1456 3300005436 Ga0070713_100071444 Ga0070713_1000714442 317
1457 3300005436 Ga0070713_100215848 Ga0070713_1002158482 317
1458 3300005437 Ga0070710_10001238 Ga0070710_100012386 317
1459 3300005437 Ga0070710_10001820 Ga0070710_100018205 317
1460 3300005437 Ga0070710_10014322 Ga0070710_100143224 317
1461 3300005439 Ga0070711_100002350 Ga0070711_1000023503 317
1462 3300005439 Ga0070711_100003473 Ga0070711_1000034734 317
1463 3300005439 Ga0070711_100161009 Ga0070711_1001610091 317
1464 3300005445 Ga0070708_100098574 Ga0070708_1000985742 317
1465 3300005455 Ga0070663_100020630 Ga0070663_1000206303 317
1466 3300005455 Ga0070663_100129121 Ga0070663_1001291212 317
1467 3300005455 Ga0070663_100132501 Ga0070663_1001325012 317
1468 3300005455 Ga0070663_100173848 Ga0070663_1001738482 317
1469 3300005457 Ga0070662_100118532 Ga0070662_1001185322 317
1470 3300005457 Ga0070662_100425940 Ga0070662_1004259401 317
1471 3300005458 Ga0070681_10069947 Ga0070681_100699473 317
1472 3300005459 Ga0068867_100021615 Ga0068867_1000216155 317
1473 3300005467 Ga0070706_100099702 Ga0070706_1000997023 317
1474 3300005471 Ga0070698_100036324 Ga0070698_1000363243 317
1475 3300005530 Ga0070679_100022733 Ga0070679_1000227334 317
1476 3300005530 Ga0070679_100089045 Ga0070679_1000890452 317
1477 3300005530 Ga0070679_100407730 Ga0070679_1004077302 317
1478 3300005535 Ga0070684_100054319 Ga0070684_1000543193 317
1479 3300005539 Ga0068853_100072650 Ga0068853_1000726502 317
1480 3300005539 Ga0068853_100139930 Ga0068853_1001399302 317
1481 3300005543 Ga0070672_100151643 Ga0070672_1001516432 317
1482 3300005548 Ga0070665_100044294 Ga0070665_1000442945 317
1483 3300005548 Ga0070665_100046013 Ga0070665_1000460132 317
1484 3300005548 Ga0070665_100082828 Ga0070665_1000828281 317
1485 3300005548 Ga0070665_100368380 Ga0070665_1003683802 317
1486 3300005548 Ga0070665_100380040 Ga0070665_1003800402 317
1487 3300005563 Ga0068855_100032479 Ga0068855_1000324794 317
1488 3300005563 Ga0068855_100064535 Ga0068855_1000645353 317
1489 3300005563 Ga0068855_100130991 Ga0068855_1001309911 317
1490 3300005563 Ga0068855_100228906 Ga0068855_1002289062 317
1491 3300005563 Ga0068855_100653046 Ga0068855_1006530461 317
1492 3300005564 Ga0070664_100202560 Ga0070664_1002025602 317
1493 3300005577 Ga0068857_100117621 Ga0068857_1001176213 317
1494 3300005616 Ga0068852_100002663 Ga0068852_1000026636 317
1495 3300005616 Ga0068852_100334862 Ga0068852_1003348622 317
1496 3300005617 Ga0068859_100313387 Ga0068859_1003133871 317
1497 3300005617 Ga0068859_100346401 Ga0068859_1003464012 317
1498 3300005618 Ga0068864_100080180 Ga0068864_1000801803 317
1499 3300005719 Ga0068861_100239575 Ga0068861_1002395752 317
1500 3300005719 Ga0068861_100286196 Ga0068861_1002861962 317
1501 3300005719 Ga0068861_100428911 Ga0068861_1004289111 317
1502 3300005834 Ga0068851_10014696 Ga0068851_100146963 317
1503 3300005841 Ga0068863_100230221 Ga0068863_1002302212 317
1504 3300005841 Ga0068863_100572368 Ga0068863_1005723681 317
1505 3300005842 Ga0068858_100050616 Ga0068858_1000506162 317
1506 3300005842 Ga0068858_100104515 Ga0068858_1001045152 317
1507 3300005843 Ga0068860_100000258 Ga0068860_10000025849 317
1508 3300005843 Ga0068860_100270797 Ga0068860_1002707972 317
1509 3300005937 Ga0081455_10000992 Ga0081455_1000099220 317
1510 3300005937 Ga0081455_10014642 Ga0081455_100146426 317
1511 3300005937 Ga0081455_10077075 Ga0081455_100770753 317
1512 3300005983 Ga0081540_1001447 Ga0081540_10014471 317
1513 3300005983 Ga0081540_1003602 Ga0081540_10036022 317
1514 3300005983 Ga0081540_1010266 Ga0081540_10102662 317
1515 3300005983 Ga0081540_1013011 Ga0081540_10130114 317
1516 3300005983 Ga0081540_1017968 Ga0081540_10179683 317
1517 3300005983 Ga0081540_1029167 Ga0081540_10291674 317
1518 3300005983 Ga0081540_1042958 Ga0081540_10429582 317
1519 3300005983 Ga0081540_1050922 Ga0081540_10509221 317
1520 3300005983 Ga0081540_1058311 Ga0081540_10583112 317
1521 3300005983 Ga0081540_1067104 Ga0081540_10671041 317
1522 3300005983 Ga0081540_1089783 Ga0081540_10897832 317
1523 3300005985 Ga0081539_10000140 Ga0081539_10000140118 317
1524 3300005985 Ga0081539_10000897 Ga0081539_1000089755 317
1525 3300005985 Ga0081539_10008354 Ga0081539_100083545 317
1526 3300005985 Ga0081539_10087407 Ga0081539_100874072 317
1527 3300006028 Ga0070717_10038867 Ga0070717_100388674 317
1528 3300006028 Ga0070717_10286247 Ga0070717_102862472 317
1529 3300006038 Ga0075365_10020374 Ga0075365_100203743 317
1530 3300006042 Ga0075368_10016033 Ga0075368_100160333 317
1531 3300006042 Ga0075368_10028860 Ga0075368_100288602 317
1532 3300006048 Ga0075363_100090159 Ga0075363_1000901592 317
1533 3300006051 Ga0075364_10137155 Ga0075364_101371552 317
1534 3300006051 Ga0075364_10267926 Ga0075364_102679262 317
1535 3300006175 Ga0070712_100027212 Ga0070712_1000272123 317
1536 3300006175 Ga0070712_100028983 Ga0070712_1000289833 317
1537 3300006178 Ga0075367_10162643 Ga0075367_101626432 317
1538 3300006237 Ga0097621_100188828 Ga0097621_1001888282 317
1539 3300006353 Ga0075370_10085010 Ga0075370_100850102 317
1540 3300006353 Ga0075370_10209295 Ga0075370_102092952 317
1541 3300006844 Ga0075428_100318846 Ga0075428_1003188462 317
1542 3300006871 Ga0075434_100249559 Ga0075434_1002495592 317
1543 3300006881 Ga0068865_100119716 Ga0068865_1001197162 317
1544 3300006931 Ga0097620_100313373 Ga0097620_1003133731 317
1545 3300006931 Ga0097620_100346440 Ga0097620_1003464402 317
1546 3300006941 Ga0099825_1025546 Ga0099825_10255463 317
1547 3300006941 Ga0099825_1034052 Ga0099825_10340522 317
1548 3300006942 Ga0099824_1007709 Ga0099824_100770919 317
1549 3300006942 Ga0099824_1009535 Ga0099824_10095357 317
1550 3300006943 Ga0099822_1037622 Ga0099822_10376223 317
1551 3300006943 Ga0099822_1044439 Ga0099822_10444392 317
1552 3300007265 Ga0099794_10019289 Ga0099794_100192893 317
1553 3300007265 Ga0099794_10033765 Ga0099794_100337652 317
1554 3300009093 Ga0105240_10002310 Ga0105240_1000231023 317
1555 3300009093 Ga0105240_10027925 Ga0105240_100279252 317
1556 3300009094 Ga0111539_10195008 Ga0111539_101950082 317
1557 3300009098 Ga0105245_10011198 Ga0105245_100111987 317
1558 3300009174 Ga0105241_10041926 Ga0105241_100419263 317
1559 3300009174 Ga0105241_10094937 Ga0105241_100949372 317
1560 3300009174 Ga0105241_10373718 Ga0105241_103737182 317
1561 3300009176 Ga0105242_10635877 Ga0105242_106358771 317
1562 3300009545 Ga0105237_10002162 Ga0105237_100021625 317
1563 3300009545 Ga0105237_10025732 Ga0105237_100257325 317
1564 3300009545 Ga0105237_10179615 Ga0105237_101796152 317
1565 3300009551 Ga0105238_10108633 Ga0105238_101086333 317
1566 3300009551 Ga0105238_10231024 Ga0105238_102310241 317
1567 3300009551 Ga0105238_10265679 Ga0105238_102656791 317
1568 3300010159 Ga0099796_10007451 Ga0099796_100074512 317
1569 3300010375 Ga0105239_10088786 Ga0105239_100887863 317
1570 3300010375 Ga0105239_10227156 Ga0105239_102271562 317
1571 3300011119 Ga0105246_10155346 Ga0105246_101553462 317
1572 3300013104 Ga0157370_10077059 Ga0157370_100770594 317
1573 3300013104 Ga0157370_10381827 Ga0157370_103818272 317
1574 3300013105 Ga0157369_10009732 Ga0157369_1000973215 317
1575 3300013105 Ga0157369_10151909 Ga0157369_101519092 317
1576 3300013105 Ga0157369_10282041 Ga0157369_102820412 317
1577 3300013296 Ga0157374_10065342 Ga0157374_100653423 317
1578 3300013297 Ga0157378_10211465 Ga0157378_102114652 317
1579 3300013306 Ga0163162_10415528 Ga0163162_104155281 317
1580 3300013307 Ga0157372_10318761 Ga0157372_103187612 317
1581 3300014497 Ga0182008_10092916 Ga0182008_100929161 317
1582 3300014968 Ga0157379_10055612 Ga0157379_100556125 317
1583 3300020069 Ga0197907_11327166 Ga0197907_113271662 317
1584 3300020069 Ga0197907_11489271 Ga0197907_114892712 317
1585 3300020070 Ga0206356_11264946 Ga0206356_112649462 317
1586 3300020081 Ga0206354_10438044 Ga0206354_104380442 317
1587 3300020082 Ga0206353_11048710 Ga0206353_110487103 317
1588 3300021320 Ga0214544_1000006 Ga0214544_1000006119 317
1589 3300021321 Ga0214542_1000002 Ga0214542_1000002256 317
1590 3300021324 Ga0214545_1000002 Ga0214545_1000002463 317
1591 3300021327 Ga0214543_1000017 Ga0214543_100001767 317
1592 3300021384 Ga0213876_10015756 Ga0213876_100157562 317
1593 3300021441 Ga0213871_10007482 Ga0213871_100074823 317
1594 3300022467 Ga0224712_10002521 Ga0224712_100025214 317
1595 3300025230 Ga0209563_101440 Ga0209563_1014402 317
1596 3300025253 Ga0209677_100615 Ga0209677_10061511 317
1597 3300025253 Ga0209677_108121 Ga0209677_1081213 317
1598 3300025254 Ga0209148_1000354 Ga0209148_100035448 317
1599 3300025254 Ga0209148_1004815 Ga0209148_10048153 317
1600 3300025261 Ga0209233_1002313 Ga0209233_10023135 317
1601 3300025261 Ga0209233_1007318 Ga0209233_10073183 317
1602 3300025272 Ga0209455_1003303 Ga0209455_10033032 317
1603 3300025272 Ga0209455_1008176 Ga0209455_10081763 317
1604 3300025272 Ga0209455_1009508 Ga0209455_10095083 317
1605 3300025273 Ga0209673_1027557 Ga0209673_10275571 317
1606 3300025295 Ga0209564_1000405 Ga0209564_100040556 317
1607 3300025295 Ga0209564_1012523 Ga0209564_10125233 317
1608 3300025297 Ga0209758_1000164 Ga0209758_1000164116 317
1609 3300025297 Ga0209758_1000216 Ga0209758_100021682 317
1610 3300025297 Ga0209758_1000375 Ga0209758_100037559 317
1611 3300025297 Ga0209758_1001489 Ga0209758_100148921 317
1612 3300025297 Ga0209758_1003612 Ga0209758_10036128 317
1613 3300025297 Ga0209758_1007900 Ga0209758_10079006 317
1614 3300025299 Ga0209256_1011392 Ga0209256_10113922 317
1615 3300025302 Ga0207426_1000580 Ga0207426_100058055 317
1616 3300025302 Ga0207426_1004590 Ga0207426_10045905 317
1617 3300025302 Ga0207426_1015864 Ga0207426_10158642 317
1618 3300025304 Ga0209257_1000782 Ga0209257_10007826 317
1619 3300025321 Ga0207656_10020027 Ga0207656_100200272 317
1620 3300025898 Ga0207692_10000660 Ga0207692_100006606 317
1621 3300025898 Ga0207692_10008365 Ga0207692_100083653 317
1622 3300025898 Ga0207692_10035057 Ga0207692_100350572 317
1623 3300025898 Ga0207692_10050786 Ga0207692_100507862 317
1624 3300025901 Ga0207688_10048076 Ga0207688_100480762 317
1625 3300025901 Ga0207688_10092199 Ga0207688_100921992 317
1626 3300025901 Ga0207688_10135731 Ga0207688_101357312 317
1627 3300025904 Ga0207647_10027278 Ga0207647_100272782 317
1628 3300025906 Ga0207699_10000526 Ga0207699_1000052618 317
1629 3300025906 Ga0207699_10042054 Ga0207699_100420542 317
1630 3300025906 Ga0207699_10047801 Ga0207699_100478012 317
1631 3300025907 Ga0207645_10283424 Ga0207645_102834241 317
1632 3300025909 Ga0207705_10187932 Ga0207705_101879322 317
1633 3300025909 Ga0207705_10349959 Ga0207705_103499591 317
1634 3300025910 Ga0207684_10033381 Ga0207684_100333812 317
1635 3300025911 Ga0207654_10052914 Ga0207654_100529142 317
1636 3300025912 Ga0207707_10001083 Ga0207707_1000108317 317
1637 3300025912 Ga0207707_10014916 Ga0207707_100149161 317
1638 3300025912 Ga0207707_10117767 Ga0207707_101177671 317
1639 3300025912 Ga0207707_10308854 Ga0207707_103088543 317
1640 3300025913 Ga0207695_10000599 Ga0207695_1000059923 317
1641 3300025913 Ga0207695_10070312 Ga0207695_100703124 317
1642 3300025913 Ga0207695_10177015 Ga0207695_101770152 317
1643 3300025914 Ga0207671_10001926 Ga0207671_1000192616 317
1644 3300025914 Ga0207671_10137820 Ga0207671_101378202 317
1645 3300025914 Ga0207671_10211906 Ga0207671_102119062 317
1646 3300025915 Ga0207693_10004729 Ga0207693_100047292 317
1647 3300025915 Ga0207693_10032143 Ga0207693_100321435 317
1648 3300025915 Ga0207693_10115388 Ga0207693_101153882 317
1649 3300025916 Ga0207663_10000334 Ga0207663_100003342 317
1650 3300025916 Ga0207663_10004028 Ga0207663_100040285 317
1651 3300025916 Ga0207663_10045957 Ga0207663_100459572 317
1652 3300025917 Ga0207660_10003821 Ga0207660_100038214 317
1653 3300025917 Ga0207660_10207136 Ga0207660_102071362 317
1654 3300025917 Ga0207660_10222708 Ga0207660_102227083 317
1655 3300025918 Ga0207662_10278473 Ga0207662_102784731 317
1656 3300025919 Ga0207657_10003922 Ga0207657_1000392220 317
1657 3300025919 Ga0207657_10187748 Ga0207657_101877482 317
1658 3300025920 Ga0207649_10064772 Ga0207649_100647722 317
1659 3300025920 Ga0207649_10068489 Ga0207649_100684891 317
1660 3300025921 Ga0207652_10003147 Ga0207652_100031477 317
1661 3300025924 Ga0207694_10072960 Ga0207694_100729603 317
1662 3300025927 Ga0207687_10019272 Ga0207687_100192722 317
1663 3300025928 Ga0207700_10379438 Ga0207700_103794381 317
1664 3300025929 Ga0207664_10087270 Ga0207664_100872702 317
1665 3300025929 Ga0207664_10346699 Ga0207664_103466992 317
1666 3300025932 Ga0207690_10210850 Ga0207690_102108502 317
1667 3300025932 Ga0207690_10410026 Ga0207690_104100261 317
1668 3300025933 Ga0207706_10137699 Ga0207706_101376992 317
1669 3300025933 Ga0207706_10205778 Ga0207706_102057782 317
1670 3300025936 Ga0207670_10207327 Ga0207670_102073272 317
1671 3300025939 Ga0207665_10005331 Ga0207665_100053314 317
1672 3300025941 Ga0207711_10398695 Ga0207711_103986951 317
1673 3300025942 Ga0207689_10074630 Ga0207689_100746303 317
1674 3300025942 Ga0207689_10213323 Ga0207689_102133232 317
1675 3300025944 Ga0207661_10009663 Ga0207661_100096635 317
1676 3300025944 Ga0207661_10323168 Ga0207661_103231682 317
1677 3300025949 Ga0207667_10100325 Ga0207667_101003253 317
1678 3300025949 Ga0207667_10192815 Ga0207667_101928152 317
1679 3300025949 Ga0207667_10686114 Ga0207667_106861141 317
1680 3300025960 Ga0207651_10358612 Ga0207651_103586121 317
1681 3300025972 Ga0207668_10108904 Ga0207668_101089042 317
1682 3300025972 Ga0207668_10267903 Ga0207668_102679032 317
1683 3300025981 Ga0207640_10204677 Ga0207640_102046771 317
1684 3300026023 Ga0207677_10007171 Ga0207677_100071714 317
1685 3300026035 Ga0207703_10294793 Ga0207703_102947932 317
1686 3300026035 Ga0207703_10388895 Ga0207703_103888952 317
1687 3300026041 Ga0207639_10034571 Ga0207639_100345712 317
1688 3300026067 Ga0207678_10036080 Ga0207678_100360803 317
1689 3300026067 Ga0207678_10226012 Ga0207678_102260122 317
1690 3300026067 Ga0207678_10270612 Ga0207678_102706122 317
1691 3300026078 Ga0207702_10085951 Ga0207702_100859512 317
1692 3300026078 Ga0207702_10147778 Ga0207702_101477782 317
1693 3300026089 Ga0207648_10031150 Ga0207648_100311502 317
1694 3300026089 Ga0207648_10452876 Ga0207648_104528761 317
1695 3300026116 Ga0207674_10024060 Ga0207674_100240605 317
1696 3300026116 Ga0207674_10032073 Ga0207674_100320734 317
1697 3300026142 Ga0207698_10121499 Ga0207698_101214992 317
1698 3300026142 Ga0207698_10145426 Ga0207698_101454262 317
1699 3300027296 Ga0209389_1000155 Ga0209389_100015524 317
1700 3300027296 Ga0209389_1000640 Ga0209389_10006406 317
1701 3300027357 Ga0209589_1000030 Ga0209589_1000030113 317
1702 3300027357 Ga0209589_1005433 Ga0209589_10054336 317
1703 3300027361 Ga0209489_100056 Ga0209489_100056113 317
1704 3300027361 Ga0209489_105575 Ga0209489_1055756 317
1705 3300027361 Ga0209489_114795 Ga0209489_1147953 317
1706 3300027363 Ga0209700_100059 Ga0209700_100059113 317
1707 3300027363 Ga0209700_104170 Ga0209700_10417025 317
1708 3300027671 Ga0209588_1017461 Ga0209588_10174611 317
1709 3300028379 Ga0268266_10000988 Ga0268266_100009885 317
1710 3300028379 Ga0268266_10002854 Ga0268266_1000285414 317
1711 3300028379 Ga0268266_10006878 Ga0268266_100068785 317
1712 3300028381 Ga0268264_10000245 Ga0268264_1000024562 317
1713 3300028558 Ga0265326_10032338 Ga0265326_100323382 317
1714 3300028563 Ga0265319_1015385 Ga0265319_10153852 317
1715 3300028573 Ga0265334_10005352 Ga0265334_100053522 317
1716 3300028573 Ga0265334_10029191 Ga0265334_100291912 317
1717 3300028577 Ga0265318_10037845 Ga0265318_100378452 317
1718 3300028653 Ga0265323_10000916 Ga0265323_100009163 317
1719 3300028666 Ga0265336_10000298 Ga0265336_1000029833 317
1720 3300028786 Ga0307517_10000125 Ga0307517_1000012572 317
1721 3300028794 Ga0307515_10184653 Ga0307515_101846532 317
1722 3300028800 Ga0265338_10000131 Ga0265338_1000013145 317
1723 3300031235 Ga0265330_10015078 Ga0265330_100150783 317
1724 3300031241 Ga0265325_10002689 Ga0265325_100026892 317
1725 3300031247 Ga0265340_10038625 Ga0265340_100386252 317
1726 3300031249 Ga0265339_10003134 Ga0265339_100031348 317
1727 3300031249 Ga0265339_10046241 Ga0265339_100462413 317
1728 3300031249 Ga0265339_10107197 Ga0265339_101071972 317
1729 3300031249 Ga0265339_10143280 Ga0265339_101432801 317
1730 3300031250 Ga0265331_10057805 Ga0265331_100578052 317
1731 3300031344 Ga0265316_10087509 Ga0265316_100875092 317
1732 3300031507 Ga0307509_10061588 Ga0307509_100615883 317
1733 3300031507 Ga0307509_10150315 Ga0307509_101503152 317
1734 3300031507 Ga0307509_10302912 Ga0307509_103029122 317
1735 3300031507 Ga0307509_10321450 Ga0307509_103214502 317
1736 3300031616 Ga0307508_10001153 Ga0307508_1000115317 317
1737 3300031711 Ga0265314_10020390 Ga0265314_100203903 317
1738 3300031711 Ga0265314_10025270 Ga0265314_100252702 317
1739 3300031712 Ga0265342_10002981 Ga0265342_1000298113 317
1740 3300031730 Ga0307516_10008305 Ga0307516_100083054 317
1741 3300031730 Ga0307516_10020167 Ga0307516_100201677 317
1742 3300031730 Ga0307516_10022528 Ga0307516_100225282 317
1743 3300031730 Ga0307516_10268774 Ga0307516_102687742 317
1744 3300031903 Ga0307407_10115289 Ga0307407_101152891 317
1745 3300031911 Ga0307412_10054934 Ga0307412_100549343 317
1746 3300031995 Ga0307409_100050870 Ga0307409_1000508702 317
1747 3300033179 Ga0307507_10085665 Ga0307507_100856653 317
1748 3300033180 Ga0307510_10010190 Ga0307510_100101903 317
1749 3300033180 Ga0307510_10244496 Ga0307510_102444961 317
1750 3300033442 Ga0315911_1000009 Ga0315911_100000925 317
1751 3300035086 Ga0373934_0001668 Ga0373934_0001668_960_1916 317
1752 3300035086 Ga0373934_0052699 Ga0373934_0052699_587_1543 317
1753 3300035089 Ga0373944_0019024 Ga0373944_0019024_792_1748 317
1754 3300035113 Ga0373936_0028477 Ga0373936_0028477_176_1132 317
1755 3300035113 Ga0373936_0074852 Ga0373936_0074852_236_1192 317
1756 3300035117 Ga0373953_0000108 Ga0373953_0000108_2672_3628 317
1757 3300035117 Ga0373953_0001849 Ga0373953_0001849_4996_5952 317
1758 3300035118 Ga0373954_0000085 Ga0373954_0000085_14346_15302 317
1759 3300035118 Ga0373954_0015553 Ga0373954_0015553_1773_2729 317
1760 3300035118 Ga0373954_0060946 Ga0373954_0060946_330_1286 317
1761 3300035119 Ga0373956_0000272 Ga0373956_0000272_8459_9415 317
1762 3300035119 Ga0373956_0030598 Ga0373956_0030598_281_1237 317
1763 3300035120 Ga0373957_0000129 Ga0373957_0000129_2191_3147 317
1764 3300035121 Ga0373960_0077538 Ga0373960_0077538_53_1006 317
1765 3300035170 Ga0373943_0027519 Ga0373943_0027519_233_1189 317
1766 3300035170 Ga0373943_0087956 Ga0373943_0087956_489_1445 317
1767 3300035170 Ga0373943_0158659 Ga0373943_0158659_165_1118 317
1768 3300035171 Ga0373946_0001563 Ga0373946_0001563_4881_5837 317
1769 3300035172 Ga0373955_0000288 Ga0373955_0000288_14427_15383 317
1770 3300035172 Ga0373955_0007868 Ga0373955_0007868_3078_4034 317
1771 3300035172 Ga0373955_0079671 Ga0373955_0079671_261_1217 317
1772 3300035410 Ga0373924_0005705 Ga0373924_0005705_1377_2333 317
1773 3300035691 Ga0373931_0274666 Ga0373931_0274666_22_978 317
1774 3300035692 Ga0373935_0002679 Ga0373935_0002679_5595_6551 317
1775 3300035692 Ga0373935_0277441 Ga0373935_0277441_192_1148 317
1776 3300035695 Ga0373927_0001471 Ga0373927_0001471_9079_10035 317
1777 3300035695 Ga0373927_0002486 Ga0373927_0002486_7126_8082 317
1778 3300035695 Ga0373927_0074697 Ga0373927_0074697_559_1515 317
1779 3300035695 Ga0373927_0078916 Ga0373927_0078916_905_1858 317
1780 3300035695 Ga0373927_0141375 Ga0373927_0141375_560_1516 317
1781 3300035724 Ga0373933_0000913 Ga0373933_0000913_8401_9357 317
1782 3300035724 Ga0373933_0084955 Ga0373933_0084955_404_1360 317
1783 3300035724 Ga0373933_0119667 Ga0373933_0119667_330_1286 317
1784 3300035725 Ga0373947_0003788 Ga0373947_0003788_3970_4926 317
1785 3300035725 Ga0373947_0009239 Ga0373947_0009239_2530_3486 317
1786 3300035725 Ga0373947_0029949 Ga0373947_0029949_1339_2295 317
1787 3300035725 Ga0373947_0050555 Ga0373947_0050555_33_986 317
1788 3300036401 Ga0373937_0005718 Ga0373937_0005718_6377_7333 317
1789 3300036401 Ga0373937_0027472 Ga0373937_0027472_30_986 317
1790 3300036401 Ga0373937_0073857 Ga0373937_0073857_1331_2287 317
1791 3300036401 Ga0373937_0117322 Ga0373937_0117322_845_1801 317
1792 3300036401 Ga0373937_0336467 Ga0373937_0336467_209_1165 317
1793 3300037068 Ga0373925_0113006 Ga0373925_0113006_767_1723 317
1794 3300037068 Ga0373925_0128671 Ga0373925_0128671_595_1551 317
1795 3300037312 Ga0395899_0050258 Ga0395899_0050258_1690_2679 317
1796 3300037312 Ga0395899_0287338 Ga0395899_0287338_150_1103 317
1797 3300037418 Ga0395900_0062423 Ga0395900_0062423_2310_3263 317
1798 3300037418 Ga0395900_0144131 Ga0395900_0144131_414_1370 317
1799 3300037418 Ga0395900_0290808 Ga0395900_0290808_78_1058 317
1800 3300037466 Ga0395898_0037146 Ga0395898_0037146_583_1563 317
1801 3300037466 Ga0395898_0443330 Ga0395898_0443330_140_1093 317
1802 3300037466 Ga0395898_0535317 Ga0395898_0535317_124_1080 317
1803 3300038443 Ga0395901_0016140 Ga0395901_0016140_6542_7495 317
1804 3300038443 Ga0395901_0267726 Ga0395901_0267726_355_1311 317
1805 3300039437 Ga0436365_0356394 Ga0436365_0356394_55_1011 317
1806 3300039437 Ga0436365_1507572 Ga0436365_1507572_293_1261 317
1807 3300039447 Ga0436361_0736352 Ga0436361_0736352_183_1139 317
1808 3300039450 Ga0436363_1138394 Ga0436363_1138394_3960_4937 317
1809 3300041451 Ga0451791_1031212 Ga0451791_1031212_49_1005 317
1810 3300041456 Ga0451795_0239567 Ga0451795_0239567_105_1061 317
1811 3300041486 Ga0451807_2348294 Ga0451807_2348294_98_1051 317
1812 3300044656 Ga0466969_0054525 Ga0466969_0054525_588_1571 317
1813 3300044658 Ga0466972_0000156 Ga0466972_0000156_24241_25194 317
1814 3300044658 Ga0466972_0002340 Ga0466972_0002340_2504_3457 317
1815 3300044684 Ga0466966_0000726 Ga0466966_0000726_4940_5893 317
1816 3300044693 Ga0466961_0000568 Ga0466961_0000568_20456_21409 317
1817 3300044694 Ga0466963_0018028 Ga0466963_0018028_1164_2120 317
1818 3300044719 Ga0466971_0050003 Ga0466971_0050003_565_1521 317
1819 3300044901 Ga0466960_0008725 Ga0466960_0008725_2366_3319 317
1820 3300045049 Ga0466959_0033944 Ga0466959_0033944_1714_2697 317
1821 3300045049 Ga0466959_0199311 Ga0466959_0199311_344_1300 317
1822 3300045976 Ga0466967_0009784 Ga0466967_0009784_5187_6140 317
1823 3300045976 Ga0466967_0049840 Ga0466967_0049840_524_1480 317
1824 3300045976 Ga0466967_0105800 Ga0466967_0105800_512_1468 317
1825 3300045976 Ga0466967_0116005 Ga0466967_0116005_1012_1968 317
1826 3300045976 Ga0466967_0162412 Ga0466967_0162412_419_1375 317
1827 3300046454 Ga0495592_0000795 Ga0495592_0000795_17376_18332 317
1828 3300046454 Ga0495592_0049186 Ga0495592_0049186_1628_2584 317
1829 3300046454 Ga0495592_0073730 Ga0495592_0073730_811_1767 317
1830 3300046455 Ga0495603_0000387 Ga0495603_0000387_17898_18854 317
1831 3300046455 Ga0495603_0040158 Ga0495603_0040158_695_1651 317
1832 3300046455 Ga0495603_0109321 Ga0495603_0109321_553_1509 317
1833 3300046459 Ga0495629_0000582 Ga0495629_0000582_20856_21812 317
1834 3300046459 Ga0495629_0001668 Ga0495629_0001668_2478_3431 317
1835 3300046459 Ga0495629_0004581 Ga0495629_0004581_5821_6777 317
1836 3300046459 Ga0495629_0109406 Ga0495629_0109406_897_1853 317
1837 3300046460 Ga0495638_0031663 Ga0495638_0031663_2180_3136 317
1838 3300046460 Ga0495638_0172847 Ga0495638_0172847_67_1020 317
1839 3300046461 Ga0495641_0010227 Ga0495641_0010227_70_1026 317
1840 3300046461 Ga0495641_0042318 Ga0495641_0042318_383_1339 317
1841 3300046462 Ga0495651_0002961 Ga0495651_0002961_8147_9103 317
1842 3300046462 Ga0495651_0013772 Ga0495651_0013772_4956_5909 317
1843 3300046462 Ga0495651_0151312 Ga0495651_0151312_176_1132 317
1844 3300046463 Ga0495653_0002685 Ga0495653_0002685_11838_12794 317
1845 3300046463 Ga0495653_0082672 Ga0495653_0082672_872_1825 317
1846 3300046472 Ga0495580_0001175 Ga0495580_0001175_188_1144 317
1847 3300046472 Ga0495580_0121050 Ga0495580_0121050_503_1456 317
1848 3300046473 Ga0495582_0005882 Ga0495582_0005882_1733_2689 317
1849 3300046473 Ga0495582_0062261 Ga0495582_0062261_1007_1963 317
1850 3300046475 Ga0495639_0000739 Ga0495639_0000739_8285_9241 317
1851 3300046476 Ga0495662_0000148 Ga0495662_0000148_17154_18110 317
1852 3300046492 Ga0495585_0016215 Ga0495585_0016215_319_1275 317
1853 3300046499 Ga0495594_0000312 Ga0495594_0000312_10087_11043 317
1854 3300046499 Ga0495594_0154240 Ga0495594_0154240_189_1145 317
1855 3300046500 Ga0495596_0066393 Ga0495596_0066393_49_1002 317
1856 3300046501 Ga0495607_0064859 Ga0495607_0064859_503_1462 317
1857 3300046507 Ga0495606_0004206 Ga0495606_0004206_161_1114 317
1858 3300046507 Ga0495606_0012913 Ga0495606_0012913_5133_6086 317
1859 3300046511 Ga0495608_0000569 Ga0495608_0000569_4019_4975 317
1860 3300046511 Ga0495608_0024234 Ga0495608_0024234_905_1861 317
1861 3300046514 Ga0495618_0015858 Ga0495618_0015858_543_1499 317
1862 3300046514 Ga0495618_0069671 Ga0495618_0069671_407_1363 317
1863 3300046515 Ga0495620_0026177 Ga0495620_0026177_85_1044 317
1864 3300046516 Ga0495628_0010360 Ga0495628_0010360_6288_7244 317
1865 3300046516 Ga0495628_0028278 Ga0495628_0028278_1006_1962 317
1866 3300046516 Ga0495628_0078122 Ga0495628_0078122_104_1060 317
1867 3300046516 Ga0495628_0091601 Ga0495628_0091601_447_1403 317
1868 3300046517 Ga0495630_0028578 Ga0495630_0028578_1452_2408 317
1869 3300046517 Ga0495630_0151306 Ga0495630_0151306_509_1465 317
1870 3300046519 Ga0495632_0101151 Ga0495632_0101151_131_1087 317
1871 3300046520 Ga0495637_0082309 Ga0495637_0082309_169_1128 317
1872 3300046522 Ga0495643_0048366 Ga0495643_0048366_536_1495 317
1873 3300046524 Ga0495648_0000855 Ga0495648_0000855_23118_24074 317
1874 3300046524 Ga0495648_0022316 Ga0495648_0022316_1831_2784 317
1875 3300046524 Ga0495648_0092062 Ga0495648_0092062_657_1610 317
1876 3300046524 Ga0495648_0093130 Ga0495648_0093130_349_1302 317
1877 3300046529 Ga0495652_0002837 Ga0495652_0002837_15149_16105 317
1878 3300046529 Ga0495652_0030800 Ga0495652_0030800_417_1373 317
1879 3300046529 Ga0495652_0142277 Ga0495652_0142277_711_1667 317
1880 3300046531 Ga0495665_0000248 Ga0495665_0000248_20629_21585 317
1881 3300046531 Ga0495665_0081361 Ga0495665_0081361_508_1464 317
1882 3300046533 Ga0495640_0004111 Ga0495640_0004111_3938_4894 317
1883 3300046533 Ga0495640_0052202 Ga0495640_0052202_596_1549 317
1884 3300046533 Ga0495640_0052535 Ga0495640_0052535_1242_2198 317
1885 3300046533 Ga0495640_0075248 Ga0495640_0075248_268_1224 317
1886 3300046533 Ga0495640_0204190 Ga0495640_0204190_280_1233 317
1887 3300046536 Ga0495587_0007583 Ga0495587_0007583_4953_5909 317
1888 3300046536 Ga0495587_0034998 Ga0495587_0034998_1817_2770 317
1889 3300046536 Ga0495587_0144334 Ga0495587_0144334_86_1042 317
1890 3300046538 Ga0495609_0034031 Ga0495609_0034031_200_1156 317
1891 3300046538 Ga0495609_0076648 Ga0495609_0076648_397_1350 317
1892 3300046543 Ga0495645_0016916 Ga0495645_0016916_1704_2660 317
1893 3300046557 Ga0495622_0002046 Ga0495622_0002046_8595_9551 317
1894 3300046559 Ga0495667_0000128 Ga0495667_0000128_44915_45871 317
1895 3300046559 Ga0495667_0012503 Ga0495667_0012503_3166_4122 317
1896 3300046559 Ga0495667_0075699 Ga0495667_0075699_575_1531 317
1897 3300046559 Ga0495667_0089013 Ga0495667_0089013_103_1056 317
1898 3300046615 Ga0495656_0015749 Ga0495656_0015749_459_1415 317
1899 3300046615 Ga0495656_0085056 Ga0495656_0085056_333_1289 317
1900 3300046615 Ga0495656_0176301 Ga0495656_0176301_17_973 317
1901 3300046616 Ga0495668_0062032 Ga0495668_0062032_580_1536 317
1902 3300046642 Ga0495634_0023145 Ga0495634_0023145_2465_3421 317
1903 3300046642 Ga0495634_0173839 Ga0495634_0173839_97_1053 317
1904 3300046660 Ga0495625_0233903 Ga0495625_0233903_138_1094 317
1905 3300046663 Ga0495635_0001128 Ga0495635_0001128_5526_6482 317
1906 3300046663 Ga0495635_0006917 Ga0495635_0006917_2949_3905 317
1907 3300046663 Ga0495635_0008480 Ga0495635_0008480_4122_5075 317
1908 3300046663 Ga0495635_0124386 Ga0495635_0124386_455_1411 317
1909 3300046664 Ga0495659_0030392 Ga0495659_0030392_398_1462 317
1910 3300046665 Ga0495661_0070878 Ga0495661_0070878_989_1999 317
1911 3300046665 Ga0495661_0121186 Ga0495661_0121186_320_1273 317
1912 3300046674 Ga0495588_0100939 Ga0495588_0100939_487_1443 317
1913 3300046675 Ga0495657_0003126 Ga0495657_0003126_8825_9781 317
1914 3300046678 Ga0495599_0002733 Ga0495599_0002733_2834_3790 317
1915 3300046678 Ga0495599_0181872 Ga0495599_0181872_221_1177 317
1916 3300046679 Ga0495623_0006786 Ga0495623_0006786_2726_3682 317
1917 3300046679 Ga0495623_0017410 Ga0495623_0017410_3275_4228 317
1918 3300046679 Ga0495623_0168690 Ga0495623_0168690_314_1270 317
1919 3300046680 Ga0495646_0000412 Ga0495646_0000412_18671_19627 317
1920 3300046680 Ga0495646_0036082 Ga0495646_0036082_214_1170 317
1921 3300046680 Ga0495646_0205430 Ga0495646_0205430_30_983 317
1922 3300046681 Ga0495647_0000541 Ga0495647_0000541_4986_5942 317
1923 3300046683 Ga0495658_0002607 Ga0495658_0002607_6338_7294 317
1924 3300046689 Ga0495613_0062657 Ga0495613_0062657_410_1363 317
1925 3300046689 Ga0495613_0195181 Ga0495613_0195181_49_1002 317
1926 3300046689 Ga0495613_0231293 Ga0495613_0231293_321_1277 317
1927 3300046690 Ga0495624_0001790 Ga0495624_0001790_4117_5073 317
1928 3300046690 Ga0495624_0034248 Ga0495624_0034248_1887_2843 317
1929 3300046690 Ga0495624_0102532 Ga0495624_0102532_605_1558 317
1930 3300046691 Ga0495670_0003510 Ga0495670_0003510_3270_4229 317
1931 3300046694 Ga0495649_0109360 Ga0495649_0109360_200_1153 317
1932 3300046809 Ga0495600_0000630 Ga0495600_0000630_276_1229 317
1933 3300046809 Ga0495600_0005826 Ga0495600_0005826_4019_4975 317
1934 3300046809 Ga0495600_0078397 Ga0495600_0078397_1053_2009 317
1935 3300047315 Ga0495581_0001004 Ga0495581_0001004_1629_2585 317
1936 3300047317 Ga0495604_0003361 Ga0495604_0003361_11398_12351 317
1937 3300047317 Ga0495604_0007172 Ga0495604_0007172_3957_4913 317
1938 3300047317 Ga0495604_0051018 Ga0495604_0051018_138_1091 317
1939 3300047317 Ga0495604_0193677 Ga0495604_0193677_331_1287 317
1940 3300047319 Ga0495674_0002207 Ga0495674_0002207_5515_6471 317
1941 3300047319 Ga0495674_0010840 Ga0495674_0010840_451_1407 317
1942 3300047319 Ga0495674_0026886 Ga0495674_0026886_55_1008 317
1943 3300047319 Ga0495674_0029042 Ga0495674_0029042_1694_2650 317
1944 3300047320 Ga0495672_0045229 Ga0495672_0045229_1079_2035 317
1945 3300047320 Ga0495672_0151782 Ga0495672_0151782_192_1148 317
1946 3300047321 Ga0495676_0036490 Ga0495676_0036490_2986_3942 317
1947 3300047321 Ga0495676_0090598 Ga0495676_0090598_851_1804 317
1948 3300047322 Ga0495680_0000424 Ga0495680_0000424_43299_44252 317
1949 3300047322 Ga0495680_0001973 Ga0495680_0001973_6377_7333 317
1950 3300047322 Ga0495680_0030826 Ga0495680_0030826_295_1251 317
1951 3300047323 Ga0495683_0062512 Ga0495683_0062512_656_1666 317
1952 3300047444 Ga0495675_0000345 Ga0495675_0000345_23688_24644 317
1953 3300047444 Ga0495675_0097120 Ga0495675_0097120_670_1626 317
1954 3300047446 Ga0495679_030186 Ga0495679_030186_632_1588 317
1955 3300047469 Ga0495673_0036088 Ga0495673_0036088_478_1434 317
1956 3300047471 Ga0495684_0000650 Ga0495684_0000650_19036_19992 317
1957 3300047471 Ga0495684_0023995 Ga0495684_0023995_953_1909 317
1958 3300047471 Ga0495684_0227102 Ga0495684_0227102_193_1149 317
1959 3300047472 Ga0495686_0018987 Ga0495686_0018987_1208_2218 317
1960 3300047673 Ga0495593_0000312 Ga0495593_0000312_12234_13190 317
1961 3300047673 Ga0495593_0058804 Ga0495593_0058804_550_1506 317
1962 3300048088 Ga0495602_0005890 Ga0495602_0005890_3829_4785 317
1963 3300048088 Ga0495602_0040539 Ga0495602_0040539_2130_3083 317
1964 3300048088 Ga0495602_0059530 Ga0495602_0059530_2347_3300 317
1965 3300048089 Ga0495614_0041269 Ga0495614_0041269_656_1612 317
1966 3300048903 Ga0496100_0099648 Ga0496100_0099648_1032_1988 317
1967 3300048903 Ga0496100_0147242 Ga0496100_0147242_229_1185 317
1968 3300048903 Ga0496100_0178180 Ga0496100_0178180_421_1374 317
1969 3300048904 Ga0496101_0325577 Ga0496101_0325577_197_1153 317
1970 3300048905 Ga0496102_0229272 Ga0496102_0229272_158_1114 317
1971 3300048906 Ga0496103_0171094 Ga0496103_0171094_280_1236 317
1972 3300048906 Ga0496103_0184669 Ga0496103_0184669_48_1001 317
1973 3300048906 Ga0496103_0209957 Ga0496103_0209957_76_1029 317
1974 3300048907 Ga0496104_0077974 Ga0496104_0077974_1044_2000 317
1975 3300048908 Ga0496105_0001254 Ga0496105_0001254_200_1153 317
1976 3300048909 Ga0496106_0002423 Ga0496106_0002423_8143_9126 317
1977 3300048911 Ga0496108_0175535 Ga0496108_0175535_601_1557 317
1978 3300048912 Ga0496109_0077295 Ga0496109_0077295_1641_2597 317
1979 3300048913 Ga0496110_0016649 Ga0496110_0016649_4133_5089 317
1980 3300048913 Ga0496110_0203472 Ga0496110_0203472_284_1240 317
1981 3300048913 Ga0496110_0204316 Ga0496110_0204316_295_1248 317
1982 3300048913 Ga0496110_0251259 Ga0496110_0251259_364_1317 317
1983 3300048914 Ga0496111_0246191 Ga0496111_0246191_203_1159 317
1984 3300048915 Ga0496112_0000004 Ga0496112_0000004_209678_210631 317
1985 3300048915 Ga0496112_0017703 Ga0496112_0017703_628_1584 317
1986 3300048915 Ga0496112_0045152 Ga0496112_0045152_2824_3780 317
1987 3300048915 Ga0496112_0127936 Ga0496112_0127936_719_1675 317
1988 3300048915 Ga0496112_0130508 Ga0496112_0130508_1469_2425 317
1989 3300048915 Ga0496112_0146867 Ga0496112_0146867_733_1689 317
1990 3300048918 Ga0496115_0065352 Ga0496115_0065352_444_1400 317
1991 3300048918 Ga0496115_0092659 Ga0496115_0092659_483_1463 317
1992 3300048918 Ga0496115_0438548 Ga0496115_0438548_39_995 317
1993 3300048919 Ga0496116_0078209 Ga0496116_0078209_548_1531 317
1994 3300048919 Ga0496116_0095280 Ga0496116_0095280_376_1332 317
1995 3300048919 Ga0496116_0097437 Ga0496116_0097437_505_1458 317
1996 3300048920 Ga0496117_0005820 Ga0496117_0005820_8299_9282 317
1997 3300048920 Ga0496117_0019106 Ga0496117_0019106_2408_3367 317
1998 3300048920 Ga0496117_0043610 Ga0496117_0043610_286_1296 317
1999 3300048921 Ga0496118_0001550 Ga0496118_0001550_11680_12663 317
2000 3300048921 Ga0496118_0022210 Ga0496118_0022210_54_1010 317
2001 3300048922 Ga0496119_0003724 Ga0496119_0003724_491_1444 317
2002 3300048922 Ga0496119_0047345 Ga0496119_0047345_211_1194 317
2003 3300048922 Ga0496119_0106791 Ga0496119_0106791_461_1414 317
2004 3300048922 Ga0496119_0140555 Ga0496119_0140555_87_1043 317
2005 3300048922 Ga0496119_0175957 Ga0496119_0175957_98_1051 317
2006 3300048923 Ga0496120_0032516 Ga0496120_0032516_1119_2072 317
2007 3300048923 Ga0496120_0072457 Ga0496120_0072457_774_1733 317
2008 3300048924 Ga0496121_0000077 Ga0496121_0000077_48751_49734 317
2009 3300048924 Ga0496121_0005416 Ga0496121_0005416_8409_9365 317
2010 3300048924 Ga0496121_0020142 Ga0496121_0020142_2436_3389 317
2011 3300048924 Ga0496121_0022123 Ga0496121_0022123_146_1105 317
2012 3300048924 Ga0496121_0049017 Ga0496121_0049017_1748_2713 317
2013 3300048924 Ga0496121_0073281 Ga0496121_0073281_1162_2118 317
2014 3300048924 Ga0496121_0097775 Ga0496121_0097775_1029_1982 317
2015 3300048924 Ga0496121_0112567 Ga0496121_0112567_1054_2007 317
2016 3300048924 Ga0496121_0159667 Ga0496121_0159667_146_1111 317
2017 3300048924 Ga0496121_0197239 Ga0496121_0197239_53_1009 317
2018 3300048925 Ga0496122_0020439 Ga0496122_0020439_4702_5658 317
2019 3300048925 Ga0496122_0022345 Ga0496122_0022345_1429_2439 317
2020 3300048925 Ga0496122_0076791 Ga0496122_0076791_19_978 317
2021 3300048926 Ga0496123_0007007 Ga0496123_0007007_4612_5622 317
2022 3300048926 Ga0496123_0145662 Ga0496123_0145662_295_1254 317
2023 3300048927 Ga0496124_0002954 Ga0496124_0002954_9565_10548 317
2024 3300048927 Ga0496124_0133193 Ga0496124_0133193_791_1801 317
2025 3300048928 Ga0496125_0000125 Ga0496125_0000125_115797_116753 317
2026 3300048928 Ga0496125_0008255 Ga0496125_0008255_6357_7316 317
2027 3300048928 Ga0496125_0022162 Ga0496125_0022162_2873_3856 317
2028 3300048928 Ga0496125_0088454 Ga0496125_0088454_38_997 317
2029 3300048929 Ga0496126_0014174 Ga0496126_0014174_1545_2528 317
2030 3300048929 Ga0496126_0018962 Ga0496126_0018962_4486_5442 317
2031 3300048929 Ga0496126_0023164 Ga0496126_0023164_200_1153 317
2032 3300048929 Ga0496126_0025338 Ga0496126_0025338_71_1027 317
2033 3300048929 Ga0496126_0047500 Ga0496126_0047500_1160_2119 317
2034 3300048929 Ga0496126_0057800 Ga0496126_0057800_240_1220 317
2035 3300048929 Ga0496126_0074477 Ga0496126_0074477_1795_2775 317
2036 3300048929 Ga0496126_0100821 Ga0496126_0100821_941_1894 317
2037 3300048929 Ga0496126_0107087 Ga0496126_0107087_977_1933 317
2038 3300048929 Ga0496126_0257743 Ga0496126_0257743_153_1112 317
2039 3300048929 Ga0496126_0359078 Ga0496126_0359078_224_1177 317
2040 3300049460 Ga0495682_0015217 Ga0495682_0015217_1547_2500 317
2041 3300049569 Ga0501032_0000345 Ga0501032_0000345_36322_37275 317
2042 3300049569 Ga0501032_0113716 Ga0501032_0113716_66_1019 317
2043 3300049570 Ga0501033_0000094 Ga0501033_0000094_40393_41346 317
2044 3300049570 Ga0501033_0071416 Ga0501033_0071416_272_1261 317
2045 3300049571 Ga0501034_0000021 Ga0501034_0000021_43441_44394 317
2046 3300049572 Ga0501036_0000115 Ga0501036_0000115_20882_21835 317
2047 3300049573 Ga0501037_0000174 Ga0501037_0000174_11166_12119 317
2048 3300049573 Ga0501037_0166634 Ga0501037_0166634_48_1001 317
2049 3300049574 Ga0501038_0000052 Ga0501038_0000052_43454_44407 317
2050 3300049574 Ga0501038_0175509 Ga0501038_0175509_138_1127 317
2051 3300049574 Ga0501038_0182308 Ga0501038_0182308_198_1151 317
2052 3300049574 Ga0501038_0305539 Ga0501038_0305539_232_1185 317
2053 3300049575 Ga0501039_0000156 Ga0501039_0000156_37276_38229 317
2054 3300049575 Ga0501039_0089917 Ga0501039_0089917_1254_2210 317
2055 3300049578 Ga0501042_0038784 Ga0501042_0038784_878_1831 317
2056 3300049579 Ga0501043_0003891 Ga0501043_0003891_9662_10615 317
2057 3300049579 Ga0501043_0126694 Ga0501043_0126694_471_1460 317
2058 3300049579 Ga0501043_0222221 Ga0501043_0222221_214_1167 317
2059 3300049580 Ga0501046_0000133 Ga0501046_0000133_25158_26111 317
2060 3300049580 Ga0501046_0060481 Ga0501046_0060481_221_1177 317
2061 3300049581 Ga0501047_0000440 Ga0501047_0000440_36687_37640 317
2062 3300049581 Ga0501047_0090883 Ga0501047_0090883_126_1082 317
2063 3300049581 Ga0501047_0132255 Ga0501047_0132255_427_1380 317
2064 3300049582 Ga0501048_0000072 Ga0501048_0000072_14305_15258 317
2065 3300049583 Ga0501067_0000076 Ga0501067_0000076_18490_19443 317
2066 3300049583 Ga0501067_0023326 Ga0501067_0023326_354_1307 317
2067 3300049584 Ga0501068_0008449 Ga0501068_0008449_1306_2259 317
2068 3300049585 Ga0501069_0013671 Ga0501069_0013671_3255_4208 317
2069 3300049586 Ga0501070_0011558 Ga0501070_0011558_2735_3688 317
2070 3300049586 Ga0501070_0031178 Ga0501070_0031178_323_1279 317
2071 3300049586 Ga0501070_0079684 Ga0501070_0079684_322_1278 317
2072 3300049588 Ga0501072_0001658 Ga0501072_0001658_8890_9843 317
2073 3300049589 Ga0501073_0000099 Ga0501073_0000099_18136_19089 317
2074 3300049589 Ga0501073_0042714 Ga0501073_0042714_1776_2729 317
2075 3300049589 Ga0501073_0050453 Ga0501073_0050453_1930_2886 317
2076 3300049590 Ga0501074_0044377 Ga0501074_0044377_887_1843 317
2077 3300049590 Ga0501074_0184445 Ga0501074_0184445_325_1278 317
2078 3300049741 Ga0501079_0004389 Ga0501079_0004389_9424_10377 317
2079 3300049741 Ga0501079_0074304 Ga0501079_0074304_1572_2525 317
2080 3300049742 Ga0501080_0000658 Ga0501080_0000658_18972_19925 317
2081 3300049744 Ga0501083_0001450 Ga0501083_0001450_6654_7607 317
2082 3300049822 Ga0501035_0000255 Ga0501035_0000255_44449_45402 317
2083 3300049822 Ga0501035_0032578 Ga0501035_0032578_3486_4439 317
2084 3300049822 Ga0501035_0046753 Ga0501035_0046753_530_1486 317
2085 3300049823 Ga0501044_0000141 Ga0501044_0000141_34930_35883 317
2086 3300049823 Ga0501044_0031151 Ga0501044_0031151_2631_3620 317
2087 3300049823 Ga0501044_0131610 Ga0501044_0131610_368_1321 317
2088 3300049823 Ga0501044_0313589 Ga0501044_0313589_66_1019 317
2089 3300050490 nmdc:mga03n38_113048_c1 nmdc:mga03n38_113048_c1_188_1141 317
2090 3300050491 nmdc:mga00v17_33021_c1 nmdc:mga00v17_33021_c1_1650_2606 317
2091 3300050492 nmdc:mga0yw44_117362_c1 nmdc:mga0yw44_117362_c1_360_1313 317
2092 3300050492 nmdc:mga0yw44_197982_c1 nmdc:mga0yw44_197982_c1_286_1239 317
2093 3300050492 nmdc:mga0yw44_24041_c1 nmdc:mga0yw44_24041_c1_1218_2177 317
2094 3300050492 nmdc:mga0yw44_71422_c1 nmdc:mga0yw44_71422_c1_982_1938 317
2095 3300050493 nmdc:mga0k408_21847_c1 nmdc:mga0k408_21847_c1_2231_3184 317
2096 3300050494 nmdc:mga06z11_25288_c1 nmdc:mga06z11_25288_c1_1219_2175 317
2097 3300050496 nmdc:mga07m45_1811_c1 nmdc:mga07m45_1811_c1_6728_7684 317
2098 3300050507 nmdc:mga05p37_185331_c1 nmdc:mga05p37_185331_c1_1206_2162 317
2099 3300050511 nmdc:mga08y16_92726_c1 nmdc:mga08y16_92726_c1_155_1111 317
2100 3300050513 nmdc:mga0rr50_26740_c1 nmdc:mga0rr50_26740_c1_1467_2423 317
2101 3300050514 nmdc:mga08x19_92852_c1 nmdc:mga08x19_92852_c1_688_1668 317
2102 3300050516 nmdc:mga0sz30_10577_c1 nmdc:mga0sz30_10577_c1_381_1340 317
2103 3300050516 nmdc:mga0sz30_35523_c1 nmdc:mga0sz30_35523_c1_869_1822 317
2104 3300050516 nmdc:mga0sz30_41570_c1 nmdc:mga0sz30_41570_c1_450_1403 317
2105 3300053077 Ga0495601_0144464 Ga0495601_0144464_189_1145 317
2106 3300053078 Ga0495612_0072117 Ga0495612_0072117_252_1208 317
2107 3300053078 Ga0495612_0127770 Ga0495612_0127770_131_1084 317
2108 3300053080 Ga0500635_0014595 Ga0500635_0014595_223_1179 317
2109 3300053080 Ga0500635_0022450 Ga0500635_0022450_818_1801 317
2110 3300053080 Ga0500635_0031115 Ga0500635_0031115_725_1681 317
2111 3300053084 Ga0495595_0000309 Ga0495595_0000309_9422_10378 317
2112 3300053084 Ga0495595_0007183 Ga0495595_0007183_1619_2575 317
2113 3300053085 Ga0495619_0004295 Ga0495619_0004295_570_1526 317
2114 3300053085 Ga0495619_0035622 Ga0495619_0035622_2138_3094 317
2115 3300053085 Ga0495619_0145203 Ga0495619_0145203_39_992 317
2116 3300053087 Ga0500643_000114 Ga0500643_000114_12411_13364 317
2117 3300053090 Ga0500646_0015271 Ga0500646_0015271_641_1651 317
2118 3300053094 Ga0500566_0000100 Ga0500566_0000100_30287_31243 317
2119 3300053094 Ga0500566_0000220 Ga0500566_0000220_3472_4431 317
2120 3300053094 Ga0500566_0001885 Ga0500566_0001885_376_1329 317
2121 3300053095 Ga0500640_005859 Ga0500640_005859_559_1515 317
2122 3300053096 Ga0500641_0002654 Ga0500641_0002654_5098_6066 317
2123 3300053096 Ga0500641_0044249 Ga0500641_0044249_821_1777 317
2124 3300053098 Ga0500650_0003775 Ga0500650_0003775_4293_5252 317
2125 3300053102 Ga0500554_003133 Ga0500554_003133_1806_2762 317
2126 3300053104 Ga0500556_0000002 Ga0500556_0000002_470581_471537 317
2127 3300053104 Ga0500556_0008488 Ga0500556_0008488_317_1270 317
2128 3300053105 Ga0500557_000010 Ga0500557_000010_95971_96924 317
2129 3300053109 Ga0500569_035121 Ga0500569_035121_458_1411 317
2130 3300053111 Ga0500572_000176 Ga0500572_000176_6338_7294 317
2131 3300053111 Ga0500572_000235 Ga0500572_000235_17577_18530 317
2132 3300053116 Ga0500592_006824 Ga0500592_006824_222_1178 317
2133 3300053119 Ga0500595_008586 Ga0500595_008586_1979_2935 317
2134 3300053119 Ga0500595_033524 Ga0500595_033524_488_1441 317
2135 3300053121 Ga0500607_016108 Ga0500607_016108_326_1279 317
2136 3300053122 Ga0500608_014667 Ga0500608_014667_1116_2072 317
2137 3300053122 Ga0500608_065882 Ga0500608_065882_408_1367 317
2138 3300053123 Ga0500614_000141 Ga0500614_000141_7897_8853 317
2139 3300053123 Ga0500614_021538 Ga0500614_021538_255_1208 317
2140 3300053130 Ga0500642_0000012 Ga0500642_0000012_108798_109757 317
2141 3300053130 Ga0500642_0000334 Ga0500642_0000334_2194_3147 317
2142 3300053130 Ga0500642_0033939 Ga0500642_0033939_921_1874 317
2143 3300053130 Ga0500642_0137836 Ga0500642_0137836_73_1029 317
2144 3300053131 Ga0500652_001569 Ga0500652_001569_1847_2806 317
2145 3300053134 Ga0500658_0055711 Ga0500658_0055711_207_1166 317
2146 3300053136 Ga0500559_0000509 Ga0500559_0000509_4450_5403 317
2147 3300053136 Ga0500559_0003396 Ga0500559_0003396_3308_4264 317
2148 3300053136 Ga0500559_0005407 Ga0500559_0005407_3842_4801 317
2149 3300053136 Ga0500559_0010805 Ga0500559_0010805_319_1275 317
2150 3300053136 Ga0500559_0086638 Ga0500559_0086638_441_1400 317
2151 3300053139 Ga0500568_0001219 Ga0500568_0001219_4186_5145 317
2152 3300053140 Ga0500573_0088519 Ga0500573_0088519_731_1687 317
2153 3300053142 Ga0500577_0000149 Ga0500577_0000149_2106_3062 317
2154 3300053145 Ga0500586_000724 Ga0500586_000724_1912_2871 317
2155 3300053150 Ga0500603_000017 Ga0500603_000017_32970_33926 317
2156 3300053150 Ga0500603_000889 Ga0500603_000889_346_1302 317
2157 3300053151 Ga0500604_0003561 Ga0500604_0003561_2279_3238 317
2158 3300053153 Ga0500616_0000508 Ga0500616_0000508_3908_4867 317
2159 3300053154 Ga0500619_029693 Ga0500619_029693_104_1063 317
2160 3300053156 Ga0500622_0006594 Ga0500622_0006594_5622_6581 317
2161 3300053156 Ga0500622_0012145 Ga0500622_0012145_2714_3667 317
2162 3300053159 Ga0500630_033993 Ga0500630_033993_85_1041 317
2163 3300053162 Ga0500638_023327 Ga0500638_023327_1092_2048 317
2164 3300053162 Ga0500638_111345 Ga0500638_111345_243_1199 317
2165 3300053163 Ga0500639_000525 Ga0500639_000525_3610_4566 317
2166 3300053163 Ga0500639_062463 Ga0500639_062463_541_1494 317
2167 3300053177 Ga0500636_0000695 Ga0500636_0000695_1612_2565 317
2168 3300053177 Ga0500636_0001744 Ga0500636_0001744_2701_3660 317
2169 3300053177 Ga0500636_0033194 Ga0500636_0033194_1559_2515 317
2170 3300053178 Ga0500637_0009251 Ga0500637_0009251_3965_4921 317
2171 3300053178 Ga0500637_0115909 Ga0500637_0115909_295_1248 317
2172 3300053178 Ga0500637_0158620 Ga0500637_0158620_51_1007 317
2173 3300053727 Ga0500611_012117 Ga0500611_012117_461_1417 317
2174 3300053729 Ga0500625_003061 Ga0500625_003061_3494_4447 317
2175 3300053730 Ga0500645_011357 Ga0500645_011357_1485_2441 317
2176 3300053735 Ga0500596_003815 Ga0500596_003815_1805_2761 317
2177 3300053735 Ga0500596_005554 Ga0500596_005554_1175_2131 317
2178 3300053736 Ga0500599_004800 Ga0500599_004800_529_1482 317
2179 3300053737 Ga0500601_000775 Ga0500601_000775_2164_3117 317
2180 3300054114 Ga0501084_0006070 Ga0501084_0006070_6506_7459 317
2181 3300055283 Ga0500661_013504 Ga0500661_013504_135_1091 317
2182 3300060353 Ga0501082_0004101 Ga0501082_0004101_5932_6885 317
2183 3300061719 Ga0466962_0027657 Ga0466962_0027657_277_1233 317
2184 iso_pu_bacteria 2935630451 2935634386 317
2185 iso_pu_bacteria 2941507105 2941511276 317
2186 iso_pu_bacteria 2941515067 2941518660 317
2187 iso_pu_bacteria 2941523033 2941530396 317
2188 iso_pu_bacteria 3005474847 3005479212 317
2189 iso_pu_bacteria 3005483717 3005489840 317
2190 iso_pu_bacteria 8019648815 8019657054 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00701

DHDPS

Dihydrodipicolinate synthetase family

43

337

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dz1-assembly1.cif.gz_A crystal structure of dihydrodipicolinate synthase from rhodopseudomonas palustris at 1.87a resolution 0.9969 1 299
3dz1-assembly1.cif.gz_A crystal structure of dihydrodipicolinate synthase from rhodopseudomonas palustris at 1.87a resolution 0.987 1 299
3na8-assembly1.cif.gz_B crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa 0.9218 6 300
3na8-assembly1.cif.gz_D crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa 0.9186 6 300
3s5n-assembly1.cif.gz_A crystal structure of human 4-hydroxy-2-oxoglutarate aldolase 0.9169 6 300
ID Description Score Start End Superfamily
3dz1A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9951 1 299 3.20.20.70
3dz1A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9849 1 299 3.20.20.70
2rfgB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9069 8 305 3.20.20.70
2yxgD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9062 7 298 3.20.20.70
5f1uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9058 1 299 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A435X9N8-F1-model_v4 Dihydrodipicolinate synthase family protein 0.9972 194 302
AF-A0A2C7AAA9-F1-model_v4 Dihydrodipicolinate synthase family protein 0.9959 1 308 GO:0005829
GO:0008840
AF-A0A261RYY6-F1-model_v4 Dihydrodipicolinate synthase family protein 0.9954 1 311 GO:0005829
GO:0008840
AF-A0A7W5TC66-F1-model_v4 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) 0.9949 2 307 GO:0005829
GO:0008840
AF-A0A2G8MJR4-F1-model_v4 deleted 0.9944 1 252

Feature Viewer

pLDDT pTM Quality
95.06 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map