F496529
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2190 | 921 | 1831 | 313 |
Family's Representative Sequence
| Representative Sequence | 3300046664|Ga0495659_0030392|Ga0495659_0030392_398_1462 |
| Length | 354 |
| Sequence | MRSIEPGISRFPDAQLRIFGLVLAHHPGMTKGSDAQMTKLTAQAAGTFAIAPTPFHDDGRIDEKSIDRLTDFYAEVGCDGVTVLGILGEAPKLDAAEAEQVAVRFVKRAKNMQIIVGVSAPGFATMRSLAKASMDAGAAGVMIAPPPHLRTDDQITGYFKQAQEAIGDEIPWVLQDYPLTLNVIFTPAVIRKIVMDSPSCVMLKHEDWPGLEKISTLRGFQKDGSLKPMSILVGNGGLFLDFEMERGADGAMTGYAFPELLIDVVKLSKAGKRDAAHDLFDAHLPLIRYEQQPGAGLAVRKHVLQKRGIISSSAQRKPGATITATAKAEVDYLLSRVARVDRRANLQPQSSAAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 3 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 4 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 5 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 6 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 7 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 8 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 9 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 10 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 11 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 12 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 13 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 14 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 15 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 16 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 17 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 18 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 19 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 20 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 21 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 22 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 23 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 24 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 25 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 26 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 27 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 28 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 29 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 30 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 31 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 32 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 33 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 34 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 35 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 36 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 37 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 38 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 39 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 40 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 41 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 42 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 43 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 44 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 45 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 46 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 47 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 48 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 49 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 50 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 51 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 52 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 53 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 54 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 55 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 56 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 57 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 58 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 59 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 60 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 61 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 62 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 63 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 64 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 65 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 66 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 67 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 68 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 69 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 70 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 71 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 72 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 73 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 74 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 75 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 76 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 77 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 78 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 79 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 80 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 81 | 2791355199 | |||
| 82 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 83 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 84 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 85 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 86 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 87 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 88 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 89 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 90 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 91 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 92 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 93 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 94 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 95 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 96 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 97 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 98 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 99 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 100 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 101 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 102 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 103 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 104 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 105 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 106 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 107 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 108 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 109 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 110 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 111 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 112 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 113 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 114 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 115 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 116 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 117 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 118 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 119 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 120 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 121 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 122 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 123 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 124 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 125 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 126 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
| 127 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 128 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 129 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 130 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 131 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 132 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 133 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 134 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 135 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 136 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 137 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 138 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 139 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 140 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 141 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 142 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 143 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 144 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 145 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 146 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 147 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 148 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 149 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 150 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 151 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 152 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 153 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 154 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 155 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 156 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 157 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 158 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 159 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 160 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 161 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 162 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 163 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 164 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 165 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 166 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 167 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 168 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 169 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 170 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 171 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 172 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 173 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 174 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 175 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 176 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 177 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 178 | 2904699407 | |||
| 179 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 180 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 181 | 2906610324 | |||
| 182 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 183 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 184 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 185 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 186 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 187 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 188 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 189 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 190 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 191 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 192 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 193 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 194 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 195 | 2922368715 | |||
| 196 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 197 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 198 | 2922425934 | |||
| 199 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 200 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 201 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 202 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 203 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 204 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 205 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 206 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 207 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 208 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 209 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 210 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 211 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 212 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 213 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 214 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 215 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 216 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 217 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 218 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 219 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 220 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 221 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 222 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 223 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 224 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 225 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 226 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 227 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 228 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 229 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 230 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 231 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 232 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 233 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 234 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 235 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 236 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 237 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 238 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 239 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 240 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 241 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 242 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 243 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 244 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 245 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 246 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 247 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 248 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 249 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 250 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 251 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 252 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 253 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 254 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 255 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 256 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 257 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 258 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 259 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 260 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 261 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 262 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 263 | 2941479691 | |||
| 264 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 265 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 266 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 267 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 268 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 269 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 270 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 271 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 272 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 273 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 274 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 275 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 276 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 277 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 278 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 279 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 280 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 281 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 282 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 283 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 284 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 285 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 286 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 287 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 288 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 289 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 290 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 291 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 292 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 293 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 294 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 295 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 296 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 297 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 298 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 299 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 300 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 301 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 302 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 303 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 304 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 305 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 306 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 307 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 308 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 309 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 310 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 311 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 312 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 313 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 314 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 315 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 316 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 317 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 318 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 319 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 320 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 321 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 322 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 323 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 324 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 325 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 326 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 327 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 328 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 329 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 330 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 331 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 332 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 333 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 334 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 335 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 336 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 337 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 338 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 339 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 340 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 341 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 342 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 343 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 344 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 345 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 346 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 347 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 348 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 349 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 350 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 351 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 352 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 353 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 354 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 355 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 356 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 357 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 358 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 359 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 360 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 361 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 362 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 363 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 364 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 365 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 366 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 367 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 368 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 369 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 370 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 371 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 372 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 373 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 374 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 375 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 376 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 377 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 378 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 379 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 380 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 381 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 382 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 383 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 384 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 385 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 386 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 388 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 389 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 390 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 391 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 392 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 393 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 394 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 395 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 396 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 397 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 399 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 400 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 401 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 402 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 403 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 405 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 407 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 408 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 409 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 410 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 411 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 412 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 413 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 414 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 415 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 416 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 417 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 418 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 419 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 420 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 421 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 422 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 423 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 424 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 425 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 426 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 427 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 428 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 429 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 430 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 431 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 432 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 433 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 434 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 435 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 436 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 437 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 438 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 439 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 440 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 441 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 442 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 443 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 444 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 445 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 446 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 447 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 448 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 449 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 450 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 451 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 452 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 453 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 454 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 455 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 456 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 457 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 458 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 459 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 460 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 461 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 462 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 463 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 464 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 465 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 466 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 467 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 468 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 469 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 470 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 471 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 472 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 473 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 474 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 475 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 476 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 477 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 478 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 479 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 480 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 481 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 482 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 483 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 484 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 485 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 486 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 487 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 488 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 489 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 490 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 491 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 492 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 493 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 494 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 495 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 496 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 497 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 498 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 499 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 500 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 501 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 502 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 503 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 504 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 505 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 506 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 507 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 508 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 509 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 510 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 511 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 512 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 513 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 514 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 515 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 516 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 517 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 518 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 519 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 520 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 521 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 522 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 523 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 524 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 525 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 526 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 527 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 528 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 529 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 530 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 531 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 532 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 533 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 534 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 535 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 536 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 537 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 538 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 539 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 540 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 541 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 542 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 543 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 544 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 545 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 546 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 547 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 548 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 549 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 550 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 551 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 553 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 554 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 555 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 556 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 557 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 558 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 559 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 560 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 561 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 562 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 563 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 564 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 565 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 566 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 567 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 568 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 569 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 570 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 571 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 572 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 573 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 574 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 575 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 576 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 577 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 578 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 579 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 580 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 581 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 582 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 583 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 584 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 585 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 586 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 587 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 588 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 589 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 590 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 591 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 592 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 593 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 594 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 595 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 596 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 597 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 598 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 599 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 600 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 601 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 602 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 603 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 604 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 605 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 606 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 607 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 608 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 609 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 610 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 611 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 612 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 613 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 614 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 615 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 616 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 617 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 618 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 619 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 620 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 621 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 622 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 623 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 624 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 625 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 626 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 627 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 628 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 629 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 630 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 631 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 632 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 633 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 634 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 635 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 636 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 637 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 638 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 639 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 640 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 641 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 642 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 643 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 652 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 653 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 654 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 655 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 656 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 657 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 658 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 659 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 660 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 661 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 662 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 663 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 664 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 665 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 666 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 667 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 668 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 669 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 670 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 671 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 672 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 673 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 674 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 675 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 676 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 677 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 678 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 679 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 680 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 681 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 682 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 683 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 684 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 685 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 686 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 687 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 688 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 689 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 690 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 691 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 692 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 693 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 694 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 695 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 696 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 697 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 698 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 699 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 700 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 701 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 702 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 703 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 704 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 705 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 706 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 707 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 708 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 709 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 710 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 711 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 712 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 713 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 714 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 715 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 716 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 717 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 718 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 719 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 720 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 721 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 722 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 723 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 724 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 725 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 726 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 727 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 728 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 729 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 730 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 731 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 732 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 733 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 734 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 735 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 736 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 737 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 738 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 739 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 740 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 741 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 742 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 743 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 744 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 745 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 746 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 747 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 748 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 749 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 750 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 751 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 752 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 753 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 754 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 755 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 756 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 757 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 758 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 759 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 760 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 761 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 762 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 763 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 764 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 765 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 766 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 767 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 768 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 769 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 770 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 771 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 772 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 773 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 774 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 775 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 776 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 777 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 778 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 779 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 780 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 781 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 782 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 783 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 784 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 785 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 786 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 787 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 788 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 789 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 790 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 791 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 792 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 793 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 794 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 795 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 796 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 797 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 798 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 799 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 800 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 801 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 802 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 803 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 804 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 805 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 806 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 807 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 808 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 809 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 810 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 811 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 812 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 813 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 814 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 815 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 816 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 817 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 818 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 819 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 820 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 821 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 822 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 823 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 824 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 825 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 826 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 827 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 828 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 829 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 830 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 831 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 832 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 833 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 834 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 835 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 836 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 837 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 838 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 839 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 840 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 841 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 842 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 843 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 844 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 845 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 846 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 847 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 848 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 849 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 850 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 851 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 852 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 853 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 854 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 855 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 856 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 857 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 858 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 859 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 860 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 861 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 862 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 863 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 864 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 865 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 866 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 867 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 868 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 869 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 870 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 871 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 872 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 873 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 874 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 875 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 876 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 877 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 878 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 879 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 880 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 881 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 882 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 883 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 884 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 885 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 886 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 887 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 888 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 889 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 890 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 891 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 892 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 893 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 894 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 895 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 896 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 897 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 898 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 899 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 900 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 901 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 902 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 903 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 904 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 905 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 906 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 907 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 908 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 909 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 910 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 911 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 912 | 8048746797 | Alcaligenes endophyticus DSM 100498 | Isolate | Unclassified |
| 913 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 914 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 915 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
| 916 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 917 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 918 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 919 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 920 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 921 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.48 |
| Metatranscriptomes | 0.32 |
| Isolates | 16.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.05 |
| Bulb | 0 |
| Endosphere | 15.8 |
| Nodule | 10.64 |
| Rhizoplane | 3.7 |
| Rhizosphere | 56.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C2224 | 2010549000 | Bacteria | 1121 |
| 2 | JGI25152J39213_1000093 | 3300002773 | Bacteria | 62826 |
| 3 | JGI25152J39213_1004057 | 3300002773 | Bacteria | 4765 |
| 4 | JGI25152J39213_1004574 | 3300002773 | Bacteria | 4311 |
| 5 | JGI25150J39212_1000045 | 3300002774 | Bacteria | 80164 |
| 6 | JGI25159J45721_1014777 | 3300002987 | Bacteria | 1742 |
| 7 | JGI25151J46595_10000023 | 3300003187 | Bacteria | 221548 |
| 8 | JGI25151J46595_10000072 | 3300003187 | Bacteria | 136769 |
| 9 | JGI25151J46595_10001720 | 3300003187 | Bacteria | 14296 |
| 10 | JGI25151J46595_10004869 | 3300003187 | Bacteria | 7013 |
| 11 | JGI25406J46586_10001179 | 3300003203 | Bacteria | 12300 |
| 12 | JGI25406J46586_10004585 | 3300003203 | Bacteria | 6433 |
| 13 | JGI25406J46586_10021358 | 3300003203 | Bacteria | 2599 |
| 14 | JGI25165J46597_1000020 | 3300003214 | Bacteria | 370477 |
| 15 | JGI25165J46597_1005560 | 3300003214 | Bacteria | 2406 |
| 16 | JGI25153J46596_10000964 | 3300003215 | Bacteria | 17430 |
| 17 | JGI25153J46596_10004272 | 3300003215 | Bacteria | 7726 |
| 18 | JGI25153J46596_10014750 | 3300003215 | Bacteria | 3229 |
| 19 | JGI25153J46596_10028068 | 3300003215 | Bacteria | 1959 |
| 20 | rootH1_10111778 | 3300003316 | Bacteria | 2916 |
| 21 | rootL2_10130353 | 3300003322 | Bacteria | 2078 |
| 22 | rootH1_10252891 | 3300003323 | Bacteria | 1581 |
| 23 | JGI25160J50197_1006435 | 3300003354 | Bacteria | 4755 |
| 24 | JGI25160J50197_1009006 | 3300003354 | Bacteria | 3744 |
| 25 | JGI25161J50226_1000294 | 3300003374 | Bacteria | 28171 |
| 26 | JGI25161J50226_1000364 | 3300003374 | Bacteria | 23227 |
| 27 | JGI25404J52841_10006257 | 3300003659 | Bacteria | 2485 |
| 28 | JGI25404J52841_10022839 | 3300003659 | Bacteria | 1351 |
| 29 | JGI25404J52841_10023380 | 3300003659 | Bacteria | 1334 |
| 30 | JGI25404J52841_10024164 | 3300003659 | Bacteria | 1310 |
| 31 | Ga0055526_1000062 | 3300003771 | Bacteria | 104151 |
| 32 | Ga0055526_1000090 | 3300003771 | Bacteria | 83051 |
| 33 | Ga0055526_1002908 | 3300003771 | Bacteria | 11255 |
| 34 | Ga0055526_1014612 | 3300003771 | Bacteria | 3214 |
| 35 | Ga0055524_1000011 | 3300003775 | Bacteria | 261442 |
| 36 | Ga0055524_1000096 | 3300003775 | Bacteria | 108231 |
| 37 | Ga0055524_1005532 | 3300003775 | Bacteria | 5617 |
| 38 | Ga0055524_1007856 | 3300003775 | Bacteria | 4488 |
| 39 | Ga0055524_1016057 | 3300003775 | Bacteria | 2703 |
| 40 | Ga0055524_1025756 | 3300003775 | Bacteria | 1834 |
| 41 | Ga0055536_1004861 | 3300003781 | Bacteria | 6710 |
| 42 | Ga0055534_1012482 | 3300003784 | Bacteria | 1675 |
| 43 | Ga0055528_1000273 | 3300003790 | Bacteria | 43784 |
| 44 | Ga0055528_1002163 | 3300003790 | Bacteria | 10793 |
| 45 | Ga0055530_10018243 | 3300003791 | Bacteria | 2171 |
| 46 | Ga0055540_1000705 | 3300003792 | Bacteria | 23016 |
| 47 | Ga0055540_1007605 | 3300003792 | Bacteria | 4050 |
| 48 | Ga0055540_1011777 | 3300003792 | Bacteria | 2793 |
| 49 | Ga0055531_10007706 | 3300003794 | Bacteria | 5816 |
| 50 | Ga0055531_10024694 | 3300003794 | Bacteria | 2207 |
| 51 | Ga0058692_1000083 | 3300003856 | Bacteria | 66222 |
| 52 | Ga0058692_1000334 | 3300003856 | Bacteria | 23353 |
| 53 | Ga0055543_1000031 | 3300004625 | Bacteria | 130583 |
| 54 | Ga0055543_1005787 | 3300004625 | Bacteria | 3099 |
| 55 | Ga0065165_1000146 | 3300005262 | Bacteria | 122774 |
| 56 | Ga0065165_1000384 | 3300005262 | Bacteria | 71731 |
| 57 | Ga0065165_1001478 | 3300005262 | Bacteria | 25070 |
| 58 | Ga0065165_1015769 | 3300005262 | Bacteria | 2865 |
| 59 | Ga0065165_1049491 | 3300005262 | Bacteria | 1201 |
| 60 | Ga0065712_10101729 | 3300005290 | Bacteria | 2026 |
| 61 | Ga0065707_10083063 | 3300005295 | Bacteria | 10637 |
| 62 | Ga0070658_10046430 | 3300005327 | Bacteria | 3514 |
| 63 | Ga0070658_10077434 | 3300005327 | Bacteria | 2728 |
| 64 | Ga0070658_10460442 | 3300005327 | Bacteria | 1096 |
| 65 | Ga0070683_100141803 | 3300005329 | Bacteria | 2277 |
| 66 | Ga0070683_100348744 | 3300005329 | Bacteria | 1410 |
| 67 | Ga0070670_100020910 | 3300005331 | Bacteria | 5629 |
| 68 | Ga0070670_100054773 | 3300005331 | Bacteria | 3424 |
| 69 | Ga0070670_100059448 | 3300005331 | Bacteria | 3281 |
| 70 | Ga0068869_100116788 | 3300005334 | Bacteria | 2036 |
| 71 | Ga0070680_100003612 | 3300005336 | Bacteria | 11550 |
| 72 | Ga0070680_100006838 | 3300005336 | Bacteria | 8693 |
| 73 | Ga0070680_100290426 | 3300005336 | Bacteria | 1386 |
| 74 | Ga0068868_100027083 | 3300005338 | Bacteria | 4371 |
| 75 | Ga0068868_100051682 | 3300005338 | Bacteria | 3234 |
| 76 | Ga0068868_100095597 | 3300005338 | Bacteria | 2399 |
| 77 | Ga0068868_100181172 | 3300005338 | Bacteria | 1748 |
| 78 | Ga0070660_100000712 | 3300005339 | Bacteria | 22019 |
| 79 | Ga0070660_100105000 | 3300005339 | Bacteria | 2241 |
| 80 | Ga0070660_100406332 | 3300005339 | Bacteria | 1126 |
| 81 | Ga0070661_100040992 | 3300005344 | Bacteria | 3378 |
| 82 | Ga0070668_100126453 | 3300005347 | Bacteria | 2048 |
| 83 | Ga0070668_100323250 | 3300005347 | Bacteria | 1299 |
| 84 | Ga0070675_100004539 | 3300005354 | Bacteria | 10598 |
| 85 | Ga0070675_100004711 | 3300005354 | Bacteria | 10413 |
| 86 | Ga0070671_100373939 | 3300005355 | Unclassified | 1217 |
| 87 | Ga0070674_100002295 | 3300005356 | Bacteria | 10558 |
| 88 | Ga0070674_100045491 | 3300005356 | Bacteria | 2999 |
| 89 | Ga0070674_100069140 | 3300005356 | Bacteria | 2490 |
| 90 | Ga0070673_100002654 | 3300005364 | Bacteria | 10944 |
| 91 | Ga0070659_100032961 | 3300005366 | Bacteria | 4023 |
| 92 | Ga0070659_100176657 | 3300005366 | Bacteria | 1751 |
| 93 | Ga0070667_100046864 | 3300005367 | Bacteria | 3637 |
| 94 | Ga0070667_100097327 | 3300005367 | Bacteria | 2538 |
| 95 | Ga0070667_100154440 | 3300005367 | Bacteria | 2018 |
| 96 | Ga0070667_100450903 | 3300005367 | Bacteria | 1175 |
| 97 | Ga0070709_10000551 | 3300005434 | Bacteria | 21925 |
| 98 | Ga0070709_10039200 | 3300005434 | Bacteria | 2906 |
| 99 | Ga0070709_10145883 | 3300005434 | Bacteria | 1631 |
| 100 | Ga0070714_100006459 | 3300005435 | Bacteria | 9056 |
| 101 | Ga0070714_100078545 | 3300005435 | Bacteria | 2868 |
| 102 | Ga0070714_100138246 | 3300005435 | Bacteria | 2184 |
| 103 | Ga0070714_100331329 | 3300005435 | Bacteria | 1426 |
| 104 | Ga0070714_100520002 | 3300005435 | Bacteria | 1137 |
| 105 | Ga0070713_100012869 | 3300005436 | Bacteria | 6154 |
| 106 | Ga0070713_100024691 | 3300005436 | Bacteria | 4687 |
| 107 | Ga0070713_100048830 | 3300005436 | Bacteria | 3487 |
| 108 | Ga0070713_100071444 | 3300005436 | Bacteria | 2933 |
| 109 | Ga0070713_100215848 | 3300005436 | Bacteria | 1739 |
| 110 | Ga0070713_100320719 | 3300005436 | Bacteria | 1431 |
| 111 | Ga0070710_10001238 | 3300005437 | Bacteria | 12107 |
| 112 | Ga0070710_10001820 | 3300005437 | Bacteria | 10067 |
| 113 | Ga0070710_10014322 | 3300005437 | Bacteria | 3990 |
| 114 | Ga0070711_100002350 | 3300005439 | Bacteria | 10755 |
| 115 | Ga0070711_100003473 | 3300005439 | Bacteria | 9187 |
| 116 | Ga0070711_100161009 | 3300005439 | Bacteria | 1701 |
| 117 | Ga0070700_100226215 | 3300005441 | Bacteria | 1329 |
| 118 | Ga0070708_100040043 | 3300005445 | Bacteria | 4103 |
| 119 | Ga0070708_100098574 | 3300005445 | Bacteria | 2672 |
| 120 | Ga0070708_100199091 | 3300005445 | Bacteria | 1875 |
| 121 | Ga0070663_100020630 | 3300005455 | Bacteria | 4365 |
| 122 | Ga0070663_100100803 | 3300005455 | Bacteria | 2154 |
| 123 | Ga0070663_100129121 | 3300005455 | Bacteria | 1917 |
| 124 | Ga0070663_100132501 | 3300005455 | Bacteria | 1894 |
| 125 | Ga0070663_100173848 | 3300005455 | Bacteria | 1666 |
| 126 | Ga0070678_100084994 | 3300005456 | Bacteria | 2410 |
| 127 | Ga0070662_100118532 | 3300005457 | Bacteria | 2026 |
| 128 | Ga0070662_100425940 | 3300005457 | Bacteria | 1098 |
| 129 | Ga0070681_10069947 | 3300005458 | Bacteria | 3475 |
| 130 | Ga0070681_10103948 | 3300005458 | Bacteria | 2783 |
| 131 | Ga0068867_100001776 | 3300005459 | Bacteria | 14990 |
| 132 | Ga0068867_100002021 | 3300005459 | Bacteria | 14179 |
| 133 | Ga0068867_100021615 | 3300005459 | Bacteria | 4592 |
| 134 | Ga0070706_100099702 | 3300005467 | Bacteria | 2699 |
| 135 | Ga0070707_100009136 | 3300005468 | Bacteria | 9192 |
| 136 | Ga0070698_100036324 | 3300005471 | Bacteria | 5090 |
| 137 | Ga0070699_100269399 | 3300005518 | Bacteria | 1524 |
| 138 | Ga0070699_100374399 | 3300005518 | Unclassified | 1285 |
| 139 | Ga0070679_100022733 | 3300005530 | Bacteria | 6131 |
| 140 | Ga0070679_100038790 | 3300005530 | Bacteria | 4736 |
| 141 | Ga0070679_100089045 | 3300005530 | Bacteria | 3073 |
| 142 | Ga0070679_100121386 | 3300005530 | Unclassified | 2598 |
| 143 | Ga0070679_100407730 | 3300005530 | Bacteria | 1305 |
| 144 | Ga0070684_100054319 | 3300005535 | Bacteria | 3490 |
| 145 | Ga0070684_100328729 | 3300005535 | Bacteria | 1405 |
| 146 | Ga0070697_100002285 | 3300005536 | Bacteria | 14708 |
| 147 | Ga0068853_100057773 | 3300005539 | Bacteria | 3349 |
| 148 | Ga0068853_100072650 | 3300005539 | Bacteria | 2998 |
| 149 | Ga0068853_100139930 | 3300005539 | Bacteria | 2172 |
| 150 | Ga0068853_100494938 | 3300005539 | Bacteria | 1154 |
| 151 | Ga0070672_100001907 | 3300005543 | Bacteria | 13071 |
| 152 | Ga0070672_100005394 | 3300005543 | Bacteria | 8468 |
| 153 | Ga0070672_100114902 | 3300005543 | Bacteria | 2198 |
| 154 | Ga0070672_100151643 | 3300005543 | Bacteria | 1918 |
| 155 | Ga0070696_100142431 | 3300005546 | Bacteria | 1753 |
| 156 | Ga0070665_100044294 | 3300005548 | Bacteria | 4469 |
| 157 | Ga0070665_100046013 | 3300005548 | Bacteria | 4383 |
| 158 | Ga0070665_100082828 | 3300005548 | Bacteria | 3213 |
| 159 | Ga0070665_100272492 | 3300005548 | Bacteria | 1694 |
| 160 | Ga0070665_100368380 | 3300005548 | Bacteria | 1443 |
| 161 | Ga0070665_100380040 | 3300005548 | Bacteria | 1420 |
| 162 | Ga0068855_100015850 | 3300005563 | Bacteria | 9067 |
| 163 | Ga0068855_100021411 | 3300005563 | Bacteria | 7753 |
| 164 | Ga0068855_100032479 | 3300005563 | Bacteria | 6232 |
| 165 | Ga0068855_100064535 | 3300005563 | Bacteria | 4270 |
| 166 | Ga0068855_100130991 | 3300005563 | Bacteria | 2864 |
| 167 | Ga0068855_100155871 | 3300005563 | Bacteria | 2595 |
| 168 | Ga0068855_100183174 | 3300005563 | Bacteria | 2367 |
| 169 | Ga0068855_100228906 | 3300005563 | Bacteria | 2082 |
| 170 | Ga0068855_100653046 | 3300005563 | Bacteria | 1129 |
| 171 | Ga0070664_100202560 | 3300005564 | Bacteria | 1771 |
| 172 | Ga0068857_100117621 | 3300005577 | Bacteria | 2392 |
| 173 | Ga0068856_100000680 | 3300005614 | Bacteria | 36872 |
| 174 | Ga0068856_100416396 | 3300005614 | Bacteria | 1364 |
| 175 | Ga0070702_100094948 | 3300005615 | Bacteria | 1816 |
| 176 | Ga0068852_100000134 | 3300005616 | Bacteria | 49788 |
| 177 | Ga0068852_100002663 | 3300005616 | Bacteria | 12346 |
| 178 | Ga0068852_100334862 | 3300005616 | Bacteria | 1473 |
| 179 | Ga0068859_100024084 | 3300005617 | Bacteria | 6109 |
| 180 | Ga0068859_100184886 | 3300005617 | Bacteria | 2167 |
| 181 | Ga0068859_100255239 | 3300005617 | Bacteria | 1844 |
| 182 | Ga0068859_100313387 | 3300005617 | Bacteria | 1663 |
| 183 | Ga0068859_100346401 | 3300005617 | Bacteria | 1580 |
| 184 | Ga0068864_100080180 | 3300005618 | Bacteria | 2859 |
| 185 | Ga0068861_100043821 | 3300005719 | Bacteria | 3361 |
| 186 | Ga0068861_100196607 | 3300005719 | Bacteria | 1690 |
| 187 | Ga0068861_100239575 | 3300005719 | Bacteria | 1542 |
| 188 | Ga0068861_100286196 | 3300005719 | Bacteria | 1421 |
| 189 | Ga0068861_100428911 | 3300005719 | Bacteria | 1180 |
| 190 | Ga0068851_10014696 | 3300005834 | Bacteria | 3720 |
| 191 | Ga0068851_10098127 | 3300005834 | Bacteria | 1551 |
| 192 | Ga0068863_100067022 | 3300005841 | Bacteria | 3396 |
| 193 | Ga0068863_100230221 | 3300005841 | Bacteria | 1787 |
| 194 | Ga0068863_100285967 | 3300005841 | Bacteria | 1598 |
| 195 | Ga0068863_100572368 | 3300005841 | Bacteria | 1116 |
| 196 | Ga0068858_100045095 | 3300005842 | Bacteria | 4085 |
| 197 | Ga0068858_100050616 | 3300005842 | Bacteria | 3845 |
| 198 | Ga0068858_100073406 | 3300005842 | Bacteria | 3175 |
| 199 | Ga0068858_100104515 | 3300005842 | Bacteria | 2642 |
| 200 | Ga0068860_100000258 | 3300005843 | Bacteria | 77761 |
| 201 | Ga0068860_100003477 | 3300005843 | Bacteria | 16211 |
| 202 | Ga0068860_100270797 | 3300005843 | Bacteria | 1657 |
| 203 | Ga0068860_100463404 | 3300005843 | Unclassified | 1261 |
| 204 | Ga0068862_100032793 | 3300005844 | Bacteria | 4387 |
| 205 | Ga0068862_100063701 | 3300005844 | Bacteria | 3172 |
| 206 | Ga0081455_10000992 | 3300005937 | Bacteria | 36052 |
| 207 | Ga0081455_10014642 | 3300005937 | Bacteria | 7670 |
| 208 | Ga0081455_10077075 | 3300005937 | Bacteria | 2744 |
| 209 | Ga0081455_10113926 | 3300005937 | Bacteria | 2143 |
| 210 | Ga0081538_10043613 | 3300005981 | Bacteria | 2812 |
| 211 | Ga0081538_10054608 | 3300005981 | Bacteria | 2361 |
| 212 | Ga0081540_1001447 | 3300005983 | Bacteria | 20522 |
| 213 | Ga0081540_1003602 | 3300005983 | Bacteria | 12156 |
| 214 | Ga0081540_1010266 | 3300005983 | Bacteria | 6358 |
| 215 | Ga0081540_1013011 | 3300005983 | Bacteria | 5435 |
| 216 | Ga0081540_1017968 | 3300005983 | Bacteria | 4358 |
| 217 | Ga0081540_1029167 | 3300005983 | Bacteria | 3080 |
| 218 | Ga0081540_1042958 | 3300005983 | Bacteria | 2325 |
| 219 | Ga0081540_1050922 | 3300005983 | Bacteria | 2052 |
| 220 | Ga0081540_1058311 | 3300005983 | Bacteria | 1860 |
| 221 | Ga0081540_1067104 | 3300005983 | Bacteria | 1678 |
| 222 | Ga0081540_1089783 | 3300005983 | Bacteria | 1355 |
| 223 | Ga0081539_10000140 | 3300005985 | Bacteria | 166746 |
| 224 | Ga0081539_10000259 | 3300005985 | Bacteria | 121997 |
| 225 | Ga0081539_10000897 | 3300005985 | Bacteria | 56772 |
| 226 | Ga0081539_10008354 | 3300005985 | Bacteria | 9047 |
| 227 | Ga0081539_10087407 | 3300005985 | Bacteria | 1619 |
| 228 | Ga0070717_10012420 | 3300006028 | Bacteria | 6494 |
| 229 | Ga0070717_10038867 | 3300006028 | Bacteria | 3869 |
| 230 | Ga0070717_10225358 | 3300006028 | Bacteria | 1649 |
| 231 | Ga0070717_10286247 | 3300006028 | Bacteria | 1462 |
| 232 | Ga0070717_10386289 | 3300006028 | Bacteria | 1256 |
| 233 | Ga0075365_10006531 | 3300006038 | Bacteria | 6424 |
| 234 | Ga0075365_10020374 | 3300006038 | Bacteria | 4111 |
| 235 | Ga0075365_10023183 | 3300006038 | Bacteria | 3901 |
| 236 | Ga0075365_10032401 | 3300006038 | Bacteria | 3359 |
| 237 | Ga0075365_10042363 | 3300006038 | Bacteria | 2976 |
| 238 | Ga0075365_10079692 | 3300006038 | Bacteria | 2216 |
| 239 | Ga0075365_10085484 | 3300006038 | Bacteria | 2143 |
| 240 | Ga0075365_10098835 | 3300006038 | Bacteria | 1997 |
| 241 | Ga0075365_10171676 | 3300006038 | Bacteria | 1513 |
| 242 | Ga0075365_10240706 | 3300006038 | Bacteria | 1271 |
| 243 | Ga0075368_10016033 | 3300006042 | Bacteria | 2787 |
| 244 | Ga0075368_10028860 | 3300006042 | Bacteria | 2144 |
| 245 | Ga0075368_10031789 | 3300006042 | Bacteria | 2048 |
| 246 | Ga0075368_10092647 | 3300006042 | Bacteria | 1236 |
| 247 | Ga0075363_100045141 | 3300006048 | Bacteria | 2336 |
| 248 | Ga0075363_100090159 | 3300006048 | Bacteria | 1686 |
| 249 | Ga0075364_10000193 | 3300006051 | Bacteria | 28203 |
| 250 | Ga0075364_10008004 | 3300006051 | Bacteria | 6299 |
| 251 | Ga0075364_10010568 | 3300006051 | Bacteria | 5581 |
| 252 | Ga0075364_10034528 | 3300006051 | Bacteria | 3264 |
| 253 | Ga0075364_10046887 | 3300006051 | Bacteria | 2814 |
| 254 | Ga0075364_10108093 | 3300006051 | Bacteria | 1855 |
| 255 | Ga0075364_10137155 | 3300006051 | Bacteria | 1644 |
| 256 | Ga0075364_10267926 | 3300006051 | Bacteria | 1161 |
| 257 | Ga0070715_10054192 | 3300006163 | Bacteria | 1736 |
| 258 | Ga0070712_100027212 | 3300006175 | Bacteria | 3816 |
| 259 | Ga0070712_100028983 | 3300006175 | Bacteria | 3708 |
| 260 | Ga0075362_10013075 | 3300006177 | Bacteria | 3313 |
| 261 | Ga0075367_10002507 | 3300006178 | Bacteria | 8416 |
| 262 | Ga0075367_10162643 | 3300006178 | Bacteria | 1388 |
| 263 | Ga0075369_10005702 | 3300006186 | Bacteria | 4671 |
| 264 | Ga0075369_10009035 | 3300006186 | Bacteria | 3857 |
| 265 | Ga0075369_10021073 | 3300006186 | Bacteria | 2675 |
| 266 | Ga0075369_10037856 | 3300006186 | Bacteria | 2056 |
| 267 | Ga0075366_10015710 | 3300006195 | Bacteria | 4344 |
| 268 | Ga0097621_100006967 | 3300006237 | Bacteria | 8050 |
| 269 | Ga0097621_100008135 | 3300006237 | Bacteria | 7541 |
| 270 | Ga0097621_100068270 | 3300006237 | Bacteria | 2931 |
| 271 | Ga0097621_100188828 | 3300006237 | Bacteria | 1783 |
| 272 | Ga0075370_10051959 | 3300006353 | Bacteria | 2325 |
| 273 | Ga0075370_10053554 | 3300006353 | Bacteria | 2290 |
| 274 | Ga0075370_10085010 | 3300006353 | Bacteria | 1821 |
| 275 | Ga0075370_10209295 | 3300006353 | Bacteria | 1151 |
| 276 | Ga0068871_100055704 | 3300006358 | Bacteria | 3211 |
| 277 | Ga0068871_100185980 | 3300006358 | Bacteria | 1787 |
| 278 | Ga0068871_100309432 | 3300006358 | Bacteria | 1388 |
| 279 | Ga0075428_100003153 | 3300006844 | Bacteria | 18000 |
| 280 | Ga0075428_100318846 | 3300006844 | Bacteria | 1670 |
| 281 | Ga0075430_100007426 | 3300006846 | Bacteria | 9257 |
| 282 | Ga0075430_100075877 | 3300006846 | Bacteria | 2818 |
| 283 | Ga0075430_100100344 | 3300006846 | Bacteria | 2418 |
| 284 | Ga0075430_100280033 | 3300006846 | Bacteria | 1380 |
| 285 | Ga0075431_100002020 | 3300006847 | Bacteria | 19367 |
| 286 | Ga0075431_100003055 | 3300006847 | Bacteria | 16202 |
| 287 | Ga0075431_100018467 | 3300006847 | Bacteria | 7102 |
| 288 | Ga0075431_100045239 | 3300006847 | Bacteria | 4538 |
| 289 | Ga0075431_100140002 | 3300006847 | Bacteria | 2494 |
| 290 | Ga0075433_10000430 | 3300006852 | Bacteria | 26976 |
| 291 | Ga0075434_100027927 | 3300006871 | Bacteria | 5539 |
| 292 | Ga0075434_100249559 | 3300006871 | Bacteria | 1794 |
| 293 | Ga0075429_100003574 | 3300006880 | Bacteria | 13245 |
| 294 | Ga0075429_100003704 | 3300006880 | Bacteria | 13027 |
| 295 | Ga0075429_100004847 | 3300006880 | Bacteria | 11594 |
| 296 | Ga0075429_100149183 | 3300006880 | Bacteria | 2047 |
| 297 | Ga0075429_100211156 | 3300006880 | Bacteria | 1701 |
| 298 | Ga0068865_100002268 | 3300006881 | Bacteria | 11318 |
| 299 | Ga0068865_100032138 | 3300006881 | Bacteria | 3504 |
| 300 | Ga0068865_100119716 | 3300006881 | Bacteria | 1955 |
| 301 | Ga0068865_100195342 | 3300006881 | Bacteria | 1568 |
| 302 | Ga0075436_100000875 | 3300006914 | Bacteria | 19991 |
| 303 | Ga0097620_100024082 | 3300006931 | Bacteria | 6109 |
| 304 | Ga0097620_100184881 | 3300006931 | Bacteria | 2167 |
| 305 | Ga0097620_100255245 | 3300006931 | Bacteria | 1844 |
| 306 | Ga0097620_100313373 | 3300006931 | Bacteria | 1663 |
| 307 | Ga0097620_100346440 | 3300006931 | Bacteria | 1580 |
| 308 | Ga0099825_1025546 | 3300006941 | Bacteria | 3272 |
| 309 | Ga0099825_1034052 | 3300006941 | Bacteria | 1925 |
| 310 | Ga0099824_1007709 | 3300006942 | Bacteria | 14129 |
| 311 | Ga0099824_1009535 | 3300006942 | Bacteria | 11905 |
| 312 | Ga0099822_1037622 | 3300006943 | Bacteria | 2930 |
| 313 | Ga0099822_1044439 | 3300006943 | Bacteria | 2196 |
| 314 | Ga0099794_10019289 | 3300007265 | Bacteria | 3069 |
| 315 | Ga0099794_10033765 | 3300007265 | Bacteria | 2406 |
| 316 | Ga0105240_10002310 | 3300009093 | Bacteria | 30856 |
| 317 | Ga0105240_10005407 | 3300009093 | Bacteria | 19043 |
| 318 | Ga0105240_10027925 | 3300009093 | Bacteria | 7381 |
| 319 | Ga0105240_10030542 | 3300009093 | Bacteria | 7002 |
| 320 | Ga0105240_10105135 | 3300009093 | Bacteria | 3427 |
| 321 | Ga0105240_10201312 | 3300009093 | Bacteria | 2333 |
| 322 | Ga0111539_10114563 | 3300009094 | Bacteria | 3162 |
| 323 | Ga0111539_10195008 | 3300009094 | Bacteria | 2362 |
| 324 | Ga0105245_10011198 | 3300009098 | Bacteria | 7806 |
| 325 | Ga0105245_10087602 | 3300009098 | Bacteria | 2858 |
| 326 | Ga0114129_10000065 | 3300009147 | Bacteria | 94355 |
| 327 | Ga0114129_10001450 | 3300009147 | Bacteria | 32002 |
| 328 | Ga0114129_10006174 | 3300009147 | Bacteria | 16999 |
| 329 | Ga0114129_10016131 | 3300009147 | Bacteria | 10629 |
| 330 | Ga0114129_10025555 | 3300009147 | Bacteria | 8367 |
| 331 | Ga0114129_10078313 | 3300009147 | Bacteria | 4598 |
| 332 | Ga0114129_11134639 | 3300009147 | Bacteria | 977 |
| 333 | Ga0105243_10000028 | 3300009148 | Bacteria | 190789 |
| 334 | Ga0105243_10000106 | 3300009148 | Bacteria | 95432 |
| 335 | Ga0105243_10094929 | 3300009148 | Bacteria | 2464 |
| 336 | Ga0105241_10041926 | 3300009174 | Bacteria | 3460 |
| 337 | Ga0105241_10094937 | 3300009174 | Bacteria | 2360 |
| 338 | Ga0105241_10373718 | 3300009174 | Bacteria | 1243 |
| 339 | Ga0105242_10000184 | 3300009176 | Bacteria | 47750 |
| 340 | Ga0105242_10012090 | 3300009176 | Bacteria | 6641 |
| 341 | Ga0105242_10026716 | 3300009176 | Bacteria | 4577 |
| 342 | Ga0105242_10635877 | 3300009176 | Bacteria | 1036 |
| 343 | Ga0105248_10065071 | 3300009177 | Bacteria | 4093 |
| 344 | Ga0105248_10337987 | 3300009177 | Bacteria | 1695 |
| 345 | Ga0105237_10002162 | 3300009545 | Bacteria | 24710 |
| 346 | Ga0105237_10025732 | 3300009545 | Bacteria | 6017 |
| 347 | Ga0105237_10042104 | 3300009545 | Bacteria | 4606 |
| 348 | Ga0105237_10179615 | 3300009545 | Bacteria | 2117 |
| 349 | Ga0105237_10309025 | 3300009545 | Bacteria | 1584 |
| 350 | Ga0105238_10008143 | 3300009551 | Bacteria | 10484 |
| 351 | Ga0105238_10108633 | 3300009551 | Bacteria | 2755 |
| 352 | Ga0105238_10231024 | 3300009551 | Bacteria | 1826 |
| 353 | Ga0105238_10265679 | 3300009551 | Bacteria | 1696 |
| 354 | Ga0105249_10144156 | 3300009553 | Bacteria | 2287 |
| 355 | Ga0099796_10007451 | 3300010159 | Bacteria | 2862 |
| 356 | Ga0105239_10088786 | 3300010375 | Bacteria | 3409 |
| 357 | Ga0105239_10227156 | 3300010375 | Bacteria | 2094 |
| 358 | Ga0105239_10326162 | 3300010375 | Bacteria | 1732 |
| 359 | Ga0105239_10612587 | 3300010375 | Bacteria | 1242 |
| 360 | Ga0105246_10017489 | 3300011119 | Bacteria | 4557 |
| 361 | Ga0105246_10155346 | 3300011119 | Bacteria | 1737 |
| 362 | Ga0157371_10099208 | 3300013102 | Bacteria | 2065 |
| 363 | Ga0157370_10077059 | 3300013104 | Bacteria | 3141 |
| 364 | Ga0157370_10381827 | 3300013104 | Bacteria | 1298 |
| 365 | Ga0157369_10009732 | 3300013105 | Bacteria | 10992 |
| 366 | Ga0157369_10025423 | 3300013105 | Bacteria | 6575 |
| 367 | Ga0157369_10151909 | 3300013105 | Bacteria | 2447 |
| 368 | Ga0157369_10223225 | 3300013105 | Bacteria | 1971 |
| 369 | Ga0157369_10282041 | 3300013105 | Bacteria | 1730 |
| 370 | Ga0157369_10403329 | 3300013105 | Bacteria | 1418 |
| 371 | Ga0171462_1023 | 3300013250 | Bacteria | 136797 |
| 372 | Ga0171462_1029 | 3300013250 | Bacteria | 110139 |
| 373 | Ga0157374_10049880 | 3300013296 | Bacteria | 3888 |
| 374 | Ga0157374_10065342 | 3300013296 | Bacteria | 3416 |
| 375 | Ga0157378_10011636 | 3300013297 | Bacteria | 7703 |
| 376 | Ga0157378_10026868 | 3300013297 | Bacteria | 5076 |
| 377 | Ga0157378_10039107 | 3300013297 | Bacteria | 4206 |
| 378 | Ga0157378_10211465 | 3300013297 | Bacteria | 1839 |
| 379 | Ga0163162_10003566 | 3300013306 | Bacteria | 14886 |
| 380 | Ga0163162_10415528 | 3300013306 | Bacteria | 1477 |
| 381 | Ga0163162_10584292 | 3300013306 | Bacteria | 1244 |
| 382 | Ga0157372_10044988 | 3300013307 | Bacteria | 4894 |
| 383 | Ga0157372_10137753 | 3300013307 | Bacteria | 2811 |
| 384 | Ga0157372_10318761 | 3300013307 | Bacteria | 1810 |
| 385 | Ga0157372_10414317 | 3300013307 | Unclassified | 1570 |
| 386 | Ga0157372_10785337 | 3300013307 | Bacteria | 1107 |
| 387 | Ga0157375_10026229 | 3300013308 | Bacteria | 5427 |
| 388 | Ga0157375_10058420 | 3300013308 | Bacteria | 3816 |
| 389 | Ga0157375_10066362 | 3300013308 | Bacteria | 3602 |
| 390 | Ga0157375_10156434 | 3300013308 | Bacteria | 2418 |
| 391 | Ga0157375_10332188 | 3300013308 | Bacteria | 1685 |
| 392 | Ga0163163_10002136 | 3300014325 | Bacteria | 16698 |
| 393 | Ga0163163_10010953 | 3300014325 | Bacteria | 8192 |
| 394 | Ga0157380_10287449 | 3300014326 | Bacteria | 1508 |
| 395 | Ga0182008_10001849 | 3300014497 | Bacteria | 13776 |
| 396 | Ga0182008_10092916 | 3300014497 | Bacteria | 1488 |
| 397 | Ga0157377_10227428 | 3300014745 | Bacteria | 1197 |
| 398 | Ga0157379_10002228 | 3300014968 | Bacteria | 16141 |
| 399 | Ga0157379_10034241 | 3300014968 | Bacteria | 4527 |
| 400 | Ga0157379_10055612 | 3300014968 | Bacteria | 3535 |
| 401 | Ga0182006_1018279 | 3300015261 | Bacteria | 2964 |
| 402 | Ga0182007_10000577 | 3300015262 | Bacteria | 21601 |
| 403 | Ga0182005_1029514 | 3300015265 | Bacteria | 1496 |
| 404 | Ga0163161_10006805 | 3300017792 | Bacteria | 7904 |
| 405 | Ga0163161_10311765 | 3300017792 | Bacteria | 1242 |
| 406 | Ga0197907_11327166 | 3300020069 | Bacteria | 1519 |
| 407 | Ga0197907_11489271 | 3300020069 | Bacteria | 1547 |
| 408 | Ga0206356_11264946 | 3300020070 | Bacteria | 1912 |
| 409 | Ga0206354_10438044 | 3300020081 | Bacteria | 1732 |
| 410 | Ga0206353_11048710 | 3300020082 | Bacteria | 1938 |
| 411 | Ga0214544_1000006 | 3300021320 | Bacteria | 380728 |
| 412 | Ga0214542_1000002 | 3300021321 | Bacteria | 720798 |
| 413 | Ga0214545_1000002 | 3300021324 | Bacteria | 727485 |
| 414 | Ga0214543_1000017 | 3300021327 | Bacteria | 290109 |
| 415 | Ga0213872_10036241 | 3300021361 | Bacteria | 2255 |
| 416 | Ga0213874_10000725 | 3300021377 | Bacteria | 6660 |
| 417 | Ga0213874_10003303 | 3300021377 | Bacteria | 3566 |
| 418 | Ga0213874_10035511 | 3300021377 | Bacteria | 1465 |
| 419 | Ga0213876_10015756 | 3300021384 | Bacteria | 4001 |
| 420 | Ga0213875_10004342 | 3300021388 | Bacteria | 7809 |
| 421 | Ga0213875_10015983 | 3300021388 | Bacteria | 3646 |
| 422 | Ga0213875_10019342 | 3300021388 | Bacteria | 3276 |
| 423 | Ga0213875_10063752 | 3300021388 | Bacteria | 1722 |
| 424 | Ga0213871_10007482 | 3300021441 | Bacteria | 2364 |
| 425 | Ga0213871_10011645 | 3300021441 | Bacteria | 2025 |
| 426 | Ga0224712_10002521 | 3300022467 | Bacteria | 4538 |
| 427 | Ga0228711_1010044 | 3300022739 | Bacteria | 12584 |
| 428 | Ga0228710_1010269 | 3300022740 | Bacteria | 12585 |
| 429 | Ga0228598_1014149 | 3300024227 | Bacteria | 1579 |
| 430 | Ga0209436_100043 | 3300025208 | Bacteria | 71870 |
| 431 | Ga0209563_101440 | 3300025230 | Bacteria | 6314 |
| 432 | Ga0207427_102270 | 3300025231 | Bacteria | 5372 |
| 433 | Ga0207425_1000038 | 3300025245 | Bacteria | 221600 |
| 434 | Ga0207425_1005641 | 3300025245 | Bacteria | 3536 |
| 435 | Ga0207425_1012329 | 3300025245 | Bacteria | 2010 |
| 436 | Ga0209677_100615 | 3300025253 | Bacteria | 19096 |
| 437 | Ga0209677_108121 | 3300025253 | Bacteria | 2090 |
| 438 | Ga0209148_1000354 | 3300025254 | Bacteria | 59155 |
| 439 | Ga0209148_1004815 | 3300025254 | Bacteria | 3223 |
| 440 | Ga0209129_1000016 | 3300025258 | Bacteria | 485491 |
| 441 | Ga0209129_1000036 | 3300025258 | Bacteria | 328331 |
| 442 | Ga0209129_1000529 | 3300025258 | Bacteria | 26631 |
| 443 | Ga0209129_1005013 | 3300025258 | Bacteria | 4875 |
| 444 | Ga0209129_1006246 | 3300025258 | Bacteria | 3930 |
| 445 | Ga0209233_1000047 | 3300025261 | Bacteria | 459614 |
| 446 | Ga0209233_1000360 | 3300025261 | Bacteria | 41483 |
| 447 | Ga0209233_1002313 | 3300025261 | Bacteria | 7104 |
| 448 | Ga0209233_1007318 | 3300025261 | Bacteria | 3503 |
| 449 | Ga0209455_1003303 | 3300025272 | Bacteria | 5789 |
| 450 | Ga0209455_1008176 | 3300025272 | Bacteria | 2871 |
| 451 | Ga0209455_1009508 | 3300025272 | Bacteria | 2548 |
| 452 | Ga0209673_1000691 | 3300025273 | Bacteria | 48251 |
| 453 | Ga0209673_1005907 | 3300025273 | Bacteria | 6049 |
| 454 | Ga0209673_1007005 | 3300025273 | Bacteria | 5306 |
| 455 | Ga0209673_1026127 | 3300025273 | Bacteria | 1925 |
| 456 | Ga0209673_1027557 | 3300025273 | Bacteria | 1846 |
| 457 | Ga0209673_1038826 | 3300025273 | Bacteria | 1381 |
| 458 | Ga0209130_1000023 | 3300025284 | Bacteria | 359355 |
| 459 | Ga0209130_1000393 | 3300025284 | Bacteria | 47764 |
| 460 | Ga0209130_1001383 | 3300025284 | Bacteria | 16323 |
| 461 | Ga0209675_1000274 | 3300025291 | Bacteria | 49492 |
| 462 | Ga0209675_1001067 | 3300025291 | Bacteria | 16975 |
| 463 | Ga0209675_1005572 | 3300025291 | Bacteria | 5241 |
| 464 | Ga0209676_1001299 | 3300025292 | Bacteria | 25543 |
| 465 | Ga0209676_1007558 | 3300025292 | Bacteria | 5063 |
| 466 | Ga0209676_1011038 | 3300025292 | Bacteria | 3690 |
| 467 | Ga0209676_1053345 | 3300025292 | Bacteria | 1049 |
| 468 | Ga0209025_1000003 | 3300025294 | Bacteria | 1366495 |
| 469 | Ga0209025_1000018 | 3300025294 | Bacteria | 686898 |
| 470 | Ga0209025_1000108 | 3300025294 | Bacteria | 221600 |
| 471 | Ga0209025_1000187 | 3300025294 | Bacteria | 154788 |
| 472 | Ga0209025_1002393 | 3300025294 | Bacteria | 20037 |
| 473 | Ga0209025_1004739 | 3300025294 | Bacteria | 11582 |
| 474 | Ga0209025_1010347 | 3300025294 | Bacteria | 6331 |
| 475 | Ga0209025_1014903 | 3300025294 | Bacteria | 4737 |
| 476 | Ga0209564_1000043 | 3300025295 | Bacteria | 388153 |
| 477 | Ga0209564_1000052 | 3300025295 | Bacteria | 356578 |
| 478 | Ga0209564_1000143 | 3300025295 | Bacteria | 177136 |
| 479 | Ga0209564_1000405 | 3300025295 | Bacteria | 76803 |
| 480 | Ga0209564_1000537 | 3300025295 | Bacteria | 61336 |
| 481 | Ga0209564_1000558 | 3300025295 | Bacteria | 59623 |
| 482 | Ga0209564_1002222 | 3300025295 | Bacteria | 16072 |
| 483 | Ga0209564_1012523 | 3300025295 | Bacteria | 3690 |
| 484 | Ga0209564_1025787 | 3300025295 | Bacteria | 1965 |
| 485 | Ga0209758_1000104 | 3300025297 | Bacteria | 221600 |
| 486 | Ga0209758_1000164 | 3300025297 | Bacteria | 151759 |
| 487 | Ga0209758_1000170 | 3300025297 | Bacteria | 149476 |
| 488 | Ga0209758_1000216 | 3300025297 | Bacteria | 125352 |
| 489 | Ga0209758_1000375 | 3300025297 | Bacteria | 77872 |
| 490 | Ga0209758_1001489 | 3300025297 | Bacteria | 27341 |
| 491 | Ga0209758_1003095 | 3300025297 | Bacteria | 15755 |
| 492 | Ga0209758_1003612 | 3300025297 | Bacteria | 13840 |
| 493 | Ga0209758_1004652 | 3300025297 | Bacteria | 11240 |
| 494 | Ga0209758_1007900 | 3300025297 | Bacteria | 7065 |
| 495 | Ga0209758_1012118 | 3300025297 | Bacteria | 4875 |
| 496 | Ga0209758_1015538 | 3300025297 | Bacteria | 3930 |
| 497 | Ga0209758_1029665 | 3300025297 | Bacteria | 2281 |
| 498 | Ga0209050_1002087 | 3300025298 | Bacteria | 18309 |
| 499 | Ga0209050_1007449 | 3300025298 | Bacteria | 6132 |
| 500 | Ga0209256_1000099 | 3300025299 | Bacteria | 203782 |
| 501 | Ga0209256_1000111 | 3300025299 | Bacteria | 178442 |
| 502 | Ga0209256_1000374 | 3300025299 | Bacteria | 71875 |
| 503 | Ga0209256_1000648 | 3300025299 | Bacteria | 47343 |
| 504 | Ga0209256_1000709 | 3300025299 | Bacteria | 44332 |
| 505 | Ga0209256_1006841 | 3300025299 | Bacteria | 5867 |
| 506 | Ga0209256_1011392 | 3300025299 | Bacteria | 3564 |
| 507 | Ga0209256_1022459 | 3300025299 | Bacteria | 1909 |
| 508 | Ga0207426_1000087 | 3300025302 | Bacteria | 288870 |
| 509 | Ga0207426_1000580 | 3300025302 | Bacteria | 48953 |
| 510 | Ga0207426_1004590 | 3300025302 | Bacteria | 6664 |
| 511 | Ga0207426_1015864 | 3300025302 | Bacteria | 2722 |
| 512 | Ga0209051_1000114 | 3300025303 | Bacteria | 152303 |
| 513 | Ga0209051_1000350 | 3300025303 | Bacteria | 68654 |
| 514 | Ga0209051_1000600 | 3300025303 | Bacteria | 42450 |
| 515 | Ga0209051_1000641 | 3300025303 | Bacteria | 40092 |
| 516 | Ga0209051_1001025 | 3300025303 | Bacteria | 26597 |
| 517 | Ga0209051_1005829 | 3300025303 | Bacteria | 7090 |
| 518 | Ga0209051_1013123 | 3300025303 | Bacteria | 3961 |
| 519 | Ga0209051_1028281 | 3300025303 | Bacteria | 2217 |
| 520 | Ga0209257_1000015 | 3300025304 | Bacteria | 908141 |
| 521 | Ga0209257_1000782 | 3300025304 | Bacteria | 46895 |
| 522 | Ga0209257_1007708 | 3300025304 | Bacteria | 6419 |
| 523 | Ga0209257_1022231 | 3300025304 | Bacteria | 2269 |
| 524 | Ga0207697_10013127 | 3300025315 | Bacteria | 3460 |
| 525 | Ga0207656_10004899 | 3300025321 | Bacteria | 4700 |
| 526 | Ga0207656_10020027 | 3300025321 | Bacteria | 2653 |
| 527 | Ga0207656_10045341 | 3300025321 | Bacteria | 1881 |
| 528 | Ga0207692_10000660 | 3300025898 | Bacteria | 12148 |
| 529 | Ga0207692_10008365 | 3300025898 | Bacteria | 4277 |
| 530 | Ga0207692_10035057 | 3300025898 | Bacteria | 2435 |
| 531 | Ga0207692_10050786 | 3300025898 | Bacteria | 2099 |
| 532 | Ga0207688_10048076 | 3300025901 | Bacteria | 2383 |
| 533 | Ga0207688_10092199 | 3300025901 | Bacteria | 1741 |
| 534 | Ga0207688_10135731 | 3300025901 | Bacteria | 1445 |
| 535 | Ga0207647_10027278 | 3300025904 | Bacteria | 3724 |
| 536 | Ga0207699_10000526 | 3300025906 | Bacteria | 18963 |
| 537 | Ga0207699_10042054 | 3300025906 | Bacteria | 2644 |
| 538 | Ga0207699_10047801 | 3300025906 | Bacteria | 2510 |
| 539 | Ga0207645_10069942 | 3300025907 | Bacteria | 2245 |
| 540 | Ga0207645_10079533 | 3300025907 | Bacteria | 2101 |
| 541 | Ga0207645_10283424 | 3300025907 | Bacteria | 1100 |
| 542 | Ga0207643_10127481 | 3300025908 | Bacteria | 1512 |
| 543 | Ga0207705_10058570 | 3300025909 | Bacteria | 2779 |
| 544 | Ga0207705_10121261 | 3300025909 | Bacteria | 1940 |
| 545 | Ga0207705_10187932 | 3300025909 | Bacteria | 1561 |
| 546 | Ga0207705_10349959 | 3300025909 | Bacteria | 1138 |
| 547 | Ga0207684_10000920 | 3300025910 | Bacteria | 33379 |
| 548 | Ga0207684_10033381 | 3300025910 | Bacteria | 4376 |
| 549 | Ga0207654_10052914 | 3300025911 | Bacteria | 2342 |
| 550 | Ga0207707_10001083 | 3300025912 | Bacteria | 26026 |
| 551 | Ga0207707_10001941 | 3300025912 | Bacteria | 18821 |
| 552 | Ga0207707_10014916 | 3300025912 | Bacteria | 6767 |
| 553 | Ga0207707_10117767 | 3300025912 | Bacteria | 2322 |
| 554 | Ga0207707_10308854 | 3300025912 | Bacteria | 1367 |
| 555 | Ga0207707_10337195 | 3300025912 | Bacteria | 1300 |
| 556 | Ga0207695_10000599 | 3300025913 | Bacteria | 72238 |
| 557 | Ga0207695_10055983 | 3300025913 | Bacteria | 4106 |
| 558 | Ga0207695_10070312 | 3300025913 | Bacteria | 3579 |
| 559 | Ga0207695_10087929 | 3300025913 | Bacteria | 3129 |
| 560 | Ga0207695_10177015 | 3300025913 | Bacteria | 2055 |
| 561 | Ga0207671_10001926 | 3300025914 | Bacteria | 23032 |
| 562 | Ga0207671_10090005 | 3300025914 | Bacteria | 2310 |
| 563 | Ga0207671_10137820 | 3300025914 | Bacteria | 1878 |
| 564 | Ga0207671_10211906 | 3300025914 | Bacteria | 1516 |
| 565 | Ga0207693_10004729 | 3300025915 | Bacteria | 11452 |
| 566 | Ga0207693_10032143 | 3300025915 | Bacteria | 4143 |
| 567 | Ga0207693_10115388 | 3300025915 | Bacteria | 2108 |
| 568 | Ga0207663_10000334 | 3300025916 | Bacteria | 20607 |
| 569 | Ga0207663_10004028 | 3300025916 | Bacteria | 7281 |
| 570 | Ga0207663_10045957 | 3300025916 | Bacteria | 2688 |
| 571 | Ga0207660_10003821 | 3300025917 | Bacteria | 9815 |
| 572 | Ga0207660_10207136 | 3300025917 | Bacteria | 1534 |
| 573 | Ga0207660_10222708 | 3300025917 | Bacteria | 1481 |
| 574 | Ga0207662_10278473 | 3300025918 | Bacteria | 1106 |
| 575 | Ga0207657_10003922 | 3300025919 | Bacteria | 15790 |
| 576 | Ga0207657_10187748 | 3300025919 | Bacteria | 1668 |
| 577 | Ga0207657_10424667 | 3300025919 | Bacteria | 1044 |
| 578 | Ga0207649_10064772 | 3300025920 | Bacteria | 2312 |
| 579 | Ga0207649_10068489 | 3300025920 | Bacteria | 2257 |
| 580 | Ga0207652_10003147 | 3300025921 | Bacteria | 13749 |
| 581 | Ga0207652_10012449 | 3300025921 | Bacteria | 6875 |
| 582 | Ga0207652_10099773 | 3300025921 | Bacteria | 2563 |
| 583 | Ga0207652_10151739 | 3300025921 | Unclassified | 2075 |
| 584 | Ga0207646_10013186 | 3300025922 | Bacteria | 7911 |
| 585 | Ga0207681_10001984 | 3300025923 | Bacteria | 13141 |
| 586 | Ga0207694_10072960 | 3300025924 | Bacteria | 2684 |
| 587 | Ga0207694_10137892 | 3300025924 | Bacteria | 1960 |
| 588 | Ga0207650_10000274 | 3300025925 | Bacteria | 54226 |
| 589 | Ga0207650_10154557 | 3300025925 | Bacteria | 1813 |
| 590 | Ga0207659_10004273 | 3300025926 | Bacteria | 8637 |
| 591 | Ga0207687_10019272 | 3300025927 | Bacteria | 4519 |
| 592 | Ga0207687_10022862 | 3300025927 | Bacteria | 4164 |
| 593 | Ga0207687_10192768 | 3300025927 | Bacteria | 1587 |
| 594 | Ga0207700_10001731 | 3300025928 | Bacteria | 12395 |
| 595 | Ga0207700_10222552 | 3300025928 | Bacteria | 1601 |
| 596 | Ga0207700_10294979 | 3300025928 | Bacteria | 1398 |
| 597 | Ga0207700_10379438 | 3300025928 | Bacteria | 1236 |
| 598 | Ga0207664_10020781 | 3300025929 | Bacteria | 4872 |
| 599 | Ga0207664_10087270 | 3300025929 | Bacteria | 2550 |
| 600 | Ga0207664_10346699 | 3300025929 | Bacteria | 1314 |
| 601 | Ga0207664_10403233 | 3300025929 | Bacteria | 1216 |
| 602 | Ga0207690_10210850 | 3300025932 | Bacteria | 1481 |
| 603 | Ga0207690_10410026 | 3300025932 | Bacteria | 1082 |
| 604 | Ga0207706_10137699 | 3300025933 | Bacteria | 2147 |
| 605 | Ga0207706_10205778 | 3300025933 | Bacteria | 1726 |
| 606 | Ga0207686_10000019 | 3300025934 | Bacteria | 187616 |
| 607 | Ga0207686_10094415 | 3300025934 | Bacteria | 1983 |
| 608 | Ga0207709_10000064 | 3300025935 | Bacteria | 191119 |
| 609 | Ga0207709_10000077 | 3300025935 | Bacteria | 169923 |
| 610 | Ga0207709_10048569 | 3300025935 | Bacteria | 2586 |
| 611 | Ga0207709_10081886 | 3300025935 | Bacteria | 2082 |
| 612 | Ga0207670_10207327 | 3300025936 | Bacteria | 1493 |
| 613 | Ga0207669_10158436 | 3300025937 | Bacteria | 1595 |
| 614 | Ga0207704_10001539 | 3300025938 | Bacteria | 10349 |
| 615 | Ga0207704_10283522 | 3300025938 | Bacteria | 1260 |
| 616 | Ga0207665_10005331 | 3300025939 | Bacteria | 8593 |
| 617 | Ga0207691_10000494 | 3300025940 | Bacteria | 39257 |
| 618 | Ga0207691_10003618 | 3300025940 | Bacteria | 14996 |
| 619 | Ga0207691_10016790 | 3300025940 | Bacteria | 6947 |
| 620 | Ga0207691_10085938 | 3300025940 | Bacteria | 2823 |
| 621 | Ga0207691_10266214 | 3300025940 | Bacteria | 1477 |
| 622 | Ga0207711_10108304 | 3300025941 | Bacteria | 2468 |
| 623 | Ga0207711_10398695 | 3300025941 | Bacteria | 1278 |
| 624 | Ga0207689_10074630 | 3300025942 | Bacteria | 2786 |
| 625 | Ga0207689_10182636 | 3300025942 | Bacteria | 1730 |
| 626 | Ga0207689_10213323 | 3300025942 | Bacteria | 1595 |
| 627 | Ga0207689_10449430 | 3300025942 | Bacteria | 1077 |
| 628 | Ga0207661_10009663 | 3300025944 | Bacteria | 6926 |
| 629 | Ga0207661_10034064 | 3300025944 | Bacteria | 3958 |
| 630 | Ga0207661_10036733 | 3300025944 | Bacteria | 3826 |
| 631 | Ga0207661_10323168 | 3300025944 | Bacteria | 1387 |
| 632 | Ga0207667_10007523 | 3300025949 | Bacteria | 13074 |
| 633 | Ga0207667_10070582 | 3300025949 | Bacteria | 3635 |
| 634 | Ga0207667_10100325 | 3300025949 | Bacteria | 2986 |
| 635 | Ga0207667_10161364 | 3300025949 | Bacteria | 2305 |
| 636 | Ga0207667_10163755 | 3300025949 | Bacteria | 2287 |
| 637 | Ga0207667_10192815 | 3300025949 | Bacteria | 2091 |
| 638 | Ga0207667_10450555 | 3300025949 | Bacteria | 1308 |
| 639 | Ga0207667_10686114 | 3300025949 | Bacteria | 1027 |
| 640 | Ga0207651_10001168 | 3300025960 | Bacteria | 11757 |
| 641 | Ga0207651_10358612 | 3300025960 | Bacteria | 1230 |
| 642 | Ga0207712_10046934 | 3300025961 | Bacteria | 2997 |
| 643 | Ga0207668_10108904 | 3300025972 | Bacteria | 2074 |
| 644 | Ga0207668_10267903 | 3300025972 | Bacteria | 1395 |
| 645 | Ga0207640_10204677 | 3300025981 | Bacteria | 1498 |
| 646 | Ga0207658_10029968 | 3300025986 | Bacteria | 3849 |
| 647 | Ga0207658_10052349 | 3300025986 | Bacteria | 3012 |
| 648 | Ga0207658_10076590 | 3300025986 | Bacteria | 2549 |
| 649 | Ga0207658_10147770 | 3300025986 | Bacteria | 1911 |
| 650 | Ga0207677_10007171 | 3300026023 | Bacteria | 6139 |
| 651 | Ga0207677_10087375 | 3300026023 | Bacteria | 2257 |
| 652 | Ga0207703_10049718 | 3300026035 | Bacteria | 3390 |
| 653 | Ga0207703_10066822 | 3300026035 | Bacteria | 2958 |
| 654 | Ga0207703_10284261 | 3300026035 | Bacteria | 1503 |
| 655 | Ga0207703_10294793 | 3300026035 | Bacteria | 1477 |
| 656 | Ga0207703_10388895 | 3300026035 | Bacteria | 1292 |
| 657 | Ga0207639_10034571 | 3300026041 | Bacteria | 3736 |
| 658 | Ga0207639_10048023 | 3300026041 | Bacteria | 3229 |
| 659 | Ga0207639_10103211 | 3300026041 | Bacteria | 2309 |
| 660 | Ga0207678_10028024 | 3300026067 | Bacteria | 4919 |
| 661 | Ga0207678_10036080 | 3300026067 | Bacteria | 4303 |
| 662 | Ga0207678_10226012 | 3300026067 | Bacteria | 1602 |
| 663 | Ga0207678_10270612 | 3300026067 | Bacteria | 1457 |
| 664 | Ga0207708_10085820 | 3300026075 | Bacteria | 2422 |
| 665 | Ga0207708_10258452 | 3300026075 | Bacteria | 1405 |
| 666 | Ga0207702_10000433 | 3300026078 | Bacteria | 47747 |
| 667 | Ga0207702_10085951 | 3300026078 | Bacteria | 2742 |
| 668 | Ga0207702_10147778 | 3300026078 | Bacteria | 2135 |
| 669 | Ga0207648_10020558 | 3300026089 | Bacteria | 5943 |
| 670 | Ga0207648_10031150 | 3300026089 | Bacteria | 4716 |
| 671 | Ga0207648_10035092 | 3300026089 | Bacteria | 4421 |
| 672 | Ga0207648_10113756 | 3300026089 | Bacteria | 2377 |
| 673 | Ga0207648_10138768 | 3300026089 | Bacteria | 2142 |
| 674 | Ga0207648_10452876 | 3300026089 | Bacteria | 1169 |
| 675 | Ga0207674_10024060 | 3300026116 | Bacteria | 6514 |
| 676 | Ga0207674_10032073 | 3300026116 | Bacteria | 5511 |
| 677 | Ga0207675_100002430 | 3300026118 | Bacteria | 18452 |
| 678 | Ga0207675_100198698 | 3300026118 | Bacteria | 1925 |
| 679 | Ga0207683_10275203 | 3300026121 | Bacteria | 1538 |
| 680 | Ga0207698_10001165 | 3300026142 | Bacteria | 15335 |
| 681 | Ga0207698_10121499 | 3300026142 | Bacteria | 2212 |
| 682 | Ga0207698_10145426 | 3300026142 | Bacteria | 2049 |
| 683 | Ga0207698_10288402 | 3300026142 | Bacteria | 1522 |
| 684 | Ga0209389_1000155 | 3300027296 | Bacteria | 57647 |
| 685 | Ga0209389_1000640 | 3300027296 | Bacteria | 21616 |
| 686 | Ga0209371_1000251 | 3300027312 | Bacteria | 66325 |
| 687 | Ga0209371_1000425 | 3300027312 | Bacteria | 43402 |
| 688 | Ga0209589_1000030 | 3300027357 | Bacteria | 147457 |
| 689 | Ga0209589_1005433 | 3300027357 | Bacteria | 21616 |
| 690 | Ga0209489_100056 | 3300027361 | Bacteria | 147457 |
| 691 | Ga0209489_105575 | 3300027361 | Bacteria | 21616 |
| 692 | Ga0209489_114795 | 3300027361 | Bacteria | 5218 |
| 693 | Ga0209700_100059 | 3300027363 | Bacteria | 147457 |
| 694 | Ga0209700_104170 | 3300027363 | Bacteria | 26475 |
| 695 | Ga0209588_1017461 | 3300027671 | Bacteria | 2225 |
| 696 | Ga0209813_10010901 | 3300027866 | Bacteria | 2363 |
| 697 | Ga0209813_10033520 | 3300027866 | Bacteria | 1527 |
| 698 | Ga0268266_10000988 | 3300028379 | Bacteria | 35821 |
| 699 | Ga0268266_10002854 | 3300028379 | Bacteria | 18005 |
| 700 | Ga0268266_10006878 | 3300028379 | Bacteria | 10351 |
| 701 | Ga0268266_10102980 | 3300028379 | Bacteria | 2519 |
| 702 | Ga0268266_10291164 | 3300028379 | Bacteria | 1521 |
| 703 | Ga0268265_10109639 | 3300028380 | Bacteria | 2250 |
| 704 | Ga0268265_10112099 | 3300028380 | Bacteria | 2229 |
| 705 | Ga0268264_10000245 | 3300028381 | Bacteria | 102529 |
| 706 | Ga0268264_10020744 | 3300028381 | Bacteria | 5369 |
| 707 | Ga0268264_10103682 | 3300028381 | Bacteria | 2477 |
| 708 | Ga0268264_10315132 | 3300028381 | Bacteria | 1477 |
| 709 | Ga0268264_10356976 | 3300028381 | Bacteria | 1393 |
| 710 | Ga0265326_10032338 | 3300028558 | Bacteria | 1489 |
| 711 | Ga0265319_1015385 | 3300028563 | Bacteria | 2969 |
| 712 | Ga0265334_10005352 | 3300028573 | Bacteria | 5605 |
| 713 | Ga0265334_10029191 | 3300028573 | Bacteria | 2212 |
| 714 | Ga0265318_10037845 | 3300028577 | Bacteria | 1846 |
| 715 | Ga0265323_10000916 | 3300028653 | Bacteria | 15563 |
| 716 | Ga0265336_10000298 | 3300028666 | Bacteria | 33834 |
| 717 | Ga0307517_10000125 | 3300028786 | Bacteria | 115466 |
| 718 | Ga0307515_10034944 | 3300028794 | Bacteria | 8200 |
| 719 | Ga0307515_10184653 | 3300028794 | Bacteria | 2020 |
| 720 | Ga0265338_10000131 | 3300028800 | Bacteria | 137627 |
| 721 | Ga0268256_1000475 | 3300030500 | Bacteria | 34521 |
| 722 | Ga0268256_1001004 | 3300030500 | Bacteria | 19148 |
| 723 | Ga0307511_10018563 | 3300030521 | Bacteria | 6637 |
| 724 | Ga0265760_10007459 | 3300031090 | Bacteria | 3124 |
| 725 | Ga0265330_10015078 | 3300031235 | Bacteria | 3579 |
| 726 | Ga0265325_10002689 | 3300031241 | Bacteria | 11892 |
| 727 | Ga0265340_10038625 | 3300031247 | Bacteria | 2360 |
| 728 | Ga0265339_10003134 | 3300031249 | Bacteria | 11644 |
| 729 | Ga0265339_10046241 | 3300031249 | Bacteria | 2394 |
| 730 | Ga0265339_10079522 | 3300031249 | Bacteria | 1735 |
| 731 | Ga0265339_10107197 | 3300031249 | Bacteria | 1449 |
| 732 | Ga0265339_10143280 | 3300031249 | Bacteria | 1214 |
| 733 | Ga0265331_10057805 | 3300031250 | Bacteria | 1838 |
| 734 | Ga0265316_10087509 | 3300031344 | Bacteria | 2380 |
| 735 | Ga0307513_10081546 | 3300031456 | Bacteria | 3333 |
| 736 | Ga0307513_10108571 | 3300031456 | Bacteria | 2775 |
| 737 | Ga0307509_10061588 | 3300031507 | Bacteria | 3959 |
| 738 | Ga0307509_10150315 | 3300031507 | Bacteria | 2245 |
| 739 | Ga0307509_10302912 | 3300031507 | Bacteria | 1345 |
| 740 | Ga0307509_10321450 | 3300031507 | Bacteria | 1284 |
| 741 | Ga0307408_100001144 | 3300031548 | Bacteria | 20165 |
| 742 | Ga0307408_100269328 | 3300031548 | Bacteria | 1413 |
| 743 | Ga0307408_100327522 | 3300031548 | Bacteria | 1292 |
| 744 | Ga0265313_10024533 | 3300031595 | Bacteria | 3219 |
| 745 | Ga0265313_10026971 | 3300031595 | Bacteria | 3015 |
| 746 | Ga0307508_10001153 | 3300031616 | Bacteria | 30369 |
| 747 | Ga0265314_10020390 | 3300031711 | Bacteria | 5117 |
| 748 | Ga0265314_10025270 | 3300031711 | Bacteria | 4485 |
| 749 | Ga0265314_10198913 | 3300031711 | Unclassified | 1186 |
| 750 | Ga0265342_10002981 | 3300031712 | Bacteria | 14213 |
| 751 | Ga0265342_10032697 | 3300031712 | Bacteria | 3206 |
| 752 | Ga0316576_10116137 | 3300031727 | Bacteria | 2008 |
| 753 | Ga0316578_10107579 | 3300031728 | Bacteria | 1674 |
| 754 | Ga0307516_10008305 | 3300031730 | Bacteria | 11768 |
| 755 | Ga0307516_10020167 | 3300031730 | Bacteria | 6894 |
| 756 | Ga0307516_10022528 | 3300031730 | Bacteria | 6466 |
| 757 | Ga0307516_10202268 | 3300031730 | Bacteria | 1705 |
| 758 | Ga0307516_10268774 | 3300031730 | Bacteria | 1392 |
| 759 | Ga0307405_10042455 | 3300031731 | Bacteria | 2768 |
| 760 | Ga0307405_10204202 | 3300031731 | Bacteria | 1438 |
| 761 | Ga0307413_10023153 | 3300031824 | Bacteria | 3362 |
| 762 | Ga0307413_10027937 | 3300031824 | Bacteria | 3134 |
| 763 | Ga0307410_10012854 | 3300031852 | Bacteria | 4860 |
| 764 | Ga0307410_10053148 | 3300031852 | Bacteria | 2740 |
| 765 | Ga0307410_10083034 | 3300031852 | Bacteria | 2255 |
| 766 | Ga0307410_10157424 | 3300031852 | Bacteria | 1698 |
| 767 | Ga0307406_10000141 | 3300031901 | Bacteria | 43017 |
| 768 | Ga0307406_10009687 | 3300031901 | Bacteria | 5417 |
| 769 | Ga0307406_10011607 | 3300031901 | Bacteria | 5004 |
| 770 | Ga0307407_10010347 | 3300031903 | Bacteria | 4394 |
| 771 | Ga0307407_10115289 | 3300031903 | Bacteria | 1694 |
| 772 | Ga0307412_10000563 | 3300031911 | Bacteria | 21947 |
| 773 | Ga0307412_10005563 | 3300031911 | Bacteria | 7074 |
| 774 | Ga0307412_10037202 | 3300031911 | Bacteria | 3125 |
| 775 | Ga0307412_10054934 | 3300031911 | Bacteria | 2646 |
| 776 | Ga0307409_100015688 | 3300031995 | Bacteria | 4982 |
| 777 | Ga0307409_100050870 | 3300031995 | Bacteria | 3167 |
| 778 | Ga0307416_100025154 | 3300032002 | Bacteria | 4360 |
| 779 | Ga0307416_100068001 | 3300032002 | Bacteria | 2941 |
| 780 | Ga0307416_100700864 | 3300032002 | Bacteria | 1102 |
| 781 | Ga0307414_10021590 | 3300032004 | Bacteria | 4045 |
| 782 | Ga0307414_10037909 | 3300032004 | Bacteria | 3232 |
| 783 | Ga0307414_10262379 | 3300032004 | Bacteria | 1442 |
| 784 | Ga0307414_10388290 | 3300032004 | Bacteria | 1209 |
| 785 | Ga0307411_10017180 | 3300032005 | Bacteria | 4113 |
| 786 | Ga0307411_10053380 | 3300032005 | Bacteria | 2648 |
| 787 | Ga0307415_100385468 | 3300032126 | Bacteria | 1192 |
| 788 | Ga0307507_10061386 | 3300033179 | Bacteria | 3500 |
| 789 | Ga0307507_10085665 | 3300033179 | Bacteria | 2739 |
| 790 | Ga0307510_10010190 | 3300033180 | Bacteria | 11174 |
| 791 | Ga0307510_10234916 | 3300033180 | Bacteria | 1333 |
| 792 | Ga0307510_10244496 | 3300033180 | Bacteria | 1286 |
| 793 | Ga0315911_1000009 | 3300033442 | Bacteria | 379354 |
| 794 | Ga0373934_0001668 | 3300035086 | Bacteria | 8155 |
| 795 | Ga0373934_0052699 | 3300035086 | Bacteria | 1614 |
| 796 | Ga0373944_0019024 | 3300035089 | Bacteria | 1967 |
| 797 | Ga0373936_0028477 | 3300035113 | Bacteria | 2196 |
| 798 | Ga0373936_0074852 | 3300035113 | Bacteria | 1401 |
| 799 | Ga0373953_0000108 | 3300035117 | Bacteria | 20124 |
| 800 | Ga0373953_0001849 | 3300035117 | Bacteria | 6262 |
| 801 | Ga0373954_0000085 | 3300035118 | Bacteria | 31872 |
| 802 | Ga0373954_0015553 | 3300035118 | Bacteria | 3401 |
| 803 | Ga0373954_0060946 | 3300035118 | Bacteria | 1780 |
| 804 | Ga0373956_0000272 | 3300035119 | Bacteria | 20783 |
| 805 | Ga0373956_0030598 | 3300035119 | Bacteria | 2354 |
| 806 | Ga0373957_0000129 | 3300035120 | Bacteria | 18551 |
| 807 | Ga0373960_0077538 | 3300035121 | Bacteria | 1040 |
| 808 | Ga0373943_0027519 | 3300035170 | Bacteria | 2672 |
| 809 | Ga0373943_0087956 | 3300035170 | Bacteria | 1604 |
| 810 | Ga0373943_0158659 | 3300035170 | Bacteria | 1230 |
| 811 | Ga0373946_0001563 | 3300035171 | Bacteria | 7976 |
| 812 | Ga0373955_0000288 | 3300035172 | Bacteria | 20919 |
| 813 | Ga0373955_0007868 | 3300035172 | Bacteria | 4917 |
| 814 | Ga0373955_0079671 | 3300035172 | Bacteria | 1848 |
| 815 | Ga0316574_0306155 | 3300035398 | Bacteria | 1010 |
| 816 | Ga0373924_0005705 | 3300035410 | Bacteria | 4419 |
| 817 | Ga0373931_0274666 | 3300035691 | Bacteria | 1033 |
| 818 | Ga0373935_0002679 | 3300035692 | Bacteria | 10244 |
| 819 | Ga0373935_0277441 | 3300035692 | Bacteria | 1179 |
| 820 | Ga0373927_0001471 | 3300035695 | Bacteria | 17726 |
| 821 | Ga0373927_0002486 | 3300035695 | Bacteria | 13456 |
| 822 | Ga0373927_0074697 | 3300035695 | Bacteria | 2194 |
| 823 | Ga0373927_0078916 | 3300035695 | Bacteria | 2132 |
| 824 | Ga0373927_0141375 | 3300035695 | Bacteria | 1574 |
| 825 | Ga0373933_0000059 | 3300035724 | Bacteria | 65716 |
| 826 | Ga0373933_0000913 | 3300035724 | Bacteria | 18054 |
| 827 | Ga0373933_0084955 | 3300035724 | Bacteria | 1945 |
| 828 | Ga0373933_0119667 | 3300035724 | Bacteria | 1648 |
| 829 | Ga0373947_0003788 | 3300035725 | Bacteria | 8912 |
| 830 | Ga0373947_0009239 | 3300035725 | Bacteria | 5666 |
| 831 | Ga0373947_0009876 | 3300035725 | Bacteria | 5480 |
| 832 | Ga0373947_0029949 | 3300035725 | Bacteria | 3195 |
| 833 | Ga0373947_0050555 | 3300035725 | Bacteria | 2500 |
| 834 | Ga0373937_0005718 | 3300036401 | Bacteria | 10679 |
| 835 | Ga0373937_0027472 | 3300036401 | Bacteria | 5146 |
| 836 | Ga0373937_0073857 | 3300036401 | Bacteria | 3146 |
| 837 | Ga0373937_0117322 | 3300036401 | Bacteria | 2479 |
| 838 | Ga0373937_0317447 | 3300036401 | Bacteria | 1474 |
| 839 | Ga0373937_0336467 | 3300036401 | Bacteria | 1429 |
| 840 | Ga0316584_0027739 | 3300036712 | Bacteria | 4169 |
| 841 | Ga0373925_0113006 | 3300037068 | Bacteria | 2100 |
| 842 | Ga0373925_0128671 | 3300037068 | Bacteria | 1972 |
| 843 | Ga0395899_0001144 | 3300037312 | Bacteria | 23503 |
| 844 | Ga0395899_0002482 | 3300037312 | Bacteria | 14968 |
| 845 | Ga0395899_0013792 | 3300037312 | Bacteria | 6177 |
| 846 | Ga0395899_0050258 | 3300037312 | Bacteria | 3096 |
| 847 | Ga0395899_0257482 | 3300037312 | Bacteria | 1195 |
| 848 | Ga0395899_0287338 | 3300037312 | Bacteria | 1117 |
| 849 | Ga0395900_0004339 | 3300037418 | Bacteria | 15044 |
| 850 | Ga0395900_0007142 | 3300037418 | Bacteria | 11572 |
| 851 | Ga0395900_0027248 | 3300037418 | Bacteria | 5851 |
| 852 | Ga0395900_0062423 | 3300037418 | Bacteria | 3830 |
| 853 | Ga0395900_0068312 | 3300037418 | Bacteria | 3652 |
| 854 | Ga0395900_0109149 | 3300037418 | Bacteria | 2842 |
| 855 | Ga0395900_0144131 | 3300037418 | Bacteria | 2437 |
| 856 | Ga0395900_0163053 | 3300037418 | Bacteria | 2273 |
| 857 | Ga0395900_0290808 | 3300037418 | Bacteria | 1623 |
| 858 | Ga0395900_0423143 | 3300037418 | Bacteria | 1292 |
| 859 | Ga0395898_0004409 | 3300037466 | Bacteria | 15400 |
| 860 | Ga0395898_0005265 | 3300037466 | Bacteria | 13987 |
| 861 | Ga0395898_0030072 | 3300037466 | Bacteria | 5439 |
| 862 | Ga0395898_0037146 | 3300037466 | Bacteria | 4834 |
| 863 | Ga0395898_0037278 | 3300037466 | Bacteria | 4824 |
| 864 | Ga0395898_0443330 | 3300037466 | Bacteria | 1237 |
| 865 | Ga0395898_0535317 | 3300037466 | Bacteria | 1113 |
| 866 | Ga0395905_0005945 | 3300037471 | Bacteria | 12364 |
| 867 | Ga0395905_0056296 | 3300037471 | Bacteria | 3679 |
| 868 | Ga0395905_0157417 | 3300037471 | Bacteria | 2136 |
| 869 | Ga0436364_0017639 | 3300037853 | Bacteria | 1305 |
| 870 | Ga0436364_0249115 | 3300037853 | Bacteria | 14135 |
| 871 | Ga0436364_0250721 | 3300037853 | Bacteria | 9532 |
| 872 | Ga0436364_0719526 | 3300037853 | Bacteria | 3689 |
| 873 | Ga0436364_1273230 | 3300037853 | Bacteria | 1465 |
| 874 | Ga0395901_0014750 | 3300038443 | Bacteria | 7942 |
| 875 | Ga0395901_0016140 | 3300038443 | Bacteria | 7606 |
| 876 | Ga0395901_0028762 | 3300038443 | Bacteria | 5717 |
| 877 | Ga0395901_0072555 | 3300038443 | Bacteria | 3589 |
| 878 | Ga0395901_0188466 | 3300038443 | Bacteria | 2163 |
| 879 | Ga0395901_0267726 | 3300038443 | Bacteria | 1778 |
| 880 | Ga0395901_0358708 | 3300038443 | Bacteria | 1503 |
| 881 | Ga0395901_0613777 | 3300038443 | Bacteria | 1095 |
| 882 | Ga0400483_016022 | 3300039062 | Bacteria | 1190 |
| 883 | Ga0400483_132723 | 3300039062 | Bacteria | 9120 |
| 884 | Ga0400483_191502 | 3300039062 | Bacteria | 1289 |
| 885 | Ga0400483_226394 | 3300039062 | Bacteria | 2447 |
| 886 | Ga0400483_244580 | 3300039062 | Bacteria | 6857 |
| 887 | Ga0436365_0356394 | 3300039437 | Bacteria | 1177 |
| 888 | Ga0436365_0656380 | 3300039437 | Bacteria | 1757 |
| 889 | Ga0436365_1507572 | 3300039437 | Bacteria | 1585 |
| 890 | Ga0436360_0872516 | 3300039438 | Bacteria | 5005 |
| 891 | Ga0436361_0736352 | 3300039447 | Bacteria | 2181 |
| 892 | Ga0436361_0898793 | 3300039447 | Bacteria | 17943 |
| 893 | Ga0436361_1018297 | 3300039447 | Bacteria | 1164 |
| 894 | Ga0436363_0628780 | 3300039450 | Bacteria | 1828 |
| 895 | Ga0436363_1138394 | 3300039450 | Bacteria | 9676 |
| 896 | Ga0436362_0372017 | 3300039453 | Bacteria | 1086 |
| 897 | Ga0436362_1134067 | 3300039453 | Bacteria | 12134 |
| 898 | Ga0439466_0028978 | 3300041411 | Bacteria | 1907 |
| 899 | Ga0439465_0000965 | 3300041413 | Bacteria | 9142 |
| 900 | Ga0451791_1031212 | 3300041451 | Bacteria | 1113 |
| 901 | Ga0451795_0239567 | 3300041456 | Bacteria | 1118 |
| 902 | Ga0451807_2348294 | 3300041486 | Bacteria | 1202 |
| 903 | Ga0451853_4020387 | 3300041512 | Bacteria | 1141 |
| 904 | Ga0439442_001123 | 3300042002 | Bacteria | 5340 |
| 905 | Ga0439448_0008188 | 3300042005 | Bacteria | 3055 |
| 906 | Ga0439449_0015407 | 3300042007 | Bacteria | 2873 |
| 907 | Ga0450920_000242 | 3300042122 | Bacteria | 8128 |
| 908 | Ga0450903_000099 | 3300042138 | Bacteria | 18213 |
| 909 | Ga0450907_004183 | 3300042146 | Bacteria | 2500 |
| 910 | Ga0439434_0000853 | 3300042435 | Bacteria | 8795 |
| 911 | Ga0451577_0423127 | 3300042876 | Bacteria | 1209 |
| 912 | Ga0466969_0054525 | 3300044656 | Bacteria | 1958 |
| 913 | Ga0466972_0000156 | 3300044658 | Bacteria | 55040 |
| 914 | Ga0466972_0002340 | 3300044658 | Bacteria | 9337 |
| 915 | Ga0453683_0039263 | 3300044673 | Bacteria | 2975 |
| 916 | Ga0466965_0005513 | 3300044683 | Bacteria | 5705 |
| 917 | Ga0466965_0224212 | 3300044683 | Bacteria | 1002 |
| 918 | Ga0466966_0000726 | 3300044684 | Bacteria | 20952 |
| 919 | Ga0466961_0000568 | 3300044693 | Bacteria | 23491 |
| 920 | Ga0466963_0018028 | 3300044694 | Bacteria | 4406 |
| 921 | Ga0466963_0030469 | 3300044694 | Bacteria | 3482 |
| 922 | Ga0466963_0080911 | 3300044694 | Bacteria | 2200 |
| 923 | Ga0453684_0097814 | 3300044712 | Bacteria | 3601 |
| 924 | Ga0466971_0050003 | 3300044719 | Bacteria | 1881 |
| 925 | Ga0466971_0059768 | 3300044719 | Bacteria | 1722 |
| 926 | Ga0466968_0016076 | 3300044735 | Bacteria | 2975 |
| 927 | Ga0466960_0008725 | 3300044901 | Bacteria | 4159 |
| 928 | Ga0466960_0138920 | 3300044901 | Bacteria | 1289 |
| 929 | Ga0466959_0033944 | 3300045049 | Bacteria | 3775 |
| 930 | Ga0466959_0064143 | 3300045049 | Bacteria | 2667 |
| 931 | Ga0466959_0199311 | 3300045049 | Bacteria | 1394 |
| 932 | Ga0451576_0011400 | 3300045051 | Bacteria | 10104 |
| 933 | Ga0451576_0443228 | 3300045051 | Bacteria | 1363 |
| 934 | Ga0466967_0009784 | 3300045976 | Bacteria | 7147 |
| 935 | Ga0466967_0049840 | 3300045976 | Bacteria | 3665 |
| 936 | Ga0466967_0105800 | 3300045976 | Bacteria | 2578 |
| 937 | Ga0466967_0116005 | 3300045976 | Bacteria | 2467 |
| 938 | Ga0466967_0162412 | 3300045976 | Bacteria | 2098 |
| 939 | Ga0495627_000007 | 3300046453 | Bacteria | 575915 |
| 940 | Ga0495592_0000795 | 3300046454 | Bacteria | 21828 |
| 941 | Ga0495592_0017948 | 3300046454 | Bacteria | 5376 |
| 942 | Ga0495592_0043205 | 3300046454 | Bacteria | 3373 |
| 943 | Ga0495592_0049186 | 3300046454 | Bacteria | 3134 |
| 944 | Ga0495592_0073730 | 3300046454 | Bacteria | 2481 |
| 945 | Ga0495603_0000387 | 3300046455 | Bacteria | 24105 |
| 946 | Ga0495603_0016135 | 3300046455 | Bacteria | 4516 |
| 947 | Ga0495603_0040158 | 3300046455 | Bacteria | 2801 |
| 948 | Ga0495603_0067622 | 3300046455 | Bacteria | 2103 |
| 949 | Ga0495603_0109321 | 3300046455 | Bacteria | 1613 |
| 950 | Ga0495591_003223 | 3300046458 | Bacteria | 8588 |
| 951 | Ga0495629_0000582 | 3300046459 | Bacteria | 29684 |
| 952 | Ga0495629_0001668 | 3300046459 | Bacteria | 17432 |
| 953 | Ga0495629_0004581 | 3300046459 | Bacteria | 10343 |
| 954 | Ga0495629_0109406 | 3300046459 | Bacteria | 1927 |
| 955 | Ga0495638_0000632 | 3300046460 | Bacteria | 38873 |
| 956 | Ga0495638_0021945 | 3300046460 | Bacteria | 4196 |
| 957 | Ga0495638_0031663 | 3300046460 | Bacteria | 3397 |
| 958 | Ga0495638_0172847 | 3300046460 | Bacteria | 1238 |
| 959 | Ga0495641_0010227 | 3300046461 | Bacteria | 5462 |
| 960 | Ga0495641_0042318 | 3300046461 | Bacteria | 2112 |
| 961 | Ga0495651_0002961 | 3300046462 | Bacteria | 13121 |
| 962 | Ga0495651_0004548 | 3300046462 | Bacteria | 10603 |
| 963 | Ga0495651_0013772 | 3300046462 | Bacteria | 6253 |
| 964 | Ga0495651_0151312 | 3300046462 | Bacteria | 1672 |
| 965 | Ga0495651_0155481 | 3300046462 | Bacteria | 1644 |
| 966 | Ga0495653_0002685 | 3300046463 | Bacteria | 14171 |
| 967 | Ga0495653_0050466 | 3300046463 | Bacteria | 3200 |
| 968 | Ga0495653_0082672 | 3300046463 | Bacteria | 2370 |
| 969 | Ga0495650_0001505 | 3300046471 | Bacteria | 22211 |
| 970 | Ga0495650_0006708 | 3300046471 | Bacteria | 7128 |
| 971 | Ga0495650_0078515 | 3300046471 | Bacteria | 1278 |
| 972 | Ga0495580_0001175 | 3300046472 | Bacteria | 23040 |
| 973 | Ga0495580_0037235 | 3300046472 | Bacteria | 3492 |
| 974 | Ga0495580_0121050 | 3300046472 | Bacteria | 1817 |
| 975 | Ga0495582_0005799 | 3300046473 | Bacteria | 6880 |
| 976 | Ga0495582_0005882 | 3300046473 | Bacteria | 6835 |
| 977 | Ga0495582_0062261 | 3300046473 | Bacteria | 2061 |
| 978 | Ga0495605_0000658 | 3300046474 | Bacteria | 26313 |
| 979 | Ga0495605_0043068 | 3300046474 | Bacteria | 2240 |
| 980 | Ga0495639_0000739 | 3300046475 | Bacteria | 14934 |
| 981 | Ga0495662_0000148 | 3300046476 | Bacteria | 27496 |
| 982 | Ga0495662_0020563 | 3300046476 | Bacteria | 3194 |
| 983 | Ga0495664_0014537 | 3300046477 | Bacteria | 4464 |
| 984 | Ga0495664_0042937 | 3300046477 | Bacteria | 2679 |
| 985 | Ga0495664_0054520 | 3300046477 | Bacteria | 2377 |
| 986 | Ga0495585_0016215 | 3300046492 | Bacteria | 4317 |
| 987 | Ga0495594_0000312 | 3300046499 | Bacteria | 23910 |
| 988 | Ga0495594_0090319 | 3300046499 | Bacteria | 1716 |
| 989 | Ga0495594_0154240 | 3300046499 | Bacteria | 1304 |
| 990 | Ga0495596_0003637 | 3300046500 | Bacteria | 7745 |
| 991 | Ga0495596_0066393 | 3300046500 | Bacteria | 1403 |
| 992 | Ga0495607_0000024 | 3300046501 | Bacteria | 159904 |
| 993 | Ga0495607_0005882 | 3300046501 | Bacteria | 8714 |
| 994 | Ga0495607_0064859 | 3300046501 | Bacteria | 2061 |
| 995 | Ga0495607_0080348 | 3300046501 | Unclassified | 1793 |
| 996 | Ga0495606_0004206 | 3300046507 | Bacteria | 14566 |
| 997 | Ga0495606_0012913 | 3300046507 | Bacteria | 6647 |
| 998 | Ga0495606_0035300 | 3300046507 | Bacteria | 3419 |
| 999 | Ga0495606_0096906 | 3300046507 | Bacteria | 1803 |
| 1000 | Ga0495606_0130004 | 3300046507 | Bacteria | 1498 |
| 1001 | Ga0495606_0161826 | 3300046507 | Bacteria | 1305 |
| 1002 | Ga0495608_0000569 | 3300046511 | Bacteria | 25372 |
| 1003 | Ga0495608_0001782 | 3300046511 | Bacteria | 15382 |
| 1004 | Ga0495608_0024234 | 3300046511 | Bacteria | 4151 |
| 1005 | Ga0495608_0030766 | 3300046511 | Bacteria | 3632 |
| 1006 | Ga0495608_0145227 | 3300046511 | Bacteria | 1513 |
| 1007 | Ga0495610_0009082 | 3300046512 | Bacteria | 6335 |
| 1008 | Ga0495610_0020992 | 3300046512 | Bacteria | 3604 |
| 1009 | Ga0495610_0021886 | 3300046512 | Bacteria | 3508 |
| 1010 | Ga0495610_0031592 | 3300046512 | Bacteria | 2761 |
| 1011 | Ga0495610_0076902 | 3300046512 | Bacteria | 1543 |
| 1012 | Ga0495616_0003258 | 3300046513 | Bacteria | 10438 |
| 1013 | Ga0495616_0011852 | 3300046513 | Bacteria | 4969 |
| 1014 | Ga0495616_0055101 | 3300046513 | Bacteria | 1970 |
| 1015 | Ga0495618_0015858 | 3300046514 | Bacteria | 4599 |
| 1016 | Ga0495618_0047475 | 3300046514 | Bacteria | 2710 |
| 1017 | Ga0495618_0069671 | 3300046514 | Bacteria | 2236 |
| 1018 | Ga0495618_0111286 | 3300046514 | Bacteria | 1753 |
| 1019 | Ga0495620_0025454 | 3300046515 | Bacteria | 2799 |
| 1020 | Ga0495620_0026177 | 3300046515 | Bacteria | 2746 |
| 1021 | Ga0495628_0000179 | 3300046516 | Bacteria | 55815 |
| 1022 | Ga0495628_0010360 | 3300046516 | Bacteria | 7926 |
| 1023 | Ga0495628_0028278 | 3300046516 | Bacteria | 4556 |
| 1024 | Ga0495628_0038197 | 3300046516 | Bacteria | 3844 |
| 1025 | Ga0495628_0078122 | 3300046516 | Bacteria | 2574 |
| 1026 | Ga0495628_0091601 | 3300046516 | Bacteria | 2353 |
| 1027 | Ga0495630_0021991 | 3300046517 | Bacteria | 4711 |
| 1028 | Ga0495630_0028578 | 3300046517 | Bacteria | 4143 |
| 1029 | Ga0495630_0048283 | 3300046517 | Bacteria | 3185 |
| 1030 | Ga0495630_0151306 | 3300046517 | Bacteria | 1765 |
| 1031 | Ga0495631_0064306 | 3300046518 | Bacteria | 1588 |
| 1032 | Ga0495632_0000078 | 3300046519 | Bacteria | 100643 |
| 1033 | Ga0495632_0000392 | 3300046519 | Bacteria | 41102 |
| 1034 | Ga0495632_0101151 | 3300046519 | Bacteria | 1358 |
| 1035 | Ga0495637_0000279 | 3300046520 | Bacteria | 40327 |
| 1036 | Ga0495637_0082309 | 3300046520 | Bacteria | 1282 |
| 1037 | Ga0495643_0000757 | 3300046522 | Bacteria | 36364 |
| 1038 | Ga0495643_0031491 | 3300046522 | Bacteria | 2951 |
| 1039 | Ga0495643_0039945 | 3300046522 | Bacteria | 2564 |
| 1040 | Ga0495643_0048366 | 3300046522 | Bacteria | 2299 |
| 1041 | Ga0495643_0057135 | 3300046522 | Bacteria | 2080 |
| 1042 | Ga0495643_0081349 | 3300046522 | Bacteria | 1684 |
| 1043 | Ga0495643_0092256 | 3300046522 | Bacteria | 1561 |
| 1044 | Ga0495648_0000855 | 3300046524 | Bacteria | 32117 |
| 1045 | Ga0495648_0001231 | 3300046524 | Bacteria | 25613 |
| 1046 | Ga0495648_0004816 | 3300046524 | Bacteria | 11388 |
| 1047 | Ga0495648_0007196 | 3300046524 | Bacteria | 8941 |
| 1048 | Ga0495648_0017191 | 3300046524 | Bacteria | 5180 |
| 1049 | Ga0495648_0022316 | 3300046524 | Bacteria | 4361 |
| 1050 | Ga0495648_0068816 | 3300046524 | Bacteria | 2063 |
| 1051 | Ga0495648_0092062 | 3300046524 | Bacteria | 1694 |
| 1052 | Ga0495648_0093130 | 3300046524 | Bacteria | 1681 |
| 1053 | Ga0495666_0003127 | 3300046526 | Bacteria | 8320 |
| 1054 | Ga0495666_0003603 | 3300046526 | Bacteria | 7826 |
| 1055 | Ga0495642_0060718 | 3300046528 | Bacteria | 1568 |
| 1056 | Ga0495652_0002837 | 3300046529 | Bacteria | 17453 |
| 1057 | Ga0495652_0003775 | 3300046529 | Bacteria | 14784 |
| 1058 | Ga0495652_0030800 | 3300046529 | Bacteria | 4702 |
| 1059 | Ga0495652_0142277 | 3300046529 | Bacteria | 1885 |
| 1060 | Ga0495654_0000152 | 3300046530 | Bacteria | 70943 |
| 1061 | Ga0495654_0010946 | 3300046530 | Bacteria | 4928 |
| 1062 | Ga0495665_0000248 | 3300046531 | Bacteria | 27116 |
| 1063 | Ga0495665_0019828 | 3300046531 | Bacteria | 3616 |
| 1064 | Ga0495665_0081361 | 3300046531 | Bacteria | 1703 |
| 1065 | Ga0495665_0131765 | 3300046531 | Bacteria | 1308 |
| 1066 | Ga0495640_0004111 | 3300046533 | Bacteria | 11641 |
| 1067 | Ga0495640_0011322 | 3300046533 | Bacteria | 6868 |
| 1068 | Ga0495640_0052202 | 3300046533 | Bacteria | 2809 |
| 1069 | Ga0495640_0052535 | 3300046533 | Bacteria | 2798 |
| 1070 | Ga0495640_0075248 | 3300046533 | Bacteria | 2255 |
| 1071 | Ga0495640_0204190 | 3300046533 | Bacteria | 1251 |
| 1072 | Ga0495587_0001588 | 3300046536 | Bacteria | 15129 |
| 1073 | Ga0495587_0007583 | 3300046536 | Bacteria | 7020 |
| 1074 | Ga0495587_0017552 | 3300046536 | Bacteria | 4445 |
| 1075 | Ga0495587_0034998 | 3300046536 | Bacteria | 3026 |
| 1076 | Ga0495587_0140324 | 3300046536 | Bacteria | 1379 |
| 1077 | Ga0495587_0144334 | 3300046536 | Bacteria | 1357 |
| 1078 | Ga0495609_0000055 | 3300046538 | Bacteria | 146808 |
| 1079 | Ga0495609_0034031 | 3300046538 | Bacteria | 2311 |
| 1080 | Ga0495609_0076648 | 3300046538 | Bacteria | 1465 |
| 1081 | Ga0495621_0008537 | 3300046539 | Bacteria | 3077 |
| 1082 | Ga0495597_0000067 | 3300046542 | Bacteria | 90183 |
| 1083 | Ga0495645_0016916 | 3300046543 | Bacteria | 5219 |
| 1084 | Ga0495645_0073011 | 3300046543 | Bacteria | 2472 |
| 1085 | Ga0495622_0002046 | 3300046557 | Bacteria | 9854 |
| 1086 | Ga0495633_0024938 | 3300046558 | Bacteria | 2950 |
| 1087 | Ga0495633_0051932 | 3300046558 | Bacteria | 1931 |
| 1088 | Ga0495667_0000128 | 3300046559 | Bacteria | 54804 |
| 1089 | Ga0495667_0012503 | 3300046559 | Bacteria | 5756 |
| 1090 | Ga0495667_0075699 | 3300046559 | Bacteria | 2190 |
| 1091 | Ga0495667_0089013 | 3300046559 | Bacteria | 2001 |
| 1092 | Ga0495656_0015749 | 3300046615 | Bacteria | 2860 |
| 1093 | Ga0495656_0039529 | 3300046615 | Bacteria | 1960 |
| 1094 | Ga0495656_0085056 | 3300046615 | Bacteria | 1435 |
| 1095 | Ga0495656_0176301 | 3300046615 | Bacteria | 1048 |
| 1096 | Ga0495668_0062032 | 3300046616 | Bacteria | 2060 |
| 1097 | Ga0495634_0023145 | 3300046642 | Bacteria | 4369 |
| 1098 | Ga0495634_0025613 | 3300046642 | Bacteria | 4122 |
| 1099 | Ga0495634_0173839 | 3300046642 | Bacteria | 1352 |
| 1100 | Ga0495625_0003310 | 3300046660 | Bacteria | 16253 |
| 1101 | Ga0495625_0233903 | 3300046660 | Bacteria | 1199 |
| 1102 | Ga0495635_0001128 | 3300046663 | Bacteria | 17791 |
| 1103 | Ga0495635_0006917 | 3300046663 | Bacteria | 7923 |
| 1104 | Ga0495635_0008480 | 3300046663 | Bacteria | 7178 |
| 1105 | Ga0495635_0105169 | 3300046663 | Bacteria | 1928 |
| 1106 | Ga0495635_0124386 | 3300046663 | Bacteria | 1759 |
| 1107 | Ga0495635_0437632 | 3300046663 | Bacteria | 865 |
| 1108 | Ga0495659_0030392 | 3300046664 | Bacteria | 1880 |
| 1109 | Ga0495661_0004742 | 3300046665 | Bacteria | 9766 |
| 1110 | Ga0495661_0029524 | 3300046665 | Bacteria | 3498 |
| 1111 | Ga0495661_0070878 | 3300046665 | Bacteria | 2038 |
| 1112 | Ga0495661_0098104 | 3300046665 | Bacteria | 1654 |
| 1113 | Ga0495661_0121186 | 3300046665 | Bacteria | 1445 |
| 1114 | Ga0495588_0004100 | 3300046674 | Bacteria | 6412 |
| 1115 | Ga0495588_0034945 | 3300046674 | Bacteria | 2545 |
| 1116 | Ga0495588_0100939 | 3300046674 | Bacteria | 1516 |
| 1117 | Ga0495657_0003126 | 3300046675 | Bacteria | 13671 |
| 1118 | Ga0495657_0019735 | 3300046675 | Bacteria | 4859 |
| 1119 | Ga0495599_0002733 | 3300046678 | Bacteria | 10293 |
| 1120 | Ga0495599_0007297 | 3300046678 | Bacteria | 6695 |
| 1121 | Ga0495599_0010870 | 3300046678 | Bacteria | 5579 |
| 1122 | Ga0495599_0181872 | 3300046678 | Bacteria | 1295 |
| 1123 | Ga0495623_0006786 | 3300046679 | Bacteria | 7448 |
| 1124 | Ga0495623_0017410 | 3300046679 | Bacteria | 4643 |
| 1125 | Ga0495623_0022836 | 3300046679 | Bacteria | 4039 |
| 1126 | Ga0495623_0098492 | 3300046679 | Bacteria | 1784 |
| 1127 | Ga0495623_0168690 | 3300046679 | Bacteria | 1280 |
| 1128 | Ga0495646_0000412 | 3300046680 | Bacteria | 22576 |
| 1129 | Ga0495646_0014066 | 3300046680 | Bacteria | 5088 |
| 1130 | Ga0495646_0022116 | 3300046680 | Bacteria | 4013 |
| 1131 | Ga0495646_0036082 | 3300046680 | Bacteria | 3065 |
| 1132 | Ga0495646_0046613 | 3300046680 | Bacteria | 2642 |
| 1133 | Ga0495646_0205430 | 3300046680 | Bacteria | 1071 |
| 1134 | Ga0495647_0000541 | 3300046681 | Bacteria | 11104 |
| 1135 | Ga0495647_0053660 | 3300046681 | Bacteria | 1573 |
| 1136 | Ga0495658_0002607 | 3300046683 | Bacteria | 9063 |
| 1137 | Ga0495613_0062657 | 3300046689 | Bacteria | 2721 |
| 1138 | Ga0495613_0195181 | 3300046689 | Bacteria | 1429 |
| 1139 | Ga0495613_0231293 | 3300046689 | Bacteria | 1295 |
| 1140 | Ga0495624_0001790 | 3300046690 | Bacteria | 16446 |
| 1141 | Ga0495624_0009857 | 3300046690 | Bacteria | 6605 |
| 1142 | Ga0495624_0034248 | 3300046690 | Bacteria | 3286 |
| 1143 | Ga0495624_0102532 | 3300046690 | Bacteria | 1761 |
| 1144 | Ga0495670_0000775 | 3300046691 | Bacteria | 15311 |
| 1145 | Ga0495670_0003510 | 3300046691 | Bacteria | 7696 |
| 1146 | Ga0495671_0007355 | 3300046692 | Bacteria | 6285 |
| 1147 | Ga0495671_0089719 | 3300046692 | Bacteria | 1505 |
| 1148 | Ga0495649_0031993 | 3300046694 | Bacteria | 2900 |
| 1149 | Ga0495649_0100456 | 3300046694 | Bacteria | 1538 |
| 1150 | Ga0495649_0109360 | 3300046694 | Bacteria | 1466 |
| 1151 | Ga0495600_0000630 | 3300046809 | Bacteria | 18197 |
| 1152 | Ga0495600_0001270 | 3300046809 | Bacteria | 13925 |
| 1153 | Ga0495600_0005826 | 3300046809 | Bacteria | 7449 |
| 1154 | Ga0495600_0078397 | 3300046809 | Bacteria | 2157 |
| 1155 | Ga0495660_0000639 | 3300046810 | Bacteria | 27219 |
| 1156 | Ga0495660_0005079 | 3300046810 | Bacteria | 7907 |
| 1157 | Ga0495660_0055865 | 3300046810 | Bacteria | 2136 |
| 1158 | Ga0495581_0001004 | 3300047315 | Bacteria | 15232 |
| 1159 | Ga0495581_0028284 | 3300047315 | Bacteria | 3250 |
| 1160 | Ga0495581_0029693 | 3300047315 | Bacteria | 3168 |
| 1161 | Ga0495604_0003361 | 3300047317 | Bacteria | 12760 |
| 1162 | Ga0495604_0007172 | 3300047317 | Bacteria | 8829 |
| 1163 | Ga0495604_0015742 | 3300047317 | Bacteria | 6036 |
| 1164 | Ga0495604_0023467 | 3300047317 | Bacteria | 4921 |
| 1165 | Ga0495604_0033682 | 3300047317 | Bacteria | 4054 |
| 1166 | Ga0495604_0041977 | 3300047317 | Bacteria | 3586 |
| 1167 | Ga0495604_0051018 | 3300047317 | Bacteria | 3210 |
| 1168 | Ga0495604_0193677 | 3300047317 | Bacteria | 1415 |
| 1169 | Ga0495636_0017842 | 3300047318 | Bacteria | 2843 |
| 1170 | Ga0495674_0002207 | 3300047319 | Bacteria | 19142 |
| 1171 | Ga0495674_0010840 | 3300047319 | Bacteria | 8620 |
| 1172 | Ga0495674_0011690 | 3300047319 | Bacteria | 8282 |
| 1173 | Ga0495674_0026886 | 3300047319 | Bacteria | 5263 |
| 1174 | Ga0495674_0029042 | 3300047319 | Bacteria | 5037 |
| 1175 | Ga0495674_0081886 | 3300047319 | Bacteria | 2768 |
| 1176 | Ga0495672_0002625 | 3300047320 | Bacteria | 16239 |
| 1177 | Ga0495672_0011801 | 3300047320 | Bacteria | 6138 |
| 1178 | Ga0495672_0045229 | 3300047320 | Bacteria | 2636 |
| 1179 | Ga0495672_0065297 | 3300047320 | Bacteria | 2081 |
| 1180 | Ga0495672_0151782 | 3300047320 | Bacteria | 1201 |
| 1181 | Ga0495676_0036490 | 3300047321 | Bacteria | 4104 |
| 1182 | Ga0495676_0045710 | 3300047321 | Bacteria | 3561 |
| 1183 | Ga0495676_0090598 | 3300047321 | Bacteria | 2288 |
| 1184 | Ga0495680_0000424 | 3300047322 | Bacteria | 47310 |
| 1185 | Ga0495680_0001973 | 3300047322 | Bacteria | 21554 |
| 1186 | Ga0495680_0016955 | 3300047322 | Bacteria | 6238 |
| 1187 | Ga0495680_0030826 | 3300047322 | Bacteria | 4372 |
| 1188 | Ga0495680_0108550 | 3300047322 | Bacteria | 2059 |
| 1189 | Ga0495683_0005297 | 3300047323 | Bacteria | 7166 |
| 1190 | Ga0495683_0062512 | 3300047323 | Bacteria | 1842 |
| 1191 | Ga0495687_008477 | 3300047443 | Bacteria | 5881 |
| 1192 | Ga0495675_0000012 | 3300047444 | Bacteria | 146748 |
| 1193 | Ga0495675_0000345 | 3300047444 | Bacteria | 32608 |
| 1194 | Ga0495675_0004966 | 3300047444 | Bacteria | 8098 |
| 1195 | Ga0495675_0097120 | 3300047444 | Bacteria | 1846 |
| 1196 | Ga0495679_007570 | 3300047446 | Bacteria | 4512 |
| 1197 | Ga0495679_012872 | 3300047446 | Bacteria | 3164 |
| 1198 | Ga0495679_030186 | 3300047446 | Bacteria | 1762 |
| 1199 | Ga0495673_0000530 | 3300047469 | Bacteria | 39656 |
| 1200 | Ga0495673_0014011 | 3300047469 | Bacteria | 4185 |
| 1201 | Ga0495673_0036088 | 3300047469 | Bacteria | 2271 |
| 1202 | Ga0495681_0000443 | 3300047470 | Bacteria | 31697 |
| 1203 | Ga0495681_0005328 | 3300047470 | Bacteria | 8630 |
| 1204 | Ga0495681_0061535 | 3300047470 | Bacteria | 1729 |
| 1205 | Ga0495684_0000152 | 3300047471 | Bacteria | 51013 |
| 1206 | Ga0495684_0000650 | 3300047471 | Bacteria | 27935 |
| 1207 | Ga0495684_0023995 | 3300047471 | Bacteria | 4692 |
| 1208 | Ga0495684_0026007 | 3300047471 | Bacteria | 4498 |
| 1209 | Ga0495684_0071430 | 3300047471 | Bacteria | 2638 |
| 1210 | Ga0495684_0227102 | 3300047471 | Bacteria | 1366 |
| 1211 | Ga0495686_0010693 | 3300047472 | Bacteria | 6515 |
| 1212 | Ga0495686_0018987 | 3300047472 | Bacteria | 4600 |
| 1213 | Ga0495686_0027943 | 3300047472 | Bacteria | 3677 |
| 1214 | Ga0495686_0073951 | 3300047472 | Bacteria | 2092 |
| 1215 | Ga0495593_0000312 | 3300047673 | Bacteria | 26693 |
| 1216 | Ga0495593_0058804 | 3300047673 | Bacteria | 2015 |
| 1217 | Ga0495602_0003796 | 3300048088 | Bacteria | 15712 |
| 1218 | Ga0495602_0005890 | 3300048088 | Bacteria | 12875 |
| 1219 | Ga0495602_0010425 | 3300048088 | Bacteria | 9646 |
| 1220 | Ga0495602_0040539 | 3300048088 | Bacteria | 4267 |
| 1221 | Ga0495602_0059530 | 3300048088 | Bacteria | 3333 |
| 1222 | Ga0495602_0064539 | 3300048088 | Bacteria | 3165 |
| 1223 | Ga0495602_0081111 | 3300048088 | Bacteria | 2729 |
| 1224 | Ga0495614_0002892 | 3300048089 | Bacteria | 7646 |
| 1225 | Ga0495614_0041269 | 3300048089 | Bacteria | 1979 |
| 1226 | Ga0495626_0000412 | 3300048091 | Bacteria | 43929 |
| 1227 | Ga0496100_0044702 | 3300048903 | Bacteria | 2838 |
| 1228 | Ga0496100_0099648 | 3300048903 | Bacteria | 2000 |
| 1229 | Ga0496100_0147242 | 3300048903 | Bacteria | 1676 |
| 1230 | Ga0496100_0178180 | 3300048903 | Bacteria | 1536 |
| 1231 | Ga0496101_0002458 | 3300048904 | Bacteria | 11379 |
| 1232 | Ga0496101_0062275 | 3300048904 | Bacteria | 2712 |
| 1233 | Ga0496101_0300851 | 3300048904 | Bacteria | 1256 |
| 1234 | Ga0496101_0325577 | 3300048904 | Bacteria | 1206 |
| 1235 | Ga0496101_0392766 | 3300048904 | Bacteria | 1092 |
| 1236 | Ga0496102_0007740 | 3300048905 | Bacteria | 9181 |
| 1237 | Ga0496102_0058983 | 3300048905 | Bacteria | 3508 |
| 1238 | Ga0496102_0069817 | 3300048905 | Bacteria | 3225 |
| 1239 | Ga0496102_0229272 | 3300048905 | Bacteria | 1751 |
| 1240 | Ga0496103_0097643 | 3300048906 | Bacteria | 1857 |
| 1241 | Ga0496103_0171094 | 3300048906 | Bacteria | 1395 |
| 1242 | Ga0496103_0184669 | 3300048906 | Bacteria | 1340 |
| 1243 | Ga0496103_0209957 | 3300048906 | Bacteria | 1252 |
| 1244 | Ga0496104_0001994 | 3300048907 | Bacteria | 17714 |
| 1245 | Ga0496104_0075355 | 3300048907 | Bacteria | 3212 |
| 1246 | Ga0496104_0077974 | 3300048907 | Bacteria | 3157 |
| 1247 | Ga0496104_0137566 | 3300048907 | Bacteria | 2346 |
| 1248 | Ga0496104_0284182 | 3300048907 | Bacteria | 1567 |
| 1249 | Ga0496104_0365080 | 3300048907 | Bacteria | 1356 |
| 1250 | Ga0496105_0001254 | 3300048908 | Bacteria | 17716 |
| 1251 | Ga0496105_0002533 | 3300048908 | Bacteria | 13261 |
| 1252 | Ga0496105_0043339 | 3300048908 | Bacteria | 3711 |
| 1253 | Ga0496105_0100971 | 3300048908 | Bacteria | 2382 |
| 1254 | Ga0496105_0119133 | 3300048908 | Bacteria | 2177 |
| 1255 | Ga0496105_0224771 | 3300048908 | Bacteria | 1527 |
| 1256 | Ga0496105_0310946 | 3300048908 | Unclassified | 1265 |
| 1257 | Ga0496106_0000001 | 3300048909 | Bacteria | 497458 |
| 1258 | Ga0496106_0001555 | 3300048909 | Bacteria | 17284 |
| 1259 | Ga0496106_0002423 | 3300048909 | Bacteria | 13907 |
| 1260 | Ga0496106_0093536 | 3300048909 | Bacteria | 2323 |
| 1261 | Ga0496107_0126110 | 3300048910 | Bacteria | 1888 |
| 1262 | Ga0496107_0147709 | 3300048910 | Bacteria | 1738 |
| 1263 | Ga0496108_0001200 | 3300048911 | Bacteria | 20310 |
| 1264 | Ga0496108_0007201 | 3300048911 | Bacteria | 9016 |
| 1265 | Ga0496108_0082301 | 3300048911 | Bacteria | 2729 |
| 1266 | Ga0496108_0175535 | 3300048911 | Bacteria | 1855 |
| 1267 | Ga0496109_0017496 | 3300048912 | Bacteria | 6284 |
| 1268 | Ga0496109_0077295 | 3300048912 | Bacteria | 3063 |
| 1269 | Ga0496109_0116944 | 3300048912 | Bacteria | 2481 |
| 1270 | Ga0496109_0202773 | 3300048912 | Bacteria | 1865 |
| 1271 | Ga0496110_0006609 | 3300048913 | Bacteria | 9210 |
| 1272 | Ga0496110_0016649 | 3300048913 | Bacteria | 6141 |
| 1273 | Ga0496110_0017235 | 3300048913 | Bacteria | 6041 |
| 1274 | Ga0496110_0124895 | 3300048913 | Bacteria | 2321 |
| 1275 | Ga0496110_0203472 | 3300048913 | Bacteria | 1799 |
| 1276 | Ga0496110_0204316 | 3300048913 | Bacteria | 1795 |
| 1277 | Ga0496110_0251259 | 3300048913 | Bacteria | 1609 |
| 1278 | Ga0496111_0001890 | 3300048914 | Bacteria | 12398 |
| 1279 | Ga0496111_0056382 | 3300048914 | Bacteria | 2843 |
| 1280 | Ga0496111_0246191 | 3300048914 | Bacteria | 1327 |
| 1281 | Ga0496112_0000004 | 3300048915 | Bacteria | 553294 |
| 1282 | Ga0496112_0001865 | 3300048915 | Bacteria | 16603 |
| 1283 | Ga0496112_0004442 | 3300048915 | Bacteria | 11884 |
| 1284 | Ga0496112_0017703 | 3300048915 | Bacteria | 6704 |
| 1285 | Ga0496112_0045152 | 3300048915 | Bacteria | 4319 |
| 1286 | Ga0496112_0067255 | 3300048915 | Bacteria | 3536 |
| 1287 | Ga0496112_0127936 | 3300048915 | Bacteria | 2511 |
| 1288 | Ga0496112_0130508 | 3300048915 | Bacteria | 2484 |
| 1289 | Ga0496112_0146867 | 3300048915 | Bacteria | 2326 |
| 1290 | Ga0496112_0401379 | 3300048915 | Bacteria | 1311 |
| 1291 | Ga0496113_0000167 | 3300048916 | Bacteria | 29216 |
| 1292 | Ga0496113_0137186 | 3300048916 | Bacteria | 1923 |
| 1293 | Ga0496113_0180894 | 3300048916 | Bacteria | 1671 |
| 1294 | Ga0496114_0028876 | 3300048917 | Bacteria | 4556 |
| 1295 | Ga0496115_0007883 | 3300048918 | Bacteria | 7857 |
| 1296 | Ga0496115_0044765 | 3300048918 | Bacteria | 3532 |
| 1297 | Ga0496115_0065352 | 3300048918 | Bacteria | 2938 |
| 1298 | Ga0496115_0092659 | 3300048918 | Bacteria | 2470 |
| 1299 | Ga0496115_0438548 | 3300048918 | Bacteria | 1056 |
| 1300 | Ga0496116_0000583 | 3300048919 | Bacteria | 48822 |
| 1301 | Ga0496116_0002160 | 3300048919 | Bacteria | 20948 |
| 1302 | Ga0496116_0012189 | 3300048919 | Bacteria | 7034 |
| 1303 | Ga0496116_0031220 | 3300048919 | Bacteria | 3818 |
| 1304 | Ga0496116_0051150 | 3300048919 | Bacteria | 2746 |
| 1305 | Ga0496116_0078209 | 3300048919 | Bacteria | 2064 |
| 1306 | Ga0496116_0095280 | 3300048919 | Bacteria | 1797 |
| 1307 | Ga0496116_0097437 | 3300048919 | Bacteria | 1768 |
| 1308 | Ga0496116_0132979 | 3300048919 | Bacteria | 1414 |
| 1309 | Ga0496117_0001578 | 3300048920 | Bacteria | 32349 |
| 1310 | Ga0496117_0003177 | 3300048920 | Bacteria | 19535 |
| 1311 | Ga0496117_0005820 | 3300048920 | Bacteria | 12770 |
| 1312 | Ga0496117_0019052 | 3300048920 | Bacteria | 5654 |
| 1313 | Ga0496117_0019106 | 3300048920 | Bacteria | 5642 |
| 1314 | Ga0496117_0033438 | 3300048920 | Bacteria | 3887 |
| 1315 | Ga0496117_0041847 | 3300048920 | Bacteria | 3350 |
| 1316 | Ga0496117_0043610 | 3300048920 | Bacteria | 3259 |
| 1317 | Ga0496117_0047973 | 3300048920 | Bacteria | 3056 |
| 1318 | Ga0496118_0001250 | 3300048921 | Bacteria | 39043 |
| 1319 | Ga0496118_0001550 | 3300048921 | Bacteria | 34182 |
| 1320 | Ga0496118_0003916 | 3300048921 | Bacteria | 18225 |
| 1321 | Ga0496118_0007940 | 3300048921 | Bacteria | 11103 |
| 1322 | Ga0496118_0010621 | 3300048921 | Bacteria | 9089 |
| 1323 | Ga0496118_0018142 | 3300048921 | Bacteria | 6363 |
| 1324 | Ga0496118_0018819 | 3300048921 | Bacteria | 6202 |
| 1325 | Ga0496118_0022210 | 3300048921 | Bacteria | 5557 |
| 1326 | Ga0496118_0074733 | 3300048921 | Bacteria | 2421 |
| 1327 | Ga0496118_0095666 | 3300048921 | Bacteria | 2026 |
| 1328 | Ga0496119_0000478 | 3300048922 | Bacteria | 54715 |
| 1329 | Ga0496119_0003724 | 3300048922 | Bacteria | 15612 |
| 1330 | Ga0496119_0018131 | 3300048922 | Bacteria | 5256 |
| 1331 | Ga0496119_0044797 | 3300048922 | Bacteria | 2781 |
| 1332 | Ga0496119_0047345 | 3300048922 | Bacteria | 2676 |
| 1333 | Ga0496119_0106791 | 3300048922 | Bacteria | 1562 |
| 1334 | Ga0496119_0128198 | 3300048922 | Bacteria | 1386 |
| 1335 | Ga0496119_0140555 | 3300048922 | Bacteria | 1304 |
| 1336 | Ga0496119_0154324 | 3300048922 | Bacteria | 1227 |
| 1337 | Ga0496119_0175957 | 3300048922 | Bacteria | 1126 |
| 1338 | Ga0496120_0004181 | 3300048923 | Bacteria | 12366 |
| 1339 | Ga0496120_0032516 | 3300048923 | Bacteria | 3145 |
| 1340 | Ga0496120_0072457 | 3300048923 | Bacteria | 1888 |
| 1341 | Ga0496120_0091942 | 3300048923 | Bacteria | 1619 |
| 1342 | Ga0496120_0118123 | 3300048923 | Bacteria | 1375 |
| 1343 | Ga0496121_0000077 | 3300048924 | Bacteria | 235293 |
| 1344 | Ga0496121_0000138 | 3300048924 | Bacteria | 163543 |
| 1345 | Ga0496121_0000240 | 3300048924 | Bacteria | 117890 |
| 1346 | Ga0496121_0000508 | 3300048924 | Bacteria | 74420 |
| 1347 | Ga0496121_0005416 | 3300048924 | Bacteria | 16386 |
| 1348 | Ga0496121_0009567 | 3300048924 | Bacteria | 11105 |
| 1349 | Ga0496121_0011095 | 3300048924 | Bacteria | 10054 |
| 1350 | Ga0496121_0020142 | 3300048924 | Bacteria | 6622 |
| 1351 | Ga0496121_0022123 | 3300048924 | Bacteria | 6185 |
| 1352 | Ga0496121_0049017 | 3300048924 | Bacteria | 3587 |
| 1353 | Ga0496121_0057423 | 3300048924 | Bacteria | 3226 |
| 1354 | Ga0496121_0063125 | 3300048924 | Bacteria | 3029 |
| 1355 | Ga0496121_0067138 | 3300048924 | Bacteria | 2908 |
| 1356 | Ga0496121_0073281 | 3300048924 | Bacteria | 2745 |
| 1357 | Ga0496121_0086614 | 3300048924 | Bacteria | 2461 |
| 1358 | Ga0496121_0097775 | 3300048924 | Bacteria | 2273 |
| 1359 | Ga0496121_0101104 | 3300048924 | Bacteria | 2224 |
| 1360 | Ga0496121_0103679 | 3300048924 | Bacteria | 2187 |
| 1361 | Ga0496121_0112567 | 3300048924 | Bacteria | 2073 |
| 1362 | Ga0496121_0124232 | 3300048924 | Bacteria | 1943 |
| 1363 | Ga0496121_0159667 | 3300048924 | Bacteria | 1650 |
| 1364 | Ga0496121_0171067 | 3300048924 | Bacteria | 1578 |
| 1365 | Ga0496121_0197239 | 3300048924 | Bacteria | 1438 |
| 1366 | Ga0496121_0199321 | 3300048924 | Bacteria | 1428 |
| 1367 | Ga0496122_0000214 | 3300048925 | Bacteria | 129132 |
| 1368 | Ga0496122_0000634 | 3300048925 | Bacteria | 71553 |
| 1369 | Ga0496122_0000889 | 3300048925 | Bacteria | 55661 |
| 1370 | Ga0496122_0003070 | 3300048925 | Bacteria | 22517 |
| 1371 | Ga0496122_0007213 | 3300048925 | Bacteria | 12440 |
| 1372 | Ga0496122_0008693 | 3300048925 | Bacteria | 10880 |
| 1373 | Ga0496122_0010631 | 3300048925 | Bacteria | 9454 |
| 1374 | Ga0496122_0020439 | 3300048925 | Bacteria | 5982 |
| 1375 | Ga0496122_0021407 | 3300048925 | Bacteria | 5790 |
| 1376 | Ga0496122_0022345 | 3300048925 | Bacteria | 5626 |
| 1377 | Ga0496122_0035330 | 3300048925 | Bacteria | 4068 |
| 1378 | Ga0496122_0040105 | 3300048925 | Bacteria | 3726 |
| 1379 | Ga0496122_0075500 | 3300048925 | Bacteria | 2377 |
| 1380 | Ga0496122_0076791 | 3300048925 | Bacteria | 2349 |
| 1381 | Ga0496122_0112977 | 3300048925 | Bacteria | 1776 |
| 1382 | Ga0496122_0143621 | 3300048925 | Bacteria | 1488 |
| 1383 | Ga0496123_0000289 | 3300048926 | Bacteria | 98253 |
| 1384 | Ga0496123_0000736 | 3300048926 | Bacteria | 53090 |
| 1385 | Ga0496123_0003134 | 3300048926 | Bacteria | 18968 |
| 1386 | Ga0496123_0005560 | 3300048926 | Bacteria | 12623 |
| 1387 | Ga0496123_0007007 | 3300048926 | Bacteria | 10749 |
| 1388 | Ga0496123_0007137 | 3300048926 | Bacteria | 10613 |
| 1389 | Ga0496123_0018413 | 3300048926 | Bacteria | 5559 |
| 1390 | Ga0496123_0018897 | 3300048926 | Bacteria | 5457 |
| 1391 | Ga0496123_0033027 | 3300048926 | Bacteria | 3732 |
| 1392 | Ga0496123_0080981 | 3300048926 | Bacteria | 1975 |
| 1393 | Ga0496123_0110235 | 3300048926 | Bacteria | 1575 |
| 1394 | Ga0496123_0145662 | 3300048926 | Bacteria | 1287 |
| 1395 | Ga0496124_0000023 | 3300048927 | Bacteria | 415226 |
| 1396 | Ga0496124_0000139 | 3300048927 | Bacteria | 149873 |
| 1397 | Ga0496124_0002954 | 3300048927 | Bacteria | 21347 |
| 1398 | Ga0496124_0005342 | 3300048927 | Bacteria | 14501 |
| 1399 | Ga0496124_0008253 | 3300048927 | Bacteria | 10922 |
| 1400 | Ga0496124_0017130 | 3300048927 | Bacteria | 6848 |
| 1401 | Ga0496124_0021305 | 3300048927 | Bacteria | 5974 |
| 1402 | Ga0496124_0022423 | 3300048927 | Bacteria | 5788 |
| 1403 | Ga0496124_0086064 | 3300048927 | Bacteria | 2573 |
| 1404 | Ga0496124_0089120 | 3300048927 | Bacteria | 2519 |
| 1405 | Ga0496124_0098614 | 3300048927 | Bacteria | 2370 |
| 1406 | Ga0496124_0133193 | 3300048927 | Bacteria | 1972 |
| 1407 | Ga0496124_0168714 | 3300048927 | Bacteria | 1698 |
| 1408 | Ga0496125_0000125 | 3300048928 | Bacteria | 169979 |
| 1409 | Ga0496125_0000182 | 3300048928 | Bacteria | 137747 |
| 1410 | Ga0496125_0004131 | 3300048928 | Bacteria | 16954 |
| 1411 | Ga0496125_0008255 | 3300048928 | Bacteria | 10936 |
| 1412 | Ga0496125_0022162 | 3300048928 | Bacteria | 5903 |
| 1413 | Ga0496125_0050765 | 3300048928 | Bacteria | 3430 |
| 1414 | Ga0496125_0053684 | 3300048928 | Bacteria | 3301 |
| 1415 | Ga0496125_0080288 | 3300048928 | Bacteria | 2497 |
| 1416 | Ga0496125_0088454 | 3300048928 | Bacteria | 2334 |
| 1417 | Ga0496126_0014174 | 3300048929 | Bacteria | 8069 |
| 1418 | Ga0496126_0018962 | 3300048929 | Bacteria | 6795 |
| 1419 | Ga0496126_0023164 | 3300048929 | Bacteria | 6020 |
| 1420 | Ga0496126_0025338 | 3300048929 | Bacteria | 5707 |
| 1421 | Ga0496126_0037600 | 3300048929 | Bacteria | 4515 |
| 1422 | Ga0496126_0047500 | 3300048929 | Bacteria | 3929 |
| 1423 | Ga0496126_0057800 | 3300048929 | Bacteria | 3499 |
| 1424 | Ga0496126_0074477 | 3300048929 | Bacteria | 3015 |
| 1425 | Ga0496126_0100821 | 3300048929 | Bacteria | 2526 |
| 1426 | Ga0496126_0102228 | 3300048929 | Bacteria | 2506 |
| 1427 | Ga0496126_0107087 | 3300048929 | Bacteria | 2438 |
| 1428 | Ga0496126_0167438 | 3300048929 | Bacteria | 1874 |
| 1429 | Ga0496126_0257743 | 3300048929 | Bacteria | 1451 |
| 1430 | Ga0496126_0259561 | 3300048929 | Bacteria | 1445 |
| 1431 | Ga0496126_0308974 | 3300048929 | Bacteria | 1302 |
| 1432 | Ga0496126_0359078 | 3300048929 | Bacteria | 1190 |
| 1433 | Ga0495678_000143 | 3300049459 | Bacteria | 86601 |
| 1434 | Ga0495678_010019 | 3300049459 | Bacteria | 4633 |
| 1435 | Ga0495682_0015217 | 3300049460 | Bacteria | 2915 |
| 1436 | Ga0495682_0026635 | 3300049460 | Bacteria | 2145 |
| 1437 | Ga0501031_0002561 | 3300049568 | Bacteria | 11583 |
| 1438 | Ga0501031_0028662 | 3300049568 | Bacteria | 3630 |
| 1439 | Ga0501031_0094997 | 3300049568 | Bacteria | 1945 |
| 1440 | Ga0501031_0351448 | 3300049568 | Bacteria | 954 |
| 1441 | Ga0501032_0000345 | 3300049569 | Bacteria | 38831 |
| 1442 | Ga0501032_0004619 | 3300049569 | Bacteria | 10359 |
| 1443 | Ga0501032_0014407 | 3300049569 | Bacteria | 5601 |
| 1444 | Ga0501032_0043053 | 3300049569 | Bacteria | 3060 |
| 1445 | Ga0501032_0094655 | 3300049569 | Bacteria | 1980 |
| 1446 | Ga0501032_0113716 | 3300049569 | Bacteria | 1790 |
| 1447 | Ga0501032_0221444 | 3300049569 | Bacteria | 1231 |
| 1448 | Ga0501033_0000094 | 3300049570 | Bacteria | 84669 |
| 1449 | Ga0501033_0071416 | 3300049570 | Bacteria | 2550 |
| 1450 | Ga0501033_0075574 | 3300049570 | Bacteria | 2473 |
| 1451 | Ga0501034_0000021 | 3300049571 | Bacteria | 266023 |
| 1452 | Ga0501034_0001365 | 3300049571 | Bacteria | 32928 |
| 1453 | Ga0501034_0003055 | 3300049571 | Bacteria | 19328 |
| 1454 | Ga0501034_0022443 | 3300049571 | Bacteria | 6432 |
| 1455 | Ga0501034_0034037 | 3300049571 | Bacteria | 5166 |
| 1456 | Ga0501034_0069730 | 3300049571 | Bacteria | 3526 |
| 1457 | Ga0501034_0089924 | 3300049571 | Bacteria | 3068 |
| 1458 | Ga0501034_0125451 | 3300049571 | Bacteria | 2552 |
| 1459 | Ga0501034_0434183 | 3300049571 | Bacteria | 1233 |
| 1460 | Ga0501036_0000115 | 3300049572 | Bacteria | 49866 |
| 1461 | Ga0501036_0001315 | 3300049572 | Bacteria | 19056 |
| 1462 | Ga0501036_0045657 | 3300049572 | Bacteria | 3711 |
| 1463 | Ga0501036_0046107 | 3300049572 | Bacteria | 3691 |
| 1464 | Ga0501036_0100560 | 3300049572 | Bacteria | 2446 |
| 1465 | Ga0501036_0237736 | 3300049572 | Bacteria | 1528 |
| 1466 | Ga0501036_0390838 | 3300049572 | Bacteria | 1160 |
| 1467 | Ga0501037_0000174 | 3300049573 | Bacteria | 60960 |
| 1468 | Ga0501037_0004241 | 3300049573 | Bacteria | 10400 |
| 1469 | Ga0501037_0041694 | 3300049573 | Bacteria | 3375 |
| 1470 | Ga0501037_0100343 | 3300049573 | Bacteria | 2090 |
| 1471 | Ga0501037_0102588 | 3300049573 | Bacteria | 2063 |
| 1472 | Ga0501037_0166634 | 3300049573 | Bacteria | 1568 |
| 1473 | Ga0501037_0360432 | 3300049573 | Bacteria | 1002 |
| 1474 | Ga0501038_0000052 | 3300049574 | Bacteria | 94841 |
| 1475 | Ga0501038_0002280 | 3300049574 | Bacteria | 17849 |
| 1476 | Ga0501038_0072671 | 3300049574 | Bacteria | 2914 |
| 1477 | Ga0501038_0154527 | 3300049574 | Bacteria | 1869 |
| 1478 | Ga0501038_0175509 | 3300049574 | Bacteria | 1732 |
| 1479 | Ga0501038_0177594 | 3300049574 | Bacteria | 1720 |
| 1480 | Ga0501038_0182308 | 3300049574 | Bacteria | 1693 |
| 1481 | Ga0501038_0231026 | 3300049574 | Bacteria | 1472 |
| 1482 | Ga0501038_0298123 | 3300049574 | Bacteria | 1266 |
| 1483 | Ga0501038_0303181 | 3300049574 | Bacteria | 1253 |
| 1484 | Ga0501038_0305539 | 3300049574 | Bacteria | 1247 |
| 1485 | Ga0501039_0000156 | 3300049575 | Bacteria | 47049 |
| 1486 | Ga0501039_0002927 | 3300049575 | Bacteria | 12775 |
| 1487 | Ga0501039_0035313 | 3300049575 | Bacteria | 3858 |
| 1488 | Ga0501039_0053328 | 3300049575 | Bacteria | 3129 |
| 1489 | Ga0501039_0089917 | 3300049575 | Bacteria | 2393 |
| 1490 | Ga0501039_0126434 | 3300049575 | Bacteria | 2005 |
| 1491 | Ga0501039_0415884 | 3300049575 | Bacteria | 1056 |
| 1492 | Ga0501040_0007819 | 3300049576 | Bacteria | 6924 |
| 1493 | Ga0501040_0156679 | 3300049576 | Bacteria | 1608 |
| 1494 | Ga0501040_0210466 | 3300049576 | Bacteria | 1382 |
| 1495 | Ga0501041_0031853 | 3300049577 | Bacteria | 3187 |
| 1496 | Ga0501041_0144812 | 3300049577 | Bacteria | 1482 |
| 1497 | Ga0501041_0163440 | 3300049577 | Bacteria | 1392 |
| 1498 | Ga0501042_0003824 | 3300049578 | Bacteria | 9518 |
| 1499 | Ga0501042_0038784 | 3300049578 | Bacteria | 3383 |
| 1500 | Ga0501042_0191035 | 3300049578 | Unclassified | 1477 |
| 1501 | Ga0501043_0003891 | 3300049579 | Bacteria | 12258 |
| 1502 | Ga0501043_0007149 | 3300049579 | Bacteria | 8880 |
| 1503 | Ga0501043_0016367 | 3300049579 | Bacteria | 5815 |
| 1504 | Ga0501043_0074640 | 3300049579 | Bacteria | 2664 |
| 1505 | Ga0501043_0126694 | 3300049579 | Bacteria | 2002 |
| 1506 | Ga0501043_0222221 | 3300049579 | Bacteria | 1461 |
| 1507 | Ga0501043_0281092 | 3300049579 | Bacteria | 1276 |
| 1508 | Ga0501046_0000133 | 3300049580 | Bacteria | 79467 |
| 1509 | Ga0501046_0002355 | 3300049580 | Bacteria | 17801 |
| 1510 | Ga0501046_0028960 | 3300049580 | Bacteria | 4507 |
| 1511 | Ga0501046_0031080 | 3300049580 | Bacteria | 4332 |
| 1512 | Ga0501046_0060481 | 3300049580 | Bacteria | 2964 |
| 1513 | Ga0501046_0077958 | 3300049580 | Bacteria | 2564 |
| 1514 | Ga0501046_0205588 | 3300049580 | Bacteria | 1464 |
| 1515 | Ga0501047_0000440 | 3300049581 | Bacteria | 46007 |
| 1516 | Ga0501047_0003444 | 3300049581 | Bacteria | 14966 |
| 1517 | Ga0501047_0003515 | 3300049581 | Bacteria | 14801 |
| 1518 | Ga0501047_0007345 | 3300049581 | Bacteria | 10359 |
| 1519 | Ga0501047_0015373 | 3300049581 | Bacteria | 7289 |
| 1520 | Ga0501047_0045708 | 3300049581 | Bacteria | 4233 |
| 1521 | Ga0501047_0090883 | 3300049581 | Bacteria | 2930 |
| 1522 | Ga0501047_0106562 | 3300049581 | Bacteria | 2684 |
| 1523 | Ga0501047_0128951 | 3300049581 | Bacteria | 2410 |
| 1524 | Ga0501047_0132255 | 3300049581 | Bacteria | 2375 |
| 1525 | Ga0501048_0000072 | 3300049582 | Bacteria | 51953 |
| 1526 | Ga0501048_0001333 | 3300049582 | Bacteria | 18714 |
| 1527 | Ga0501048_0057148 | 3300049582 | Bacteria | 2767 |
| 1528 | Ga0501048_0123404 | 3300049582 | Bacteria | 1831 |
| 1529 | Ga0501067_0000076 | 3300049583 | Bacteria | 56529 |
| 1530 | Ga0501067_0023326 | 3300049583 | Bacteria | 3429 |
| 1531 | Ga0501067_0045029 | 3300049583 | Bacteria | 2451 |
| 1532 | Ga0501067_0086204 | 3300049583 | Bacteria | 1743 |
| 1533 | Ga0501068_0001765 | 3300049584 | Bacteria | 11496 |
| 1534 | Ga0501068_0008449 | 3300049584 | Bacteria | 5730 |
| 1535 | Ga0501068_0258118 | 3300049584 | Bacteria | 1111 |
| 1536 | Ga0501069_0013671 | 3300049585 | Bacteria | 4331 |
| 1537 | Ga0501069_0106904 | 3300049585 | Bacteria | 1591 |
| 1538 | Ga0501069_0174958 | 3300049585 | Bacteria | 1239 |
| 1539 | Ga0501070_0001529 | 3300049586 | Bacteria | 20585 |
| 1540 | Ga0501070_0006975 | 3300049586 | Bacteria | 9611 |
| 1541 | Ga0501070_0011558 | 3300049586 | Bacteria | 7452 |
| 1542 | Ga0501070_0031178 | 3300049586 | Bacteria | 4466 |
| 1543 | Ga0501070_0079684 | 3300049586 | Bacteria | 2710 |
| 1544 | Ga0501070_0090655 | 3300049586 | Bacteria | 2530 |
| 1545 | Ga0501070_0385348 | 3300049586 | Bacteria | 1135 |
| 1546 | Ga0501071_0002932 | 3300049587 | Bacteria | 10537 |
| 1547 | Ga0501071_0077841 | 3300049587 | Bacteria | 2423 |
| 1548 | Ga0501071_0088864 | 3300049587 | Bacteria | 2267 |
| 1549 | Ga0501071_0122632 | 3300049587 | Bacteria | 1927 |
| 1550 | Ga0501072_0001658 | 3300049588 | Bacteria | 16605 |
| 1551 | Ga0501072_0033267 | 3300049588 | Bacteria | 4040 |
| 1552 | Ga0501072_0056563 | 3300049588 | Bacteria | 3091 |
| 1553 | Ga0501072_0101669 | 3300049588 | Bacteria | 2285 |
| 1554 | Ga0501072_0229988 | 3300049588 | Bacteria | 1477 |
| 1555 | Ga0501073_0000065 | 3300049589 | Bacteria | 65736 |
| 1556 | Ga0501073_0000099 | 3300049589 | Bacteria | 55207 |
| 1557 | Ga0501073_0007507 | 3300049589 | Bacteria | 8099 |
| 1558 | Ga0501073_0011276 | 3300049589 | Bacteria | 6539 |
| 1559 | Ga0501073_0042714 | 3300049589 | Bacteria | 3199 |
| 1560 | Ga0501073_0050453 | 3300049589 | Bacteria | 2916 |
| 1561 | Ga0501074_0002696 | 3300049590 | Bacteria | 12434 |
| 1562 | Ga0501074_0044377 | 3300049590 | Bacteria | 3219 |
| 1563 | Ga0501074_0054018 | 3300049590 | Bacteria | 2897 |
| 1564 | Ga0501074_0055023 | 3300049590 | Bacteria | 2869 |
| 1565 | Ga0501074_0071192 | 3300049590 | Bacteria | 2500 |
| 1566 | Ga0501074_0137314 | 3300049590 | Bacteria | 1749 |
| 1567 | Ga0501074_0184445 | 3300049590 | Bacteria | 1488 |
| 1568 | Ga0501075_0045988 | 3300049591 | Bacteria | 3278 |
| 1569 | Ga0501075_0373331 | 3300049591 | Bacteria | 1087 |
| 1570 | Ga0501076_0030980 | 3300049592 | Bacteria | 4168 |
| 1571 | Ga0501076_0031880 | 3300049592 | Bacteria | 4113 |
| 1572 | Ga0501077_0037985 | 3300049593 | Bacteria | 3066 |
| 1573 | Ga0501077_0039610 | 3300049593 | Bacteria | 3002 |
| 1574 | Ga0501077_0130878 | 3300049593 | Bacteria | 1591 |
| 1575 | Ga0501079_0004389 | 3300049741 | Bacteria | 10442 |
| 1576 | Ga0501079_0005301 | 3300049741 | Bacteria | 9593 |
| 1577 | Ga0501079_0026282 | 3300049741 | Bacteria | 4463 |
| 1578 | Ga0501079_0074304 | 3300049741 | Bacteria | 2628 |
| 1579 | Ga0501079_0171779 | 3300049741 | Bacteria | 1690 |
| 1580 | Ga0501079_0341865 | 3300049741 | Bacteria | 1172 |
| 1581 | Ga0501080_0000658 | 3300049742 | Bacteria | 27440 |
| 1582 | Ga0501080_0002779 | 3300049742 | Bacteria | 15373 |
| 1583 | Ga0501080_0106418 | 3300049742 | Bacteria | 2599 |
| 1584 | Ga0501083_0000604 | 3300049744 | Bacteria | 23119 |
| 1585 | Ga0501083_0001450 | 3300049744 | Bacteria | 16195 |
| 1586 | Ga0501083_0012684 | 3300049744 | Bacteria | 5896 |
| 1587 | Ga0501083_0014028 | 3300049744 | Bacteria | 5601 |
| 1588 | Ga0501083_0016470 | 3300049744 | Bacteria | 5174 |
| 1589 | Ga0501280_001117 | 3300049776 | Bacteria | 5384 |
| 1590 | Ga0501035_0000255 | 3300049822 | Bacteria | 63841 |
| 1591 | Ga0501035_0003219 | 3300049822 | Bacteria | 15648 |
| 1592 | Ga0501035_0007115 | 3300049822 | Bacteria | 10458 |
| 1593 | Ga0501035_0011601 | 3300049822 | Bacteria | 8169 |
| 1594 | Ga0501035_0022569 | 3300049822 | Bacteria | 5780 |
| 1595 | Ga0501035_0032578 | 3300049822 | Bacteria | 4740 |
| 1596 | Ga0501035_0046753 | 3300049822 | Bacteria | 3892 |
| 1597 | Ga0501035_0090286 | 3300049822 | Bacteria | 2697 |
| 1598 | Ga0501035_0163509 | 3300049822 | Bacteria | 1926 |
| 1599 | Ga0501035_0165171 | 3300049822 | Bacteria | 1915 |
| 1600 | Ga0501035_0292287 | 3300049822 | Bacteria | 1375 |
| 1601 | Ga0501035_0293900 | 3300049822 | Bacteria | 1371 |
| 1602 | Ga0501044_0000141 | 3300049823 | Bacteria | 88569 |
| 1603 | Ga0501044_0002860 | 3300049823 | Bacteria | 19649 |
| 1604 | Ga0501044_0031151 | 3300049823 | Bacteria | 5616 |
| 1605 | Ga0501044_0032771 | 3300049823 | Bacteria | 5461 |
| 1606 | Ga0501044_0046301 | 3300049823 | Bacteria | 4504 |
| 1607 | Ga0501044_0063135 | 3300049823 | Bacteria | 3785 |
| 1608 | Ga0501044_0131610 | 3300049823 | Bacteria | 2495 |
| 1609 | Ga0501044_0143343 | 3300049823 | Bacteria | 2377 |
| 1610 | Ga0501044_0153413 | 3300049823 | Bacteria | 2284 |
| 1611 | Ga0501044_0313589 | 3300049823 | Bacteria | 1494 |
| 1612 | Ga0501044_0347259 | 3300049823 | Bacteria | 1404 |
| 1613 | Ga0501044_0528425 | 3300049823 | Bacteria | 1079 |
| 1614 | Ga0501045_0003550 | 3300049824 | Bacteria | 10707 |
| 1615 | Ga0501045_0030185 | 3300049824 | Bacteria | 3922 |
| 1616 | Ga0501045_0037949 | 3300049824 | Bacteria | 3504 |
| 1617 | nmdc:mga03n38_113048_c1 | 3300050490 | Bacteria | 1325 |
| 1618 | nmdc:mga00v17_112602_c1 | 3300050491 | Bacteria | 1727 |
| 1619 | nmdc:mga00v17_11836_c1 | 3300050491 | Bacteria | 4800 |
| 1620 | nmdc:mga00v17_122319_c1 | 3300050491 | Bacteria | 1658 |
| 1621 | nmdc:mga00v17_178_c1 | 3300050491 | Bacteria | 37572 |
| 1622 | nmdc:mga00v17_26284_c1 | 3300050491 | Bacteria | 3391 |
| 1623 | nmdc:mga00v17_33021_c1 | 3300050491 | Bacteria | 3063 |
| 1624 | nmdc:mga00v17_63931_c1 | 3300050491 | Bacteria | 2267 |
| 1625 | nmdc:mga00v17_91223_c1 | 3300050491 | Bacteria | 1914 |
| 1626 | nmdc:mga0yw44_117362_c1 | 3300050492 | Bacteria | 1357 |
| 1627 | nmdc:mga0yw44_170150_c1 | 3300050492 | Bacteria | 1430 |
| 1628 | nmdc:mga0yw44_197982_c1 | 3300050492 | Bacteria | 1326 |
| 1629 | nmdc:mga0yw44_24041_c1 | 3300050492 | Bacteria | 3442 |
| 1630 | nmdc:mga0yw44_289666_c1 | 3300050492 | Bacteria | 1095 |
| 1631 | nmdc:mga0yw44_347507_c1 | 3300050492 | Bacteria | 998 |
| 1632 | nmdc:mga0yw44_71422_c1 | 3300050492 | Bacteria | 2155 |
| 1633 | nmdc:mga0k408_107321_c1 | 3300050493 | Bacteria | 1649 |
| 1634 | nmdc:mga0k408_21847_c1 | 3300050493 | Bacteria | 3599 |
| 1635 | nmdc:mga06z11_25288_c1 | 3300050494 | Bacteria | 2812 |
| 1636 | nmdc:mga06z11_5600_c1 | 3300050494 | Bacteria | 5052 |
| 1637 | nmdc:mga04h51_62746_c1 | 3300050495 | Bacteria | 1278 |
| 1638 | nmdc:mga04h51_76776_c1 | 3300050495 | Bacteria | 1178 |
| 1639 | nmdc:mga07m45_104095_c1 | 3300050496 | Bacteria | 1632 |
| 1640 | nmdc:mga07m45_1811_c1 | 3300050496 | Bacteria | 9847 |
| 1641 | nmdc:mga07m45_72816_c1 | 3300050496 | Bacteria | 1956 |
| 1642 | nmdc:mga07m45_86591_c2 | 3300050496 | Bacteria | 1469 |
| 1643 | nmdc:mga05p37_150931_c1 | 3300050507 | Bacteria | 2472 |
| 1644 | nmdc:mga05p37_156848_c1 | 3300050507 | Bacteria | 2781 |
| 1645 | nmdc:mga05p37_185331_c1 | 3300050507 | Bacteria | 2530 |
| 1646 | nmdc:mga05p37_2636_c1 | 3300050507 | Bacteria | 20883 |
| 1647 | nmdc:mga05p37_3032_c1 | 3300050507 | Bacteria | 19509 |
| 1648 | nmdc:mga05p37_967_c1 | 3300050507 | Bacteria | 32558 |
| 1649 | nmdc:mga09592_25520_c1 | 3300050508 | Bacteria | 4892 |
| 1650 | nmdc:mga09592_3458_c1 | 3300050508 | Bacteria | 12754 |
| 1651 | nmdc:mga09592_41226_c1 | 3300050508 | Bacteria | 3881 |
| 1652 | nmdc:mga09592_858_c1 | 3300050508 | Bacteria | 23710 |
| 1653 | nmdc:mga09592_9739_c1 | 3300050508 | Bacteria | 7805 |
| 1654 | nmdc:mga0qj67_68379_c1 | 3300050509 | Bacteria | 2831 |
| 1655 | nmdc:mga0qj67_82897_c1 | 3300050509 | Bacteria | 2571 |
| 1656 | nmdc:mga06r32_11440_c1 | 3300050510 | Bacteria | 7992 |
| 1657 | nmdc:mga06r32_34004_c1 | 3300050510 | Bacteria | 4805 |
| 1658 | nmdc:mga06r32_6916_c1 | 3300050510 | Bacteria | 10198 |
| 1659 | nmdc:mga06r32_7062_c1 | 3300050510 | Bacteria | 10103 |
| 1660 | nmdc:mga08y16_92726_c1 | 3300050511 | Bacteria | 3147 |
| 1661 | nmdc:mga0n895_2596_c1 | 3300050512 | Bacteria | 14193 |
| 1662 | nmdc:mga0rr50_26740_c1 | 3300050513 | Bacteria | 4031 |
| 1663 | nmdc:mga0rr50_429_c1 | 3300050513 | Bacteria | 22601 |
| 1664 | nmdc:mga08x19_132698_c1 | 3300050514 | Bacteria | 1676 |
| 1665 | nmdc:mga08x19_767_c1 | 3300050514 | Bacteria | 20471 |
| 1666 | nmdc:mga08x19_92852_c1 | 3300050514 | Bacteria | 1994 |
| 1667 | nmdc:mga0a205_38067_c1 | 3300050515 | Bacteria | 4627 |
| 1668 | nmdc:mga0sz30_10577_c1 | 3300050516 | Bacteria | 3539 |
| 1669 | nmdc:mga0sz30_35523_c1 | 3300050516 | Bacteria | 2080 |
| 1670 | nmdc:mga0sz30_41570_c1 | 3300050516 | Bacteria | 1933 |
| 1671 | nmdc:mga0sz30_92061_c1 | 3300050516 | Bacteria | 1320 |
| 1672 | Ga0495601_0144464 | 3300053077 | Bacteria | 1552 |
| 1673 | Ga0495612_0072117 | 3300053078 | Bacteria | 1441 |
| 1674 | Ga0495612_0127770 | 3300053078 | Bacteria | 1097 |
| 1675 | Ga0500635_0014595 | 3300053080 | Bacteria | 2305 |
| 1676 | Ga0500635_0022450 | 3300053080 | Bacteria | 1956 |
| 1677 | Ga0500635_0031115 | 3300053080 | Bacteria | 1725 |
| 1678 | Ga0495595_0000309 | 3300053084 | Bacteria | 19034 |
| 1679 | Ga0495595_0007183 | 3300053084 | Bacteria | 4552 |
| 1680 | Ga0495619_0004295 | 3300053085 | Bacteria | 9087 |
| 1681 | Ga0495619_0035622 | 3300053085 | Bacteria | 3237 |
| 1682 | Ga0495619_0145203 | 3300053085 | Bacteria | 1635 |
| 1683 | Ga0500643_000114 | 3300053087 | Bacteria | 84221 |
| 1684 | Ga0500643_048642 | 3300053087 | Bacteria | 1218 |
| 1685 | Ga0500644_0000490 | 3300053088 | Bacteria | 17289 |
| 1686 | Ga0500644_0160845 | 3300053088 | Bacteria | 907 |
| 1687 | Ga0500646_0002275 | 3300053090 | Bacteria | 5001 |
| 1688 | Ga0500646_0015271 | 3300053090 | Bacteria | 1999 |
| 1689 | Ga0500583_0044731 | 3300053092 | Bacteria | 2029 |
| 1690 | Ga0500583_0128496 | 3300053092 | Bacteria | 1256 |
| 1691 | Ga0500651_0006211 | 3300053093 | Bacteria | 6870 |
| 1692 | Ga0500651_0024276 | 3300053093 | Bacteria | 3801 |
| 1693 | Ga0500651_0092970 | 3300053093 | Bacteria | 1855 |
| 1694 | Ga0500651_0252962 | 3300053093 | Bacteria | 1024 |
| 1695 | Ga0500566_0000100 | 3300053094 | Bacteria | 43788 |
| 1696 | Ga0500566_0000220 | 3300053094 | Bacteria | 30427 |
| 1697 | Ga0500566_0001885 | 3300053094 | Bacteria | 12343 |
| 1698 | Ga0500566_0050801 | 3300053094 | Bacteria | 2373 |
| 1699 | Ga0500640_005859 | 3300053095 | Bacteria | 4634 |
| 1700 | Ga0500641_0002654 | 3300053096 | Bacteria | 6320 |
| 1701 | Ga0500641_0005082 | 3300053096 | Bacteria | 4662 |
| 1702 | Ga0500641_0044249 | 3300053096 | Bacteria | 1810 |
| 1703 | Ga0500650_0001074 | 3300053098 | Bacteria | 7853 |
| 1704 | Ga0500650_0003775 | 3300053098 | Bacteria | 5349 |
| 1705 | Ga0500554_003133 | 3300053102 | Bacteria | 3346 |
| 1706 | Ga0500554_074459 | 3300053102 | Bacteria | 1110 |
| 1707 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 1708 | Ga0500556_0000023 | 3300053104 | Bacteria | 168755 |
| 1709 | Ga0500556_0000052 | 3300053104 | Bacteria | 117825 |
| 1710 | Ga0500556_0008488 | 3300053104 | Bacteria | 2966 |
| 1711 | Ga0500557_000010 | 3300053105 | Bacteria | 118251 |
| 1712 | Ga0500560_000134 | 3300053107 | Bacteria | 8027 |
| 1713 | Ga0500560_002379 | 3300053107 | Bacteria | 3575 |
| 1714 | Ga0500562_006887 | 3300053108 | Bacteria | 2868 |
| 1715 | Ga0500562_011668 | 3300053108 | Bacteria | 2231 |
| 1716 | Ga0500562_026751 | 3300053108 | Bacteria | 1513 |
| 1717 | Ga0500569_035121 | 3300053109 | Bacteria | 1435 |
| 1718 | Ga0500572_000176 | 3300053111 | Bacteria | 22627 |
| 1719 | Ga0500572_000235 | 3300053111 | Bacteria | 19688 |
| 1720 | Ga0500572_001926 | 3300053111 | Bacteria | 5211 |
| 1721 | Ga0500572_020475 | 3300053111 | Bacteria | 1741 |
| 1722 | Ga0500592_006824 | 3300053116 | Bacteria | 1817 |
| 1723 | Ga0500592_010240 | 3300053116 | Bacteria | 1492 |
| 1724 | Ga0500593_093092 | 3300053117 | Bacteria | 1272 |
| 1725 | Ga0500594_0000814 | 3300053118 | Bacteria | 6664 |
| 1726 | Ga0500594_0012754 | 3300053118 | Bacteria | 1987 |
| 1727 | Ga0500595_000450 | 3300053119 | Bacteria | 25570 |
| 1728 | Ga0500595_008586 | 3300053119 | Bacteria | 4169 |
| 1729 | Ga0500595_033524 | 3300053119 | Bacteria | 1704 |
| 1730 | Ga0500607_016108 | 3300053121 | Bacteria | 4294 |
| 1731 | Ga0500608_000720 | 3300053122 | Bacteria | 12152 |
| 1732 | Ga0500608_014667 | 3300053122 | Bacteria | 3504 |
| 1733 | Ga0500608_065882 | 3300053122 | Bacteria | 1728 |
| 1734 | Ga0500614_000141 | 3300053123 | Bacteria | 17860 |
| 1735 | Ga0500614_021538 | 3300053123 | Bacteria | 1496 |
| 1736 | Ga0500618_000348 | 3300053125 | Bacteria | 32595 |
| 1737 | Ga0500642_0000005 | 3300053130 | Bacteria | 422725 |
| 1738 | Ga0500642_0000012 | 3300053130 | Bacteria | 206424 |
| 1739 | Ga0500642_0000334 | 3300053130 | Bacteria | 16200 |
| 1740 | Ga0500642_0033939 | 3300053130 | Bacteria | 2155 |
| 1741 | Ga0500642_0137836 | 3300053130 | Bacteria | 1144 |
| 1742 | Ga0500652_001569 | 3300053131 | Bacteria | 6987 |
| 1743 | Ga0500652_055115 | 3300053131 | Bacteria | 1628 |
| 1744 | Ga0500658_0000786 | 3300053134 | Bacteria | 13133 |
| 1745 | Ga0500658_0001722 | 3300053134 | Bacteria | 8655 |
| 1746 | Ga0500658_0055711 | 3300053134 | Bacteria | 1628 |
| 1747 | Ga0500559_0000509 | 3300053136 | Bacteria | 27329 |
| 1748 | Ga0500559_0003396 | 3300053136 | Bacteria | 7846 |
| 1749 | Ga0500559_0005407 | 3300053136 | Bacteria | 5882 |
| 1750 | Ga0500559_0010805 | 3300053136 | Bacteria | 3914 |
| 1751 | Ga0500559_0086638 | 3300053136 | Bacteria | 1430 |
| 1752 | Ga0500568_0000001 | 3300053139 | Bacteria | 988705 |
| 1753 | Ga0500568_0000019 | 3300053139 | Bacteria | 195696 |
| 1754 | Ga0500568_0000246 | 3300053139 | Bacteria | 46161 |
| 1755 | Ga0500568_0000440 | 3300053139 | Bacteria | 31182 |
| 1756 | Ga0500568_0001219 | 3300053139 | Bacteria | 17157 |
| 1757 | Ga0500568_0001959 | 3300053139 | Bacteria | 12590 |
| 1758 | Ga0500568_0004746 | 3300053139 | Bacteria | 7204 |
| 1759 | Ga0500573_0003907 | 3300053140 | Bacteria | 7784 |
| 1760 | Ga0500573_0047509 | 3300053140 | Bacteria | 2472 |
| 1761 | Ga0500573_0088519 | 3300053140 | Bacteria | 1751 |
| 1762 | Ga0500577_0000078 | 3300053142 | Bacteria | 22529 |
| 1763 | Ga0500577_0000149 | 3300053142 | Bacteria | 17206 |
| 1764 | Ga0500577_0084835 | 3300053142 | Bacteria | 1270 |
| 1765 | Ga0500577_0099490 | 3300053142 | Bacteria | 1187 |
| 1766 | Ga0500586_000724 | 3300053145 | Bacteria | 6766 |
| 1767 | Ga0500603_000017 | 3300053150 | Bacteria | 56324 |
| 1768 | Ga0500603_000889 | 3300053150 | Bacteria | 7110 |
| 1769 | Ga0500604_0000324 | 3300053151 | Bacteria | 13292 |
| 1770 | Ga0500604_0001078 | 3300053151 | Bacteria | 7625 |
| 1771 | Ga0500604_0003561 | 3300053151 | Bacteria | 4195 |
| 1772 | Ga0500616_0000085 | 3300053153 | Bacteria | 193192 |
| 1773 | Ga0500616_0000351 | 3300053153 | Bacteria | 65787 |
| 1774 | Ga0500616_0000508 | 3300053153 | Bacteria | 49451 |
| 1775 | Ga0500616_0000681 | 3300053153 | Bacteria | 39796 |
| 1776 | Ga0500616_0076057 | 3300053153 | Bacteria | 1698 |
| 1777 | Ga0500616_0095923 | 3300053153 | Bacteria | 1459 |
| 1778 | Ga0500619_000086 | 3300053154 | Bacteria | 26088 |
| 1779 | Ga0500619_029693 | 3300053154 | Bacteria | 1656 |
| 1780 | Ga0500622_0000206 | 3300053156 | Bacteria | 62842 |
| 1781 | Ga0500622_0000613 | 3300053156 | Bacteria | 32349 |
| 1782 | Ga0500622_0001984 | 3300053156 | Bacteria | 15344 |
| 1783 | Ga0500622_0005324 | 3300053156 | Bacteria | 7756 |
| 1784 | Ga0500622_0006594 | 3300053156 | Bacteria | 6694 |
| 1785 | Ga0500622_0012145 | 3300053156 | Bacteria | 4673 |
| 1786 | Ga0500624_000452 | 3300053157 | Bacteria | 12326 |
| 1787 | Ga0500630_033993 | 3300053159 | Bacteria | 2500 |
| 1788 | Ga0500634_0000073 | 3300053161 | Bacteria | 39695 |
| 1789 | Ga0500634_0002205 | 3300053161 | Bacteria | 8108 |
| 1790 | Ga0500634_0021157 | 3300053161 | Bacteria | 3522 |
| 1791 | Ga0500638_008035 | 3300053162 | Bacteria | 4467 |
| 1792 | Ga0500638_023327 | 3300053162 | Bacteria | 2941 |
| 1793 | Ga0500638_111345 | 3300053162 | Bacteria | 1264 |
| 1794 | Ga0500639_000525 | 3300053163 | Bacteria | 19105 |
| 1795 | Ga0500639_062463 | 3300053163 | Bacteria | 1917 |
| 1796 | Ga0500636_0000695 | 3300053177 | Bacteria | 18042 |
| 1797 | Ga0500636_0001446 | 3300053177 | Bacteria | 12929 |
| 1798 | Ga0500636_0001744 | 3300053177 | Bacteria | 11921 |
| 1799 | Ga0500636_0014958 | 3300053177 | Bacteria | 4568 |
| 1800 | Ga0500636_0033194 | 3300053177 | Bacteria | 3057 |
| 1801 | Ga0500637_0004182 | 3300053178 | Bacteria | 6802 |
| 1802 | Ga0500637_0009251 | 3300053178 | Bacteria | 5007 |
| 1803 | Ga0500637_0115909 | 3300053178 | Bacteria | 1554 |
| 1804 | Ga0500637_0158620 | 3300053178 | Bacteria | 1304 |
| 1805 | Ga0500611_012117 | 3300053727 | Bacteria | 1446 |
| 1806 | Ga0500625_003061 | 3300053729 | Bacteria | 6484 |
| 1807 | Ga0500645_011357 | 3300053730 | Bacteria | 2912 |
| 1808 | Ga0500645_015458 | 3300053730 | Bacteria | 2417 |
| 1809 | Ga0500645_017977 | 3300053730 | Bacteria | 2212 |
| 1810 | Ga0500645_052976 | 3300053730 | Bacteria | 1181 |
| 1811 | Ga0500596_003815 | 3300053735 | Bacteria | 2825 |
| 1812 | Ga0500596_005554 | 3300053735 | Bacteria | 2204 |
| 1813 | Ga0500599_004800 | 3300053736 | Bacteria | 1681 |
| 1814 | Ga0500601_000775 | 3300053737 | Bacteria | 4088 |
| 1815 | Ga0501084_0006070 | 3300054114 | Bacteria | 9938 |
| 1816 | Ga0501084_0034876 | 3300054114 | Bacteria | 4208 |
| 1817 | Ga0501084_0086043 | 3300054114 | Bacteria | 2639 |
| 1818 | Ga0501084_0115422 | 3300054114 | Bacteria | 2257 |
| 1819 | Ga0501084_0357249 | 3300054114 | Bacteria | 1234 |
| 1820 | Ga0500661_013504 | 3300055283 | Bacteria | 1472 |
| 1821 | Ga0500661_024384 | 3300055283 | Bacteria | 1069 |
| 1822 | Ga0501082_0004101 | 3300060353 | Bacteria | 12720 |
| 1823 | Ga0501082_0041087 | 3300060353 | Bacteria | 3987 |
| 1824 | Ga0501082_0097758 | 3300060353 | Bacteria | 2538 |
| 1825 | Ga0501082_0117174 | 3300060353 | Bacteria | 2307 |
| 1826 | Ga0501082_0153091 | 3300060353 | Bacteria | 2003 |
| 1827 | Ga0501082_0170403 | 3300060353 | Bacteria | 1893 |
| 1828 | Ga0466962_0027657 | 3300061719 | Bacteria | 2721 |
| 1829 | Ga0530510_0030439 | 3300061734 | Bacteria | 3877 |
| 1830 | Ga0530510_0048029 | 3300061734 | Bacteria | 3085 |
| 1831 | Ga0530510_0242412 | 3300061734 | Bacteria | 1342 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053088 | Ga0500644_0160845 | Ga0500644_0160845_136_894 | 245 |
| 2 | 3300049741 | Ga0501079_0341865 | Ga0501079_0341865_337_1158 | 259 |
| 3 | 3300050495 | nmdc:mga04h51_76776_c1 | nmdc:mga04h51_76776_c1_11_820 | 260 |
| 4 | 3300049573 | Ga0501037_0360432 | Ga0501037_0360432_185_976 | 261 |
| 5 | 3300046663 | Ga0495635_0437632 | Ga0495635_0437632_39_842 | 264 |
| 6 | 3300037853 | Ga0436364_0017639 | Ga0436364_0017639_463_1278 | 267 |
| 7 | 3300049577 | Ga0501041_0163440 | Ga0501041_0163440_31_957 | 271 |
| 8 | 3300049584 | Ga0501068_0258118 | Ga0501068_0258118_136_1062 | 271 |
| 9 | 3300049587 | Ga0501071_0088864 | Ga0501071_0088864_789_1715 | 271 |
| 10 | 3300049588 | Ga0501072_0033267 | Ga0501072_0033267_789_1715 | 271 |
| 11 | 3300049593 | Ga0501077_0039610 | Ga0501077_0039610_1030_1956 | 271 |
| 12 | 3300049741 | Ga0501079_0005301 | Ga0501079_0005301_787_1713 | 271 |
| 13 | 3300054114 | Ga0501084_0086043 | Ga0501084_0086043_554_1480 | 271 |
| 14 | 3300053092 | Ga0500583_0128496 | Ga0500583_0128496_18_842 | 272 |
| 15 | 3300025922 | Ga0207646_10013186 | Ga0207646_100131868 | 273 |
| 16 | 3300039447 | Ga0436361_1018297 | Ga0436361_1018297_310_1146 | 274 |
| 17 | 3300048929 | Ga0496126_0259561 | Ga0496126_0259561_17_847 | 274 |
| 18 | 3300049578 | Ga0501042_0191035 | Ga0501042_0191035_515_1441 | 275 |
| 19 | 3300037312 | Ga0395899_0257482 | Ga0395899_0257482_330_1175 | 276 |
| 20 | 3300050496 | nmdc:mga07m45_104095_c1 | nmdc:mga07m45_104095_c1_25_885 | 277 |
| 21 | 3300049569 | Ga0501032_0221444 | Ga0501032_0221444_368_1213 | 281 |
| 22 | 3300021441 | Ga0213871_10011645 | Ga0213871_100116451 | 282 |
| 23 | 3300039438 | Ga0436360_0872516 | Ga0436360_0872516_2321_3250 | 282 |
| 24 | 3300006846 | Ga0075430_100075877 | Ga0075430_1000758774 | 283 |
| 25 | 3300006847 | Ga0075431_100140002 | Ga0075431_1001400022 | 283 |
| 26 | 3300006880 | Ga0075429_100004847 | Ga0075429_10000484715 | 283 |
| 27 | 3300009147 | Ga0114129_10078313 | Ga0114129_100783136 | 283 |
| 28 | 3300050507 | nmdc:mga05p37_150931_c1 | nmdc:mga05p37_150931_c1_1141_2067 | 283 |
| 29 | 3300050508 | nmdc:mga09592_858_c1 | nmdc:mga09592_858_c1_939_1865 | 283 |
| 30 | 3300050509 | nmdc:mga0qj67_68379_c1 | nmdc:mga0qj67_68379_c1_1251_2177 | 283 |
| 31 | 3300050510 | nmdc:mga06r32_34004_c1 | nmdc:mga06r32_34004_c1_1032_1958 | 283 |
| 32 | 3300037853 | Ga0436364_1273230 | Ga0436364_1273230_553_1437 | 284 |
| 33 | 3300049583 | Ga0501067_0086204 | Ga0501067_0086204_382_1308 | 284 |
| 34 | 3300049585 | Ga0501069_0106904 | Ga0501069_0106904_61_987 | 284 |
| 35 | 3300061734 | Ga0530510_0242412 | Ga0530510_0242412_161_1087 | 284 |
| 36 | 3300046536 | Ga0495587_0001588 | Ga0495587_0001588_91_996 | 285 |
| 37 | 3300031456 | Ga0307513_10108571 | Ga0307513_101085712 | 290 |
| 38 | 3300013297 | Ga0157378_10039107 | Ga0157378_100391071 | 291 |
| 39 | iso_pu_bacteria | 8002392321 | 8002392677 | 291 |
| 40 | 3300031852 | Ga0307410_10053148 | Ga0307410_100531483 | 292 |
| 41 | 3300032126 | Ga0307415_100385468 | Ga0307415_1003854682 | 292 |
| 42 | 3300049591 | Ga0501075_0373331 | Ga0501075_0373331_71_949 | 292 |
| 43 | 3300006847 | Ga0075431_100045239 | Ga0075431_1000452396 | 293 |
| 44 | 3300009147 | Ga0114129_10006174 | Ga0114129_100061745 | 293 |
| 45 | 3300050508 | nmdc:mga09592_41226_c1 | nmdc:mga09592_41226_c1_417_1349 | 293 |
| 46 | 3300046453 | Ga0495627_000007 | Ga0495627_000007_310119_311084 | 294 |
| 47 | 3300046522 | Ga0495643_0039945 | Ga0495643_0039945_69_1046 | 294 |
| 48 | 3300046538 | Ga0495609_0000055 | Ga0495609_0000055_123058_124035 | 294 |
| 49 | 3300047470 | Ga0495681_0000443 | Ga0495681_0000443_21728_22681 | 294 |
| 50 | 3300049572 | Ga0501036_0045657 | Ga0501036_0045657_2764_3690 | 294 |
| 51 | 3300061734 | Ga0530510_0030439 | Ga0530510_0030439_2258_3184 | 294 |
| 52 | 3300037418 | Ga0395900_0004339 | Ga0395900_0004339_9554_10459 | 295 |
| 53 | 3300042876 | Ga0451577_0423127 | Ga0451577_0423127_97_1005 | 295 |
| 54 | 3300046810 | Ga0495660_0000639 | Ga0495660_0000639_13346_14323 | 295 |
| 55 | 3300046454 | Ga0495592_0043205 | Ga0495592_0043205_2421_3362 | 297 |
| 56 | 3300049575 | Ga0501039_0035313 | Ga0501039_0035313_2517_3428 | 297 |
| 57 | 3300049576 | Ga0501040_0156679 | Ga0501040_0156679_169_1080 | 297 |
| 58 | 3300049587 | Ga0501071_0122632 | Ga0501071_0122632_638_1549 | 297 |
| 59 | 3300049588 | Ga0501072_0056563 | Ga0501072_0056563_1338_2249 | 297 |
| 60 | 3300049590 | Ga0501074_0071192 | Ga0501074_0071192_1061_1972 | 297 |
| 61 | 3300049592 | Ga0501076_0030980 | Ga0501076_0030980_2186_3097 | 297 |
| 62 | 3300054114 | Ga0501084_0115422 | Ga0501084_0115422_574_1485 | 297 |
| 63 | 3300060353 | Ga0501082_0170403 | Ga0501082_0170403_450_1361 | 297 |
| 64 | 3300009147 | Ga0114129_10016131 | Ga0114129_100161315 | 298 |
| 65 | 3300049568 | Ga0501031_0028662 | Ga0501031_0028662_2300_3304 | 298 |
| 66 | 3300049569 | Ga0501032_0014407 | Ga0501032_0014407_1059_2012 | 298 |
| 67 | 3300049572 | Ga0501036_0390838 | Ga0501036_0390838_43_1047 | 298 |
| 68 | 3300049574 | Ga0501038_0072671 | Ga0501038_0072671_962_1966 | 299 |
| 69 | 3300049822 | Ga0501035_0011601 | Ga0501035_0011601_1200_2204 | 299 |
| 70 | 3300053139 | Ga0500568_0000019 | Ga0500568_0000019_83034_83954 | 299 |
| 71 | iso_pu_bacteria | 2894772417 | 2894772619 | 299 |
| 72 | 3300050493 | nmdc:mga0k408_107321_c1 | nmdc:mga0k408_107321_c1_554_1456 | 300 |
| 73 | 3300039062 | Ga0400483_016022 | Ga0400483_016022_210_1127 | 301 |
| 74 | 3300039062 | Ga0400483_226394 | Ga0400483_226394_1262_2179 | 301 |
| 75 | 3300046507 | Ga0495606_0096906 | Ga0495606_0096906_751_1677 | 301 |
| 76 | 3300049568 | Ga0501031_0351448 | Ga0501031_0351448_11_916 | 301 |
| 77 | 3300049571 | Ga0501034_0069730 | Ga0501034_0069730_576_1514 | 301 |
| 78 | iso_pu_bacteria | 2585427590 | 2585824954 | 301 |
| 79 | iso_pu_bacteria | 2602042107 | 2603862115 | 301 |
| 80 | iso_pu_bacteria | 2738541317 | 2738944760 | 301 |
| 81 | iso_pu_bacteria | 2913308742 | 2913309381 | 301 |
| 82 | iso_pu_bacteria | 2919073203 | 2919077421 | 301 |
| 83 | 3300003214 | JGI25165J46597_1005560 | JGI25165J46597_10055603 | 302 |
| 84 | 3300025231 | Ga0207427_102270 | Ga0207427_1022704 | 302 |
| 85 | 3300025261 | Ga0209233_1000360 | Ga0209233_10003603 | 302 |
| 86 | 3300025928 | Ga0207700_10222552 | Ga0207700_102225522 | 302 |
| 87 | 3300031249 | Ga0265339_10079522 | Ga0265339_100795223 | 302 |
| 88 | 3300031595 | Ga0265313_10026971 | Ga0265313_100269714 | 302 |
| 89 | 3300031711 | Ga0265314_10198913 | Ga0265314_101989132 | 302 |
| 90 | 3300031712 | Ga0265342_10032697 | Ga0265342_100326972 | 302 |
| 91 | 3300039062 | Ga0400483_244580 | Ga0400483_244580_1373_2293 | 302 |
| 92 | 3300049572 | Ga0501036_0046107 | Ga0501036_0046107_60_1004 | 302 |
| 93 | 3300049579 | Ga0501043_0074640 | Ga0501043_0074640_514_1458 | 302 |
| 94 | 3300049822 | Ga0501035_0293900 | Ga0501035_0293900_167_1105 | 302 |
| 95 | iso_pu_bacteria | 2510917026 | 2511170302 | 302 |
| 96 | iso_pu_bacteria | 2517487022 | 2517567910 | 302 |
| 97 | iso_pu_bacteria | 2537561587 | 2537872810 | 302 |
| 98 | iso_pu_bacteria | 2582581294 | 2585202651 | 302 |
| 99 | iso_pu_bacteria | 2582581294 | 2585204995 | 302 |
| 100 | iso_pu_bacteria | 2582581298 | 2585221918 | 302 |
| 101 | iso_pu_bacteria | 2582581304 | 2585258440 | 302 |
| 102 | iso_pu_bacteria | 2582581304 | 2585259070 | 302 |
| 103 | iso_pu_bacteria | 2582581315 | 2585326800 | 302 |
| 104 | iso_pu_bacteria | 2585427529 | 2585543912 | 302 |
| 105 | iso_pu_bacteria | 2585427633 | 2585998154 | 302 |
| 106 | iso_pu_bacteria | 2585427634 | 2586002731 | 302 |
| 107 | iso_pu_bacteria | 2599185210 | 2599606141 | 302 |
| 108 | iso_pu_bacteria | 2643221558 | 2643814231 | 302 |
| 109 | iso_pu_bacteria | 2643221599 | 2644006856 | 302 |
| 110 | iso_pu_bacteria | 2643221618 | 2644104989 | 302 |
| 111 | iso_pu_bacteria | 2643221655 | 2644307532 | 302 |
| 112 | iso_pu_bacteria | 2643221712 | 2644613618 | 302 |
| 113 | iso_pu_bacteria | 2738541293 | 2738801863 | 302 |
| 114 | iso_pu_bacteria | 2738541317 | 2738944897 | 302 |
| 115 | iso_pu_bacteria | 2802428861 | 2802740879 | 302 |
| 116 | iso_pu_bacteria | 2802428863 | 2802751984 | 302 |
| 117 | iso_pu_bacteria | 2837678835 | 2837680715 | 302 |
| 118 | iso_pu_bacteria | 2842333319 | 2842333839 | 302 |
| 119 | iso_pu_bacteria | 2891048133 | 2891049441 | 302 |
| 120 | iso_pu_bacteria | 2904434214 | 2904439381 | 302 |
| 121 | iso_pu_bacteria | 2913308742 | 2913309520 | 302 |
| 122 | iso_pu_bacteria | 2919100787 | 2919103129 | 302 |
| 123 | iso_pu_bacteria | 2929138655 | 2929143580 | 302 |
| 124 | iso_pu_bacteria | 2937036028 | 2937039307 | 302 |
| 125 | iso_pu_bacteria | 2957437181 | 2957437960 | 302 |
| 126 | iso_pu_bacteria | 2960591022 | 2960591538 | 302 |
| 127 | iso_pu_bacteria | 2960631154 | 2960632279 | 302 |
| 128 | iso_pu_bacteria | 2967728569 | 2967731437 | 302 |
| 129 | iso_pu_bacteria | 2977530762 | 2977536111 | 302 |
| 130 | iso_pu_bacteria | 2978969890 | 2978970381 | 302 |
| 131 | iso_pu_bacteria | 2984587000 | 2984587402 | 302 |
| 132 | iso_pu_bacteria | 2995392953 | 2995396714 | 302 |
| 133 | iso_pu_bacteria | 3005452660 | 3005458225 | 302 |
| 134 | iso_pu_bacteria | 8018150411 | 8018152901 | 302 |
| 135 | iso_pu_bacteria | 8054460903 | 8054464177 | 302 |
| 136 | 3300005563 | Ga0068855_100183174 | Ga0068855_1001831741 | 303 |
| 137 | 3300009148 | Ga0105243_10000028 | Ga0105243_1000002818 | 303 |
| 138 | 3300009176 | Ga0105242_10000184 | Ga0105242_1000018417 | 303 |
| 139 | 3300025934 | Ga0207686_10000019 | Ga0207686_1000001920 | 303 |
| 140 | 3300025935 | Ga0207709_10000064 | Ga0207709_1000006420 | 303 |
| 141 | 3300026142 | Ga0207698_10288402 | Ga0207698_102884022 | 303 |
| 142 | 3300031456 | Ga0307513_10081546 | Ga0307513_100815463 | 303 |
| 143 | 3300031730 | Ga0307516_10202268 | Ga0307516_102022682 | 303 |
| 144 | 3300033180 | Ga0307510_10234916 | Ga0307510_102349161 | 303 |
| 145 | 3300039062 | Ga0400483_132723 | Ga0400483_132723_3437_4357 | 303 |
| 146 | 3300044683 | Ga0466965_0005513 | Ga0466965_0005513_3406_4323 | 303 |
| 147 | 3300044683 | Ga0466965_0224212 | Ga0466965_0224212_25_942 | 303 |
| 148 | 3300046460 | Ga0495638_0021945 | Ga0495638_0021945_529_1461 | 303 |
| 149 | 3300049573 | Ga0501037_0100343 | Ga0501037_0100343_940_1860 | 303 |
| 150 | 3300049574 | Ga0501038_0154527 | Ga0501038_0154527_55_975 | 303 |
| 151 | 3300049823 | Ga0501044_0347259 | Ga0501044_0347259_465_1385 | 303 |
| 152 | iso_pu_bacteria | 2671180139 | 2671692991 | 303 |
| 153 | iso_pu_bacteria | 2881412998 | 2881417966 | 303 |
| 154 | iso_pu_bacteria | 2899803654 | 2899806855 | 303 |
| 155 | iso_pu_bacteria | 2917699015 | 2917703365 | 303 |
| 156 | iso_pu_bacteria | 8048746797 | 8048748964 | 303 |
| 157 | iso_pu_bacteria | 8054563764 | 8054565887 | 303 |
| 158 | iso_pu_bacteria | 8057529695 | 8057533826 | 303 |
| 159 | 3300003187 | JGI25151J46595_10001720 | JGI25151J46595_100017202 | 304 |
| 160 | 3300006051 | Ga0075364_10010568 | Ga0075364_100105685 | 304 |
| 161 | 3300006846 | Ga0075430_100007426 | Ga0075430_1000074269 | 304 |
| 162 | 3300009147 | Ga0114129_10025555 | Ga0114129_100255553 | 304 |
| 163 | 3300025291 | Ga0209675_1005572 | Ga0209675_10055723 | 304 |
| 164 | 3300025294 | Ga0209025_1000018 | Ga0209025_1000018277 | 304 |
| 165 | 3300039450 | Ga0436363_0628780 | Ga0436363_0628780_180_1106 | 304 |
| 166 | 3300046474 | Ga0495605_0043068 | Ga0495605_0043068_628_1554 | 304 |
| 167 | 3300046512 | Ga0495610_0020992 | Ga0495610_0020992_103_1029 | 304 |
| 168 | 3300046522 | Ga0495643_0057135 | Ga0495643_0057135_863_1789 | 304 |
| 169 | 3300046524 | Ga0495648_0007196 | Ga0495648_0007196_6553_7467 | 304 |
| 170 | 3300050491 | nmdc:mga00v17_112602_c1 | nmdc:mga00v17_112602_c1_420_1424 | 304 |
| 171 | 3300050507 | nmdc:mga05p37_156848_c1 | nmdc:mga05p37_156848_c1_887_1813 | 304 |
| 172 | 3300053125 | Ga0500618_000348 | Ga0500618_000348_18752_19675 | 304 |
| 173 | 3300053142 | Ga0500577_0000078 | Ga0500577_0000078_18369_19283 | 304 |
| 174 | 3300053156 | Ga0500622_0000613 | Ga0500622_0000613_28642_29568 | 304 |
| 175 | iso_pu_bacteria | 2510917030 | 2511197483 | 304 |
| 176 | iso_pu_bacteria | 2582581298 | 2585225081 | 304 |
| 177 | iso_pu_bacteria | 2585427529 | 2585547637 | 304 |
| 178 | iso_pu_bacteria | 2585427634 | 2585998717 | 304 |
| 179 | iso_pu_bacteria | 2643221557 | 2643808908 | 304 |
| 180 | iso_pu_bacteria | 2643221610 | 2644068011 | 304 |
| 181 | iso_pu_bacteria | 2643221668 | 2644378432 | 304 |
| 182 | iso_pu_bacteria | 2643221675 | 2644418966 | 304 |
| 183 | iso_pu_bacteria | 2643221680 | 2644453421 | 304 |
| 184 | iso_pu_bacteria | 2643221723 | 2644672386 | 304 |
| 185 | iso_pu_bacteria | 2643221726 | 2644688304 | 304 |
| 186 | iso_pu_bacteria | 2775507049 | 2776910904 | 304 |
| 187 | iso_pu_bacteria | 2841734538 | 2841738856 | 304 |
| 188 | iso_pu_bacteria | 2855730933 | 2855731040 | 304 |
| 189 | iso_pu_bacteria | 2855767633 | 2855770359 | 304 |
| 190 | iso_pu_bacteria | 2871474448 | 2871476845 | 304 |
| 191 | iso_pu_bacteria | 2878788777 | 2878789151 | 304 |
| 192 | iso_pu_bacteria | 2919100787 | 2919105765 | 304 |
| 193 | iso_pu_bacteria | 2919171160 | 2919172236 | 304 |
| 194 | iso_pu_bacteria | 2924733363 | 2924739732 | 304 |
| 195 | iso_pu_bacteria | 2937836603 | 2937842925 | 304 |
| 196 | iso_pu_bacteria | 2958071322 | 2958072263 | 304 |
| 197 | iso_pu_bacteria | 3003665799 | 3003666842 | 304 |
| 198 | iso_pu_bacteria | 3004268573 | 3004274748 | 304 |
| 199 | iso_pu_bacteria | 3005409236 | 3005413616 | 304 |
| 200 | iso_pu_bacteria | 3005445848 | 3005448996 | 304 |
| 201 | iso_pu_bacteria | 8001845381 | 8001847308 | 304 |
| 202 | iso_pu_bacteria | 8004633249 | 8004634324 | 304 |
| 203 | iso_pu_bacteria | 8005301065 | 8005301833 | 304 |
| 204 | iso_pu_bacteria | 8045864390 | 8045866933 | 304 |
| 205 | 3300002773 | JGI25152J39213_1000093 | JGI25152J39213_100009324 | 305 |
| 206 | 3300002774 | JGI25150J39212_1000045 | JGI25150J39212_100004542 | 305 |
| 207 | 3300003187 | JGI25151J46595_10000023 | JGI25151J46595_10000023183 | 305 |
| 208 | 3300003203 | JGI25406J46586_10021358 | JGI25406J46586_100213582 | 305 |
| 209 | 3300003215 | JGI25153J46596_10004272 | JGI25153J46596_100042724 | 305 |
| 210 | 3300003323 | rootH1_10252891 | rootH1_102528912 | 305 |
| 211 | 3300003856 | Ga0058692_1000083 | Ga0058692_100008334 | 305 |
| 212 | 3300003856 | Ga0058692_1000334 | Ga0058692_10003345 | 305 |
| 213 | 3300005436 | Ga0070713_100024691 | Ga0070713_1000246912 | 305 |
| 214 | 3300005445 | Ga0070708_100040043 | Ga0070708_1000400432 | 305 |
| 215 | 3300005468 | Ga0070707_100009136 | Ga0070707_1000091365 | 305 |
| 216 | 3300005518 | Ga0070699_100374399 | Ga0070699_1003743992 | 305 |
| 217 | 3300005536 | Ga0070697_100002285 | Ga0070697_10000228513 | 305 |
| 218 | 3300005546 | Ga0070696_100142431 | Ga0070696_1001424312 | 305 |
| 219 | 3300005985 | Ga0081539_10000259 | Ga0081539_10000259100 | 305 |
| 220 | 3300006038 | Ga0075365_10032401 | Ga0075365_100324012 | 305 |
| 221 | 3300006038 | Ga0075365_10042363 | Ga0075365_100423632 | 305 |
| 222 | 3300006051 | Ga0075364_10000193 | Ga0075364_100001935 | 305 |
| 223 | 3300006051 | Ga0075364_10008004 | Ga0075364_100080042 | 305 |
| 224 | 3300006051 | Ga0075364_10034528 | Ga0075364_100345283 | 305 |
| 225 | 3300006186 | Ga0075369_10009035 | Ga0075369_100090352 | 305 |
| 226 | 3300006186 | Ga0075369_10037856 | Ga0075369_100378563 | 305 |
| 227 | 3300006844 | Ga0075428_100003153 | Ga0075428_10000315316 | 305 |
| 228 | 3300006847 | Ga0075431_100002020 | Ga0075431_10000202013 | 305 |
| 229 | 3300006847 | Ga0075431_100003055 | Ga0075431_1000030555 | 305 |
| 230 | 3300006852 | Ga0075433_10000430 | Ga0075433_1000043016 | 305 |
| 231 | 3300006871 | Ga0075434_100027927 | Ga0075434_1000279277 | 305 |
| 232 | 3300006880 | Ga0075429_100003574 | Ga0075429_1000035747 | 305 |
| 233 | 3300006880 | Ga0075429_100003704 | Ga0075429_10000370410 | 305 |
| 234 | 3300006914 | Ga0075436_100000875 | Ga0075436_1000008756 | 305 |
| 235 | 3300009093 | Ga0105240_10201312 | Ga0105240_102013122 | 305 |
| 236 | 3300009147 | Ga0114129_10000065 | Ga0114129_1000006533 | 305 |
| 237 | 3300009147 | Ga0114129_10001450 | Ga0114129_1000145018 | 305 |
| 238 | 3300009147 | Ga0114129_11134639 | Ga0114129_111346391 | 305 |
| 239 | 3300013105 | Ga0157369_10025423 | Ga0157369_100254232 | 305 |
| 240 | 3300013105 | Ga0157369_10223225 | Ga0157369_102232252 | 305 |
| 241 | 3300021361 | Ga0213872_10036241 | Ga0213872_100362412 | 305 |
| 242 | 3300021377 | Ga0213874_10035511 | Ga0213874_100355112 | 305 |
| 243 | 3300022739 | Ga0228711_1010044 | Ga0228711_101004412 | 305 |
| 244 | 3300022740 | Ga0228710_1010269 | Ga0228710_10102696 | 305 |
| 245 | 3300025245 | Ga0207425_1000038 | Ga0207425_100003847 | 305 |
| 246 | 3300025258 | Ga0209129_1000036 | Ga0209129_100003647 | 305 |
| 247 | 3300025273 | Ga0209673_1026127 | Ga0209673_10261271 | 305 |
| 248 | 3300025294 | Ga0209025_1000108 | Ga0209025_100010847 | 305 |
| 249 | 3300025295 | Ga0209564_1025787 | Ga0209564_10257872 | 305 |
| 250 | 3300025297 | Ga0209758_1000104 | Ga0209758_1000104180 | 305 |
| 251 | 3300025303 | Ga0209051_1028281 | Ga0209051_10282812 | 305 |
| 252 | 3300025910 | Ga0207684_10000920 | Ga0207684_100009205 | 305 |
| 253 | 3300025944 | Ga0207661_10036733 | Ga0207661_100367332 | 305 |
| 254 | 3300025949 | Ga0207667_10450555 | Ga0207667_104505551 | 305 |
| 255 | 3300027312 | Ga0209371_1000251 | Ga0209371_100025148 | 305 |
| 256 | 3300027312 | Ga0209371_1000425 | Ga0209371_100042543 | 305 |
| 257 | 3300030500 | Ga0268256_1000475 | Ga0268256_100047519 | 305 |
| 258 | 3300030500 | Ga0268256_1001004 | Ga0268256_10010045 | 305 |
| 259 | 3300031727 | Ga0316576_10116137 | Ga0316576_101161371 | 305 |
| 260 | 3300031901 | Ga0307406_10009687 | Ga0307406_100096872 | 305 |
| 261 | 3300031911 | Ga0307412_10005563 | Ga0307412_100055636 | 305 |
| 262 | 3300032004 | Ga0307414_10037909 | Ga0307414_100379093 | 305 |
| 263 | 3300037418 | Ga0395900_0068312 | Ga0395900_0068312_2162_3088 | 305 |
| 264 | 3300037466 | Ga0395898_0030072 | Ga0395898_0030072_3797_4723 | 305 |
| 265 | 3300039062 | Ga0400483_191502 | Ga0400483_191502_246_1172 | 305 |
| 266 | 3300044694 | Ga0466963_0080911 | Ga0466963_0080911_1112_2038 | 305 |
| 267 | 3300044719 | Ga0466971_0059768 | Ga0466971_0059768_95_1087 | 305 |
| 268 | 3300045049 | Ga0466959_0064143 | Ga0466959_0064143_1506_2498 | 305 |
| 269 | 3300046460 | Ga0495638_0000632 | Ga0495638_0000632_35214_36140 | 305 |
| 270 | 3300046471 | Ga0495650_0078515 | Ga0495650_0078515_339_1265 | 305 |
| 271 | 3300046501 | Ga0495607_0005882 | Ga0495607_0005882_208_1134 | 305 |
| 272 | 3300046507 | Ga0495606_0130004 | Ga0495606_0130004_67_984 | 305 |
| 273 | 3300046512 | Ga0495610_0009082 | Ga0495610_0009082_128_1054 | 305 |
| 274 | 3300046512 | Ga0495610_0031592 | Ga0495610_0031592_657_1574 | 305 |
| 275 | 3300046512 | Ga0495610_0076902 | Ga0495610_0076902_586_1512 | 305 |
| 276 | 3300046513 | Ga0495616_0011852 | Ga0495616_0011852_455_1372 | 305 |
| 277 | 3300046515 | Ga0495620_0025454 | Ga0495620_0025454_953_1879 | 305 |
| 278 | 3300046518 | Ga0495631_0064306 | Ga0495631_0064306_544_1461 | 305 |
| 279 | 3300046519 | Ga0495632_0000078 | Ga0495632_0000078_67858_68784 | 305 |
| 280 | 3300046519 | Ga0495632_0000392 | Ga0495632_0000392_25120_26046 | 305 |
| 281 | 3300046522 | Ga0495643_0031491 | Ga0495643_0031491_437_1354 | 305 |
| 282 | 3300046524 | Ga0495648_0004816 | Ga0495648_0004816_7838_8755 | 305 |
| 283 | 3300046524 | Ga0495648_0068816 | Ga0495648_0068816_307_1224 | 305 |
| 284 | 3300046530 | Ga0495654_0000152 | Ga0495654_0000152_5122_6048 | 305 |
| 285 | 3300046530 | Ga0495654_0010946 | Ga0495654_0010946_258_1175 | 305 |
| 286 | 3300046558 | Ga0495633_0024938 | Ga0495633_0024938_1264_2190 | 305 |
| 287 | 3300046558 | Ga0495633_0051932 | Ga0495633_0051932_63_989 | 305 |
| 288 | 3300046615 | Ga0495656_0039529 | Ga0495656_0039529_939_1865 | 305 |
| 289 | 3300046660 | Ga0495625_0003310 | Ga0495625_0003310_6513_7430 | 305 |
| 290 | 3300046665 | Ga0495661_0029524 | Ga0495661_0029524_2386_3303 | 305 |
| 291 | 3300046674 | Ga0495588_0004100 | Ga0495588_0004100_664_1590 | 305 |
| 292 | 3300046691 | Ga0495670_0000775 | Ga0495670_0000775_13524_14441 | 305 |
| 293 | 3300046692 | Ga0495671_0007355 | Ga0495671_0007355_4825_5742 | 305 |
| 294 | 3300046694 | Ga0495649_0031993 | Ga0495649_0031993_867_1841 | 305 |
| 295 | 3300046810 | Ga0495660_0055865 | Ga0495660_0055865_895_1812 | 305 |
| 296 | 3300047318 | Ga0495636_0017842 | Ga0495636_0017842_611_1537 | 305 |
| 297 | 3300047320 | Ga0495672_0011801 | Ga0495672_0011801_3463_4389 | 305 |
| 298 | 3300047470 | Ga0495681_0005328 | Ga0495681_0005328_474_1400 | 305 |
| 299 | 3300047470 | Ga0495681_0061535 | Ga0495681_0061535_219_1145 | 305 |
| 300 | 3300047472 | Ga0495686_0027943 | Ga0495686_0027943_1349_2275 | 305 |
| 301 | 3300048904 | Ga0496101_0062275 | Ga0496101_0062275_1650_2576 | 305 |
| 302 | 3300048919 | Ga0496116_0000583 | Ga0496116_0000583_11575_12501 | 305 |
| 303 | 3300048919 | Ga0496116_0002160 | Ga0496116_0002160_7511_8428 | 305 |
| 304 | 3300048919 | Ga0496116_0031220 | Ga0496116_0031220_1053_1979 | 305 |
| 305 | 3300048920 | Ga0496117_0001578 | Ga0496117_0001578_18686_19612 | 305 |
| 306 | 3300048920 | Ga0496117_0003177 | Ga0496117_0003177_4252_5178 | 305 |
| 307 | 3300048920 | Ga0496117_0019052 | Ga0496117_0019052_2189_3118 | 305 |
| 308 | 3300048920 | Ga0496117_0041847 | Ga0496117_0041847_1938_2864 | 305 |
| 309 | 3300048920 | Ga0496117_0047973 | Ga0496117_0047973_12_929 | 305 |
| 310 | 3300048921 | Ga0496118_0001250 | Ga0496118_0001250_36467_37393 | 305 |
| 311 | 3300048921 | Ga0496118_0010621 | Ga0496118_0010621_5983_6912 | 305 |
| 312 | 3300048921 | Ga0496118_0018142 | Ga0496118_0018142_2427_3353 | 305 |
| 313 | 3300048921 | Ga0496118_0018819 | Ga0496118_0018819_3431_4357 | 305 |
| 314 | 3300048921 | Ga0496118_0095666 | Ga0496118_0095666_606_1532 | 305 |
| 315 | 3300048922 | Ga0496119_0000478 | Ga0496119_0000478_10823_11755 | 305 |
| 316 | 3300048922 | Ga0496119_0154324 | Ga0496119_0154324_86_1012 | 305 |
| 317 | 3300048923 | Ga0496120_0091942 | Ga0496120_0091942_483_1409 | 305 |
| 318 | 3300048924 | Ga0496121_0000138 | Ga0496121_0000138_43192_44118 | 305 |
| 319 | 3300048924 | Ga0496121_0000240 | Ga0496121_0000240_82843_83769 | 305 |
| 320 | 3300048924 | Ga0496121_0009567 | Ga0496121_0009567_9266_10195 | 305 |
| 321 | 3300048924 | Ga0496121_0067138 | Ga0496121_0067138_196_1122 | 305 |
| 322 | 3300048925 | Ga0496122_0000634 | Ga0496122_0000634_25242_26174 | 305 |
| 323 | 3300048925 | Ga0496122_0000889 | Ga0496122_0000889_1845_2771 | 305 |
| 324 | 3300048925 | Ga0496122_0010631 | Ga0496122_0010631_6092_7021 | 305 |
| 325 | 3300048925 | Ga0496122_0035330 | Ga0496122_0035330_2231_3157 | 305 |
| 326 | 3300048925 | Ga0496122_0075500 | Ga0496122_0075500_1000_1917 | 305 |
| 327 | 3300048925 | Ga0496122_0112977 | Ga0496122_0112977_174_1100 | 305 |
| 328 | 3300048925 | Ga0496122_0143621 | Ga0496122_0143621_53_979 | 305 |
| 329 | 3300048926 | Ga0496123_0000736 | Ga0496123_0000736_20686_21618 | 305 |
| 330 | 3300048926 | Ga0496123_0005560 | Ga0496123_0005560_812_1738 | 305 |
| 331 | 3300048926 | Ga0496123_0018413 | Ga0496123_0018413_2231_3148 | 305 |
| 332 | 3300048926 | Ga0496123_0018897 | Ga0496123_0018897_3400_4329 | 305 |
| 333 | 3300048926 | Ga0496123_0080981 | Ga0496123_0080981_262_1188 | 305 |
| 334 | 3300048926 | Ga0496123_0110235 | Ga0496123_0110235_169_1095 | 305 |
| 335 | 3300048927 | Ga0496124_0000023 | Ga0496124_0000023_297895_298821 | 305 |
| 336 | 3300048927 | Ga0496124_0000139 | Ga0496124_0000139_125651_126625 | 305 |
| 337 | 3300048927 | Ga0496124_0005342 | Ga0496124_0005342_9005_9931 | 305 |
| 338 | 3300048927 | Ga0496124_0022423 | Ga0496124_0022423_1285_2211 | 305 |
| 339 | 3300048927 | Ga0496124_0098614 | Ga0496124_0098614_994_1920 | 305 |
| 340 | 3300048928 | Ga0496125_0000182 | Ga0496125_0000182_117051_117977 | 305 |
| 341 | 3300048928 | Ga0496125_0004131 | Ga0496125_0004131_8341_9270 | 305 |
| 342 | 3300048929 | Ga0496126_0102228 | Ga0496126_0102228_941_1867 | 305 |
| 343 | 3300048929 | Ga0496126_0167438 | Ga0496126_0167438_310_1236 | 305 |
| 344 | 3300049569 | Ga0501032_0043053 | Ga0501032_0043053_995_1921 | 305 |
| 345 | 3300049571 | Ga0501034_0001365 | Ga0501034_0001365_16319_17245 | 305 |
| 346 | 3300049580 | Ga0501046_0031080 | Ga0501046_0031080_3320_4246 | 305 |
| 347 | 3300049581 | Ga0501047_0106562 | Ga0501047_0106562_896_1822 | 305 |
| 348 | 3300049744 | Ga0501083_0012684 | Ga0501083_0012684_1705_2673 | 305 |
| 349 | 3300049822 | Ga0501035_0007115 | Ga0501035_0007115_888_1814 | 305 |
| 350 | 3300049823 | Ga0501044_0063135 | Ga0501044_0063135_1060_1986 | 305 |
| 351 | 3300050491 | nmdc:mga00v17_11836_c1 | nmdc:mga00v17_11836_c1_2714_3640 | 305 |
| 352 | 3300050491 | nmdc:mga00v17_178_c1 | nmdc:mga00v17_178_c1_31252_32178 | 305 |
| 353 | 3300050491 | nmdc:mga00v17_26284_c1 | nmdc:mga00v17_26284_c1_695_1612 | 305 |
| 354 | 3300050496 | nmdc:mga07m45_72816_c1 | nmdc:mga07m45_72816_c1_671_1588 | 305 |
| 355 | 3300050507 | nmdc:mga05p37_2636_c1 | nmdc:mga05p37_2636_c1_145_1074 | 305 |
| 356 | 3300050507 | nmdc:mga05p37_3032_c1 | nmdc:mga05p37_3032_c1_12758_13690 | 305 |
| 357 | 3300050507 | nmdc:mga05p37_967_c1 | nmdc:mga05p37_967_c1_28470_29402 | 305 |
| 358 | 3300050508 | nmdc:mga09592_3458_c1 | nmdc:mga09592_3458_c1_4929_5858 | 305 |
| 359 | 3300050508 | nmdc:mga09592_9739_c1 | nmdc:mga09592_9739_c1_1388_2320 | 305 |
| 360 | 3300050510 | nmdc:mga06r32_6916_c1 | nmdc:mga06r32_6916_c1_6262_7191 | 305 |
| 361 | 3300050510 | nmdc:mga06r32_7062_c1 | nmdc:mga06r32_7062_c1_3502_4440 | 305 |
| 362 | 3300050512 | nmdc:mga0n895_2596_c1 | nmdc:mga0n895_2596_c1_12530_13462 | 305 |
| 363 | 3300050513 | nmdc:mga0rr50_429_c1 | nmdc:mga0rr50_429_c1_8053_8985 | 305 |
| 364 | 3300050514 | nmdc:mga08x19_767_c1 | nmdc:mga08x19_767_c1_12133_13065 | 305 |
| 365 | 3300050515 | nmdc:mga0a205_38067_c1 | nmdc:mga0a205_38067_c1_3157_4089 | 305 |
| 366 | 3300053087 | Ga0500643_048642 | Ga0500643_048642_203_1120 | 305 |
| 367 | 3300053088 | Ga0500644_0000490 | Ga0500644_0000490_366_1283 | 305 |
| 368 | 3300053093 | Ga0500651_0024276 | Ga0500651_0024276_439_1356 | 305 |
| 369 | 3300053093 | Ga0500651_0092970 | Ga0500651_0092970_336_1253 | 305 |
| 370 | 3300053096 | Ga0500641_0005082 | Ga0500641_0005082_2585_3502 | 305 |
| 371 | 3300053098 | Ga0500650_0001074 | Ga0500650_0001074_4606_5523 | 305 |
| 372 | 3300053104 | Ga0500556_0000023 | Ga0500556_0000023_122828_123760 | 305 |
| 373 | 3300053107 | Ga0500560_000134 | Ga0500560_000134_28_954 | 305 |
| 374 | 3300053107 | Ga0500560_002379 | Ga0500560_002379_974_1900 | 305 |
| 375 | 3300053108 | Ga0500562_006887 | Ga0500562_006887_196_1113 | 305 |
| 376 | 3300053108 | Ga0500562_026751 | Ga0500562_026751_10_936 | 305 |
| 377 | 3300053111 | Ga0500572_001926 | Ga0500572_001926_3863_4789 | 305 |
| 378 | 3300053111 | Ga0500572_020475 | Ga0500572_020475_274_1200 | 305 |
| 379 | 3300053116 | Ga0500592_010240 | Ga0500592_010240_153_1070 | 305 |
| 380 | 3300053117 | Ga0500593_093092 | Ga0500593_093092_248_1165 | 305 |
| 381 | 3300053118 | Ga0500594_0000814 | Ga0500594_0000814_5473_6390 | 305 |
| 382 | 3300053130 | Ga0500642_0000005 | Ga0500642_0000005_314444_315361 | 305 |
| 383 | 3300053134 | Ga0500658_0000786 | Ga0500658_0000786_10776_11693 | 305 |
| 384 | 3300053139 | Ga0500568_0000246 | Ga0500568_0000246_35507_36424 | 305 |
| 385 | 3300053139 | Ga0500568_0000440 | Ga0500568_0000440_1588_2514 | 305 |
| 386 | 3300053140 | Ga0500573_0003907 | Ga0500573_0003907_987_1913 | 305 |
| 387 | 3300053142 | Ga0500577_0084835 | Ga0500577_0084835_153_1070 | 305 |
| 388 | 3300053142 | Ga0500577_0099490 | Ga0500577_0099490_108_1034 | 305 |
| 389 | 3300053151 | Ga0500604_0000324 | Ga0500604_0000324_9610_10527 | 305 |
| 390 | 3300053153 | Ga0500616_0000351 | Ga0500616_0000351_53156_54082 | 305 |
| 391 | 3300053153 | Ga0500616_0000681 | Ga0500616_0000681_12171_13097 | 305 |
| 392 | 3300053156 | Ga0500622_0001984 | Ga0500622_0001984_13208_14137 | 305 |
| 393 | 3300053157 | Ga0500624_000452 | Ga0500624_000452_5010_5936 | 305 |
| 394 | 3300053161 | Ga0500634_0000073 | Ga0500634_0000073_12953_13879 | 305 |
| 395 | 3300053161 | Ga0500634_0002205 | Ga0500634_0002205_1720_2646 | 305 |
| 396 | 3300053161 | Ga0500634_0021157 | Ga0500634_0021157_243_1265 | 305 |
| 397 | 3300053177 | Ga0500636_0001446 | Ga0500636_0001446_5905_6831 | 305 |
| 398 | 3300053730 | Ga0500645_015458 | Ga0500645_015458_832_1749 | 305 |
| 399 | 3300053730 | Ga0500645_017977 | Ga0500645_017977_1154_2086 | 305 |
| 400 | 3300060353 | Ga0501082_0041087 | Ga0501082_0041087_1903_2958 | 305 |
| 401 | iso_pu_bacteria | 2511231024 | 2511373572 | 305 |
| 402 | iso_pu_bacteria | 2643221734 | 2644737969 | 305 |
| 403 | iso_pu_bacteria | 2643221736 | 2644743974 | 305 |
| 404 | iso_pu_bacteria | 2818991467 | 2819720666 | 305 |
| 405 | iso_pu_bacteria | 2828305725 | 2828310309 | 305 |
| 406 | iso_pu_bacteria | 2841760612 | 2841764200 | 305 |
| 407 | iso_pu_bacteria | 2841911363 | 2841913837 | 305 |
| 408 | iso_pu_bacteria | 2841917233 | 2841919554 | 305 |
| 409 | iso_pu_bacteria | 2842521101 | 2842526983 | 305 |
| 410 | iso_pu_bacteria | 2842694124 | 2842695851 | 305 |
| 411 | iso_pu_bacteria | 2844104063 | 2844108345 | 305 |
| 412 | iso_pu_bacteria | 2851182111 | 2851185518 | 305 |
| 413 | iso_pu_bacteria | 2851246043 | 2851250635 | 305 |
| 414 | iso_pu_bacteria | 2881161766 | 2881163622 | 305 |
| 415 | iso_pu_bacteria | 2917699015 | 2917702753 | 305 |
| 416 | iso_pu_bacteria | 643348564 | 643605132 | 305 |
| 417 | iso_pu_bacteria | 8057529695 | 8057533717 | 305 |
| 418 | 3300003771 | Ga0055526_1000062 | Ga0055526_100006224 | 306 |
| 419 | 3300003775 | Ga0055524_1000011 | Ga0055524_100001166 | 306 |
| 420 | 3300003784 | Ga0055534_1012482 | Ga0055534_10124822 | 306 |
| 421 | 3300005355 | Ga0070671_100373939 | Ga0070671_1003739392 | 306 |
| 422 | 3300005445 | Ga0070708_100199091 | Ga0070708_1001990912 | 306 |
| 423 | 3300013250 | Ga0171462_1023 | Ga0171462_1023115 | 306 |
| 424 | 3300025273 | Ga0209673_1007005 | Ga0209673_10070054 | 306 |
| 425 | 3300025291 | Ga0209675_1000274 | Ga0209675_100027435 | 306 |
| 426 | 3300025295 | Ga0209564_1000143 | Ga0209564_100014365 | 306 |
| 427 | 3300025299 | Ga0209256_1000111 | Ga0209256_100011191 | 306 |
| 428 | 3300031090 | Ga0265760_10007459 | Ga0265760_100074592 | 306 |
| 429 | 3300031548 | Ga0307408_100001144 | Ga0307408_10000114417 | 306 |
| 430 | 3300031731 | Ga0307405_10204202 | Ga0307405_102042021 | 306 |
| 431 | 3300031901 | Ga0307406_10000141 | Ga0307406_1000014112 | 306 |
| 432 | 3300037418 | Ga0395900_0163053 | Ga0395900_0163053_1021_1983 | 306 |
| 433 | 3300044712 | Ga0453684_0097814 | Ga0453684_0097814_2421_3359 | 306 |
| 434 | 3300046462 | Ga0495651_0155481 | Ga0495651_0155481_120_1073 | 306 |
| 435 | 3300046474 | Ga0495605_0000658 | Ga0495605_0000658_22906_23835 | 306 |
| 436 | 3300046501 | Ga0495607_0000024 | Ga0495607_0000024_11050_11979 | 306 |
| 437 | 3300046501 | Ga0495607_0080348 | Ga0495607_0080348_516_1445 | 306 |
| 438 | 3300046513 | Ga0495616_0003258 | Ga0495616_0003258_7027_7956 | 306 |
| 439 | 3300046513 | Ga0495616_0055101 | Ga0495616_0055101_621_1550 | 306 |
| 440 | 3300046520 | Ga0495637_0000279 | Ga0495637_0000279_1794_2723 | 306 |
| 441 | 3300046522 | Ga0495643_0000757 | Ga0495643_0000757_16012_16941 | 306 |
| 442 | 3300046810 | Ga0495660_0005079 | Ga0495660_0005079_1004_1933 | 306 |
| 443 | 3300047469 | Ga0495673_0000530 | Ga0495673_0000530_22967_23896 | 306 |
| 444 | 3300048091 | Ga0495626_0000412 | Ga0495626_0000412_19294_20223 | 306 |
| 445 | 3300048908 | Ga0496105_0310946 | Ga0496105_0310946_255_1175 | 306 |
| 446 | 3300049459 | Ga0495678_000143 | Ga0495678_000143_37267_38196 | 306 |
| 447 | 3300049459 | Ga0495678_010019 | Ga0495678_010019_2061_2990 | 306 |
| 448 | 3300049571 | Ga0501034_0022443 | Ga0501034_0022443_114_1043 | 306 |
| 449 | 3300049571 | Ga0501034_0125451 | Ga0501034_0125451_567_1517 | 306 |
| 450 | 3300049571 | Ga0501034_0434183 | Ga0501034_0434183_185_1114 | 306 |
| 451 | 3300049573 | Ga0501037_0041694 | Ga0501037_0041694_2226_3155 | 306 |
| 452 | 3300049574 | Ga0501038_0298123 | Ga0501038_0298123_155_1075 | 306 |
| 453 | 3300049581 | Ga0501047_0003444 | Ga0501047_0003444_8827_9756 | 306 |
| 454 | 3300049776 | Ga0501280_001117 | Ga0501280_001117_2016_2945 | 306 |
| 455 | 3300050491 | nmdc:mga00v17_63931_c1 | nmdc:mga00v17_63931_c1_973_1893 | 306 |
| 456 | iso_pu_bacteria | 2513237146 | 2513928748 | 306 |
| 457 | iso_pu_bacteria | 2599185170 | 2599415043 | 306 |
| 458 | iso_pu_bacteria | 2643221651 | 2644288012 | 306 |
| 459 | iso_pu_bacteria | 2643221733 | 2644729597 | 306 |
| 460 | iso_pu_bacteria | 2738541277 | 2738723897 | 306 |
| 461 | iso_pu_bacteria | 2738543019 | 2739284628 | 306 |
| 462 | iso_pu_bacteria | 2784132148 | 2784593075 | 306 |
| 463 | iso_pu_bacteria | 2786546132 | 2786666553 | 306 |
| 464 | iso_pu_bacteria | 2838035591 | 2838039232 | 306 |
| 465 | iso_pu_bacteria | 2838661181 | 2838667656 | 306 |
| 466 | iso_pu_bacteria | 2933016740 | 2933018519 | 306 |
| 467 | iso_pu_bacteria | 2954673503 | 2954681640 | 306 |
| 468 | iso_pu_bacteria | 2954731030 | 2954732045 | 306 |
| 469 | iso_pu_bacteria | 8055225921 | 8055226586 | 306 |
| 470 | 3300003214 | JGI25165J46597_1000020 | JGI25165J46597_1000020212 | 307 |
| 471 | 3300003792 | Ga0055540_1000705 | Ga0055540_10007054 | 307 |
| 472 | 3300003792 | Ga0055540_1011777 | Ga0055540_10117772 | 307 |
| 473 | 3300003794 | Ga0055531_10007706 | Ga0055531_100077062 | 307 |
| 474 | 3300005719 | Ga0068861_100196607 | Ga0068861_1001966072 | 307 |
| 475 | 3300005843 | Ga0068860_100463404 | Ga0068860_1004634042 | 307 |
| 476 | 3300005981 | Ga0081538_10054608 | Ga0081538_100546082 | 307 |
| 477 | 3300006038 | Ga0075365_10079692 | Ga0075365_100796923 | 307 |
| 478 | 3300006038 | Ga0075365_10171676 | Ga0075365_101716761 | 307 |
| 479 | 3300006353 | Ga0075370_10053554 | Ga0075370_100535541 | 307 |
| 480 | 3300006846 | Ga0075430_100280033 | Ga0075430_1002800332 | 307 |
| 481 | 3300006880 | Ga0075429_100211156 | Ga0075429_1002111562 | 307 |
| 482 | 3300009148 | Ga0105243_10000106 | Ga0105243_1000010650 | 307 |
| 483 | 3300014325 | Ga0163163_10010953 | Ga0163163_100109534 | 307 |
| 484 | 3300021377 | Ga0213874_10000725 | Ga0213874_100007254 | 307 |
| 485 | 3300021377 | Ga0213874_10003303 | Ga0213874_100033031 | 307 |
| 486 | 3300021388 | Ga0213875_10004342 | Ga0213875_100043422 | 307 |
| 487 | 3300025261 | Ga0209233_1000047 | Ga0209233_1000047123 | 307 |
| 488 | 3300025273 | Ga0209673_1038826 | Ga0209673_10388262 | 307 |
| 489 | 3300025292 | Ga0209676_1053345 | Ga0209676_10533451 | 307 |
| 490 | 3300025303 | Ga0209051_1000114 | Ga0209051_1000114137 | 307 |
| 491 | 3300025303 | Ga0209051_1000350 | Ga0209051_100035043 | 307 |
| 492 | 3300025304 | Ga0209257_1000015 | Ga0209257_1000015764 | 307 |
| 493 | 3300025909 | Ga0207705_10121261 | Ga0207705_101212612 | 307 |
| 494 | 3300025928 | Ga0207700_10294979 | Ga0207700_102949792 | 307 |
| 495 | 3300025935 | Ga0207709_10000077 | Ga0207709_10000077117 | 307 |
| 496 | 3300026118 | Ga0207675_100198698 | Ga0207675_1001986983 | 307 |
| 497 | 3300028381 | Ga0268264_10356976 | Ga0268264_103569761 | 307 |
| 498 | 3300028794 | Ga0307515_10034944 | Ga0307515_100349448 | 307 |
| 499 | 3300031728 | Ga0316578_10107579 | Ga0316578_101075793 | 307 |
| 500 | 3300032004 | Ga0307414_10262379 | Ga0307414_102623792 | 307 |
| 501 | 3300032004 | Ga0307414_10388290 | Ga0307414_103882901 | 307 |
| 502 | 3300032005 | Ga0307411_10053380 | Ga0307411_100533802 | 307 |
| 503 | 3300035398 | Ga0316574_0306155 | Ga0316574_0306155_42_995 | 307 |
| 504 | 3300036712 | Ga0316584_0027739 | Ga0316584_0027739_1474_2427 | 307 |
| 505 | 3300037312 | Ga0395899_0002482 | Ga0395899_0002482_6207_7148 | 307 |
| 506 | 3300037418 | Ga0395900_0027248 | Ga0395900_0027248_2969_3904 | 307 |
| 507 | 3300037418 | Ga0395900_0109149 | Ga0395900_0109149_1159_2097 | 307 |
| 508 | 3300037418 | Ga0395900_0423143 | Ga0395900_0423143_201_1142 | 307 |
| 509 | 3300037466 | Ga0395898_0005265 | Ga0395898_0005265_11478_12416 | 307 |
| 510 | 3300037466 | Ga0395898_0037278 | Ga0395898_0037278_3234_4169 | 307 |
| 511 | 3300037471 | Ga0395905_0005945 | Ga0395905_0005945_5641_6582 | 307 |
| 512 | 3300037471 | Ga0395905_0056296 | Ga0395905_0056296_327_1262 | 307 |
| 513 | 3300037853 | Ga0436364_0250721 | Ga0436364_0250721_487_1437 | 307 |
| 514 | 3300038443 | Ga0395901_0014750 | Ga0395901_0014750_4856_5791 | 307 |
| 515 | 3300038443 | Ga0395901_0028762 | Ga0395901_0028762_3713_4651 | 307 |
| 516 | 3300039453 | Ga0436362_1134067 | Ga0436362_1134067_4343_5293 | 307 |
| 517 | 3300044673 | Ga0453683_0039263 | Ga0453683_0039263_118_1122 | 307 |
| 518 | 3300045051 | Ga0451576_0011400 | Ga0451576_0011400_3982_4986 | 307 |
| 519 | 3300045051 | Ga0451576_0443228 | Ga0451576_0443228_253_1185 | 307 |
| 520 | 3300046454 | Ga0495592_0017948 | Ga0495592_0017948_4225_5163 | 307 |
| 521 | 3300046455 | Ga0495603_0016135 | Ga0495603_0016135_2825_3763 | 307 |
| 522 | 3300046458 | Ga0495591_003223 | Ga0495591_003223_5250_6188 | 307 |
| 523 | 3300046462 | Ga0495651_0004548 | Ga0495651_0004548_879_1817 | 307 |
| 524 | 3300046471 | Ga0495650_0001505 | Ga0495650_0001505_17676_18614 | 307 |
| 525 | 3300046471 | Ga0495650_0006708 | Ga0495650_0006708_4014_4952 | 307 |
| 526 | 3300046472 | Ga0495580_0037235 | Ga0495580_0037235_754_1692 | 307 |
| 527 | 3300046473 | Ga0495582_0005799 | Ga0495582_0005799_4586_5524 | 307 |
| 528 | 3300046476 | Ga0495662_0020563 | Ga0495662_0020563_1967_2905 | 307 |
| 529 | 3300046477 | Ga0495664_0014537 | Ga0495664_0014537_1683_2621 | 307 |
| 530 | 3300046477 | Ga0495664_0054520 | Ga0495664_0054520_587_1525 | 307 |
| 531 | 3300046499 | Ga0495594_0090319 | Ga0495594_0090319_155_1093 | 307 |
| 532 | 3300046500 | Ga0495596_0003637 | Ga0495596_0003637_4165_5103 | 307 |
| 533 | 3300046507 | Ga0495606_0035300 | Ga0495606_0035300_591_1529 | 307 |
| 534 | 3300046511 | Ga0495608_0001782 | Ga0495608_0001782_10539_11477 | 307 |
| 535 | 3300046514 | Ga0495618_0111286 | Ga0495618_0111286_589_1527 | 307 |
| 536 | 3300046516 | Ga0495628_0038197 | Ga0495628_0038197_60_998 | 307 |
| 537 | 3300046517 | Ga0495630_0021991 | Ga0495630_0021991_1684_2622 | 307 |
| 538 | 3300046524 | Ga0495648_0017191 | Ga0495648_0017191_2727_3665 | 307 |
| 539 | 3300046526 | Ga0495666_0003127 | Ga0495666_0003127_4698_5636 | 307 |
| 540 | 3300046526 | Ga0495666_0003603 | Ga0495666_0003603_2877_3815 | 307 |
| 541 | 3300046528 | Ga0495642_0060718 | Ga0495642_0060718_299_1234 | 307 |
| 542 | 3300046531 | Ga0495665_0019828 | Ga0495665_0019828_1137_2075 | 307 |
| 543 | 3300046531 | Ga0495665_0131765 | Ga0495665_0131765_290_1228 | 307 |
| 544 | 3300046533 | Ga0495640_0011322 | Ga0495640_0011322_4447_5385 | 307 |
| 545 | 3300046536 | Ga0495587_0017552 | Ga0495587_0017552_2910_3848 | 307 |
| 546 | 3300046536 | Ga0495587_0140324 | Ga0495587_0140324_107_1045 | 307 |
| 547 | 3300046539 | Ga0495621_0008537 | Ga0495621_0008537_328_1272 | 307 |
| 548 | 3300046542 | Ga0495597_0000067 | Ga0495597_0000067_77841_78782 | 307 |
| 549 | 3300046642 | Ga0495634_0025613 | Ga0495634_0025613_1672_2610 | 307 |
| 550 | 3300046665 | Ga0495661_0004742 | Ga0495661_0004742_7040_7978 | 307 |
| 551 | 3300046665 | Ga0495661_0098104 | Ga0495661_0098104_458_1396 | 307 |
| 552 | 3300046674 | Ga0495588_0034945 | Ga0495588_0034945_585_1523 | 307 |
| 553 | 3300046678 | Ga0495599_0010870 | Ga0495599_0010870_3230_4168 | 307 |
| 554 | 3300046679 | Ga0495623_0022836 | Ga0495623_0022836_2658_3596 | 307 |
| 555 | 3300046679 | Ga0495623_0098492 | Ga0495623_0098492_267_1205 | 307 |
| 556 | 3300046680 | Ga0495646_0014066 | Ga0495646_0014066_1102_2040 | 307 |
| 557 | 3300046680 | Ga0495646_0022116 | Ga0495646_0022116_2259_3197 | 307 |
| 558 | 3300046690 | Ga0495624_0009857 | Ga0495624_0009857_5587_6525 | 307 |
| 559 | 3300046692 | Ga0495671_0089719 | Ga0495671_0089719_401_1339 | 307 |
| 560 | 3300046694 | Ga0495649_0100456 | Ga0495649_0100456_492_1430 | 307 |
| 561 | 3300046809 | Ga0495600_0001270 | Ga0495600_0001270_12338_13276 | 307 |
| 562 | 3300047315 | Ga0495581_0028284 | Ga0495581_0028284_1605_2543 | 307 |
| 563 | 3300047315 | Ga0495581_0029693 | Ga0495581_0029693_227_1165 | 307 |
| 564 | 3300047317 | Ga0495604_0023467 | Ga0495604_0023467_3149_4087 | 307 |
| 565 | 3300047317 | Ga0495604_0033682 | Ga0495604_0033682_290_1228 | 307 |
| 566 | 3300047317 | Ga0495604_0041977 | Ga0495604_0041977_1014_1952 | 307 |
| 567 | 3300047322 | Ga0495680_0108550 | Ga0495680_0108550_577_1515 | 307 |
| 568 | 3300047323 | Ga0495683_0005297 | Ga0495683_0005297_846_1784 | 307 |
| 569 | 3300047443 | Ga0495687_008477 | Ga0495687_008477_4872_5807 | 307 |
| 570 | 3300047444 | Ga0495675_0004966 | Ga0495675_0004966_5061_5999 | 307 |
| 571 | 3300047446 | Ga0495679_007570 | Ga0495679_007570_1502_2440 | 307 |
| 572 | 3300047446 | Ga0495679_012872 | Ga0495679_012872_1554_2492 | 307 |
| 573 | 3300047469 | Ga0495673_0014011 | Ga0495673_0014011_3222_4160 | 307 |
| 574 | 3300047471 | Ga0495684_0071430 | Ga0495684_0071430_1057_1995 | 307 |
| 575 | 3300048088 | Ga0495602_0010425 | Ga0495602_0010425_6811_7749 | 307 |
| 576 | 3300048088 | Ga0495602_0064539 | Ga0495602_0064539_1474_2412 | 307 |
| 577 | 3300048089 | Ga0495614_0002892 | Ga0495614_0002892_1535_2473 | 307 |
| 578 | 3300048904 | Ga0496101_0300851 | Ga0496101_0300851_155_1093 | 307 |
| 579 | 3300048906 | Ga0496103_0097643 | Ga0496103_0097643_398_1342 | 307 |
| 580 | 3300048907 | Ga0496104_0284182 | Ga0496104_0284182_537_1481 | 307 |
| 581 | 3300048909 | Ga0496106_0000001 | Ga0496106_0000001_272560_273498 | 307 |
| 582 | 3300048912 | Ga0496109_0202773 | Ga0496109_0202773_827_1771 | 307 |
| 583 | 3300048914 | Ga0496111_0056382 | Ga0496111_0056382_1145_2089 | 307 |
| 584 | 3300048924 | Ga0496121_0011095 | Ga0496121_0011095_7089_8027 | 307 |
| 585 | 3300048925 | Ga0496122_0021407 | Ga0496122_0021407_4528_5460 | 307 |
| 586 | 3300049460 | Ga0495682_0026635 | Ga0495682_0026635_492_1430 | 307 |
| 587 | 3300049575 | Ga0501039_0126434 | Ga0501039_0126434_635_1561 | 307 |
| 588 | 3300049576 | Ga0501040_0210466 | Ga0501040_0210466_28_966 | 307 |
| 589 | 3300049577 | Ga0501041_0144812 | Ga0501041_0144812_296_1234 | 307 |
| 590 | 3300049579 | Ga0501043_0281092 | Ga0501043_0281092_82_1017 | 307 |
| 591 | 3300049580 | Ga0501046_0205588 | Ga0501046_0205588_459_1427 | 307 |
| 592 | 3300049581 | Ga0501047_0128951 | Ga0501047_0128951_1094_2029 | 307 |
| 593 | 3300049586 | Ga0501070_0090655 | Ga0501070_0090655_481_1422 | 307 |
| 594 | 3300049587 | Ga0501071_0077841 | Ga0501071_0077841_451_1389 | 307 |
| 595 | 3300049588 | Ga0501072_0101669 | Ga0501072_0101669_991_1929 | 307 |
| 596 | 3300049592 | Ga0501076_0031880 | Ga0501076_0031880_205_1173 | 307 |
| 597 | 3300049822 | Ga0501035_0090286 | Ga0501035_0090286_1370_2305 | 307 |
| 598 | 3300049822 | Ga0501035_0163509 | Ga0501035_0163509_791_1753 | 307 |
| 599 | 3300049823 | Ga0501044_0032771 | Ga0501044_0032771_4283_5215 | 307 |
| 600 | 3300049823 | Ga0501044_0143343 | Ga0501044_0143343_156_1097 | 307 |
| 601 | 3300049823 | Ga0501044_0153413 | Ga0501044_0153413_1147_2082 | 307 |
| 602 | 3300049824 | Ga0501045_0037949 | Ga0501045_0037949_990_1958 | 307 |
| 603 | 3300050492 | nmdc:mga0yw44_170150_c1 | nmdc:mga0yw44_170150_c1_112_1047 | 307 |
| 604 | 3300050492 | nmdc:mga0yw44_289666_c1 | nmdc:mga0yw44_289666_c1_112_1047 | 307 |
| 605 | 3300050514 | nmdc:mga08x19_132698_c1 | nmdc:mga08x19_132698_c1_333_1295 | 307 |
| 606 | 3300053108 | Ga0500562_011668 | Ga0500562_011668_432_1373 | 307 |
| 607 | 3300053122 | Ga0500608_000720 | Ga0500608_000720_3652_4590 | 307 |
| 608 | 3300053131 | Ga0500652_055115 | Ga0500652_055115_562_1485 | 307 |
| 609 | 3300053139 | Ga0500568_0004746 | Ga0500568_0004746_1859_2797 | 307 |
| 610 | 3300054114 | Ga0501084_0357249 | Ga0501084_0357249_190_1158 | 307 |
| 611 | 3300060353 | Ga0501082_0097758 | Ga0501082_0097758_1261_2229 | 307 |
| 612 | 3300061734 | Ga0530510_0048029 | Ga0530510_0048029_149_1117 | 307 |
| 613 | iso_pu_bacteria | 2643221569 | 2643859822 | 307 |
| 614 | iso_pu_bacteria | 2643221621 | 2644124984 | 307 |
| 615 | iso_pu_bacteria | 2941479691 | 2941484591 | 307 |
| 616 | 3300002773 | JGI25152J39213_1004057 | JGI25152J39213_10040573 | 308 |
| 617 | 3300002773 | JGI25152J39213_1004574 | JGI25152J39213_10045743 | 308 |
| 618 | 3300003187 | JGI25151J46595_10004869 | JGI25151J46595_100048692 | 308 |
| 619 | 3300003354 | JGI25160J50197_1009006 | JGI25160J50197_10090063 | 308 |
| 620 | 3300003374 | JGI25161J50226_1000294 | JGI25161J50226_100029419 | 308 |
| 621 | 3300003374 | JGI25161J50226_1000364 | JGI25161J50226_10003643 | 308 |
| 622 | 3300003775 | Ga0055524_1005532 | Ga0055524_10055322 | 308 |
| 623 | 3300003775 | Ga0055524_1007856 | Ga0055524_10078564 | 308 |
| 624 | 3300003790 | Ga0055528_1000273 | Ga0055528_100027318 | 308 |
| 625 | 3300003790 | Ga0055528_1002163 | Ga0055528_10021639 | 308 |
| 626 | 3300003791 | Ga0055530_10018243 | Ga0055530_100182432 | 308 |
| 627 | 3300003792 | Ga0055540_1007605 | Ga0055540_10076052 | 308 |
| 628 | 3300003794 | Ga0055531_10024694 | Ga0055531_100246942 | 308 |
| 629 | 3300004625 | Ga0055543_1000031 | Ga0055543_100003171 | 308 |
| 630 | 3300005262 | Ga0065165_1015769 | Ga0065165_10157692 | 308 |
| 631 | 3300005329 | Ga0070683_100348744 | Ga0070683_1003487441 | 308 |
| 632 | 3300005338 | Ga0068868_100181172 | Ga0068868_1001811722 | 308 |
| 633 | 3300005458 | Ga0070681_10103948 | Ga0070681_101039483 | 308 |
| 634 | 3300005539 | Ga0068853_100494938 | Ga0068853_1004949381 | 308 |
| 635 | 3300005563 | Ga0068855_100015850 | Ga0068855_1000158504 | 308 |
| 636 | 3300005563 | Ga0068855_100021411 | Ga0068855_1000214119 | 308 |
| 637 | 3300005614 | Ga0068856_100416396 | Ga0068856_1004163962 | 308 |
| 638 | 3300005616 | Ga0068852_100000134 | Ga0068852_10000013416 | 308 |
| 639 | 3300005617 | Ga0068859_100184886 | Ga0068859_1001848862 | 308 |
| 640 | 3300005842 | Ga0068858_100073406 | Ga0068858_1000734063 | 308 |
| 641 | 3300006163 | Ga0070715_10054192 | Ga0070715_100541922 | 308 |
| 642 | 3300006186 | Ga0075369_10021073 | Ga0075369_100210732 | 308 |
| 643 | 3300006195 | Ga0075366_10015710 | Ga0075366_100157103 | 308 |
| 644 | 3300006237 | Ga0097621_100006967 | Ga0097621_1000069672 | 308 |
| 645 | 3300006237 | Ga0097621_100008135 | Ga0097621_1000081356 | 308 |
| 646 | 3300006353 | Ga0075370_10051959 | Ga0075370_100519593 | 308 |
| 647 | 3300006358 | Ga0068871_100185980 | Ga0068871_1001859802 | 308 |
| 648 | 3300006881 | Ga0068865_100195342 | Ga0068865_1001953422 | 308 |
| 649 | 3300006931 | Ga0097620_100184881 | Ga0097620_1001848812 | 308 |
| 650 | 3300009093 | Ga0105240_10005407 | Ga0105240_100054074 | 308 |
| 651 | 3300009176 | Ga0105242_10012090 | Ga0105242_100120902 | 308 |
| 652 | 3300009176 | Ga0105242_10026716 | Ga0105242_100267163 | 308 |
| 653 | 3300009177 | Ga0105248_10065071 | Ga0105248_100650711 | 308 |
| 654 | 3300013105 | Ga0157369_10403329 | Ga0157369_104033292 | 308 |
| 655 | 3300013307 | Ga0157372_10044988 | Ga0157372_100449886 | 308 |
| 656 | 3300025208 | Ga0209436_100043 | Ga0209436_10004316 | 308 |
| 657 | 3300025245 | Ga0207425_1005641 | Ga0207425_10056412 | 308 |
| 658 | 3300025245 | Ga0207425_1012329 | Ga0207425_10123292 | 308 |
| 659 | 3300025258 | Ga0209129_1000016 | Ga0209129_100001673 | 308 |
| 660 | 3300025258 | Ga0209129_1000529 | Ga0209129_10005293 | 308 |
| 661 | 3300025258 | Ga0209129_1005013 | Ga0209129_10050133 | 308 |
| 662 | 3300025258 | Ga0209129_1006246 | Ga0209129_10062463 | 308 |
| 663 | 3300025273 | Ga0209673_1000691 | Ga0209673_100069128 | 308 |
| 664 | 3300025273 | Ga0209673_1005907 | Ga0209673_10059075 | 308 |
| 665 | 3300025284 | Ga0209130_1000023 | Ga0209130_1000023306 | 308 |
| 666 | 3300025292 | Ga0209676_1007558 | Ga0209676_10075582 | 308 |
| 667 | 3300025292 | Ga0209676_1011038 | Ga0209676_10110383 | 308 |
| 668 | 3300025294 | Ga0209025_1002393 | Ga0209025_10023932 | 308 |
| 669 | 3300025294 | Ga0209025_1010347 | Ga0209025_10103472 | 308 |
| 670 | 3300025295 | Ga0209564_1000558 | Ga0209564_100055853 | 308 |
| 671 | 3300025295 | Ga0209564_1002222 | Ga0209564_10022222 | 308 |
| 672 | 3300025297 | Ga0209758_1000170 | Ga0209758_100017015 | 308 |
| 673 | 3300025297 | Ga0209758_1003095 | Ga0209758_10030957 | 308 |
| 674 | 3300025297 | Ga0209758_1012118 | Ga0209758_10121183 | 308 |
| 675 | 3300025297 | Ga0209758_1015538 | Ga0209758_10155383 | 308 |
| 676 | 3300025298 | Ga0209050_1007449 | Ga0209050_10074491 | 308 |
| 677 | 3300025299 | Ga0209256_1000648 | Ga0209256_100064830 | 308 |
| 678 | 3300025299 | Ga0209256_1000709 | Ga0209256_100070945 | 308 |
| 679 | 3300025299 | Ga0209256_1006841 | Ga0209256_10068413 | 308 |
| 680 | 3300025302 | Ga0207426_1000087 | Ga0207426_100008756 | 308 |
| 681 | 3300025303 | Ga0209051_1000600 | Ga0209051_100060044 | 308 |
| 682 | 3300025303 | Ga0209051_1000641 | Ga0209051_100064139 | 308 |
| 683 | 3300025303 | Ga0209051_1001025 | Ga0209051_10010258 | 308 |
| 684 | 3300025303 | Ga0209051_1005829 | Ga0209051_10058295 | 308 |
| 685 | 3300025303 | Ga0209051_1013123 | Ga0209051_10131233 | 308 |
| 686 | 3300025304 | Ga0209257_1007708 | Ga0209257_10077088 | 308 |
| 687 | 3300025304 | Ga0209257_1022231 | Ga0209257_10222313 | 308 |
| 688 | 3300025321 | Ga0207656_10004899 | Ga0207656_100048992 | 308 |
| 689 | 3300025912 | Ga0207707_10337195 | Ga0207707_103371952 | 308 |
| 690 | 3300025913 | Ga0207695_10055983 | Ga0207695_100559832 | 308 |
| 691 | 3300025921 | Ga0207652_10099773 | Ga0207652_100997733 | 308 |
| 692 | 3300025924 | Ga0207694_10137892 | Ga0207694_101378922 | 308 |
| 693 | 3300025927 | Ga0207687_10022862 | Ga0207687_100228626 | 308 |
| 694 | 3300025938 | Ga0207704_10283522 | Ga0207704_102835222 | 308 |
| 695 | 3300025949 | Ga0207667_10007523 | Ga0207667_1000752312 | 308 |
| 696 | 3300025949 | Ga0207667_10070582 | Ga0207667_100705825 | 308 |
| 697 | 3300026035 | Ga0207703_10066822 | Ga0207703_100668222 | 308 |
| 698 | 3300026142 | Ga0207698_10001165 | Ga0207698_1000116511 | 308 |
| 699 | 3300028381 | Ga0268264_10103682 | Ga0268264_101036823 | 308 |
| 700 | 3300033179 | Ga0307507_10061386 | Ga0307507_100613862 | 308 |
| 701 | 3300039447 | Ga0436361_0898793 | Ga0436361_0898793_1434_2360 | 308 |
| 702 | 3300041411 | Ga0439466_0028978 | Ga0439466_0028978_504_1442 | 308 |
| 703 | 3300041413 | Ga0439465_0000965 | Ga0439465_0000965_5210_6148 | 308 |
| 704 | 3300042002 | Ga0439442_001123 | Ga0439442_001123_1074_2006 | 308 |
| 705 | 3300042122 | Ga0450920_000242 | Ga0450920_000242_6597_7529 | 308 |
| 706 | 3300042146 | Ga0450907_004183 | Ga0450907_004183_100_1032 | 308 |
| 707 | 3300042435 | Ga0439434_0000853 | Ga0439434_0000853_1712_2644 | 308 |
| 708 | 3300046512 | Ga0495610_0021886 | Ga0495610_0021886_2554_3480 | 308 |
| 709 | 3300046522 | Ga0495643_0081349 | Ga0495643_0081349_310_1236 | 308 |
| 710 | 3300047472 | Ga0495686_0073951 | Ga0495686_0073951_734_1660 | 308 |
| 711 | 3300048904 | Ga0496101_0392766 | Ga0496101_0392766_13_942 | 308 |
| 712 | 3300048907 | Ga0496104_0365080 | Ga0496104_0365080_413_1339 | 308 |
| 713 | 3300048908 | Ga0496105_0119133 | Ga0496105_0119133_712_1638 | 308 |
| 714 | 3300048913 | Ga0496110_0124895 | Ga0496110_0124895_964_1890 | 308 |
| 715 | 3300048919 | Ga0496116_0012189 | Ga0496116_0012189_3962_4888 | 308 |
| 716 | 3300048921 | Ga0496118_0003916 | Ga0496118_0003916_7966_8892 | 308 |
| 717 | 3300048922 | Ga0496119_0128198 | Ga0496119_0128198_97_1026 | 308 |
| 718 | 3300048924 | Ga0496121_0057423 | Ga0496121_0057423_2048_2974 | 308 |
| 719 | 3300048924 | Ga0496121_0063125 | Ga0496121_0063125_1521_2447 | 308 |
| 720 | 3300048924 | Ga0496121_0124232 | Ga0496121_0124232_466_1392 | 308 |
| 721 | 3300048925 | Ga0496122_0007213 | Ga0496122_0007213_8405_9331 | 308 |
| 722 | 3300048925 | Ga0496122_0008693 | Ga0496122_0008693_4525_5451 | 308 |
| 723 | 3300048926 | Ga0496123_0007137 | Ga0496123_0007137_5715_6641 | 308 |
| 724 | 3300048926 | Ga0496123_0033027 | Ga0496123_0033027_2518_3444 | 308 |
| 725 | 3300048927 | Ga0496124_0008253 | Ga0496124_0008253_2851_3777 | 308 |
| 726 | 3300048927 | Ga0496124_0021305 | Ga0496124_0021305_1543_2469 | 308 |
| 727 | 3300048928 | Ga0496125_0080288 | Ga0496125_0080288_528_1454 | 308 |
| 728 | 3300049568 | Ga0501031_0094997 | Ga0501031_0094997_467_1393 | 308 |
| 729 | 3300049574 | Ga0501038_0303181 | Ga0501038_0303181_221_1168 | 308 |
| 730 | 3300049575 | Ga0501039_0415884 | Ga0501039_0415884_86_1033 | 308 |
| 731 | 3300049581 | Ga0501047_0003515 | Ga0501047_0003515_12767_13693 | 308 |
| 732 | 3300049581 | Ga0501047_0045708 | Ga0501047_0045708_194_1123 | 308 |
| 733 | 3300049586 | Ga0501070_0006975 | Ga0501070_0006975_1109_2035 | 308 |
| 734 | 3300049589 | Ga0501073_0000065 | Ga0501073_0000065_8378_9304 | 308 |
| 735 | 3300049590 | Ga0501074_0002696 | Ga0501074_0002696_6421_7347 | 308 |
| 736 | 3300049741 | Ga0501079_0026282 | Ga0501079_0026282_57_983 | 308 |
| 737 | 3300049742 | Ga0501080_0106418 | Ga0501080_0106418_1109_2035 | 308 |
| 738 | 3300049744 | Ga0501083_0000604 | Ga0501083_0000604_19848_20774 | 308 |
| 739 | 3300049744 | Ga0501083_0016470 | Ga0501083_0016470_3365_4312 | 308 |
| 740 | 3300049823 | Ga0501044_0528425 | Ga0501044_0528425_27_953 | 308 |
| 741 | 3300050492 | nmdc:mga0yw44_347507_c1 | nmdc:mga0yw44_347507_c1_40_969 | 308 |
| 742 | 3300050496 | nmdc:mga07m45_86591_c2 | nmdc:mga07m45_86591_c2_344_1270 | 308 |
| 743 | 3300050516 | nmdc:mga0sz30_92061_c1 | nmdc:mga0sz30_92061_c1_165_1091 | 308 |
| 744 | 3300053093 | Ga0500651_0252962 | Ga0500651_0252962_23_949 | 308 |
| 745 | 3300053118 | Ga0500594_0012754 | Ga0500594_0012754_679_1635 | 308 |
| 746 | 3300053134 | Ga0500658_0001722 | Ga0500658_0001722_7655_8581 | 308 |
| 747 | 3300053139 | Ga0500568_0000001 | Ga0500568_0000001_639963_640889 | 308 |
| 748 | 3300053139 | Ga0500568_0001959 | Ga0500568_0001959_2718_3644 | 308 |
| 749 | 3300053140 | Ga0500573_0047509 | Ga0500573_0047509_241_1167 | 308 |
| 750 | 3300053153 | Ga0500616_0076057 | Ga0500616_0076057_699_1625 | 308 |
| 751 | 3300053156 | Ga0500622_0000206 | Ga0500622_0000206_20075_21001 | 308 |
| 752 | iso_pu_bacteria | 2513237087 | 2513592919 | 308 |
| 753 | iso_pu_bacteria | 2545555834 | 2545672700 | 308 |
| 754 | iso_pu_bacteria | 2855730933 | 2855734405 | 308 |
| 755 | iso_pu_bacteria | 2855767633 | 2855769995 | 308 |
| 756 | iso_pu_bacteria | 2881412998 | 2881414245 | 308 |
| 757 | iso_pu_bacteria | 2990059506 | 2990065154 | 308 |
| 758 | iso_pu_bacteria | 641522639 | 641643487 | 308 |
| 759 | 3300002987 | JGI25159J45721_1014777 | JGI25159J45721_10147772 | 309 |
| 760 | 3300003187 | JGI25151J46595_10000072 | JGI25151J46595_1000007254 | 309 |
| 761 | 3300003316 | rootH1_10111778 | rootH1_101117784 | 309 |
| 762 | 3300003322 | rootL2_10130353 | rootL2_101303532 | 309 |
| 763 | 3300003771 | Ga0055526_1000090 | Ga0055526_100009021 | 309 |
| 764 | 3300003771 | Ga0055526_1002908 | Ga0055526_10029089 | 309 |
| 765 | 3300003775 | Ga0055524_1000096 | Ga0055524_100009614 | 309 |
| 766 | 3300003775 | Ga0055524_1025756 | Ga0055524_10257562 | 309 |
| 767 | 3300005262 | Ga0065165_1000146 | Ga0065165_100014643 | 309 |
| 768 | 3300005262 | Ga0065165_1000384 | Ga0065165_100038433 | 309 |
| 769 | 3300005327 | Ga0070658_10077434 | Ga0070658_100774343 | 309 |
| 770 | 3300005331 | Ga0070670_100020910 | Ga0070670_1000209107 | 309 |
| 771 | 3300005354 | Ga0070675_100004711 | Ga0070675_1000047117 | 309 |
| 772 | 3300005435 | Ga0070714_100138246 | Ga0070714_1001382462 | 309 |
| 773 | 3300005518 | Ga0070699_100269399 | Ga0070699_1002693991 | 309 |
| 774 | 3300005841 | Ga0068863_100285967 | Ga0068863_1002859672 | 309 |
| 775 | 3300005844 | Ga0068862_100032793 | Ga0068862_1000327933 | 309 |
| 776 | 3300005844 | Ga0068862_100063701 | Ga0068862_1000637012 | 309 |
| 777 | 3300006038 | Ga0075365_10006531 | Ga0075365_100065315 | 309 |
| 778 | 3300006038 | Ga0075365_10023183 | Ga0075365_100231832 | 309 |
| 779 | 3300006038 | Ga0075365_10085484 | Ga0075365_100854841 | 309 |
| 780 | 3300006042 | Ga0075368_10031789 | Ga0075368_100317892 | 309 |
| 781 | 3300006042 | Ga0075368_10092647 | Ga0075368_100926472 | 309 |
| 782 | 3300006048 | Ga0075363_100045141 | Ga0075363_1000451412 | 309 |
| 783 | 3300006051 | Ga0075364_10108093 | Ga0075364_101080932 | 309 |
| 784 | 3300006186 | Ga0075369_10005702 | Ga0075369_100057022 | 309 |
| 785 | 3300006846 | Ga0075430_100100344 | Ga0075430_1001003444 | 309 |
| 786 | 3300006847 | Ga0075431_100018467 | Ga0075431_1000184676 | 309 |
| 787 | 3300006880 | Ga0075429_100149183 | Ga0075429_1001491834 | 309 |
| 788 | 3300009094 | Ga0111539_10114563 | Ga0111539_101145633 | 309 |
| 789 | 3300013250 | Ga0171462_1029 | Ga0171462_102953 | 309 |
| 790 | 3300013307 | Ga0157372_10785337 | Ga0157372_107853371 | 309 |
| 791 | 3300014497 | Ga0182008_10001849 | Ga0182008_100018497 | 309 |
| 792 | 3300015261 | Ga0182006_1018279 | Ga0182006_10182792 | 309 |
| 793 | 3300015262 | Ga0182007_10000577 | Ga0182007_1000057710 | 309 |
| 794 | 3300015265 | Ga0182005_1029514 | Ga0182005_10295142 | 309 |
| 795 | 3300025284 | Ga0209130_1000393 | Ga0209130_100039355 | 309 |
| 796 | 3300025284 | Ga0209130_1001383 | Ga0209130_100138318 | 309 |
| 797 | 3300025291 | Ga0209675_1001067 | Ga0209675_10010674 | 309 |
| 798 | 3300025294 | Ga0209025_1000187 | Ga0209025_100018713 | 309 |
| 799 | 3300025294 | Ga0209025_1004739 | Ga0209025_10047398 | 309 |
| 800 | 3300025294 | Ga0209025_1014903 | Ga0209025_10149036 | 309 |
| 801 | 3300025295 | Ga0209564_1000043 | Ga0209564_1000043277 | 309 |
| 802 | 3300025295 | Ga0209564_1000052 | Ga0209564_1000052220 | 309 |
| 803 | 3300025299 | Ga0209256_1000099 | Ga0209256_100009969 | 309 |
| 804 | 3300025299 | Ga0209256_1000374 | Ga0209256_100037441 | 309 |
| 805 | 3300025907 | Ga0207645_10079533 | Ga0207645_100795332 | 309 |
| 806 | 3300025909 | Ga0207705_10058570 | Ga0207705_100585703 | 309 |
| 807 | 3300025925 | Ga0207650_10154557 | Ga0207650_101545572 | 309 |
| 808 | 3300025929 | Ga0207664_10020781 | Ga0207664_100207812 | 309 |
| 809 | 3300025935 | Ga0207709_10081886 | Ga0207709_100818862 | 309 |
| 810 | 3300025940 | Ga0207691_10085938 | Ga0207691_100859382 | 309 |
| 811 | 3300025986 | Ga0207658_10147770 | Ga0207658_101477702 | 309 |
| 812 | 3300026089 | Ga0207648_10113756 | Ga0207648_101137562 | 309 |
| 813 | 3300026089 | Ga0207648_10138768 | Ga0207648_101387682 | 309 |
| 814 | 3300027866 | Ga0209813_10010901 | Ga0209813_100109014 | 309 |
| 815 | 3300027866 | Ga0209813_10033520 | Ga0209813_100335202 | 309 |
| 816 | 3300028380 | Ga0268265_10109639 | Ga0268265_101096392 | 309 |
| 817 | 3300030521 | Ga0307511_10018563 | Ga0307511_100185636 | 309 |
| 818 | 3300031852 | Ga0307410_10083034 | Ga0307410_100830342 | 309 |
| 819 | 3300037312 | Ga0395899_0001144 | Ga0395899_0001144_12681_13610 | 309 |
| 820 | 3300037312 | Ga0395899_0013792 | Ga0395899_0013792_5020_5949 | 309 |
| 821 | 3300037418 | Ga0395900_0007142 | Ga0395900_0007142_138_1067 | 309 |
| 822 | 3300037466 | Ga0395898_0004409 | Ga0395898_0004409_3238_4167 | 309 |
| 823 | 3300038443 | Ga0395901_0072555 | Ga0395901_0072555_720_1649 | 309 |
| 824 | 3300038443 | Ga0395901_0188466 | Ga0395901_0188466_863_1792 | 309 |
| 825 | 3300038443 | Ga0395901_0358708 | Ga0395901_0358708_112_1041 | 309 |
| 826 | 3300041512 | Ga0451853_4020387 | Ga0451853_4020387_181_1110 | 309 |
| 827 | 3300042005 | Ga0439448_0008188 | Ga0439448_0008188_2005_2940 | 309 |
| 828 | 3300042138 | Ga0450903_000099 | Ga0450903_000099_11948_12883 | 309 |
| 829 | 3300044694 | Ga0466963_0030469 | Ga0466963_0030469_235_1167 | 309 |
| 830 | 3300044735 | Ga0466968_0016076 | Ga0466968_0016076_395_1324 | 309 |
| 831 | 3300044901 | Ga0466960_0138920 | Ga0466960_0138920_246_1181 | 309 |
| 832 | 3300046522 | Ga0495643_0092256 | Ga0495643_0092256_571_1500 | 309 |
| 833 | 3300048910 | Ga0496107_0126110 | Ga0496107_0126110_601_1530 | 309 |
| 834 | 3300048920 | Ga0496117_0033438 | Ga0496117_0033438_24_953 | 309 |
| 835 | 3300048921 | Ga0496118_0074733 | Ga0496118_0074733_556_1485 | 309 |
| 836 | 3300048923 | Ga0496120_0118123 | Ga0496120_0118123_36_965 | 309 |
| 837 | 3300048924 | Ga0496121_0101104 | Ga0496121_0101104_601_1530 | 309 |
| 838 | 3300048924 | Ga0496121_0199321 | Ga0496121_0199321_407_1336 | 309 |
| 839 | 3300048925 | Ga0496122_0003070 | Ga0496122_0003070_16370_17299 | 309 |
| 840 | 3300048925 | Ga0496122_0040105 | Ga0496122_0040105_2303_3232 | 309 |
| 841 | 3300048926 | Ga0496123_0003134 | Ga0496123_0003134_14790_15719 | 309 |
| 842 | 3300048927 | Ga0496124_0017130 | Ga0496124_0017130_2863_3804 | 309 |
| 843 | 3300048928 | Ga0496125_0050765 | Ga0496125_0050765_332_1261 | 309 |
| 844 | 3300048929 | Ga0496126_0308974 | Ga0496126_0308974_188_1117 | 309 |
| 845 | 3300049569 | Ga0501032_0094655 | Ga0501032_0094655_484_1413 | 309 |
| 846 | 3300049570 | Ga0501033_0075574 | Ga0501033_0075574_1479_2408 | 309 |
| 847 | 3300049571 | Ga0501034_0034037 | Ga0501034_0034037_2447_3376 | 309 |
| 848 | 3300049571 | Ga0501034_0089924 | Ga0501034_0089924_970_1899 | 309 |
| 849 | 3300049572 | Ga0501036_0100560 | Ga0501036_0100560_911_1876 | 309 |
| 850 | 3300049573 | Ga0501037_0102588 | Ga0501037_0102588_531_1460 | 309 |
| 851 | 3300049574 | Ga0501038_0177594 | Ga0501038_0177594_133_1062 | 309 |
| 852 | 3300049574 | Ga0501038_0231026 | Ga0501038_0231026_180_1109 | 309 |
| 853 | 3300049579 | Ga0501043_0016367 | Ga0501043_0016367_1265_2194 | 309 |
| 854 | 3300049580 | Ga0501046_0077958 | Ga0501046_0077958_833_1762 | 309 |
| 855 | 3300049581 | Ga0501047_0015373 | Ga0501047_0015373_762_1691 | 309 |
| 856 | 3300049582 | Ga0501048_0057148 | Ga0501048_0057148_1373_2302 | 309 |
| 857 | 3300049589 | Ga0501073_0011276 | Ga0501073_0011276_1736_2677 | 309 |
| 858 | 3300049822 | Ga0501035_0003219 | Ga0501035_0003219_12053_12982 | 309 |
| 859 | 3300049823 | Ga0501044_0046301 | Ga0501044_0046301_2455_3384 | 309 |
| 860 | 3300050491 | nmdc:mga00v17_122319_c1 | nmdc:mga00v17_122319_c1_272_1213 | 309 |
| 861 | 3300050495 | nmdc:mga04h51_62746_c1 | nmdc:mga04h51_62746_c1_78_1007 | 309 |
| 862 | 3300050508 | nmdc:mga09592_25520_c1 | nmdc:mga09592_25520_c1_1432_2361 | 309 |
| 863 | 3300050509 | nmdc:mga0qj67_82897_c1 | nmdc:mga0qj67_82897_c1_583_1512 | 309 |
| 864 | 3300050510 | nmdc:mga06r32_11440_c1 | nmdc:mga06r32_11440_c1_4420_5349 | 309 |
| 865 | 3300053090 | Ga0500646_0002275 | Ga0500646_0002275_1823_2785 | 309 |
| 866 | 3300053092 | Ga0500583_0044731 | Ga0500583_0044731_751_1713 | 309 |
| 867 | 3300053093 | Ga0500651_0006211 | Ga0500651_0006211_294_1247 | 309 |
| 868 | 3300053104 | Ga0500556_0000052 | Ga0500556_0000052_111577_112506 | 309 |
| 869 | 3300053151 | Ga0500604_0001078 | Ga0500604_0001078_4191_5153 | 309 |
| 870 | 3300053153 | Ga0500616_0095923 | Ga0500616_0095923_76_1005 | 309 |
| 871 | 3300053156 | Ga0500622_0005324 | Ga0500622_0005324_2126_3055 | 309 |
| 872 | 3300053177 | Ga0500636_0014958 | Ga0500636_0014958_622_1551 | 309 |
| 873 | 3300053730 | Ga0500645_052976 | Ga0500645_052976_98_1027 | 309 |
| 874 | iso_pu_bacteria | 2599185292 | 2599903531 | 309 |
| 875 | 3300005436 | Ga0070713_100320719 | Ga0070713_1003207192 | 310 |
| 876 | 3300005441 | Ga0070700_100226215 | Ga0070700_1002262152 | 310 |
| 877 | 3300005530 | Ga0070679_100121386 | Ga0070679_1001213862 | 310 |
| 878 | 3300006028 | Ga0070717_10225358 | Ga0070717_102253582 | 310 |
| 879 | 3300009093 | Ga0105240_10030542 | Ga0105240_100305426 | 310 |
| 880 | 3300009545 | Ga0105237_10042104 | Ga0105237_100421044 | 310 |
| 881 | 3300013306 | Ga0163162_10584292 | Ga0163162_105842921 | 310 |
| 882 | 3300013307 | Ga0157372_10414317 | Ga0157372_104143172 | 310 |
| 883 | 3300025919 | Ga0207657_10424667 | Ga0207657_104246671 | 310 |
| 884 | 3300025921 | Ga0207652_10151739 | Ga0207652_101517392 | 310 |
| 885 | 3300026075 | Ga0207708_10258452 | Ga0207708_102584521 | 310 |
| 886 | 3300031595 | Ga0265313_10024533 | Ga0265313_100245331 | 310 |
| 887 | 3300031731 | Ga0307405_10042455 | Ga0307405_100424553 | 310 |
| 888 | 3300031824 | Ga0307413_10023153 | Ga0307413_100231532 | 310 |
| 889 | 3300031852 | Ga0307410_10012854 | Ga0307410_100128542 | 310 |
| 890 | 3300031903 | Ga0307407_10010347 | Ga0307407_100103475 | 310 |
| 891 | 3300032002 | Ga0307416_100068001 | Ga0307416_1000680012 | 310 |
| 892 | 3300042007 | Ga0439449_0015407 | Ga0439449_0015407_1306_2238 | 310 |
| 893 | 3300048924 | Ga0496121_0171067 | Ga0496121_0171067_205_1149 | 310 |
| 894 | 3300049580 | Ga0501046_0028960 | Ga0501046_0028960_1685_2620 | 310 |
| 895 | 3300049582 | Ga0501048_0123404 | Ga0501048_0123404_780_1715 | 310 |
| 896 | 3300049586 | Ga0501070_0385348 | Ga0501070_0385348_37_1032 | 310 |
| 897 | 3300049590 | Ga0501074_0137314 | Ga0501074_0137314_668_1672 | 310 |
| 898 | 3300049591 | Ga0501075_0045988 | Ga0501075_0045988_1932_2867 | 310 |
| 899 | 3300049593 | Ga0501077_0037985 | Ga0501077_0037985_662_1597 | 310 |
| 900 | 3300049741 | Ga0501079_0171779 | Ga0501079_0171779_179_1183 | 310 |
| 901 | 3300049822 | Ga0501035_0292287 | Ga0501035_0292287_43_975 | 310 |
| 902 | 3300053153 | Ga0500616_0000085 | Ga0500616_0000085_173449_174381 | 310 |
| 903 | 3300054114 | Ga0501084_0034876 | Ga0501084_0034876_3014_3949 | 310 |
| 904 | 3300060353 | Ga0501082_0153091 | Ga0501082_0153091_393_1328 | 310 |
| 905 | 3300005367 | Ga0070667_100046864 | Ga0070667_1000468642 | 311 |
| 906 | 3300005543 | Ga0070672_100005394 | Ga0070672_1000053944 | 311 |
| 907 | 3300005617 | Ga0068859_100024084 | Ga0068859_1000240843 | 311 |
| 908 | 3300005842 | Ga0068858_100045095 | Ga0068858_1000450953 | 311 |
| 909 | 3300006881 | Ga0068865_100032138 | Ga0068865_1000321383 | 311 |
| 910 | 3300006931 | Ga0097620_100024082 | Ga0097620_1000240823 | 311 |
| 911 | 3300013102 | Ga0157371_10099208 | Ga0157371_100992082 | 311 |
| 912 | 3300013308 | Ga0157375_10026229 | Ga0157375_100262296 | 311 |
| 913 | 3300014745 | Ga0157377_10227428 | Ga0157377_102274281 | 311 |
| 914 | 3300014968 | Ga0157379_10002228 | Ga0157379_100022288 | 311 |
| 915 | 3300017792 | Ga0163161_10311765 | Ga0163161_103117652 | 311 |
| 916 | 3300025298 | Ga0209050_1002087 | Ga0209050_100208710 | 311 |
| 917 | 3300025940 | Ga0207691_10003618 | Ga0207691_1000361810 | 311 |
| 918 | 3300025986 | Ga0207658_10052349 | Ga0207658_100523493 | 311 |
| 919 | 3300026035 | Ga0207703_10284261 | Ga0207703_102842612 | 311 |
| 920 | 3300026041 | Ga0207639_10048023 | Ga0207639_100480232 | 311 |
| 921 | 3300028381 | Ga0268264_10315132 | Ga0268264_103151322 | 311 |
| 922 | 3300031911 | Ga0307412_10000563 | Ga0307412_1000056313 | 311 |
| 923 | 3300032002 | Ga0307416_100700864 | Ga0307416_1007008641 | 311 |
| 924 | 3300039437 | Ga0436365_0656380 | Ga0436365_0656380_147_1085 | 311 |
| 925 | 3300048905 | Ga0496102_0069817 | Ga0496102_0069817_2044_2979 | 311 |
| 926 | 3300048908 | Ga0496105_0043339 | Ga0496105_0043339_1095_2030 | 311 |
| 927 | 3300048915 | Ga0496112_0401379 | Ga0496112_0401379_104_1039 | 311 |
| 928 | 3300048916 | Ga0496113_0137186 | Ga0496113_0137186_918_1853 | 311 |
| 929 | 3300048919 | Ga0496116_0051150 | Ga0496116_0051150_462_1397 | 311 |
| 930 | 3300048919 | Ga0496116_0132979 | Ga0496116_0132979_368_1312 | 311 |
| 931 | 3300048921 | Ga0496118_0007940 | Ga0496118_0007940_9205_10140 | 311 |
| 932 | 3300048922 | Ga0496119_0018131 | Ga0496119_0018131_4260_5195 | 311 |
| 933 | 3300048923 | Ga0496120_0004181 | Ga0496120_0004181_629_1564 | 311 |
| 934 | 3300048924 | Ga0496121_0000508 | Ga0496121_0000508_22314_23249 | 311 |
| 935 | 3300048924 | Ga0496121_0086614 | Ga0496121_0086614_829_1773 | 311 |
| 936 | 3300048925 | Ga0496122_0000214 | Ga0496122_0000214_64311_65255 | 311 |
| 937 | 3300048926 | Ga0496123_0000289 | Ga0496123_0000289_32999_33943 | 311 |
| 938 | 3300048927 | Ga0496124_0086064 | Ga0496124_0086064_825_1760 | 311 |
| 939 | 3300048927 | Ga0496124_0089120 | Ga0496124_0089120_830_1774 | 311 |
| 940 | 3300048927 | Ga0496124_0168714 | Ga0496124_0168714_174_1124 | 311 |
| 941 | 3300048928 | Ga0496125_0053684 | Ga0496125_0053684_1062_2006 | 311 |
| 942 | 3300048929 | Ga0496126_0037600 | Ga0496126_0037600_2407_3342 | 311 |
| 943 | 3300049572 | Ga0501036_0237736 | Ga0501036_0237736_534_1469 | 311 |
| 944 | 3300049575 | Ga0501039_0053328 | Ga0501039_0053328_1401_2336 | 311 |
| 945 | 3300049577 | Ga0501041_0031853 | Ga0501041_0031853_104_1039 | 311 |
| 946 | 3300049590 | Ga0501074_0055023 | Ga0501074_0055023_1204_2139 | 311 |
| 947 | 3300049593 | Ga0501077_0130878 | Ga0501077_0130878_542_1477 | 311 |
| 948 | 3300049822 | Ga0501035_0165171 | Ga0501035_0165171_620_1555 | 311 |
| 949 | 3300049824 | Ga0501045_0030185 | Ga0501045_0030185_18_953 | 311 |
| 950 | 3300060353 | Ga0501082_0117174 | Ga0501082_0117174_800_1735 | 311 |
| 951 | 3300005290 | Ga0065712_10101729 | Ga0065712_101017292 | 312 |
| 952 | 3300005295 | Ga0065707_10083063 | Ga0065707_100830633 | 312 |
| 953 | 3300005331 | Ga0070670_100054773 | Ga0070670_1000547731 | 312 |
| 954 | 3300005334 | Ga0068869_100116788 | Ga0068869_1001167882 | 312 |
| 955 | 3300005338 | Ga0068868_100095597 | Ga0068868_1000955972 | 312 |
| 956 | 3300005347 | Ga0070668_100126453 | Ga0070668_1001264531 | 312 |
| 957 | 3300005354 | Ga0070675_100004539 | Ga0070675_1000045398 | 312 |
| 958 | 3300005356 | Ga0070674_100002295 | Ga0070674_1000022957 | 312 |
| 959 | 3300005364 | Ga0070673_100002654 | Ga0070673_1000026546 | 312 |
| 960 | 3300005367 | Ga0070667_100154440 | Ga0070667_1001544403 | 312 |
| 961 | 3300005456 | Ga0070678_100084994 | Ga0070678_1000849943 | 312 |
| 962 | 3300005459 | Ga0068867_100001776 | Ga0068867_1000017766 | 312 |
| 963 | 3300005459 | Ga0068867_100002021 | Ga0068867_10000202113 | 312 |
| 964 | 3300005543 | Ga0070672_100001907 | Ga0070672_1000019077 | 312 |
| 965 | 3300005543 | Ga0070672_100114902 | Ga0070672_1001149022 | 312 |
| 966 | 3300005563 | Ga0068855_100155871 | Ga0068855_1001558712 | 312 |
| 967 | 3300005617 | Ga0068859_100255239 | Ga0068859_1002552392 | 312 |
| 968 | 3300005719 | Ga0068861_100043821 | Ga0068861_1000438212 | 312 |
| 969 | 3300005834 | Ga0068851_10098127 | Ga0068851_100981272 | 312 |
| 970 | 3300005841 | Ga0068863_100067022 | Ga0068863_1000670222 | 312 |
| 971 | 3300005843 | Ga0068860_100003477 | Ga0068860_10000347713 | 312 |
| 972 | 3300005937 | Ga0081455_10113926 | Ga0081455_101139262 | 312 |
| 973 | 3300006051 | Ga0075364_10046887 | Ga0075364_100468873 | 312 |
| 974 | 3300006177 | Ga0075362_10013075 | Ga0075362_100130752 | 312 |
| 975 | 3300006237 | Ga0097621_100068270 | Ga0097621_1000682702 | 312 |
| 976 | 3300006358 | Ga0068871_100055704 | Ga0068871_1000557042 | 312 |
| 977 | 3300006881 | Ga0068865_100002268 | Ga0068865_1000022686 | 312 |
| 978 | 3300006931 | Ga0097620_100255245 | Ga0097620_1002552452 | 312 |
| 979 | 3300009093 | Ga0105240_10105135 | Ga0105240_101051351 | 312 |
| 980 | 3300009148 | Ga0105243_10094929 | Ga0105243_100949291 | 312 |
| 981 | 3300009553 | Ga0105249_10144156 | Ga0105249_101441563 | 312 |
| 982 | 3300010375 | Ga0105239_10612587 | Ga0105239_106125872 | 312 |
| 983 | 3300013297 | Ga0157378_10011636 | Ga0157378_100116363 | 312 |
| 984 | 3300013306 | Ga0163162_10003566 | Ga0163162_1000356611 | 312 |
| 985 | 3300013308 | Ga0157375_10066362 | Ga0157375_100663622 | 312 |
| 986 | 3300013308 | Ga0157375_10332188 | Ga0157375_103321882 | 312 |
| 987 | 3300014326 | Ga0157380_10287449 | Ga0157380_102874492 | 312 |
| 988 | 3300014968 | Ga0157379_10034241 | Ga0157379_100342413 | 312 |
| 989 | 3300017792 | Ga0163161_10006805 | Ga0163161_100068057 | 312 |
| 990 | 3300021388 | Ga0213875_10015983 | Ga0213875_100159832 | 312 |
| 991 | 3300021388 | Ga0213875_10063752 | Ga0213875_100637522 | 312 |
| 992 | 3300025294 | Ga0209025_1000003 | Ga0209025_1000003522 | 312 |
| 993 | 3300025315 | Ga0207697_10013127 | Ga0207697_100131274 | 312 |
| 994 | 3300025321 | Ga0207656_10045341 | Ga0207656_100453412 | 312 |
| 995 | 3300025907 | Ga0207645_10069942 | Ga0207645_100699422 | 312 |
| 996 | 3300025913 | Ga0207695_10087929 | Ga0207695_100879292 | 312 |
| 997 | 3300025923 | Ga0207681_10001984 | Ga0207681_100019846 | 312 |
| 998 | 3300025925 | Ga0207650_10000274 | Ga0207650_1000027440 | 312 |
| 999 | 3300025926 | Ga0207659_10004273 | Ga0207659_100042732 | 312 |
| 1000 | 3300025934 | Ga0207686_10094415 | Ga0207686_100944153 | 312 |
| 1001 | 3300025935 | Ga0207709_10048569 | Ga0207709_100485692 | 312 |
| 1002 | 3300025937 | Ga0207669_10158436 | Ga0207669_101584362 | 312 |
| 1003 | 3300025938 | Ga0207704_10001539 | Ga0207704_100015394 | 312 |
| 1004 | 3300025940 | Ga0207691_10000494 | Ga0207691_1000049430 | 312 |
| 1005 | 3300025940 | Ga0207691_10016790 | Ga0207691_100167906 | 312 |
| 1006 | 3300025942 | Ga0207689_10182636 | Ga0207689_101826362 | 312 |
| 1007 | 3300025942 | Ga0207689_10449430 | Ga0207689_104494301 | 312 |
| 1008 | 3300025949 | Ga0207667_10163755 | Ga0207667_101637553 | 312 |
| 1009 | 3300025960 | Ga0207651_10001168 | Ga0207651_100011682 | 312 |
| 1010 | 3300025961 | Ga0207712_10046934 | Ga0207712_100469343 | 312 |
| 1011 | 3300025986 | Ga0207658_10029968 | Ga0207658_100299683 | 312 |
| 1012 | 3300026023 | Ga0207677_10087375 | Ga0207677_100873752 | 312 |
| 1013 | 3300026035 | Ga0207703_10049718 | Ga0207703_100497182 | 312 |
| 1014 | 3300026041 | Ga0207639_10103211 | Ga0207639_101032112 | 312 |
| 1015 | 3300026075 | Ga0207708_10085820 | Ga0207708_100858202 | 312 |
| 1016 | 3300026089 | Ga0207648_10020558 | Ga0207648_100205585 | 312 |
| 1017 | 3300026089 | Ga0207648_10035092 | Ga0207648_100350923 | 312 |
| 1018 | 3300026118 | Ga0207675_100002430 | Ga0207675_1000024308 | 312 |
| 1019 | 3300026121 | Ga0207683_10275203 | Ga0207683_102752032 | 312 |
| 1020 | 3300028379 | Ga0268266_10291164 | Ga0268266_102911642 | 312 |
| 1021 | 3300028380 | Ga0268265_10112099 | Ga0268265_101120993 | 312 |
| 1022 | 3300028381 | Ga0268264_10020744 | Ga0268264_100207443 | 312 |
| 1023 | 3300031548 | Ga0307408_100327522 | Ga0307408_1003275222 | 312 |
| 1024 | 3300031824 | Ga0307413_10027937 | Ga0307413_100279373 | 312 |
| 1025 | 3300031852 | Ga0307410_10157424 | Ga0307410_101574243 | 312 |
| 1026 | 3300031901 | Ga0307406_10011607 | Ga0307406_100116074 | 312 |
| 1027 | 3300031911 | Ga0307412_10037202 | Ga0307412_100372023 | 312 |
| 1028 | 3300031995 | Ga0307409_100015688 | Ga0307409_1000156883 | 312 |
| 1029 | 3300032002 | Ga0307416_100025154 | Ga0307416_1000251544 | 312 |
| 1030 | 3300032004 | Ga0307414_10021590 | Ga0307414_100215903 | 312 |
| 1031 | 3300032005 | Ga0307411_10017180 | Ga0307411_100171803 | 312 |
| 1032 | 3300037853 | Ga0436364_0249115 | Ga0436364_0249115_11614_12552 | 312 |
| 1033 | 3300049568 | Ga0501031_0002561 | Ga0501031_0002561_226_1170 | 312 |
| 1034 | 3300049569 | Ga0501032_0004619 | Ga0501032_0004619_9190_10134 | 312 |
| 1035 | 3300049571 | Ga0501034_0003055 | Ga0501034_0003055_9195_10139 | 312 |
| 1036 | 3300049572 | Ga0501036_0001315 | Ga0501036_0001315_9190_10134 | 312 |
| 1037 | 3300049573 | Ga0501037_0004241 | Ga0501037_0004241_6851_7795 | 312 |
| 1038 | 3300049574 | Ga0501038_0002280 | Ga0501038_0002280_9195_10139 | 312 |
| 1039 | 3300049575 | Ga0501039_0002927 | Ga0501039_0002927_7429_8373 | 312 |
| 1040 | 3300049576 | Ga0501040_0007819 | Ga0501040_0007819_533_1477 | 312 |
| 1041 | 3300049578 | Ga0501042_0003824 | Ga0501042_0003824_4016_4960 | 312 |
| 1042 | 3300049579 | Ga0501043_0007149 | Ga0501043_0007149_226_1170 | 312 |
| 1043 | 3300049580 | Ga0501046_0002355 | Ga0501046_0002355_6775_7719 | 312 |
| 1044 | 3300049581 | Ga0501047_0007345 | Ga0501047_0007345_9190_10134 | 312 |
| 1045 | 3300049582 | Ga0501048_0001333 | Ga0501048_0001333_9310_10254 | 312 |
| 1046 | 3300049583 | Ga0501067_0045029 | Ga0501067_0045029_216_1160 | 312 |
| 1047 | 3300049584 | Ga0501068_0001765 | Ga0501068_0001765_10005_10949 | 312 |
| 1048 | 3300049585 | Ga0501069_0174958 | Ga0501069_0174958_187_1131 | 312 |
| 1049 | 3300049586 | Ga0501070_0001529 | Ga0501070_0001529_9951_10895 | 312 |
| 1050 | 3300049587 | Ga0501071_0002932 | Ga0501071_0002932_6353_7297 | 312 |
| 1051 | 3300049588 | Ga0501072_0229988 | Ga0501072_0229988_372_1316 | 312 |
| 1052 | 3300049589 | Ga0501073_0007507 | Ga0501073_0007507_1300_2244 | 312 |
| 1053 | 3300049590 | Ga0501074_0054018 | Ga0501074_0054018_899_1843 | 312 |
| 1054 | 3300049742 | Ga0501080_0002779 | Ga0501080_0002779_10005_10949 | 312 |
| 1055 | 3300049744 | Ga0501083_0014028 | Ga0501083_0014028_3344_4288 | 312 |
| 1056 | 3300049823 | Ga0501044_0002860 | Ga0501044_0002860_11530_12474 | 312 |
| 1057 | 3300049824 | Ga0501045_0003550 | Ga0501045_0003550_226_1170 | 312 |
| 1058 | 3300050491 | nmdc:mga00v17_91223_c1 | nmdc:mga00v17_91223_c1_313_1251 | 312 |
| 1059 | 3300053154 | Ga0500619_000086 | Ga0500619_000086_18778_19716 | 312 |
| 1060 | 3300003781 | Ga0055536_1004861 | Ga0055536_10048617 | 313 |
| 1061 | 3300025292 | Ga0209676_1001299 | Ga0209676_100129927 | 313 |
| 1062 | 3300025295 | Ga0209564_1000537 | Ga0209564_100053728 | 313 |
| 1063 | 3300025297 | Ga0209758_1029665 | Ga0209758_10296653 | 313 |
| 1064 | 3300025299 | Ga0209256_1022459 | Ga0209256_10224592 | 313 |
| 1065 | iso_pu_bacteria | 2507262055 | 2507509718 | 313 |
| 1066 | iso_pu_bacteria | 2508501009 | 2508543735 | 313 |
| 1067 | iso_pu_bacteria | 2508501042 | 2508698478 | 313 |
| 1068 | iso_pu_bacteria | 2511231028 | 2511401320 | 313 |
| 1069 | iso_pu_bacteria | 2513237092 | 2513629168 | 313 |
| 1070 | iso_pu_bacteria | 2513237094 | 2513644825 | 313 |
| 1071 | iso_pu_bacteria | 2513237095 | 2513646220 | 313 |
| 1072 | iso_pu_bacteria | 2513237102 | 2513701786 | 313 |
| 1073 | iso_pu_bacteria | 2513237104 | 2513721448 | 313 |
| 1074 | iso_pu_bacteria | 2513237137 | 2513857455 | 313 |
| 1075 | iso_pu_bacteria | 2513237139 | 2513875799 | 313 |
| 1076 | iso_pu_bacteria | 2513237161 | 2514011538 | 313 |
| 1077 | iso_pu_bacteria | 2515154112 | 2515629166 | 313 |
| 1078 | iso_pu_bacteria | 2517093001 | 2517103586 | 313 |
| 1079 | iso_pu_bacteria | 2524023205 | 2524442175 | 313 |
| 1080 | iso_pu_bacteria | 2528768022 | 2528854142 | 313 |
| 1081 | iso_pu_bacteria | 2602042107 | 2603857090 | 313 |
| 1082 | iso_pu_bacteria | 2617270735 | 2617349240 | 313 |
| 1083 | iso_pu_bacteria | 2617270741 | 2617378234 | 313 |
| 1084 | iso_pu_bacteria | 2667528175 | 2671118061 | 313 |
| 1085 | iso_pu_bacteria | 2721755755 | 2723846085 | 313 |
| 1086 | iso_pu_bacteria | 2744054633 | 2745079440 | 313 |
| 1087 | iso_pu_bacteria | 2791355196 | 2793060310 | 313 |
| 1088 | iso_pu_bacteria | 2802429603 | 2805917671 | 313 |
| 1089 | iso_pu_bacteria | 2816332527 | 2818241441 | 313 |
| 1090 | iso_pu_bacteria | 2824600985 | 2824602177 | 313 |
| 1091 | iso_pu_bacteria | 2824609381 | 2824610165 | 313 |
| 1092 | iso_pu_bacteria | 2824617872 | 2824623822 | 313 |
| 1093 | iso_pu_bacteria | 2824626560 | 2824627764 | 313 |
| 1094 | iso_pu_bacteria | 2824635225 | 2824639300 | 313 |
| 1095 | iso_pu_bacteria | 2824644064 | 2824646871 | 313 |
| 1096 | iso_pu_bacteria | 2824653114 | 2824656143 | 313 |
| 1097 | iso_pu_bacteria | 2824661429 | 2824669095 | 313 |
| 1098 | iso_pu_bacteria | 2824671348 | 2824672858 | 313 |
| 1099 | iso_pu_bacteria | 2824679649 | 2824683986 | 313 |
| 1100 | iso_pu_bacteria | 2824687955 | 2824691009 | 313 |
| 1101 | iso_pu_bacteria | 2824696289 | 2824698417 | 313 |
| 1102 | iso_pu_bacteria | 2824704595 | 2824711605 | 313 |
| 1103 | iso_pu_bacteria | 2824714736 | 2824717922 | 313 |
| 1104 | iso_pu_bacteria | 2824723954 | 2824727655 | 313 |
| 1105 | iso_pu_bacteria | 2824732956 | 2824736720 | 313 |
| 1106 | iso_pu_bacteria | 2824746037 | 2824746873 | 313 |
| 1107 | iso_pu_bacteria | 2824753945 | 2824761663 | 313 |
| 1108 | iso_pu_bacteria | 2824763712 | 2824771278 | 313 |
| 1109 | iso_pu_bacteria | 2824773399 | 2824773974 | 313 |
| 1110 | iso_pu_bacteria | 2838122688 | 2838130026 | 313 |
| 1111 | iso_pu_bacteria | 2841941048 | 2841941181 | 313 |
| 1112 | iso_pu_bacteria | 2841949485 | 2841952792 | 313 |
| 1113 | iso_pu_bacteria | 2841957949 | 2841962303 | 313 |
| 1114 | iso_pu_bacteria | 2841966195 | 2841967336 | 313 |
| 1115 | iso_pu_bacteria | 2841974524 | 2841979267 | 313 |
| 1116 | iso_pu_bacteria | 2841983080 | 2841990840 | 313 |
| 1117 | iso_pu_bacteria | 2842038055 | 2842038682 | 313 |
| 1118 | iso_pu_bacteria | 2842045827 | 2842048373 | 313 |
| 1119 | iso_pu_bacteria | 2844315083 | 2844318080 | 313 |
| 1120 | iso_pu_bacteria | 2847930680 | 2847934889 | 313 |
| 1121 | iso_pu_bacteria | 2847939898 | 2847945456 | 313 |
| 1122 | iso_pu_bacteria | 2849076700 | 2849080358 | 313 |
| 1123 | iso_pu_bacteria | 2857509624 | 2857510292 | 313 |
| 1124 | iso_pu_bacteria | 2874590934 | 2874595172 | 313 |
| 1125 | iso_pu_bacteria | 2874612657 | 2874613138 | 313 |
| 1126 | iso_pu_bacteria | 2874620515 | 2874621616 | 313 |
| 1127 | iso_pu_bacteria | 2874628541 | 2874636590 | 313 |
| 1128 | iso_pu_bacteria | 2874645413 | 2874651033 | 313 |
| 1129 | iso_pu_bacteria | 2876761206 | 2876762494 | 313 |
| 1130 | iso_pu_bacteria | 2876771140 | 2876775108 | 313 |
| 1131 | iso_pu_bacteria | 2876818435 | 2876823923 | 313 |
| 1132 | iso_pu_bacteria | 2879074833 | 2879080551 | 313 |
| 1133 | iso_pu_bacteria | 2879083081 | 2879086279 | 313 |
| 1134 | iso_pu_bacteria | 2879099564 | 2879109402 | 313 |
| 1135 | iso_pu_bacteria | 2879127579 | 2879134843 | 313 |
| 1136 | iso_pu_bacteria | 2879142872 | 2879149154 | 313 |
| 1137 | iso_pu_bacteria | 2881364244 | 2881366283 | 313 |
| 1138 | iso_pu_bacteria | 2881665667 | 2881666224 | 313 |
| 1139 | iso_pu_bacteria | 2885366525 | 2885372877 | 313 |
| 1140 | iso_pu_bacteria | 2885409591 | 2885413003 | 313 |
| 1141 | iso_pu_bacteria | 2888378607 | 2888382883 | 313 |
| 1142 | iso_pu_bacteria | 2888388044 | 2888394920 | 313 |
| 1143 | iso_pu_bacteria | 2888419890 | 2888423357 | 313 |
| 1144 | iso_pu_bacteria | 2903727486 | 2903729613 | 313 |
| 1145 | iso_pu_bacteria | 2904666416 | 2904668668 | 313 |
| 1146 | iso_pu_bacteria | 2904711408 | 2904716720 | 313 |
| 1147 | iso_pu_bacteria | 2906602504 | 2906605759 | 313 |
| 1148 | iso_pu_bacteria | 2906626472 | 2906628213 | 313 |
| 1149 | iso_pu_bacteria | 2906643746 | 2906649434 | 313 |
| 1150 | iso_pu_bacteria | 2908739725 | 2908743817 | 313 |
| 1151 | iso_pu_bacteria | 2908775508 | 2908778998 | 313 |
| 1152 | iso_pu_bacteria | 2919073203 | 2919075597 | 313 |
| 1153 | iso_pu_bacteria | 2922368715 | 2922373089 | 313 |
| 1154 | iso_pu_bacteria | 2922393267 | 2922395288 | 313 |
| 1155 | iso_pu_bacteria | 2929615660 | 2929615846 | 313 |
| 1156 | iso_pu_bacteria | 2929624759 | 2929630459 | 313 |
| 1157 | iso_pu_bacteria | 2932784394 | 2932792511 | 313 |
| 1158 | iso_pu_bacteria | 2932794094 | 2932800343 | 313 |
| 1159 | iso_pu_bacteria | 2932801729 | 2932804517 | 313 |
| 1160 | iso_pu_bacteria | 2932809354 | 2932814032 | 313 |
| 1161 | iso_pu_bacteria | 2932818245 | 2932819477 | 313 |
| 1162 | iso_pu_bacteria | 2932828146 | 2932833815 | 313 |
| 1163 | iso_pu_bacteria | 2933577622 | 2933578868 | 313 |
| 1164 | iso_pu_bacteria | 2935608549 | 2935611422 | 313 |
| 1165 | iso_pu_bacteria | 2935616580 | 2935618659 | 313 |
| 1166 | iso_pu_bacteria | 2935638405 | 2935644502 | 313 |
| 1167 | iso_pu_bacteria | 2935648319 | 2935648806 | 313 |
| 1168 | iso_pu_bacteria | 2935656913 | 2935657111 | 313 |
| 1169 | iso_pu_bacteria | 2935665750 | 2935673607 | 313 |
| 1170 | iso_pu_bacteria | 2935675223 | 2935678501 | 313 |
| 1171 | iso_pu_bacteria | 2935684952 | 2935688002 | 313 |
| 1172 | iso_pu_bacteria | 2935694250 | 2935701386 | 313 |
| 1173 | iso_pu_bacteria | 2935703347 | 2935708359 | 313 |
| 1174 | iso_pu_bacteria | 2935713505 | 2935715022 | 313 |
| 1175 | iso_pu_bacteria | 2935722832 | 2935726413 | 313 |
| 1176 | iso_pu_bacteria | 2935732158 | 2935733840 | 313 |
| 1177 | iso_pu_bacteria | 2935741537 | 2935743219 | 313 |
| 1178 | iso_pu_bacteria | 2935750917 | 2935754742 | 313 |
| 1179 | iso_pu_bacteria | 2935760218 | 2935765449 | 313 |
| 1180 | iso_pu_bacteria | 2935769743 | 2935776273 | 313 |
| 1181 | iso_pu_bacteria | 2935777560 | 2935779597 | 313 |
| 1182 | iso_pu_bacteria | 2935785616 | 2935790262 | 313 |
| 1183 | iso_pu_bacteria | 2935793552 | 2935798845 | 313 |
| 1184 | iso_pu_bacteria | 2935801545 | 2935805403 | 313 |
| 1185 | iso_pu_bacteria | 2935810662 | 2935816696 | 313 |
| 1186 | iso_pu_bacteria | 2935819856 | 2935820899 | 313 |
| 1187 | iso_pu_bacteria | 2935827899 | 2935833749 | 313 |
| 1188 | iso_pu_bacteria | 2935837841 | 2935839565 | 313 |
| 1189 | iso_pu_bacteria | 2935847175 | 2935850841 | 313 |
| 1190 | iso_pu_bacteria | 2935855204 | 2935857024 | 313 |
| 1191 | iso_pu_bacteria | 2935864058 | 2935871152 | 313 |
| 1192 | iso_pu_bacteria | 2935873716 | 2935876345 | 313 |
| 1193 | iso_pu_bacteria | 2935883170 | 2935889711 | 313 |
| 1194 | iso_pu_bacteria | 2935908558 | 2935913791 | 313 |
| 1195 | iso_pu_bacteria | 2935916978 | 2935920219 | 313 |
| 1196 | iso_pu_bacteria | 2935926038 | 2935930558 | 313 |
| 1197 | iso_pu_bacteria | 2935934488 | 2935939469 | 313 |
| 1198 | iso_pu_bacteria | 2935942939 | 2935946418 | 313 |
| 1199 | iso_pu_bacteria | 2935951376 | 2935955743 | 313 |
| 1200 | iso_pu_bacteria | 2935959822 | 2935964665 | 313 |
| 1201 | iso_pu_bacteria | 2935967501 | 2935972547 | 313 |
| 1202 | iso_pu_bacteria | 2935975950 | 2935981620 | 313 |
| 1203 | iso_pu_bacteria | 2935984226 | 2935992047 | 313 |
| 1204 | iso_pu_bacteria | 2935992306 | 2935997686 | 313 |
| 1205 | iso_pu_bacteria | 2936002035 | 2936007204 | 313 |
| 1206 | iso_pu_bacteria | 2936011229 | 2936011716 | 313 |
| 1207 | iso_pu_bacteria | 2936019824 | 2936020311 | 313 |
| 1208 | iso_pu_bacteria | 2936028420 | 2936029006 | 313 |
| 1209 | iso_pu_bacteria | 2936037263 | 2936043042 | 313 |
| 1210 | iso_pu_bacteria | 2936046547 | 2936047034 | 313 |
| 1211 | iso_pu_bacteria | 2936055302 | 2936058086 | 313 |
| 1212 | iso_pu_bacteria | 2940556831 | 2940559881 | 313 |
| 1213 | iso_pu_bacteria | 2941531003 | 2941536026 | 313 |
| 1214 | iso_pu_bacteria | 2941538514 | 2941540254 | 313 |
| 1215 | iso_pu_bacteria | 3005506211 | 3005512648 | 313 |
| 1216 | iso_pu_bacteria | 3005587118 | 3005590411 | 313 |
| 1217 | iso_pu_bacteria | 3005594810 | 3005598131 | 313 |
| 1218 | iso_pu_bacteria | 3005710791 | 3005713809 | 313 |
| 1219 | iso_pu_bacteria | 3005718088 | 3005721318 | 313 |
| 1220 | iso_pu_bacteria | 8006926726 | 8006932791 | 313 |
| 1221 | iso_pu_bacteria | 8006933436 | 8006942137 | 313 |
| 1222 | iso_pu_bacteria | 8006973647 | 8006981873 | 313 |
| 1223 | iso_pu_bacteria | 8016511872 | 8016514618 | 313 |
| 1224 | iso_pu_bacteria | 8016522445 | 8016530723 | 313 |
| 1225 | iso_pu_bacteria | 8016530956 | 8016536009 | 313 |
| 1226 | iso_pu_bacteria | 8016539877 | 8016540289 | 313 |
| 1227 | iso_pu_bacteria | 8016548790 | 8016552941 | 313 |
| 1228 | iso_pu_bacteria | 8016557553 | 8016561318 | 313 |
| 1229 | iso_pu_bacteria | 8016575299 | 8016578455 | 313 |
| 1230 | iso_pu_bacteria | 8016595262 | 8016599176 | 313 |
| 1231 | iso_pu_bacteria | 8016603502 | 8016611870 | 313 |
| 1232 | iso_pu_bacteria | 8016613128 | 8016621935 | 313 |
| 1233 | iso_pu_bacteria | 8016622563 | 8016627915 | 313 |
| 1234 | iso_pu_bacteria | 8016630954 | 8016632240 | 313 |
| 1235 | iso_pu_bacteria | 8017057580 | 8017061812 | 313 |
| 1236 | iso_pu_bacteria | 8019530166 | 8019535736 | 313 |
| 1237 | iso_pu_bacteria | 8019538911 | 8019543745 | 313 |
| 1238 | iso_pu_bacteria | 8019547302 | 8019555026 | 313 |
| 1239 | iso_pu_bacteria | 8019576017 | 8019581341 | 313 |
| 1240 | iso_pu_bacteria | 8019597564 | 8019602268 | 313 |
| 1241 | iso_pu_bacteria | 8019608314 | 8019616294 | 313 |
| 1242 | iso_pu_bacteria | 8019619141 | 8019626898 | 313 |
| 1243 | iso_pu_bacteria | 8019629233 | 8019635620 | 313 |
| 1244 | iso_pu_bacteria | 8019638758 | 8019644065 | 313 |
| 1245 | iso_pu_bacteria | 8019659431 | 8019663417 | 313 |
| 1246 | iso_pu_bacteria | 8019668869 | 8019673032 | 313 |
| 1247 | iso_pu_bacteria | 8019678201 | 8019683111 | 313 |
| 1248 | iso_pu_bacteria | 8019687851 | 8019688802 | 313 |
| 1249 | iso_pu_bacteria | 8055742211 | 8055747493 | 313 |
| 1250 | iso_pu_bacteria | 8056673599 | 8056680548 | 313 |
| 1251 | iso_pu_bacteria | 8056681323 | 8056683888 | 313 |
| 1252 | iso_pu_bacteria | 8056967851 | 8056972433 | 313 |
| 1253 | 3300005535 | Ga0070684_100328729 | Ga0070684_1003287292 | 314 |
| 1254 | 3300005615 | Ga0070702_100094948 | Ga0070702_1000949481 | 314 |
| 1255 | 3300014325 | Ga0163163_10002136 | Ga0163163_1000213610 | 314 |
| 1256 | 3300024227 | Ga0228598_1014149 | Ga0228598_10141492 | 314 |
| 1257 | 3300025986 | Ga0207658_10076590 | Ga0207658_100765902 | 314 |
| 1258 | 3300035725 | Ga0373947_0009876 | Ga0373947_0009876_322_1296 | 314 |
| 1259 | 3300038443 | Ga0395901_0613777 | Ga0395901_0613777_52_1011 | 314 |
| 1260 | 3300047321 | Ga0495676_0045710 | Ga0495676_0045710_32_1006 | 314 |
| 1261 | 3300048905 | Ga0496102_0058983 | Ga0496102_0058983_1172_2146 | 314 |
| 1262 | 3300048907 | Ga0496104_0001994 | Ga0496104_0001994_3071_4045 | 314 |
| 1263 | 3300048908 | Ga0496105_0002533 | Ga0496105_0002533_2345_3319 | 314 |
| 1264 | 3300048911 | Ga0496108_0007201 | Ga0496108_0007201_3268_4242 | 314 |
| 1265 | 3300048912 | Ga0496109_0017496 | Ga0496109_0017496_3678_4652 | 314 |
| 1266 | 3300048914 | Ga0496111_0001890 | Ga0496111_0001890_6138_7112 | 314 |
| 1267 | 3300048915 | Ga0496112_0001865 | Ga0496112_0001865_3414_4388 | 314 |
| 1268 | 3300048916 | Ga0496113_0000167 | Ga0496113_0000167_12011_12985 | 314 |
| 1269 | 3300048917 | Ga0496114_0028876 | Ga0496114_0028876_3181_4155 | 314 |
| 1270 | 3300048918 | Ga0496115_0044765 | Ga0496115_0044765_993_1967 | 314 |
| 1271 | iso_pu_bacteria | 2508501128 | 2509149566 | 314 |
| 1272 | iso_pu_bacteria | 2513237096 | 2513661081 | 314 |
| 1273 | iso_pu_bacteria | 2513237098 | 2513673717 | 314 |
| 1274 | iso_pu_bacteria | 2513237101 | 2513691462 | 314 |
| 1275 | iso_pu_bacteria | 2513237141 | 2513893904 | 314 |
| 1276 | iso_pu_bacteria | 2513237145 | 2513922766 | 314 |
| 1277 | iso_pu_bacteria | 2517572143 | 2517893412 | 314 |
| 1278 | iso_pu_bacteria | 2524023210 | 2524470072 | 314 |
| 1279 | iso_pu_bacteria | 2524023228 | 2524537918 | 314 |
| 1280 | iso_pu_bacteria | 2728368998 | 2728747818 | 314 |
| 1281 | iso_pu_bacteria | 2791355197 | 2793071826 | 314 |
| 1282 | iso_pu_bacteria | 2791355199 | 2793076744 | 314 |
| 1283 | iso_pu_bacteria | 2857524615 | 2857528169 | 314 |
| 1284 | iso_pu_bacteria | 2874604998 | 2874608974 | 314 |
| 1285 | iso_pu_bacteria | 2876808645 | 2876809550 | 314 |
| 1286 | iso_pu_bacteria | 2879110137 | 2879110614 | 314 |
| 1287 | iso_pu_bacteria | 2885374607 | 2885377294 | 314 |
| 1288 | iso_pu_bacteria | 2885383462 | 2885389901 | 314 |
| 1289 | iso_pu_bacteria | 2889033259 | 2889041030 | 314 |
| 1290 | iso_pu_bacteria | 2893066018 | 2893068612 | 314 |
| 1291 | iso_pu_bacteria | 2903748898 | 2903755595 | 314 |
| 1292 | iso_pu_bacteria | 2903768456 | 2903774911 | 314 |
| 1293 | iso_pu_bacteria | 2904690495 | 2904696750 | 314 |
| 1294 | iso_pu_bacteria | 2904699407 | 2904701743 | 314 |
| 1295 | iso_pu_bacteria | 2906610324 | 2906617386 | 314 |
| 1296 | iso_pu_bacteria | 2906635258 | 2906640630 | 314 |
| 1297 | iso_pu_bacteria | 2906660503 | 2906665850 | 314 |
| 1298 | iso_pu_bacteria | 2908756301 | 2908761537 | 314 |
| 1299 | iso_pu_bacteria | 2922361189 | 2922368008 | 314 |
| 1300 | iso_pu_bacteria | 2922386360 | 2922392112 | 314 |
| 1301 | iso_pu_bacteria | 2922425934 | 2922429057 | 314 |
| 1302 | iso_pu_bacteria | 8006964411 | 8006964445 | 314 |
| 1303 | iso_pu_bacteria | 8006984368 | 8006986949 | 314 |
| 1304 | iso_pu_bacteria | 8006994254 | 8006996166 | 314 |
| 1305 | iso_pu_bacteria | 8019555841 | 8019557868 | 314 |
| 1306 | iso_pu_bacteria | 8019565922 | 8019567422 | 314 |
| 1307 | iso_pu_bacteria | 8056689827 | 8056694238 | 314 |
| 1308 | 3300005336 | Ga0070680_100003612 | Ga0070680_1000036124 | 315 |
| 1309 | 3300005530 | Ga0070679_100038790 | Ga0070679_1000387903 | 315 |
| 1310 | 3300005539 | Ga0068853_100057773 | Ga0068853_1000577733 | 315 |
| 1311 | 3300006038 | Ga0075365_10098835 | Ga0075365_100988352 | 315 |
| 1312 | 3300006178 | Ga0075367_10002507 | Ga0075367_100025076 | 315 |
| 1313 | 3300013307 | Ga0157372_10137753 | Ga0157372_101377532 | 315 |
| 1314 | 3300013308 | Ga0157375_10156434 | Ga0157375_101564342 | 315 |
| 1315 | 3300025912 | Ga0207707_10001941 | Ga0207707_1000194111 | 315 |
| 1316 | 3300025921 | Ga0207652_10012449 | Ga0207652_100124497 | 315 |
| 1317 | 3300025949 | Ga0207667_10161364 | Ga0207667_101613641 | 315 |
| 1318 | 3300039453 | Ga0436362_0372017 | Ga0436362_0372017_35_1063 | 315 |
| 1319 | 3300050494 | nmdc:mga06z11_5600_c1 | nmdc:mga06z11_5600_c1_1955_2902 | 315 |
| 1320 | 3300005329 | Ga0070683_100141803 | Ga0070683_1001418032 | 316 |
| 1321 | 3300005338 | Ga0068868_100027083 | Ga0068868_1000270835 | 316 |
| 1322 | 3300005356 | Ga0070674_100069140 | Ga0070674_1000691402 | 316 |
| 1323 | 3300005435 | Ga0070714_100331329 | Ga0070714_1003313291 | 316 |
| 1324 | 3300005455 | Ga0070663_100100803 | Ga0070663_1001008032 | 316 |
| 1325 | 3300005548 | Ga0070665_100272492 | Ga0070665_1002724922 | 316 |
| 1326 | 3300005614 | Ga0068856_100000680 | Ga0068856_10000068014 | 316 |
| 1327 | 3300005981 | Ga0081538_10043613 | Ga0081538_100436132 | 316 |
| 1328 | 3300006028 | Ga0070717_10012420 | Ga0070717_100124205 | 316 |
| 1329 | 3300006028 | Ga0070717_10386289 | Ga0070717_103862892 | 316 |
| 1330 | 3300006038 | Ga0075365_10240706 | Ga0075365_102407061 | 316 |
| 1331 | 3300006358 | Ga0068871_100309432 | Ga0068871_1003094322 | 316 |
| 1332 | 3300009098 | Ga0105245_10087602 | Ga0105245_100876022 | 316 |
| 1333 | 3300009177 | Ga0105248_10337987 | Ga0105248_103379872 | 316 |
| 1334 | 3300009545 | Ga0105237_10309025 | Ga0105237_103090252 | 316 |
| 1335 | 3300009551 | Ga0105238_10008143 | Ga0105238_100081432 | 316 |
| 1336 | 3300010375 | Ga0105239_10326162 | Ga0105239_103261622 | 316 |
| 1337 | 3300011119 | Ga0105246_10017489 | Ga0105246_100174896 | 316 |
| 1338 | 3300013296 | Ga0157374_10049880 | Ga0157374_100498804 | 316 |
| 1339 | 3300013297 | Ga0157378_10026868 | Ga0157378_100268683 | 316 |
| 1340 | 3300013308 | Ga0157375_10058420 | Ga0157375_100584202 | 316 |
| 1341 | 3300021388 | Ga0213875_10019342 | Ga0213875_100193422 | 316 |
| 1342 | 3300025297 | Ga0209758_1004652 | Ga0209758_10046523 | 316 |
| 1343 | 3300025908 | Ga0207643_10127481 | Ga0207643_101274812 | 316 |
| 1344 | 3300025914 | Ga0207671_10090005 | Ga0207671_100900052 | 316 |
| 1345 | 3300025927 | Ga0207687_10192768 | Ga0207687_101927682 | 316 |
| 1346 | 3300025928 | Ga0207700_10001731 | Ga0207700_100017315 | 316 |
| 1347 | 3300025929 | Ga0207664_10403233 | Ga0207664_104032331 | 316 |
| 1348 | 3300025940 | Ga0207691_10266214 | Ga0207691_102662142 | 316 |
| 1349 | 3300025941 | Ga0207711_10108304 | Ga0207711_101083043 | 316 |
| 1350 | 3300025944 | Ga0207661_10034064 | Ga0207661_100340644 | 316 |
| 1351 | 3300026067 | Ga0207678_10028024 | Ga0207678_100280244 | 316 |
| 1352 | 3300026078 | Ga0207702_10000433 | Ga0207702_1000043314 | 316 |
| 1353 | 3300028379 | Ga0268266_10102980 | Ga0268266_101029802 | 316 |
| 1354 | 3300031548 | Ga0307408_100269328 | Ga0307408_1002693282 | 316 |
| 1355 | 3300035724 | Ga0373933_0000059 | Ga0373933_0000059_22898_23851 | 316 |
| 1356 | 3300036401 | Ga0373937_0317447 | Ga0373937_0317447_447_1436 | 316 |
| 1357 | 3300037471 | Ga0395905_0157417 | Ga0395905_0157417_32_985 | 316 |
| 1358 | 3300037853 | Ga0436364_0719526 | Ga0436364_0719526_1977_2957 | 316 |
| 1359 | 3300046455 | Ga0495603_0067622 | Ga0495603_0067622_589_1542 | 316 |
| 1360 | 3300046463 | Ga0495653_0050466 | Ga0495653_0050466_58_1056 | 316 |
| 1361 | 3300046477 | Ga0495664_0042937 | Ga0495664_0042937_1125_2123 | 316 |
| 1362 | 3300046507 | Ga0495606_0161826 | Ga0495606_0161826_74_1024 | 316 |
| 1363 | 3300046511 | Ga0495608_0030766 | Ga0495608_0030766_2182_3171 | 316 |
| 1364 | 3300046511 | Ga0495608_0145227 | Ga0495608_0145227_363_1361 | 316 |
| 1365 | 3300046514 | Ga0495618_0047475 | Ga0495618_0047475_1448_2446 | 316 |
| 1366 | 3300046516 | Ga0495628_0000179 | Ga0495628_0000179_2194_3192 | 316 |
| 1367 | 3300046517 | Ga0495630_0048283 | Ga0495630_0048283_1018_2016 | 316 |
| 1368 | 3300046524 | Ga0495648_0001231 | Ga0495648_0001231_4508_5461 | 316 |
| 1369 | 3300046529 | Ga0495652_0003775 | Ga0495652_0003775_2108_3106 | 316 |
| 1370 | 3300046543 | Ga0495645_0073011 | Ga0495645_0073011_31_1029 | 316 |
| 1371 | 3300046663 | Ga0495635_0105169 | Ga0495635_0105169_746_1744 | 316 |
| 1372 | 3300046675 | Ga0495657_0019735 | Ga0495657_0019735_2867_3865 | 316 |
| 1373 | 3300046678 | Ga0495599_0007297 | Ga0495599_0007297_110_1108 | 316 |
| 1374 | 3300046680 | Ga0495646_0046613 | Ga0495646_0046613_1632_2630 | 316 |
| 1375 | 3300046681 | Ga0495647_0053660 | Ga0495647_0053660_513_1466 | 316 |
| 1376 | 3300047317 | Ga0495604_0015742 | Ga0495604_0015742_2627_3625 | 316 |
| 1377 | 3300047319 | Ga0495674_0011690 | Ga0495674_0011690_2201_3199 | 316 |
| 1378 | 3300047319 | Ga0495674_0081886 | Ga0495674_0081886_508_1497 | 316 |
| 1379 | 3300047320 | Ga0495672_0002625 | Ga0495672_0002625_7760_8719 | 316 |
| 1380 | 3300047320 | Ga0495672_0065297 | Ga0495672_0065297_10_960 | 316 |
| 1381 | 3300047322 | Ga0495680_0016955 | Ga0495680_0016955_3085_4083 | 316 |
| 1382 | 3300047444 | Ga0495675_0000012 | Ga0495675_0000012_20613_21611 | 316 |
| 1383 | 3300047471 | Ga0495684_0000152 | Ga0495684_0000152_38274_39263 | 316 |
| 1384 | 3300047471 | Ga0495684_0026007 | Ga0495684_0026007_232_1230 | 316 |
| 1385 | 3300047472 | Ga0495686_0010693 | Ga0495686_0010693_3703_4713 | 316 |
| 1386 | 3300048088 | Ga0495602_0003796 | Ga0495602_0003796_9138_10136 | 316 |
| 1387 | 3300048088 | Ga0495602_0081111 | Ga0495602_0081111_965_1954 | 316 |
| 1388 | 3300048903 | Ga0496100_0044702 | Ga0496100_0044702_1285_2250 | 316 |
| 1389 | 3300048904 | Ga0496101_0002458 | Ga0496101_0002458_3782_4747 | 316 |
| 1390 | 3300048905 | Ga0496102_0007740 | Ga0496102_0007740_1555_2520 | 316 |
| 1391 | 3300048907 | Ga0496104_0075355 | Ga0496104_0075355_913_1878 | 316 |
| 1392 | 3300048907 | Ga0496104_0137566 | Ga0496104_0137566_729_1682 | 316 |
| 1393 | 3300048908 | Ga0496105_0100971 | Ga0496105_0100971_1105_2070 | 316 |
| 1394 | 3300048908 | Ga0496105_0224771 | Ga0496105_0224771_128_1081 | 316 |
| 1395 | 3300048909 | Ga0496106_0001555 | Ga0496106_0001555_11667_12620 | 316 |
| 1396 | 3300048909 | Ga0496106_0093536 | Ga0496106_0093536_240_1205 | 316 |
| 1397 | 3300048910 | Ga0496107_0147709 | Ga0496107_0147709_77_1042 | 316 |
| 1398 | 3300048911 | Ga0496108_0001200 | Ga0496108_0001200_19059_20012 | 316 |
| 1399 | 3300048911 | Ga0496108_0082301 | Ga0496108_0082301_686_1651 | 316 |
| 1400 | 3300048912 | Ga0496109_0116944 | Ga0496109_0116944_285_1238 | 316 |
| 1401 | 3300048913 | Ga0496110_0006609 | Ga0496110_0006609_7818_8783 | 316 |
| 1402 | 3300048913 | Ga0496110_0017235 | Ga0496110_0017235_2872_3825 | 316 |
| 1403 | 3300048915 | Ga0496112_0004442 | Ga0496112_0004442_4911_5864 | 316 |
| 1404 | 3300048915 | Ga0496112_0067255 | Ga0496112_0067255_1195_2160 | 316 |
| 1405 | 3300048916 | Ga0496113_0180894 | Ga0496113_0180894_279_1244 | 316 |
| 1406 | 3300048918 | Ga0496115_0007883 | Ga0496115_0007883_358_1323 | 316 |
| 1407 | 3300048922 | Ga0496119_0044797 | Ga0496119_0044797_1058_2011 | 316 |
| 1408 | 3300048924 | Ga0496121_0103679 | Ga0496121_0103679_984_1937 | 316 |
| 1409 | 3300049822 | Ga0501035_0022569 | Ga0501035_0022569_1912_2865 | 316 |
| 1410 | 3300053094 | Ga0500566_0050801 | Ga0500566_0050801_823_1776 | 316 |
| 1411 | 3300053102 | Ga0500554_074459 | Ga0500554_074459_110_1063 | 316 |
| 1412 | 3300053119 | Ga0500595_000450 | Ga0500595_000450_24571_25524 | 316 |
| 1413 | 3300053162 | Ga0500638_008035 | Ga0500638_008035_53_1006 | 316 |
| 1414 | 3300053178 | Ga0500637_0004182 | Ga0500637_0004182_5802_6755 | 316 |
| 1415 | 3300055283 | Ga0500661_024384 | Ga0500661_024384_50_1003 | 316 |
| 1416 | 2010549000 | RicEn_C2224 | RicEn_40840 | 317 |
| 1417 | 3300003203 | JGI25406J46586_10001179 | JGI25406J46586_100011793 | 317 |
| 1418 | 3300003203 | JGI25406J46586_10004585 | JGI25406J46586_100045855 | 317 |
| 1419 | 3300003215 | JGI25153J46596_10000964 | JGI25153J46596_1000096421 | 317 |
| 1420 | 3300003215 | JGI25153J46596_10014750 | JGI25153J46596_100147502 | 317 |
| 1421 | 3300003215 | JGI25153J46596_10028068 | JGI25153J46596_100280682 | 317 |
| 1422 | 3300003354 | JGI25160J50197_1006435 | JGI25160J50197_10064354 | 317 |
| 1423 | 3300003659 | JGI25404J52841_10006257 | JGI25404J52841_100062572 | 317 |
| 1424 | 3300003659 | JGI25404J52841_10022839 | JGI25404J52841_100228391 | 317 |
| 1425 | 3300003659 | JGI25404J52841_10023380 | JGI25404J52841_100233801 | 317 |
| 1426 | 3300003659 | JGI25404J52841_10024164 | JGI25404J52841_100241642 | 317 |
| 1427 | 3300003771 | Ga0055526_1014612 | Ga0055526_10146123 | 317 |
| 1428 | 3300003775 | Ga0055524_1016057 | Ga0055524_10160572 | 317 |
| 1429 | 3300004625 | Ga0055543_1005787 | Ga0055543_10057872 | 317 |
| 1430 | 3300005262 | Ga0065165_1001478 | Ga0065165_100147828 | 317 |
| 1431 | 3300005262 | Ga0065165_1049491 | Ga0065165_10494912 | 317 |
| 1432 | 3300005327 | Ga0070658_10046430 | Ga0070658_100464303 | 317 |
| 1433 | 3300005327 | Ga0070658_10460442 | Ga0070658_104604421 | 317 |
| 1434 | 3300005331 | Ga0070670_100059448 | Ga0070670_1000594483 | 317 |
| 1435 | 3300005336 | Ga0070680_100006838 | Ga0070680_1000068384 | 317 |
| 1436 | 3300005336 | Ga0070680_100290426 | Ga0070680_1002904261 | 317 |
| 1437 | 3300005338 | Ga0068868_100051682 | Ga0068868_1000516821 | 317 |
| 1438 | 3300005339 | Ga0070660_100000712 | Ga0070660_10000071221 | 317 |
| 1439 | 3300005339 | Ga0070660_100105000 | Ga0070660_1001050002 | 317 |
| 1440 | 3300005339 | Ga0070660_100406332 | Ga0070660_1004063321 | 317 |
| 1441 | 3300005344 | Ga0070661_100040992 | Ga0070661_1000409922 | 317 |
| 1442 | 3300005347 | Ga0070668_100323250 | Ga0070668_1003232501 | 317 |
| 1443 | 3300005356 | Ga0070674_100045491 | Ga0070674_1000454913 | 317 |
| 1444 | 3300005366 | Ga0070659_100032961 | Ga0070659_1000329613 | 317 |
| 1445 | 3300005366 | Ga0070659_100176657 | Ga0070659_1001766571 | 317 |
| 1446 | 3300005367 | Ga0070667_100097327 | Ga0070667_1000973272 | 317 |
| 1447 | 3300005367 | Ga0070667_100450903 | Ga0070667_1004509031 | 317 |
| 1448 | 3300005434 | Ga0070709_10000551 | Ga0070709_100005519 | 317 |
| 1449 | 3300005434 | Ga0070709_10039200 | Ga0070709_100392002 | 317 |
| 1450 | 3300005434 | Ga0070709_10145883 | Ga0070709_101458831 | 317 |
| 1451 | 3300005435 | Ga0070714_100006459 | Ga0070714_1000064599 | 317 |
| 1452 | 3300005435 | Ga0070714_100078545 | Ga0070714_1000785453 | 317 |
| 1453 | 3300005435 | Ga0070714_100520002 | Ga0070714_1005200021 | 317 |
| 1454 | 3300005436 | Ga0070713_100012869 | Ga0070713_1000128691 | 317 |
| 1455 | 3300005436 | Ga0070713_100048830 | Ga0070713_1000488303 | 317 |
| 1456 | 3300005436 | Ga0070713_100071444 | Ga0070713_1000714442 | 317 |
| 1457 | 3300005436 | Ga0070713_100215848 | Ga0070713_1002158482 | 317 |
| 1458 | 3300005437 | Ga0070710_10001238 | Ga0070710_100012386 | 317 |
| 1459 | 3300005437 | Ga0070710_10001820 | Ga0070710_100018205 | 317 |
| 1460 | 3300005437 | Ga0070710_10014322 | Ga0070710_100143224 | 317 |
| 1461 | 3300005439 | Ga0070711_100002350 | Ga0070711_1000023503 | 317 |
| 1462 | 3300005439 | Ga0070711_100003473 | Ga0070711_1000034734 | 317 |
| 1463 | 3300005439 | Ga0070711_100161009 | Ga0070711_1001610091 | 317 |
| 1464 | 3300005445 | Ga0070708_100098574 | Ga0070708_1000985742 | 317 |
| 1465 | 3300005455 | Ga0070663_100020630 | Ga0070663_1000206303 | 317 |
| 1466 | 3300005455 | Ga0070663_100129121 | Ga0070663_1001291212 | 317 |
| 1467 | 3300005455 | Ga0070663_100132501 | Ga0070663_1001325012 | 317 |
| 1468 | 3300005455 | Ga0070663_100173848 | Ga0070663_1001738482 | 317 |
| 1469 | 3300005457 | Ga0070662_100118532 | Ga0070662_1001185322 | 317 |
| 1470 | 3300005457 | Ga0070662_100425940 | Ga0070662_1004259401 | 317 |
| 1471 | 3300005458 | Ga0070681_10069947 | Ga0070681_100699473 | 317 |
| 1472 | 3300005459 | Ga0068867_100021615 | Ga0068867_1000216155 | 317 |
| 1473 | 3300005467 | Ga0070706_100099702 | Ga0070706_1000997023 | 317 |
| 1474 | 3300005471 | Ga0070698_100036324 | Ga0070698_1000363243 | 317 |
| 1475 | 3300005530 | Ga0070679_100022733 | Ga0070679_1000227334 | 317 |
| 1476 | 3300005530 | Ga0070679_100089045 | Ga0070679_1000890452 | 317 |
| 1477 | 3300005530 | Ga0070679_100407730 | Ga0070679_1004077302 | 317 |
| 1478 | 3300005535 | Ga0070684_100054319 | Ga0070684_1000543193 | 317 |
| 1479 | 3300005539 | Ga0068853_100072650 | Ga0068853_1000726502 | 317 |
| 1480 | 3300005539 | Ga0068853_100139930 | Ga0068853_1001399302 | 317 |
| 1481 | 3300005543 | Ga0070672_100151643 | Ga0070672_1001516432 | 317 |
| 1482 | 3300005548 | Ga0070665_100044294 | Ga0070665_1000442945 | 317 |
| 1483 | 3300005548 | Ga0070665_100046013 | Ga0070665_1000460132 | 317 |
| 1484 | 3300005548 | Ga0070665_100082828 | Ga0070665_1000828281 | 317 |
| 1485 | 3300005548 | Ga0070665_100368380 | Ga0070665_1003683802 | 317 |
| 1486 | 3300005548 | Ga0070665_100380040 | Ga0070665_1003800402 | 317 |
| 1487 | 3300005563 | Ga0068855_100032479 | Ga0068855_1000324794 | 317 |
| 1488 | 3300005563 | Ga0068855_100064535 | Ga0068855_1000645353 | 317 |
| 1489 | 3300005563 | Ga0068855_100130991 | Ga0068855_1001309911 | 317 |
| 1490 | 3300005563 | Ga0068855_100228906 | Ga0068855_1002289062 | 317 |
| 1491 | 3300005563 | Ga0068855_100653046 | Ga0068855_1006530461 | 317 |
| 1492 | 3300005564 | Ga0070664_100202560 | Ga0070664_1002025602 | 317 |
| 1493 | 3300005577 | Ga0068857_100117621 | Ga0068857_1001176213 | 317 |
| 1494 | 3300005616 | Ga0068852_100002663 | Ga0068852_1000026636 | 317 |
| 1495 | 3300005616 | Ga0068852_100334862 | Ga0068852_1003348622 | 317 |
| 1496 | 3300005617 | Ga0068859_100313387 | Ga0068859_1003133871 | 317 |
| 1497 | 3300005617 | Ga0068859_100346401 | Ga0068859_1003464012 | 317 |
| 1498 | 3300005618 | Ga0068864_100080180 | Ga0068864_1000801803 | 317 |
| 1499 | 3300005719 | Ga0068861_100239575 | Ga0068861_1002395752 | 317 |
| 1500 | 3300005719 | Ga0068861_100286196 | Ga0068861_1002861962 | 317 |
| 1501 | 3300005719 | Ga0068861_100428911 | Ga0068861_1004289111 | 317 |
| 1502 | 3300005834 | Ga0068851_10014696 | Ga0068851_100146963 | 317 |
| 1503 | 3300005841 | Ga0068863_100230221 | Ga0068863_1002302212 | 317 |
| 1504 | 3300005841 | Ga0068863_100572368 | Ga0068863_1005723681 | 317 |
| 1505 | 3300005842 | Ga0068858_100050616 | Ga0068858_1000506162 | 317 |
| 1506 | 3300005842 | Ga0068858_100104515 | Ga0068858_1001045152 | 317 |
| 1507 | 3300005843 | Ga0068860_100000258 | Ga0068860_10000025849 | 317 |
| 1508 | 3300005843 | Ga0068860_100270797 | Ga0068860_1002707972 | 317 |
| 1509 | 3300005937 | Ga0081455_10000992 | Ga0081455_1000099220 | 317 |
| 1510 | 3300005937 | Ga0081455_10014642 | Ga0081455_100146426 | 317 |
| 1511 | 3300005937 | Ga0081455_10077075 | Ga0081455_100770753 | 317 |
| 1512 | 3300005983 | Ga0081540_1001447 | Ga0081540_10014471 | 317 |
| 1513 | 3300005983 | Ga0081540_1003602 | Ga0081540_10036022 | 317 |
| 1514 | 3300005983 | Ga0081540_1010266 | Ga0081540_10102662 | 317 |
| 1515 | 3300005983 | Ga0081540_1013011 | Ga0081540_10130114 | 317 |
| 1516 | 3300005983 | Ga0081540_1017968 | Ga0081540_10179683 | 317 |
| 1517 | 3300005983 | Ga0081540_1029167 | Ga0081540_10291674 | 317 |
| 1518 | 3300005983 | Ga0081540_1042958 | Ga0081540_10429582 | 317 |
| 1519 | 3300005983 | Ga0081540_1050922 | Ga0081540_10509221 | 317 |
| 1520 | 3300005983 | Ga0081540_1058311 | Ga0081540_10583112 | 317 |
| 1521 | 3300005983 | Ga0081540_1067104 | Ga0081540_10671041 | 317 |
| 1522 | 3300005983 | Ga0081540_1089783 | Ga0081540_10897832 | 317 |
| 1523 | 3300005985 | Ga0081539_10000140 | Ga0081539_10000140118 | 317 |
| 1524 | 3300005985 | Ga0081539_10000897 | Ga0081539_1000089755 | 317 |
| 1525 | 3300005985 | Ga0081539_10008354 | Ga0081539_100083545 | 317 |
| 1526 | 3300005985 | Ga0081539_10087407 | Ga0081539_100874072 | 317 |
| 1527 | 3300006028 | Ga0070717_10038867 | Ga0070717_100388674 | 317 |
| 1528 | 3300006028 | Ga0070717_10286247 | Ga0070717_102862472 | 317 |
| 1529 | 3300006038 | Ga0075365_10020374 | Ga0075365_100203743 | 317 |
| 1530 | 3300006042 | Ga0075368_10016033 | Ga0075368_100160333 | 317 |
| 1531 | 3300006042 | Ga0075368_10028860 | Ga0075368_100288602 | 317 |
| 1532 | 3300006048 | Ga0075363_100090159 | Ga0075363_1000901592 | 317 |
| 1533 | 3300006051 | Ga0075364_10137155 | Ga0075364_101371552 | 317 |
| 1534 | 3300006051 | Ga0075364_10267926 | Ga0075364_102679262 | 317 |
| 1535 | 3300006175 | Ga0070712_100027212 | Ga0070712_1000272123 | 317 |
| 1536 | 3300006175 | Ga0070712_100028983 | Ga0070712_1000289833 | 317 |
| 1537 | 3300006178 | Ga0075367_10162643 | Ga0075367_101626432 | 317 |
| 1538 | 3300006237 | Ga0097621_100188828 | Ga0097621_1001888282 | 317 |
| 1539 | 3300006353 | Ga0075370_10085010 | Ga0075370_100850102 | 317 |
| 1540 | 3300006353 | Ga0075370_10209295 | Ga0075370_102092952 | 317 |
| 1541 | 3300006844 | Ga0075428_100318846 | Ga0075428_1003188462 | 317 |
| 1542 | 3300006871 | Ga0075434_100249559 | Ga0075434_1002495592 | 317 |
| 1543 | 3300006881 | Ga0068865_100119716 | Ga0068865_1001197162 | 317 |
| 1544 | 3300006931 | Ga0097620_100313373 | Ga0097620_1003133731 | 317 |
| 1545 | 3300006931 | Ga0097620_100346440 | Ga0097620_1003464402 | 317 |
| 1546 | 3300006941 | Ga0099825_1025546 | Ga0099825_10255463 | 317 |
| 1547 | 3300006941 | Ga0099825_1034052 | Ga0099825_10340522 | 317 |
| 1548 | 3300006942 | Ga0099824_1007709 | Ga0099824_100770919 | 317 |
| 1549 | 3300006942 | Ga0099824_1009535 | Ga0099824_10095357 | 317 |
| 1550 | 3300006943 | Ga0099822_1037622 | Ga0099822_10376223 | 317 |
| 1551 | 3300006943 | Ga0099822_1044439 | Ga0099822_10444392 | 317 |
| 1552 | 3300007265 | Ga0099794_10019289 | Ga0099794_100192893 | 317 |
| 1553 | 3300007265 | Ga0099794_10033765 | Ga0099794_100337652 | 317 |
| 1554 | 3300009093 | Ga0105240_10002310 | Ga0105240_1000231023 | 317 |
| 1555 | 3300009093 | Ga0105240_10027925 | Ga0105240_100279252 | 317 |
| 1556 | 3300009094 | Ga0111539_10195008 | Ga0111539_101950082 | 317 |
| 1557 | 3300009098 | Ga0105245_10011198 | Ga0105245_100111987 | 317 |
| 1558 | 3300009174 | Ga0105241_10041926 | Ga0105241_100419263 | 317 |
| 1559 | 3300009174 | Ga0105241_10094937 | Ga0105241_100949372 | 317 |
| 1560 | 3300009174 | Ga0105241_10373718 | Ga0105241_103737182 | 317 |
| 1561 | 3300009176 | Ga0105242_10635877 | Ga0105242_106358771 | 317 |
| 1562 | 3300009545 | Ga0105237_10002162 | Ga0105237_100021625 | 317 |
| 1563 | 3300009545 | Ga0105237_10025732 | Ga0105237_100257325 | 317 |
| 1564 | 3300009545 | Ga0105237_10179615 | Ga0105237_101796152 | 317 |
| 1565 | 3300009551 | Ga0105238_10108633 | Ga0105238_101086333 | 317 |
| 1566 | 3300009551 | Ga0105238_10231024 | Ga0105238_102310241 | 317 |
| 1567 | 3300009551 | Ga0105238_10265679 | Ga0105238_102656791 | 317 |
| 1568 | 3300010159 | Ga0099796_10007451 | Ga0099796_100074512 | 317 |
| 1569 | 3300010375 | Ga0105239_10088786 | Ga0105239_100887863 | 317 |
| 1570 | 3300010375 | Ga0105239_10227156 | Ga0105239_102271562 | 317 |
| 1571 | 3300011119 | Ga0105246_10155346 | Ga0105246_101553462 | 317 |
| 1572 | 3300013104 | Ga0157370_10077059 | Ga0157370_100770594 | 317 |
| 1573 | 3300013104 | Ga0157370_10381827 | Ga0157370_103818272 | 317 |
| 1574 | 3300013105 | Ga0157369_10009732 | Ga0157369_1000973215 | 317 |
| 1575 | 3300013105 | Ga0157369_10151909 | Ga0157369_101519092 | 317 |
| 1576 | 3300013105 | Ga0157369_10282041 | Ga0157369_102820412 | 317 |
| 1577 | 3300013296 | Ga0157374_10065342 | Ga0157374_100653423 | 317 |
| 1578 | 3300013297 | Ga0157378_10211465 | Ga0157378_102114652 | 317 |
| 1579 | 3300013306 | Ga0163162_10415528 | Ga0163162_104155281 | 317 |
| 1580 | 3300013307 | Ga0157372_10318761 | Ga0157372_103187612 | 317 |
| 1581 | 3300014497 | Ga0182008_10092916 | Ga0182008_100929161 | 317 |
| 1582 | 3300014968 | Ga0157379_10055612 | Ga0157379_100556125 | 317 |
| 1583 | 3300020069 | Ga0197907_11327166 | Ga0197907_113271662 | 317 |
| 1584 | 3300020069 | Ga0197907_11489271 | Ga0197907_114892712 | 317 |
| 1585 | 3300020070 | Ga0206356_11264946 | Ga0206356_112649462 | 317 |
| 1586 | 3300020081 | Ga0206354_10438044 | Ga0206354_104380442 | 317 |
| 1587 | 3300020082 | Ga0206353_11048710 | Ga0206353_110487103 | 317 |
| 1588 | 3300021320 | Ga0214544_1000006 | Ga0214544_1000006119 | 317 |
| 1589 | 3300021321 | Ga0214542_1000002 | Ga0214542_1000002256 | 317 |
| 1590 | 3300021324 | Ga0214545_1000002 | Ga0214545_1000002463 | 317 |
| 1591 | 3300021327 | Ga0214543_1000017 | Ga0214543_100001767 | 317 |
| 1592 | 3300021384 | Ga0213876_10015756 | Ga0213876_100157562 | 317 |
| 1593 | 3300021441 | Ga0213871_10007482 | Ga0213871_100074823 | 317 |
| 1594 | 3300022467 | Ga0224712_10002521 | Ga0224712_100025214 | 317 |
| 1595 | 3300025230 | Ga0209563_101440 | Ga0209563_1014402 | 317 |
| 1596 | 3300025253 | Ga0209677_100615 | Ga0209677_10061511 | 317 |
| 1597 | 3300025253 | Ga0209677_108121 | Ga0209677_1081213 | 317 |
| 1598 | 3300025254 | Ga0209148_1000354 | Ga0209148_100035448 | 317 |
| 1599 | 3300025254 | Ga0209148_1004815 | Ga0209148_10048153 | 317 |
| 1600 | 3300025261 | Ga0209233_1002313 | Ga0209233_10023135 | 317 |
| 1601 | 3300025261 | Ga0209233_1007318 | Ga0209233_10073183 | 317 |
| 1602 | 3300025272 | Ga0209455_1003303 | Ga0209455_10033032 | 317 |
| 1603 | 3300025272 | Ga0209455_1008176 | Ga0209455_10081763 | 317 |
| 1604 | 3300025272 | Ga0209455_1009508 | Ga0209455_10095083 | 317 |
| 1605 | 3300025273 | Ga0209673_1027557 | Ga0209673_10275571 | 317 |
| 1606 | 3300025295 | Ga0209564_1000405 | Ga0209564_100040556 | 317 |
| 1607 | 3300025295 | Ga0209564_1012523 | Ga0209564_10125233 | 317 |
| 1608 | 3300025297 | Ga0209758_1000164 | Ga0209758_1000164116 | 317 |
| 1609 | 3300025297 | Ga0209758_1000216 | Ga0209758_100021682 | 317 |
| 1610 | 3300025297 | Ga0209758_1000375 | Ga0209758_100037559 | 317 |
| 1611 | 3300025297 | Ga0209758_1001489 | Ga0209758_100148921 | 317 |
| 1612 | 3300025297 | Ga0209758_1003612 | Ga0209758_10036128 | 317 |
| 1613 | 3300025297 | Ga0209758_1007900 | Ga0209758_10079006 | 317 |
| 1614 | 3300025299 | Ga0209256_1011392 | Ga0209256_10113922 | 317 |
| 1615 | 3300025302 | Ga0207426_1000580 | Ga0207426_100058055 | 317 |
| 1616 | 3300025302 | Ga0207426_1004590 | Ga0207426_10045905 | 317 |
| 1617 | 3300025302 | Ga0207426_1015864 | Ga0207426_10158642 | 317 |
| 1618 | 3300025304 | Ga0209257_1000782 | Ga0209257_10007826 | 317 |
| 1619 | 3300025321 | Ga0207656_10020027 | Ga0207656_100200272 | 317 |
| 1620 | 3300025898 | Ga0207692_10000660 | Ga0207692_100006606 | 317 |
| 1621 | 3300025898 | Ga0207692_10008365 | Ga0207692_100083653 | 317 |
| 1622 | 3300025898 | Ga0207692_10035057 | Ga0207692_100350572 | 317 |
| 1623 | 3300025898 | Ga0207692_10050786 | Ga0207692_100507862 | 317 |
| 1624 | 3300025901 | Ga0207688_10048076 | Ga0207688_100480762 | 317 |
| 1625 | 3300025901 | Ga0207688_10092199 | Ga0207688_100921992 | 317 |
| 1626 | 3300025901 | Ga0207688_10135731 | Ga0207688_101357312 | 317 |
| 1627 | 3300025904 | Ga0207647_10027278 | Ga0207647_100272782 | 317 |
| 1628 | 3300025906 | Ga0207699_10000526 | Ga0207699_1000052618 | 317 |
| 1629 | 3300025906 | Ga0207699_10042054 | Ga0207699_100420542 | 317 |
| 1630 | 3300025906 | Ga0207699_10047801 | Ga0207699_100478012 | 317 |
| 1631 | 3300025907 | Ga0207645_10283424 | Ga0207645_102834241 | 317 |
| 1632 | 3300025909 | Ga0207705_10187932 | Ga0207705_101879322 | 317 |
| 1633 | 3300025909 | Ga0207705_10349959 | Ga0207705_103499591 | 317 |
| 1634 | 3300025910 | Ga0207684_10033381 | Ga0207684_100333812 | 317 |
| 1635 | 3300025911 | Ga0207654_10052914 | Ga0207654_100529142 | 317 |
| 1636 | 3300025912 | Ga0207707_10001083 | Ga0207707_1000108317 | 317 |
| 1637 | 3300025912 | Ga0207707_10014916 | Ga0207707_100149161 | 317 |
| 1638 | 3300025912 | Ga0207707_10117767 | Ga0207707_101177671 | 317 |
| 1639 | 3300025912 | Ga0207707_10308854 | Ga0207707_103088543 | 317 |
| 1640 | 3300025913 | Ga0207695_10000599 | Ga0207695_1000059923 | 317 |
| 1641 | 3300025913 | Ga0207695_10070312 | Ga0207695_100703124 | 317 |
| 1642 | 3300025913 | Ga0207695_10177015 | Ga0207695_101770152 | 317 |
| 1643 | 3300025914 | Ga0207671_10001926 | Ga0207671_1000192616 | 317 |
| 1644 | 3300025914 | Ga0207671_10137820 | Ga0207671_101378202 | 317 |
| 1645 | 3300025914 | Ga0207671_10211906 | Ga0207671_102119062 | 317 |
| 1646 | 3300025915 | Ga0207693_10004729 | Ga0207693_100047292 | 317 |
| 1647 | 3300025915 | Ga0207693_10032143 | Ga0207693_100321435 | 317 |
| 1648 | 3300025915 | Ga0207693_10115388 | Ga0207693_101153882 | 317 |
| 1649 | 3300025916 | Ga0207663_10000334 | Ga0207663_100003342 | 317 |
| 1650 | 3300025916 | Ga0207663_10004028 | Ga0207663_100040285 | 317 |
| 1651 | 3300025916 | Ga0207663_10045957 | Ga0207663_100459572 | 317 |
| 1652 | 3300025917 | Ga0207660_10003821 | Ga0207660_100038214 | 317 |
| 1653 | 3300025917 | Ga0207660_10207136 | Ga0207660_102071362 | 317 |
| 1654 | 3300025917 | Ga0207660_10222708 | Ga0207660_102227083 | 317 |
| 1655 | 3300025918 | Ga0207662_10278473 | Ga0207662_102784731 | 317 |
| 1656 | 3300025919 | Ga0207657_10003922 | Ga0207657_1000392220 | 317 |
| 1657 | 3300025919 | Ga0207657_10187748 | Ga0207657_101877482 | 317 |
| 1658 | 3300025920 | Ga0207649_10064772 | Ga0207649_100647722 | 317 |
| 1659 | 3300025920 | Ga0207649_10068489 | Ga0207649_100684891 | 317 |
| 1660 | 3300025921 | Ga0207652_10003147 | Ga0207652_100031477 | 317 |
| 1661 | 3300025924 | Ga0207694_10072960 | Ga0207694_100729603 | 317 |
| 1662 | 3300025927 | Ga0207687_10019272 | Ga0207687_100192722 | 317 |
| 1663 | 3300025928 | Ga0207700_10379438 | Ga0207700_103794381 | 317 |
| 1664 | 3300025929 | Ga0207664_10087270 | Ga0207664_100872702 | 317 |
| 1665 | 3300025929 | Ga0207664_10346699 | Ga0207664_103466992 | 317 |
| 1666 | 3300025932 | Ga0207690_10210850 | Ga0207690_102108502 | 317 |
| 1667 | 3300025932 | Ga0207690_10410026 | Ga0207690_104100261 | 317 |
| 1668 | 3300025933 | Ga0207706_10137699 | Ga0207706_101376992 | 317 |
| 1669 | 3300025933 | Ga0207706_10205778 | Ga0207706_102057782 | 317 |
| 1670 | 3300025936 | Ga0207670_10207327 | Ga0207670_102073272 | 317 |
| 1671 | 3300025939 | Ga0207665_10005331 | Ga0207665_100053314 | 317 |
| 1672 | 3300025941 | Ga0207711_10398695 | Ga0207711_103986951 | 317 |
| 1673 | 3300025942 | Ga0207689_10074630 | Ga0207689_100746303 | 317 |
| 1674 | 3300025942 | Ga0207689_10213323 | Ga0207689_102133232 | 317 |
| 1675 | 3300025944 | Ga0207661_10009663 | Ga0207661_100096635 | 317 |
| 1676 | 3300025944 | Ga0207661_10323168 | Ga0207661_103231682 | 317 |
| 1677 | 3300025949 | Ga0207667_10100325 | Ga0207667_101003253 | 317 |
| 1678 | 3300025949 | Ga0207667_10192815 | Ga0207667_101928152 | 317 |
| 1679 | 3300025949 | Ga0207667_10686114 | Ga0207667_106861141 | 317 |
| 1680 | 3300025960 | Ga0207651_10358612 | Ga0207651_103586121 | 317 |
| 1681 | 3300025972 | Ga0207668_10108904 | Ga0207668_101089042 | 317 |
| 1682 | 3300025972 | Ga0207668_10267903 | Ga0207668_102679032 | 317 |
| 1683 | 3300025981 | Ga0207640_10204677 | Ga0207640_102046771 | 317 |
| 1684 | 3300026023 | Ga0207677_10007171 | Ga0207677_100071714 | 317 |
| 1685 | 3300026035 | Ga0207703_10294793 | Ga0207703_102947932 | 317 |
| 1686 | 3300026035 | Ga0207703_10388895 | Ga0207703_103888952 | 317 |
| 1687 | 3300026041 | Ga0207639_10034571 | Ga0207639_100345712 | 317 |
| 1688 | 3300026067 | Ga0207678_10036080 | Ga0207678_100360803 | 317 |
| 1689 | 3300026067 | Ga0207678_10226012 | Ga0207678_102260122 | 317 |
| 1690 | 3300026067 | Ga0207678_10270612 | Ga0207678_102706122 | 317 |
| 1691 | 3300026078 | Ga0207702_10085951 | Ga0207702_100859512 | 317 |
| 1692 | 3300026078 | Ga0207702_10147778 | Ga0207702_101477782 | 317 |
| 1693 | 3300026089 | Ga0207648_10031150 | Ga0207648_100311502 | 317 |
| 1694 | 3300026089 | Ga0207648_10452876 | Ga0207648_104528761 | 317 |
| 1695 | 3300026116 | Ga0207674_10024060 | Ga0207674_100240605 | 317 |
| 1696 | 3300026116 | Ga0207674_10032073 | Ga0207674_100320734 | 317 |
| 1697 | 3300026142 | Ga0207698_10121499 | Ga0207698_101214992 | 317 |
| 1698 | 3300026142 | Ga0207698_10145426 | Ga0207698_101454262 | 317 |
| 1699 | 3300027296 | Ga0209389_1000155 | Ga0209389_100015524 | 317 |
| 1700 | 3300027296 | Ga0209389_1000640 | Ga0209389_10006406 | 317 |
| 1701 | 3300027357 | Ga0209589_1000030 | Ga0209589_1000030113 | 317 |
| 1702 | 3300027357 | Ga0209589_1005433 | Ga0209589_10054336 | 317 |
| 1703 | 3300027361 | Ga0209489_100056 | Ga0209489_100056113 | 317 |
| 1704 | 3300027361 | Ga0209489_105575 | Ga0209489_1055756 | 317 |
| 1705 | 3300027361 | Ga0209489_114795 | Ga0209489_1147953 | 317 |
| 1706 | 3300027363 | Ga0209700_100059 | Ga0209700_100059113 | 317 |
| 1707 | 3300027363 | Ga0209700_104170 | Ga0209700_10417025 | 317 |
| 1708 | 3300027671 | Ga0209588_1017461 | Ga0209588_10174611 | 317 |
| 1709 | 3300028379 | Ga0268266_10000988 | Ga0268266_100009885 | 317 |
| 1710 | 3300028379 | Ga0268266_10002854 | Ga0268266_1000285414 | 317 |
| 1711 | 3300028379 | Ga0268266_10006878 | Ga0268266_100068785 | 317 |
| 1712 | 3300028381 | Ga0268264_10000245 | Ga0268264_1000024562 | 317 |
| 1713 | 3300028558 | Ga0265326_10032338 | Ga0265326_100323382 | 317 |
| 1714 | 3300028563 | Ga0265319_1015385 | Ga0265319_10153852 | 317 |
| 1715 | 3300028573 | Ga0265334_10005352 | Ga0265334_100053522 | 317 |
| 1716 | 3300028573 | Ga0265334_10029191 | Ga0265334_100291912 | 317 |
| 1717 | 3300028577 | Ga0265318_10037845 | Ga0265318_100378452 | 317 |
| 1718 | 3300028653 | Ga0265323_10000916 | Ga0265323_100009163 | 317 |
| 1719 | 3300028666 | Ga0265336_10000298 | Ga0265336_1000029833 | 317 |
| 1720 | 3300028786 | Ga0307517_10000125 | Ga0307517_1000012572 | 317 |
| 1721 | 3300028794 | Ga0307515_10184653 | Ga0307515_101846532 | 317 |
| 1722 | 3300028800 | Ga0265338_10000131 | Ga0265338_1000013145 | 317 |
| 1723 | 3300031235 | Ga0265330_10015078 | Ga0265330_100150783 | 317 |
| 1724 | 3300031241 | Ga0265325_10002689 | Ga0265325_100026892 | 317 |
| 1725 | 3300031247 | Ga0265340_10038625 | Ga0265340_100386252 | 317 |
| 1726 | 3300031249 | Ga0265339_10003134 | Ga0265339_100031348 | 317 |
| 1727 | 3300031249 | Ga0265339_10046241 | Ga0265339_100462413 | 317 |
| 1728 | 3300031249 | Ga0265339_10107197 | Ga0265339_101071972 | 317 |
| 1729 | 3300031249 | Ga0265339_10143280 | Ga0265339_101432801 | 317 |
| 1730 | 3300031250 | Ga0265331_10057805 | Ga0265331_100578052 | 317 |
| 1731 | 3300031344 | Ga0265316_10087509 | Ga0265316_100875092 | 317 |
| 1732 | 3300031507 | Ga0307509_10061588 | Ga0307509_100615883 | 317 |
| 1733 | 3300031507 | Ga0307509_10150315 | Ga0307509_101503152 | 317 |
| 1734 | 3300031507 | Ga0307509_10302912 | Ga0307509_103029122 | 317 |
| 1735 | 3300031507 | Ga0307509_10321450 | Ga0307509_103214502 | 317 |
| 1736 | 3300031616 | Ga0307508_10001153 | Ga0307508_1000115317 | 317 |
| 1737 | 3300031711 | Ga0265314_10020390 | Ga0265314_100203903 | 317 |
| 1738 | 3300031711 | Ga0265314_10025270 | Ga0265314_100252702 | 317 |
| 1739 | 3300031712 | Ga0265342_10002981 | Ga0265342_1000298113 | 317 |
| 1740 | 3300031730 | Ga0307516_10008305 | Ga0307516_100083054 | 317 |
| 1741 | 3300031730 | Ga0307516_10020167 | Ga0307516_100201677 | 317 |
| 1742 | 3300031730 | Ga0307516_10022528 | Ga0307516_100225282 | 317 |
| 1743 | 3300031730 | Ga0307516_10268774 | Ga0307516_102687742 | 317 |
| 1744 | 3300031903 | Ga0307407_10115289 | Ga0307407_101152891 | 317 |
| 1745 | 3300031911 | Ga0307412_10054934 | Ga0307412_100549343 | 317 |
| 1746 | 3300031995 | Ga0307409_100050870 | Ga0307409_1000508702 | 317 |
| 1747 | 3300033179 | Ga0307507_10085665 | Ga0307507_100856653 | 317 |
| 1748 | 3300033180 | Ga0307510_10010190 | Ga0307510_100101903 | 317 |
| 1749 | 3300033180 | Ga0307510_10244496 | Ga0307510_102444961 | 317 |
| 1750 | 3300033442 | Ga0315911_1000009 | Ga0315911_100000925 | 317 |
| 1751 | 3300035086 | Ga0373934_0001668 | Ga0373934_0001668_960_1916 | 317 |
| 1752 | 3300035086 | Ga0373934_0052699 | Ga0373934_0052699_587_1543 | 317 |
| 1753 | 3300035089 | Ga0373944_0019024 | Ga0373944_0019024_792_1748 | 317 |
| 1754 | 3300035113 | Ga0373936_0028477 | Ga0373936_0028477_176_1132 | 317 |
| 1755 | 3300035113 | Ga0373936_0074852 | Ga0373936_0074852_236_1192 | 317 |
| 1756 | 3300035117 | Ga0373953_0000108 | Ga0373953_0000108_2672_3628 | 317 |
| 1757 | 3300035117 | Ga0373953_0001849 | Ga0373953_0001849_4996_5952 | 317 |
| 1758 | 3300035118 | Ga0373954_0000085 | Ga0373954_0000085_14346_15302 | 317 |
| 1759 | 3300035118 | Ga0373954_0015553 | Ga0373954_0015553_1773_2729 | 317 |
| 1760 | 3300035118 | Ga0373954_0060946 | Ga0373954_0060946_330_1286 | 317 |
| 1761 | 3300035119 | Ga0373956_0000272 | Ga0373956_0000272_8459_9415 | 317 |
| 1762 | 3300035119 | Ga0373956_0030598 | Ga0373956_0030598_281_1237 | 317 |
| 1763 | 3300035120 | Ga0373957_0000129 | Ga0373957_0000129_2191_3147 | 317 |
| 1764 | 3300035121 | Ga0373960_0077538 | Ga0373960_0077538_53_1006 | 317 |
| 1765 | 3300035170 | Ga0373943_0027519 | Ga0373943_0027519_233_1189 | 317 |
| 1766 | 3300035170 | Ga0373943_0087956 | Ga0373943_0087956_489_1445 | 317 |
| 1767 | 3300035170 | Ga0373943_0158659 | Ga0373943_0158659_165_1118 | 317 |
| 1768 | 3300035171 | Ga0373946_0001563 | Ga0373946_0001563_4881_5837 | 317 |
| 1769 | 3300035172 | Ga0373955_0000288 | Ga0373955_0000288_14427_15383 | 317 |
| 1770 | 3300035172 | Ga0373955_0007868 | Ga0373955_0007868_3078_4034 | 317 |
| 1771 | 3300035172 | Ga0373955_0079671 | Ga0373955_0079671_261_1217 | 317 |
| 1772 | 3300035410 | Ga0373924_0005705 | Ga0373924_0005705_1377_2333 | 317 |
| 1773 | 3300035691 | Ga0373931_0274666 | Ga0373931_0274666_22_978 | 317 |
| 1774 | 3300035692 | Ga0373935_0002679 | Ga0373935_0002679_5595_6551 | 317 |
| 1775 | 3300035692 | Ga0373935_0277441 | Ga0373935_0277441_192_1148 | 317 |
| 1776 | 3300035695 | Ga0373927_0001471 | Ga0373927_0001471_9079_10035 | 317 |
| 1777 | 3300035695 | Ga0373927_0002486 | Ga0373927_0002486_7126_8082 | 317 |
| 1778 | 3300035695 | Ga0373927_0074697 | Ga0373927_0074697_559_1515 | 317 |
| 1779 | 3300035695 | Ga0373927_0078916 | Ga0373927_0078916_905_1858 | 317 |
| 1780 | 3300035695 | Ga0373927_0141375 | Ga0373927_0141375_560_1516 | 317 |
| 1781 | 3300035724 | Ga0373933_0000913 | Ga0373933_0000913_8401_9357 | 317 |
| 1782 | 3300035724 | Ga0373933_0084955 | Ga0373933_0084955_404_1360 | 317 |
| 1783 | 3300035724 | Ga0373933_0119667 | Ga0373933_0119667_330_1286 | 317 |
| 1784 | 3300035725 | Ga0373947_0003788 | Ga0373947_0003788_3970_4926 | 317 |
| 1785 | 3300035725 | Ga0373947_0009239 | Ga0373947_0009239_2530_3486 | 317 |
| 1786 | 3300035725 | Ga0373947_0029949 | Ga0373947_0029949_1339_2295 | 317 |
| 1787 | 3300035725 | Ga0373947_0050555 | Ga0373947_0050555_33_986 | 317 |
| 1788 | 3300036401 | Ga0373937_0005718 | Ga0373937_0005718_6377_7333 | 317 |
| 1789 | 3300036401 | Ga0373937_0027472 | Ga0373937_0027472_30_986 | 317 |
| 1790 | 3300036401 | Ga0373937_0073857 | Ga0373937_0073857_1331_2287 | 317 |
| 1791 | 3300036401 | Ga0373937_0117322 | Ga0373937_0117322_845_1801 | 317 |
| 1792 | 3300036401 | Ga0373937_0336467 | Ga0373937_0336467_209_1165 | 317 |
| 1793 | 3300037068 | Ga0373925_0113006 | Ga0373925_0113006_767_1723 | 317 |
| 1794 | 3300037068 | Ga0373925_0128671 | Ga0373925_0128671_595_1551 | 317 |
| 1795 | 3300037312 | Ga0395899_0050258 | Ga0395899_0050258_1690_2679 | 317 |
| 1796 | 3300037312 | Ga0395899_0287338 | Ga0395899_0287338_150_1103 | 317 |
| 1797 | 3300037418 | Ga0395900_0062423 | Ga0395900_0062423_2310_3263 | 317 |
| 1798 | 3300037418 | Ga0395900_0144131 | Ga0395900_0144131_414_1370 | 317 |
| 1799 | 3300037418 | Ga0395900_0290808 | Ga0395900_0290808_78_1058 | 317 |
| 1800 | 3300037466 | Ga0395898_0037146 | Ga0395898_0037146_583_1563 | 317 |
| 1801 | 3300037466 | Ga0395898_0443330 | Ga0395898_0443330_140_1093 | 317 |
| 1802 | 3300037466 | Ga0395898_0535317 | Ga0395898_0535317_124_1080 | 317 |
| 1803 | 3300038443 | Ga0395901_0016140 | Ga0395901_0016140_6542_7495 | 317 |
| 1804 | 3300038443 | Ga0395901_0267726 | Ga0395901_0267726_355_1311 | 317 |
| 1805 | 3300039437 | Ga0436365_0356394 | Ga0436365_0356394_55_1011 | 317 |
| 1806 | 3300039437 | Ga0436365_1507572 | Ga0436365_1507572_293_1261 | 317 |
| 1807 | 3300039447 | Ga0436361_0736352 | Ga0436361_0736352_183_1139 | 317 |
| 1808 | 3300039450 | Ga0436363_1138394 | Ga0436363_1138394_3960_4937 | 317 |
| 1809 | 3300041451 | Ga0451791_1031212 | Ga0451791_1031212_49_1005 | 317 |
| 1810 | 3300041456 | Ga0451795_0239567 | Ga0451795_0239567_105_1061 | 317 |
| 1811 | 3300041486 | Ga0451807_2348294 | Ga0451807_2348294_98_1051 | 317 |
| 1812 | 3300044656 | Ga0466969_0054525 | Ga0466969_0054525_588_1571 | 317 |
| 1813 | 3300044658 | Ga0466972_0000156 | Ga0466972_0000156_24241_25194 | 317 |
| 1814 | 3300044658 | Ga0466972_0002340 | Ga0466972_0002340_2504_3457 | 317 |
| 1815 | 3300044684 | Ga0466966_0000726 | Ga0466966_0000726_4940_5893 | 317 |
| 1816 | 3300044693 | Ga0466961_0000568 | Ga0466961_0000568_20456_21409 | 317 |
| 1817 | 3300044694 | Ga0466963_0018028 | Ga0466963_0018028_1164_2120 | 317 |
| 1818 | 3300044719 | Ga0466971_0050003 | Ga0466971_0050003_565_1521 | 317 |
| 1819 | 3300044901 | Ga0466960_0008725 | Ga0466960_0008725_2366_3319 | 317 |
| 1820 | 3300045049 | Ga0466959_0033944 | Ga0466959_0033944_1714_2697 | 317 |
| 1821 | 3300045049 | Ga0466959_0199311 | Ga0466959_0199311_344_1300 | 317 |
| 1822 | 3300045976 | Ga0466967_0009784 | Ga0466967_0009784_5187_6140 | 317 |
| 1823 | 3300045976 | Ga0466967_0049840 | Ga0466967_0049840_524_1480 | 317 |
| 1824 | 3300045976 | Ga0466967_0105800 | Ga0466967_0105800_512_1468 | 317 |
| 1825 | 3300045976 | Ga0466967_0116005 | Ga0466967_0116005_1012_1968 | 317 |
| 1826 | 3300045976 | Ga0466967_0162412 | Ga0466967_0162412_419_1375 | 317 |
| 1827 | 3300046454 | Ga0495592_0000795 | Ga0495592_0000795_17376_18332 | 317 |
| 1828 | 3300046454 | Ga0495592_0049186 | Ga0495592_0049186_1628_2584 | 317 |
| 1829 | 3300046454 | Ga0495592_0073730 | Ga0495592_0073730_811_1767 | 317 |
| 1830 | 3300046455 | Ga0495603_0000387 | Ga0495603_0000387_17898_18854 | 317 |
| 1831 | 3300046455 | Ga0495603_0040158 | Ga0495603_0040158_695_1651 | 317 |
| 1832 | 3300046455 | Ga0495603_0109321 | Ga0495603_0109321_553_1509 | 317 |
| 1833 | 3300046459 | Ga0495629_0000582 | Ga0495629_0000582_20856_21812 | 317 |
| 1834 | 3300046459 | Ga0495629_0001668 | Ga0495629_0001668_2478_3431 | 317 |
| 1835 | 3300046459 | Ga0495629_0004581 | Ga0495629_0004581_5821_6777 | 317 |
| 1836 | 3300046459 | Ga0495629_0109406 | Ga0495629_0109406_897_1853 | 317 |
| 1837 | 3300046460 | Ga0495638_0031663 | Ga0495638_0031663_2180_3136 | 317 |
| 1838 | 3300046460 | Ga0495638_0172847 | Ga0495638_0172847_67_1020 | 317 |
| 1839 | 3300046461 | Ga0495641_0010227 | Ga0495641_0010227_70_1026 | 317 |
| 1840 | 3300046461 | Ga0495641_0042318 | Ga0495641_0042318_383_1339 | 317 |
| 1841 | 3300046462 | Ga0495651_0002961 | Ga0495651_0002961_8147_9103 | 317 |
| 1842 | 3300046462 | Ga0495651_0013772 | Ga0495651_0013772_4956_5909 | 317 |
| 1843 | 3300046462 | Ga0495651_0151312 | Ga0495651_0151312_176_1132 | 317 |
| 1844 | 3300046463 | Ga0495653_0002685 | Ga0495653_0002685_11838_12794 | 317 |
| 1845 | 3300046463 | Ga0495653_0082672 | Ga0495653_0082672_872_1825 | 317 |
| 1846 | 3300046472 | Ga0495580_0001175 | Ga0495580_0001175_188_1144 | 317 |
| 1847 | 3300046472 | Ga0495580_0121050 | Ga0495580_0121050_503_1456 | 317 |
| 1848 | 3300046473 | Ga0495582_0005882 | Ga0495582_0005882_1733_2689 | 317 |
| 1849 | 3300046473 | Ga0495582_0062261 | Ga0495582_0062261_1007_1963 | 317 |
| 1850 | 3300046475 | Ga0495639_0000739 | Ga0495639_0000739_8285_9241 | 317 |
| 1851 | 3300046476 | Ga0495662_0000148 | Ga0495662_0000148_17154_18110 | 317 |
| 1852 | 3300046492 | Ga0495585_0016215 | Ga0495585_0016215_319_1275 | 317 |
| 1853 | 3300046499 | Ga0495594_0000312 | Ga0495594_0000312_10087_11043 | 317 |
| 1854 | 3300046499 | Ga0495594_0154240 | Ga0495594_0154240_189_1145 | 317 |
| 1855 | 3300046500 | Ga0495596_0066393 | Ga0495596_0066393_49_1002 | 317 |
| 1856 | 3300046501 | Ga0495607_0064859 | Ga0495607_0064859_503_1462 | 317 |
| 1857 | 3300046507 | Ga0495606_0004206 | Ga0495606_0004206_161_1114 | 317 |
| 1858 | 3300046507 | Ga0495606_0012913 | Ga0495606_0012913_5133_6086 | 317 |
| 1859 | 3300046511 | Ga0495608_0000569 | Ga0495608_0000569_4019_4975 | 317 |
| 1860 | 3300046511 | Ga0495608_0024234 | Ga0495608_0024234_905_1861 | 317 |
| 1861 | 3300046514 | Ga0495618_0015858 | Ga0495618_0015858_543_1499 | 317 |
| 1862 | 3300046514 | Ga0495618_0069671 | Ga0495618_0069671_407_1363 | 317 |
| 1863 | 3300046515 | Ga0495620_0026177 | Ga0495620_0026177_85_1044 | 317 |
| 1864 | 3300046516 | Ga0495628_0010360 | Ga0495628_0010360_6288_7244 | 317 |
| 1865 | 3300046516 | Ga0495628_0028278 | Ga0495628_0028278_1006_1962 | 317 |
| 1866 | 3300046516 | Ga0495628_0078122 | Ga0495628_0078122_104_1060 | 317 |
| 1867 | 3300046516 | Ga0495628_0091601 | Ga0495628_0091601_447_1403 | 317 |
| 1868 | 3300046517 | Ga0495630_0028578 | Ga0495630_0028578_1452_2408 | 317 |
| 1869 | 3300046517 | Ga0495630_0151306 | Ga0495630_0151306_509_1465 | 317 |
| 1870 | 3300046519 | Ga0495632_0101151 | Ga0495632_0101151_131_1087 | 317 |
| 1871 | 3300046520 | Ga0495637_0082309 | Ga0495637_0082309_169_1128 | 317 |
| 1872 | 3300046522 | Ga0495643_0048366 | Ga0495643_0048366_536_1495 | 317 |
| 1873 | 3300046524 | Ga0495648_0000855 | Ga0495648_0000855_23118_24074 | 317 |
| 1874 | 3300046524 | Ga0495648_0022316 | Ga0495648_0022316_1831_2784 | 317 |
| 1875 | 3300046524 | Ga0495648_0092062 | Ga0495648_0092062_657_1610 | 317 |
| 1876 | 3300046524 | Ga0495648_0093130 | Ga0495648_0093130_349_1302 | 317 |
| 1877 | 3300046529 | Ga0495652_0002837 | Ga0495652_0002837_15149_16105 | 317 |
| 1878 | 3300046529 | Ga0495652_0030800 | Ga0495652_0030800_417_1373 | 317 |
| 1879 | 3300046529 | Ga0495652_0142277 | Ga0495652_0142277_711_1667 | 317 |
| 1880 | 3300046531 | Ga0495665_0000248 | Ga0495665_0000248_20629_21585 | 317 |
| 1881 | 3300046531 | Ga0495665_0081361 | Ga0495665_0081361_508_1464 | 317 |
| 1882 | 3300046533 | Ga0495640_0004111 | Ga0495640_0004111_3938_4894 | 317 |
| 1883 | 3300046533 | Ga0495640_0052202 | Ga0495640_0052202_596_1549 | 317 |
| 1884 | 3300046533 | Ga0495640_0052535 | Ga0495640_0052535_1242_2198 | 317 |
| 1885 | 3300046533 | Ga0495640_0075248 | Ga0495640_0075248_268_1224 | 317 |
| 1886 | 3300046533 | Ga0495640_0204190 | Ga0495640_0204190_280_1233 | 317 |
| 1887 | 3300046536 | Ga0495587_0007583 | Ga0495587_0007583_4953_5909 | 317 |
| 1888 | 3300046536 | Ga0495587_0034998 | Ga0495587_0034998_1817_2770 | 317 |
| 1889 | 3300046536 | Ga0495587_0144334 | Ga0495587_0144334_86_1042 | 317 |
| 1890 | 3300046538 | Ga0495609_0034031 | Ga0495609_0034031_200_1156 | 317 |
| 1891 | 3300046538 | Ga0495609_0076648 | Ga0495609_0076648_397_1350 | 317 |
| 1892 | 3300046543 | Ga0495645_0016916 | Ga0495645_0016916_1704_2660 | 317 |
| 1893 | 3300046557 | Ga0495622_0002046 | Ga0495622_0002046_8595_9551 | 317 |
| 1894 | 3300046559 | Ga0495667_0000128 | Ga0495667_0000128_44915_45871 | 317 |
| 1895 | 3300046559 | Ga0495667_0012503 | Ga0495667_0012503_3166_4122 | 317 |
| 1896 | 3300046559 | Ga0495667_0075699 | Ga0495667_0075699_575_1531 | 317 |
| 1897 | 3300046559 | Ga0495667_0089013 | Ga0495667_0089013_103_1056 | 317 |
| 1898 | 3300046615 | Ga0495656_0015749 | Ga0495656_0015749_459_1415 | 317 |
| 1899 | 3300046615 | Ga0495656_0085056 | Ga0495656_0085056_333_1289 | 317 |
| 1900 | 3300046615 | Ga0495656_0176301 | Ga0495656_0176301_17_973 | 317 |
| 1901 | 3300046616 | Ga0495668_0062032 | Ga0495668_0062032_580_1536 | 317 |
| 1902 | 3300046642 | Ga0495634_0023145 | Ga0495634_0023145_2465_3421 | 317 |
| 1903 | 3300046642 | Ga0495634_0173839 | Ga0495634_0173839_97_1053 | 317 |
| 1904 | 3300046660 | Ga0495625_0233903 | Ga0495625_0233903_138_1094 | 317 |
| 1905 | 3300046663 | Ga0495635_0001128 | Ga0495635_0001128_5526_6482 | 317 |
| 1906 | 3300046663 | Ga0495635_0006917 | Ga0495635_0006917_2949_3905 | 317 |
| 1907 | 3300046663 | Ga0495635_0008480 | Ga0495635_0008480_4122_5075 | 317 |
| 1908 | 3300046663 | Ga0495635_0124386 | Ga0495635_0124386_455_1411 | 317 |
| 1909 | 3300046664 | Ga0495659_0030392 | Ga0495659_0030392_398_1462 | 317 |
| 1910 | 3300046665 | Ga0495661_0070878 | Ga0495661_0070878_989_1999 | 317 |
| 1911 | 3300046665 | Ga0495661_0121186 | Ga0495661_0121186_320_1273 | 317 |
| 1912 | 3300046674 | Ga0495588_0100939 | Ga0495588_0100939_487_1443 | 317 |
| 1913 | 3300046675 | Ga0495657_0003126 | Ga0495657_0003126_8825_9781 | 317 |
| 1914 | 3300046678 | Ga0495599_0002733 | Ga0495599_0002733_2834_3790 | 317 |
| 1915 | 3300046678 | Ga0495599_0181872 | Ga0495599_0181872_221_1177 | 317 |
| 1916 | 3300046679 | Ga0495623_0006786 | Ga0495623_0006786_2726_3682 | 317 |
| 1917 | 3300046679 | Ga0495623_0017410 | Ga0495623_0017410_3275_4228 | 317 |
| 1918 | 3300046679 | Ga0495623_0168690 | Ga0495623_0168690_314_1270 | 317 |
| 1919 | 3300046680 | Ga0495646_0000412 | Ga0495646_0000412_18671_19627 | 317 |
| 1920 | 3300046680 | Ga0495646_0036082 | Ga0495646_0036082_214_1170 | 317 |
| 1921 | 3300046680 | Ga0495646_0205430 | Ga0495646_0205430_30_983 | 317 |
| 1922 | 3300046681 | Ga0495647_0000541 | Ga0495647_0000541_4986_5942 | 317 |
| 1923 | 3300046683 | Ga0495658_0002607 | Ga0495658_0002607_6338_7294 | 317 |
| 1924 | 3300046689 | Ga0495613_0062657 | Ga0495613_0062657_410_1363 | 317 |
| 1925 | 3300046689 | Ga0495613_0195181 | Ga0495613_0195181_49_1002 | 317 |
| 1926 | 3300046689 | Ga0495613_0231293 | Ga0495613_0231293_321_1277 | 317 |
| 1927 | 3300046690 | Ga0495624_0001790 | Ga0495624_0001790_4117_5073 | 317 |
| 1928 | 3300046690 | Ga0495624_0034248 | Ga0495624_0034248_1887_2843 | 317 |
| 1929 | 3300046690 | Ga0495624_0102532 | Ga0495624_0102532_605_1558 | 317 |
| 1930 | 3300046691 | Ga0495670_0003510 | Ga0495670_0003510_3270_4229 | 317 |
| 1931 | 3300046694 | Ga0495649_0109360 | Ga0495649_0109360_200_1153 | 317 |
| 1932 | 3300046809 | Ga0495600_0000630 | Ga0495600_0000630_276_1229 | 317 |
| 1933 | 3300046809 | Ga0495600_0005826 | Ga0495600_0005826_4019_4975 | 317 |
| 1934 | 3300046809 | Ga0495600_0078397 | Ga0495600_0078397_1053_2009 | 317 |
| 1935 | 3300047315 | Ga0495581_0001004 | Ga0495581_0001004_1629_2585 | 317 |
| 1936 | 3300047317 | Ga0495604_0003361 | Ga0495604_0003361_11398_12351 | 317 |
| 1937 | 3300047317 | Ga0495604_0007172 | Ga0495604_0007172_3957_4913 | 317 |
| 1938 | 3300047317 | Ga0495604_0051018 | Ga0495604_0051018_138_1091 | 317 |
| 1939 | 3300047317 | Ga0495604_0193677 | Ga0495604_0193677_331_1287 | 317 |
| 1940 | 3300047319 | Ga0495674_0002207 | Ga0495674_0002207_5515_6471 | 317 |
| 1941 | 3300047319 | Ga0495674_0010840 | Ga0495674_0010840_451_1407 | 317 |
| 1942 | 3300047319 | Ga0495674_0026886 | Ga0495674_0026886_55_1008 | 317 |
| 1943 | 3300047319 | Ga0495674_0029042 | Ga0495674_0029042_1694_2650 | 317 |
| 1944 | 3300047320 | Ga0495672_0045229 | Ga0495672_0045229_1079_2035 | 317 |
| 1945 | 3300047320 | Ga0495672_0151782 | Ga0495672_0151782_192_1148 | 317 |
| 1946 | 3300047321 | Ga0495676_0036490 | Ga0495676_0036490_2986_3942 | 317 |
| 1947 | 3300047321 | Ga0495676_0090598 | Ga0495676_0090598_851_1804 | 317 |
| 1948 | 3300047322 | Ga0495680_0000424 | Ga0495680_0000424_43299_44252 | 317 |
| 1949 | 3300047322 | Ga0495680_0001973 | Ga0495680_0001973_6377_7333 | 317 |
| 1950 | 3300047322 | Ga0495680_0030826 | Ga0495680_0030826_295_1251 | 317 |
| 1951 | 3300047323 | Ga0495683_0062512 | Ga0495683_0062512_656_1666 | 317 |
| 1952 | 3300047444 | Ga0495675_0000345 | Ga0495675_0000345_23688_24644 | 317 |
| 1953 | 3300047444 | Ga0495675_0097120 | Ga0495675_0097120_670_1626 | 317 |
| 1954 | 3300047446 | Ga0495679_030186 | Ga0495679_030186_632_1588 | 317 |
| 1955 | 3300047469 | Ga0495673_0036088 | Ga0495673_0036088_478_1434 | 317 |
| 1956 | 3300047471 | Ga0495684_0000650 | Ga0495684_0000650_19036_19992 | 317 |
| 1957 | 3300047471 | Ga0495684_0023995 | Ga0495684_0023995_953_1909 | 317 |
| 1958 | 3300047471 | Ga0495684_0227102 | Ga0495684_0227102_193_1149 | 317 |
| 1959 | 3300047472 | Ga0495686_0018987 | Ga0495686_0018987_1208_2218 | 317 |
| 1960 | 3300047673 | Ga0495593_0000312 | Ga0495593_0000312_12234_13190 | 317 |
| 1961 | 3300047673 | Ga0495593_0058804 | Ga0495593_0058804_550_1506 | 317 |
| 1962 | 3300048088 | Ga0495602_0005890 | Ga0495602_0005890_3829_4785 | 317 |
| 1963 | 3300048088 | Ga0495602_0040539 | Ga0495602_0040539_2130_3083 | 317 |
| 1964 | 3300048088 | Ga0495602_0059530 | Ga0495602_0059530_2347_3300 | 317 |
| 1965 | 3300048089 | Ga0495614_0041269 | Ga0495614_0041269_656_1612 | 317 |
| 1966 | 3300048903 | Ga0496100_0099648 | Ga0496100_0099648_1032_1988 | 317 |
| 1967 | 3300048903 | Ga0496100_0147242 | Ga0496100_0147242_229_1185 | 317 |
| 1968 | 3300048903 | Ga0496100_0178180 | Ga0496100_0178180_421_1374 | 317 |
| 1969 | 3300048904 | Ga0496101_0325577 | Ga0496101_0325577_197_1153 | 317 |
| 1970 | 3300048905 | Ga0496102_0229272 | Ga0496102_0229272_158_1114 | 317 |
| 1971 | 3300048906 | Ga0496103_0171094 | Ga0496103_0171094_280_1236 | 317 |
| 1972 | 3300048906 | Ga0496103_0184669 | Ga0496103_0184669_48_1001 | 317 |
| 1973 | 3300048906 | Ga0496103_0209957 | Ga0496103_0209957_76_1029 | 317 |
| 1974 | 3300048907 | Ga0496104_0077974 | Ga0496104_0077974_1044_2000 | 317 |
| 1975 | 3300048908 | Ga0496105_0001254 | Ga0496105_0001254_200_1153 | 317 |
| 1976 | 3300048909 | Ga0496106_0002423 | Ga0496106_0002423_8143_9126 | 317 |
| 1977 | 3300048911 | Ga0496108_0175535 | Ga0496108_0175535_601_1557 | 317 |
| 1978 | 3300048912 | Ga0496109_0077295 | Ga0496109_0077295_1641_2597 | 317 |
| 1979 | 3300048913 | Ga0496110_0016649 | Ga0496110_0016649_4133_5089 | 317 |
| 1980 | 3300048913 | Ga0496110_0203472 | Ga0496110_0203472_284_1240 | 317 |
| 1981 | 3300048913 | Ga0496110_0204316 | Ga0496110_0204316_295_1248 | 317 |
| 1982 | 3300048913 | Ga0496110_0251259 | Ga0496110_0251259_364_1317 | 317 |
| 1983 | 3300048914 | Ga0496111_0246191 | Ga0496111_0246191_203_1159 | 317 |
| 1984 | 3300048915 | Ga0496112_0000004 | Ga0496112_0000004_209678_210631 | 317 |
| 1985 | 3300048915 | Ga0496112_0017703 | Ga0496112_0017703_628_1584 | 317 |
| 1986 | 3300048915 | Ga0496112_0045152 | Ga0496112_0045152_2824_3780 | 317 |
| 1987 | 3300048915 | Ga0496112_0127936 | Ga0496112_0127936_719_1675 | 317 |
| 1988 | 3300048915 | Ga0496112_0130508 | Ga0496112_0130508_1469_2425 | 317 |
| 1989 | 3300048915 | Ga0496112_0146867 | Ga0496112_0146867_733_1689 | 317 |
| 1990 | 3300048918 | Ga0496115_0065352 | Ga0496115_0065352_444_1400 | 317 |
| 1991 | 3300048918 | Ga0496115_0092659 | Ga0496115_0092659_483_1463 | 317 |
| 1992 | 3300048918 | Ga0496115_0438548 | Ga0496115_0438548_39_995 | 317 |
| 1993 | 3300048919 | Ga0496116_0078209 | Ga0496116_0078209_548_1531 | 317 |
| 1994 | 3300048919 | Ga0496116_0095280 | Ga0496116_0095280_376_1332 | 317 |
| 1995 | 3300048919 | Ga0496116_0097437 | Ga0496116_0097437_505_1458 | 317 |
| 1996 | 3300048920 | Ga0496117_0005820 | Ga0496117_0005820_8299_9282 | 317 |
| 1997 | 3300048920 | Ga0496117_0019106 | Ga0496117_0019106_2408_3367 | 317 |
| 1998 | 3300048920 | Ga0496117_0043610 | Ga0496117_0043610_286_1296 | 317 |
| 1999 | 3300048921 | Ga0496118_0001550 | Ga0496118_0001550_11680_12663 | 317 |
| 2000 | 3300048921 | Ga0496118_0022210 | Ga0496118_0022210_54_1010 | 317 |
| 2001 | 3300048922 | Ga0496119_0003724 | Ga0496119_0003724_491_1444 | 317 |
| 2002 | 3300048922 | Ga0496119_0047345 | Ga0496119_0047345_211_1194 | 317 |
| 2003 | 3300048922 | Ga0496119_0106791 | Ga0496119_0106791_461_1414 | 317 |
| 2004 | 3300048922 | Ga0496119_0140555 | Ga0496119_0140555_87_1043 | 317 |
| 2005 | 3300048922 | Ga0496119_0175957 | Ga0496119_0175957_98_1051 | 317 |
| 2006 | 3300048923 | Ga0496120_0032516 | Ga0496120_0032516_1119_2072 | 317 |
| 2007 | 3300048923 | Ga0496120_0072457 | Ga0496120_0072457_774_1733 | 317 |
| 2008 | 3300048924 | Ga0496121_0000077 | Ga0496121_0000077_48751_49734 | 317 |
| 2009 | 3300048924 | Ga0496121_0005416 | Ga0496121_0005416_8409_9365 | 317 |
| 2010 | 3300048924 | Ga0496121_0020142 | Ga0496121_0020142_2436_3389 | 317 |
| 2011 | 3300048924 | Ga0496121_0022123 | Ga0496121_0022123_146_1105 | 317 |
| 2012 | 3300048924 | Ga0496121_0049017 | Ga0496121_0049017_1748_2713 | 317 |
| 2013 | 3300048924 | Ga0496121_0073281 | Ga0496121_0073281_1162_2118 | 317 |
| 2014 | 3300048924 | Ga0496121_0097775 | Ga0496121_0097775_1029_1982 | 317 |
| 2015 | 3300048924 | Ga0496121_0112567 | Ga0496121_0112567_1054_2007 | 317 |
| 2016 | 3300048924 | Ga0496121_0159667 | Ga0496121_0159667_146_1111 | 317 |
| 2017 | 3300048924 | Ga0496121_0197239 | Ga0496121_0197239_53_1009 | 317 |
| 2018 | 3300048925 | Ga0496122_0020439 | Ga0496122_0020439_4702_5658 | 317 |
| 2019 | 3300048925 | Ga0496122_0022345 | Ga0496122_0022345_1429_2439 | 317 |
| 2020 | 3300048925 | Ga0496122_0076791 | Ga0496122_0076791_19_978 | 317 |
| 2021 | 3300048926 | Ga0496123_0007007 | Ga0496123_0007007_4612_5622 | 317 |
| 2022 | 3300048926 | Ga0496123_0145662 | Ga0496123_0145662_295_1254 | 317 |
| 2023 | 3300048927 | Ga0496124_0002954 | Ga0496124_0002954_9565_10548 | 317 |
| 2024 | 3300048927 | Ga0496124_0133193 | Ga0496124_0133193_791_1801 | 317 |
| 2025 | 3300048928 | Ga0496125_0000125 | Ga0496125_0000125_115797_116753 | 317 |
| 2026 | 3300048928 | Ga0496125_0008255 | Ga0496125_0008255_6357_7316 | 317 |
| 2027 | 3300048928 | Ga0496125_0022162 | Ga0496125_0022162_2873_3856 | 317 |
| 2028 | 3300048928 | Ga0496125_0088454 | Ga0496125_0088454_38_997 | 317 |
| 2029 | 3300048929 | Ga0496126_0014174 | Ga0496126_0014174_1545_2528 | 317 |
| 2030 | 3300048929 | Ga0496126_0018962 | Ga0496126_0018962_4486_5442 | 317 |
| 2031 | 3300048929 | Ga0496126_0023164 | Ga0496126_0023164_200_1153 | 317 |
| 2032 | 3300048929 | Ga0496126_0025338 | Ga0496126_0025338_71_1027 | 317 |
| 2033 | 3300048929 | Ga0496126_0047500 | Ga0496126_0047500_1160_2119 | 317 |
| 2034 | 3300048929 | Ga0496126_0057800 | Ga0496126_0057800_240_1220 | 317 |
| 2035 | 3300048929 | Ga0496126_0074477 | Ga0496126_0074477_1795_2775 | 317 |
| 2036 | 3300048929 | Ga0496126_0100821 | Ga0496126_0100821_941_1894 | 317 |
| 2037 | 3300048929 | Ga0496126_0107087 | Ga0496126_0107087_977_1933 | 317 |
| 2038 | 3300048929 | Ga0496126_0257743 | Ga0496126_0257743_153_1112 | 317 |
| 2039 | 3300048929 | Ga0496126_0359078 | Ga0496126_0359078_224_1177 | 317 |
| 2040 | 3300049460 | Ga0495682_0015217 | Ga0495682_0015217_1547_2500 | 317 |
| 2041 | 3300049569 | Ga0501032_0000345 | Ga0501032_0000345_36322_37275 | 317 |
| 2042 | 3300049569 | Ga0501032_0113716 | Ga0501032_0113716_66_1019 | 317 |
| 2043 | 3300049570 | Ga0501033_0000094 | Ga0501033_0000094_40393_41346 | 317 |
| 2044 | 3300049570 | Ga0501033_0071416 | Ga0501033_0071416_272_1261 | 317 |
| 2045 | 3300049571 | Ga0501034_0000021 | Ga0501034_0000021_43441_44394 | 317 |
| 2046 | 3300049572 | Ga0501036_0000115 | Ga0501036_0000115_20882_21835 | 317 |
| 2047 | 3300049573 | Ga0501037_0000174 | Ga0501037_0000174_11166_12119 | 317 |
| 2048 | 3300049573 | Ga0501037_0166634 | Ga0501037_0166634_48_1001 | 317 |
| 2049 | 3300049574 | Ga0501038_0000052 | Ga0501038_0000052_43454_44407 | 317 |
| 2050 | 3300049574 | Ga0501038_0175509 | Ga0501038_0175509_138_1127 | 317 |
| 2051 | 3300049574 | Ga0501038_0182308 | Ga0501038_0182308_198_1151 | 317 |
| 2052 | 3300049574 | Ga0501038_0305539 | Ga0501038_0305539_232_1185 | 317 |
| 2053 | 3300049575 | Ga0501039_0000156 | Ga0501039_0000156_37276_38229 | 317 |
| 2054 | 3300049575 | Ga0501039_0089917 | Ga0501039_0089917_1254_2210 | 317 |
| 2055 | 3300049578 | Ga0501042_0038784 | Ga0501042_0038784_878_1831 | 317 |
| 2056 | 3300049579 | Ga0501043_0003891 | Ga0501043_0003891_9662_10615 | 317 |
| 2057 | 3300049579 | Ga0501043_0126694 | Ga0501043_0126694_471_1460 | 317 |
| 2058 | 3300049579 | Ga0501043_0222221 | Ga0501043_0222221_214_1167 | 317 |
| 2059 | 3300049580 | Ga0501046_0000133 | Ga0501046_0000133_25158_26111 | 317 |
| 2060 | 3300049580 | Ga0501046_0060481 | Ga0501046_0060481_221_1177 | 317 |
| 2061 | 3300049581 | Ga0501047_0000440 | Ga0501047_0000440_36687_37640 | 317 |
| 2062 | 3300049581 | Ga0501047_0090883 | Ga0501047_0090883_126_1082 | 317 |
| 2063 | 3300049581 | Ga0501047_0132255 | Ga0501047_0132255_427_1380 | 317 |
| 2064 | 3300049582 | Ga0501048_0000072 | Ga0501048_0000072_14305_15258 | 317 |
| 2065 | 3300049583 | Ga0501067_0000076 | Ga0501067_0000076_18490_19443 | 317 |
| 2066 | 3300049583 | Ga0501067_0023326 | Ga0501067_0023326_354_1307 | 317 |
| 2067 | 3300049584 | Ga0501068_0008449 | Ga0501068_0008449_1306_2259 | 317 |
| 2068 | 3300049585 | Ga0501069_0013671 | Ga0501069_0013671_3255_4208 | 317 |
| 2069 | 3300049586 | Ga0501070_0011558 | Ga0501070_0011558_2735_3688 | 317 |
| 2070 | 3300049586 | Ga0501070_0031178 | Ga0501070_0031178_323_1279 | 317 |
| 2071 | 3300049586 | Ga0501070_0079684 | Ga0501070_0079684_322_1278 | 317 |
| 2072 | 3300049588 | Ga0501072_0001658 | Ga0501072_0001658_8890_9843 | 317 |
| 2073 | 3300049589 | Ga0501073_0000099 | Ga0501073_0000099_18136_19089 | 317 |
| 2074 | 3300049589 | Ga0501073_0042714 | Ga0501073_0042714_1776_2729 | 317 |
| 2075 | 3300049589 | Ga0501073_0050453 | Ga0501073_0050453_1930_2886 | 317 |
| 2076 | 3300049590 | Ga0501074_0044377 | Ga0501074_0044377_887_1843 | 317 |
| 2077 | 3300049590 | Ga0501074_0184445 | Ga0501074_0184445_325_1278 | 317 |
| 2078 | 3300049741 | Ga0501079_0004389 | Ga0501079_0004389_9424_10377 | 317 |
| 2079 | 3300049741 | Ga0501079_0074304 | Ga0501079_0074304_1572_2525 | 317 |
| 2080 | 3300049742 | Ga0501080_0000658 | Ga0501080_0000658_18972_19925 | 317 |
| 2081 | 3300049744 | Ga0501083_0001450 | Ga0501083_0001450_6654_7607 | 317 |
| 2082 | 3300049822 | Ga0501035_0000255 | Ga0501035_0000255_44449_45402 | 317 |
| 2083 | 3300049822 | Ga0501035_0032578 | Ga0501035_0032578_3486_4439 | 317 |
| 2084 | 3300049822 | Ga0501035_0046753 | Ga0501035_0046753_530_1486 | 317 |
| 2085 | 3300049823 | Ga0501044_0000141 | Ga0501044_0000141_34930_35883 | 317 |
| 2086 | 3300049823 | Ga0501044_0031151 | Ga0501044_0031151_2631_3620 | 317 |
| 2087 | 3300049823 | Ga0501044_0131610 | Ga0501044_0131610_368_1321 | 317 |
| 2088 | 3300049823 | Ga0501044_0313589 | Ga0501044_0313589_66_1019 | 317 |
| 2089 | 3300050490 | nmdc:mga03n38_113048_c1 | nmdc:mga03n38_113048_c1_188_1141 | 317 |
| 2090 | 3300050491 | nmdc:mga00v17_33021_c1 | nmdc:mga00v17_33021_c1_1650_2606 | 317 |
| 2091 | 3300050492 | nmdc:mga0yw44_117362_c1 | nmdc:mga0yw44_117362_c1_360_1313 | 317 |
| 2092 | 3300050492 | nmdc:mga0yw44_197982_c1 | nmdc:mga0yw44_197982_c1_286_1239 | 317 |
| 2093 | 3300050492 | nmdc:mga0yw44_24041_c1 | nmdc:mga0yw44_24041_c1_1218_2177 | 317 |
| 2094 | 3300050492 | nmdc:mga0yw44_71422_c1 | nmdc:mga0yw44_71422_c1_982_1938 | 317 |
| 2095 | 3300050493 | nmdc:mga0k408_21847_c1 | nmdc:mga0k408_21847_c1_2231_3184 | 317 |
| 2096 | 3300050494 | nmdc:mga06z11_25288_c1 | nmdc:mga06z11_25288_c1_1219_2175 | 317 |
| 2097 | 3300050496 | nmdc:mga07m45_1811_c1 | nmdc:mga07m45_1811_c1_6728_7684 | 317 |
| 2098 | 3300050507 | nmdc:mga05p37_185331_c1 | nmdc:mga05p37_185331_c1_1206_2162 | 317 |
| 2099 | 3300050511 | nmdc:mga08y16_92726_c1 | nmdc:mga08y16_92726_c1_155_1111 | 317 |
| 2100 | 3300050513 | nmdc:mga0rr50_26740_c1 | nmdc:mga0rr50_26740_c1_1467_2423 | 317 |
| 2101 | 3300050514 | nmdc:mga08x19_92852_c1 | nmdc:mga08x19_92852_c1_688_1668 | 317 |
| 2102 | 3300050516 | nmdc:mga0sz30_10577_c1 | nmdc:mga0sz30_10577_c1_381_1340 | 317 |
| 2103 | 3300050516 | nmdc:mga0sz30_35523_c1 | nmdc:mga0sz30_35523_c1_869_1822 | 317 |
| 2104 | 3300050516 | nmdc:mga0sz30_41570_c1 | nmdc:mga0sz30_41570_c1_450_1403 | 317 |
| 2105 | 3300053077 | Ga0495601_0144464 | Ga0495601_0144464_189_1145 | 317 |
| 2106 | 3300053078 | Ga0495612_0072117 | Ga0495612_0072117_252_1208 | 317 |
| 2107 | 3300053078 | Ga0495612_0127770 | Ga0495612_0127770_131_1084 | 317 |
| 2108 | 3300053080 | Ga0500635_0014595 | Ga0500635_0014595_223_1179 | 317 |
| 2109 | 3300053080 | Ga0500635_0022450 | Ga0500635_0022450_818_1801 | 317 |
| 2110 | 3300053080 | Ga0500635_0031115 | Ga0500635_0031115_725_1681 | 317 |
| 2111 | 3300053084 | Ga0495595_0000309 | Ga0495595_0000309_9422_10378 | 317 |
| 2112 | 3300053084 | Ga0495595_0007183 | Ga0495595_0007183_1619_2575 | 317 |
| 2113 | 3300053085 | Ga0495619_0004295 | Ga0495619_0004295_570_1526 | 317 |
| 2114 | 3300053085 | Ga0495619_0035622 | Ga0495619_0035622_2138_3094 | 317 |
| 2115 | 3300053085 | Ga0495619_0145203 | Ga0495619_0145203_39_992 | 317 |
| 2116 | 3300053087 | Ga0500643_000114 | Ga0500643_000114_12411_13364 | 317 |
| 2117 | 3300053090 | Ga0500646_0015271 | Ga0500646_0015271_641_1651 | 317 |
| 2118 | 3300053094 | Ga0500566_0000100 | Ga0500566_0000100_30287_31243 | 317 |
| 2119 | 3300053094 | Ga0500566_0000220 | Ga0500566_0000220_3472_4431 | 317 |
| 2120 | 3300053094 | Ga0500566_0001885 | Ga0500566_0001885_376_1329 | 317 |
| 2121 | 3300053095 | Ga0500640_005859 | Ga0500640_005859_559_1515 | 317 |
| 2122 | 3300053096 | Ga0500641_0002654 | Ga0500641_0002654_5098_6066 | 317 |
| 2123 | 3300053096 | Ga0500641_0044249 | Ga0500641_0044249_821_1777 | 317 |
| 2124 | 3300053098 | Ga0500650_0003775 | Ga0500650_0003775_4293_5252 | 317 |
| 2125 | 3300053102 | Ga0500554_003133 | Ga0500554_003133_1806_2762 | 317 |
| 2126 | 3300053104 | Ga0500556_0000002 | Ga0500556_0000002_470581_471537 | 317 |
| 2127 | 3300053104 | Ga0500556_0008488 | Ga0500556_0008488_317_1270 | 317 |
| 2128 | 3300053105 | Ga0500557_000010 | Ga0500557_000010_95971_96924 | 317 |
| 2129 | 3300053109 | Ga0500569_035121 | Ga0500569_035121_458_1411 | 317 |
| 2130 | 3300053111 | Ga0500572_000176 | Ga0500572_000176_6338_7294 | 317 |
| 2131 | 3300053111 | Ga0500572_000235 | Ga0500572_000235_17577_18530 | 317 |
| 2132 | 3300053116 | Ga0500592_006824 | Ga0500592_006824_222_1178 | 317 |
| 2133 | 3300053119 | Ga0500595_008586 | Ga0500595_008586_1979_2935 | 317 |
| 2134 | 3300053119 | Ga0500595_033524 | Ga0500595_033524_488_1441 | 317 |
| 2135 | 3300053121 | Ga0500607_016108 | Ga0500607_016108_326_1279 | 317 |
| 2136 | 3300053122 | Ga0500608_014667 | Ga0500608_014667_1116_2072 | 317 |
| 2137 | 3300053122 | Ga0500608_065882 | Ga0500608_065882_408_1367 | 317 |
| 2138 | 3300053123 | Ga0500614_000141 | Ga0500614_000141_7897_8853 | 317 |
| 2139 | 3300053123 | Ga0500614_021538 | Ga0500614_021538_255_1208 | 317 |
| 2140 | 3300053130 | Ga0500642_0000012 | Ga0500642_0000012_108798_109757 | 317 |
| 2141 | 3300053130 | Ga0500642_0000334 | Ga0500642_0000334_2194_3147 | 317 |
| 2142 | 3300053130 | Ga0500642_0033939 | Ga0500642_0033939_921_1874 | 317 |
| 2143 | 3300053130 | Ga0500642_0137836 | Ga0500642_0137836_73_1029 | 317 |
| 2144 | 3300053131 | Ga0500652_001569 | Ga0500652_001569_1847_2806 | 317 |
| 2145 | 3300053134 | Ga0500658_0055711 | Ga0500658_0055711_207_1166 | 317 |
| 2146 | 3300053136 | Ga0500559_0000509 | Ga0500559_0000509_4450_5403 | 317 |
| 2147 | 3300053136 | Ga0500559_0003396 | Ga0500559_0003396_3308_4264 | 317 |
| 2148 | 3300053136 | Ga0500559_0005407 | Ga0500559_0005407_3842_4801 | 317 |
| 2149 | 3300053136 | Ga0500559_0010805 | Ga0500559_0010805_319_1275 | 317 |
| 2150 | 3300053136 | Ga0500559_0086638 | Ga0500559_0086638_441_1400 | 317 |
| 2151 | 3300053139 | Ga0500568_0001219 | Ga0500568_0001219_4186_5145 | 317 |
| 2152 | 3300053140 | Ga0500573_0088519 | Ga0500573_0088519_731_1687 | 317 |
| 2153 | 3300053142 | Ga0500577_0000149 | Ga0500577_0000149_2106_3062 | 317 |
| 2154 | 3300053145 | Ga0500586_000724 | Ga0500586_000724_1912_2871 | 317 |
| 2155 | 3300053150 | Ga0500603_000017 | Ga0500603_000017_32970_33926 | 317 |
| 2156 | 3300053150 | Ga0500603_000889 | Ga0500603_000889_346_1302 | 317 |
| 2157 | 3300053151 | Ga0500604_0003561 | Ga0500604_0003561_2279_3238 | 317 |
| 2158 | 3300053153 | Ga0500616_0000508 | Ga0500616_0000508_3908_4867 | 317 |
| 2159 | 3300053154 | Ga0500619_029693 | Ga0500619_029693_104_1063 | 317 |
| 2160 | 3300053156 | Ga0500622_0006594 | Ga0500622_0006594_5622_6581 | 317 |
| 2161 | 3300053156 | Ga0500622_0012145 | Ga0500622_0012145_2714_3667 | 317 |
| 2162 | 3300053159 | Ga0500630_033993 | Ga0500630_033993_85_1041 | 317 |
| 2163 | 3300053162 | Ga0500638_023327 | Ga0500638_023327_1092_2048 | 317 |
| 2164 | 3300053162 | Ga0500638_111345 | Ga0500638_111345_243_1199 | 317 |
| 2165 | 3300053163 | Ga0500639_000525 | Ga0500639_000525_3610_4566 | 317 |
| 2166 | 3300053163 | Ga0500639_062463 | Ga0500639_062463_541_1494 | 317 |
| 2167 | 3300053177 | Ga0500636_0000695 | Ga0500636_0000695_1612_2565 | 317 |
| 2168 | 3300053177 | Ga0500636_0001744 | Ga0500636_0001744_2701_3660 | 317 |
| 2169 | 3300053177 | Ga0500636_0033194 | Ga0500636_0033194_1559_2515 | 317 |
| 2170 | 3300053178 | Ga0500637_0009251 | Ga0500637_0009251_3965_4921 | 317 |
| 2171 | 3300053178 | Ga0500637_0115909 | Ga0500637_0115909_295_1248 | 317 |
| 2172 | 3300053178 | Ga0500637_0158620 | Ga0500637_0158620_51_1007 | 317 |
| 2173 | 3300053727 | Ga0500611_012117 | Ga0500611_012117_461_1417 | 317 |
| 2174 | 3300053729 | Ga0500625_003061 | Ga0500625_003061_3494_4447 | 317 |
| 2175 | 3300053730 | Ga0500645_011357 | Ga0500645_011357_1485_2441 | 317 |
| 2176 | 3300053735 | Ga0500596_003815 | Ga0500596_003815_1805_2761 | 317 |
| 2177 | 3300053735 | Ga0500596_005554 | Ga0500596_005554_1175_2131 | 317 |
| 2178 | 3300053736 | Ga0500599_004800 | Ga0500599_004800_529_1482 | 317 |
| 2179 | 3300053737 | Ga0500601_000775 | Ga0500601_000775_2164_3117 | 317 |
| 2180 | 3300054114 | Ga0501084_0006070 | Ga0501084_0006070_6506_7459 | 317 |
| 2181 | 3300055283 | Ga0500661_013504 | Ga0500661_013504_135_1091 | 317 |
| 2182 | 3300060353 | Ga0501082_0004101 | Ga0501082_0004101_5932_6885 | 317 |
| 2183 | 3300061719 | Ga0466962_0027657 | Ga0466962_0027657_277_1233 | 317 |
| 2184 | iso_pu_bacteria | 2935630451 | 2935634386 | 317 |
| 2185 | iso_pu_bacteria | 2941507105 | 2941511276 | 317 |
| 2186 | iso_pu_bacteria | 2941515067 | 2941518660 | 317 |
| 2187 | iso_pu_bacteria | 2941523033 | 2941530396 | 317 |
| 2188 | iso_pu_bacteria | 3005474847 | 3005479212 | 317 |
| 2189 | iso_pu_bacteria | 3005483717 | 3005489840 | 317 |
| 2190 | iso_pu_bacteria | 8019648815 | 8019657054 | 317 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dz1-assembly1.cif.gz_A | crystal structure of dihydrodipicolinate synthase from rhodopseudomonas palustris at 1.87a resolution | 0.9969 | 1 | 299 |
| 3dz1-assembly1.cif.gz_A | crystal structure of dihydrodipicolinate synthase from rhodopseudomonas palustris at 1.87a resolution | 0.987 | 1 | 299 |
| 3na8-assembly1.cif.gz_B | crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa | 0.9218 | 6 | 300 |
| 3na8-assembly1.cif.gz_D | crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa | 0.9186 | 6 | 300 |
| 3s5n-assembly1.cif.gz_A | crystal structure of human 4-hydroxy-2-oxoglutarate aldolase | 0.9169 | 6 | 300 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3dz1A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9951 | 1 | 299 | 3.20.20.70 |
| 3dz1A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9849 | 1 | 299 | 3.20.20.70 |
| 2rfgB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9069 | 8 | 305 | 3.20.20.70 |
| 2yxgD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9062 | 7 | 298 | 3.20.20.70 |
| 5f1uA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9058 | 1 | 299 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A435X9N8-F1-model_v4 | Dihydrodipicolinate synthase family protein | 0.9972 | 194 | 302 |
|
| AF-A0A2C7AAA9-F1-model_v4 | Dihydrodipicolinate synthase family protein | 0.9959 | 1 | 308 |
GO:0005829
GO:0008840 |
| AF-A0A261RYY6-F1-model_v4 | Dihydrodipicolinate synthase family protein | 0.9954 | 1 | 311 |
GO:0005829
GO:0008840 |
| AF-A0A7W5TC66-F1-model_v4 | 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) | 0.9949 | 2 | 307 |
GO:0005829
GO:0008840 |
| AF-A0A2G8MJR4-F1-model_v4 | deleted | 0.9944 | 1 | 252 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar