F496530

General Info

Members Datasets Scaffolds Average Seq Length
2193 1094 1595 207

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100255630|Ga0068856_1002556302
Length 236
Sequence MSRFDPPPIPDAIAGFSSRAAASTNQQQLRPLMRETASQTAGPYVHIGLAPKAAGFDIFEHNFGNVLVTPQTKGERIRIEGRVLDGIGTPVRDVLVEIWQANAAGRYRHPGDRQAGKAIDETFRGWGRAASDFETGVYSFETIKPGPVMGRNGRVMAPHINFWVVARGINIGLNTRMYFSDEAEANAKDPVINLVEWESRRRTLIAEREDGKGKSGTLYRFDIRLQGDNETVFFDI

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
6 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
7 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
8 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
9 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
10 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
11 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
12 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
13 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
14 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
15 2512875024 Mesorhizobium loti R88b Isolate Nodule
16 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
17 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
18 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
19 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
20 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
21 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
22 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
23 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
24 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
25 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
26 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
27 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
28 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
29 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
30 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
31 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
32 2516143018 Ensifer sp. BR816 Isolate Nodule
33 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
34 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
35 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
36 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
37 2519899620 Rhizobium sp. Pop5 Isolate Nodule
38 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
39 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
40 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
41 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
42 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
43 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
44 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
45 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
46 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
47 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
48 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
49 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
50 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
51 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
52 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
53 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
54 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
55 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
56 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
57 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
58 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
59 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
60 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
61 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
62 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
63 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
64 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
65 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
66 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
67 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
68 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
69 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
70 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
71 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
72 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
73 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
74 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
75 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
76 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
77 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
78 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
79 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
80 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
81 2643221557 Ensifer sp. Root558 Isolate Unclassified
82 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
83 2643221580 Devosia sp. Root635 Isolate Unclassified
84 2643221591 Devosia sp. Root685 Isolate Unclassified
85 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
86 2643221599 Rhizobium sp. Root708 Isolate Unclassified
87 2643221607 Rhizobium sp. Root73 Isolate Unclassified
88 2643221610 Ensifer sp. Root74 Isolate Unclassified
89 2643221618 Ensifer sp. Root231 Isolate Unclassified
90 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
91 2643221626 Ensifer sp. Root31 Isolate Unclassified
92 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
93 2643221629 Devosia sp. Root105 Isolate Unclassified
94 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
95 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
96 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
97 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
98 2643221655 Ensifer sp. Root1252 Isolate Unclassified
99 2643221659 Ensifer sp. Root127 Isolate Unclassified
100 2643221662 Devosia sp. Root413D1 Isolate Unclassified
101 2643221668 Ensifer sp. Root423 Isolate Unclassified
102 2643221674 Devosia sp. Root436 Isolate Unclassified
103 2643221675 Ensifer sp. Root1298 Isolate Unclassified
104 2643221680 Ensifer sp. Root1312 Isolate Unclassified
105 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
106 2643221688 Rhizobium sp. Root482 Isolate Unclassified
107 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
108 2643221698 Ensifer sp. Root142 Isolate Unclassified
109 2643221712 Ensifer sp. Root258 Isolate Unclassified
110 2643221719 Rhizobium sp. Root274 Isolate Unclassified
111 2643221723 Ensifer sp. Root278 Isolate Unclassified
112 2643221726 Ensifer sp. Root954 Isolate Unclassified
113 2643221736 Bosea sp. Root483D1 Isolate Unclassified
114 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
115 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
116 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
117 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
118 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
119 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
120 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
121 2718217882 Rhizobium sp. N741 Isolate Nodule
122 2718217927 Rhizobium sp. N324 Isolate Nodule
123 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
124 2718218009 Rhizobium sp. N561 Isolate Nodule
125 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
126 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
127 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
128 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
129 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
130 2718218363 Rhizobium sp. N113 Isolate Nodule
131 2718218365 Rhizobium sp. N731 Isolate Nodule
132 2718218366 Rhizobium sp. N621 Isolate Nodule
133 2718218423 Rhizobium sp. N941 Isolate Nodule
134 2721755514 Rhizobium sp. N6212 Isolate Nodule
135 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
136 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
137 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
138 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
139 2721755809 Rhizobium sp. N541 Isolate Nodule
140 2721755810 Rhizobium sp. N871 Isolate Nodule
141 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
142 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
143 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
144 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
145 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
146 2728369365 Rhizobium sp. N1341 Isolate Nodule
147 2728369397 Rhizobium sp. N1314 Isolate Nodule
148 2738541293 Rhizobium sp. GV031 Isolate Unclassified
149 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
150 2738543024 Aminobacter sp. AP02 Isolate Unclassified
151 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
152 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
153 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
154 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
155 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
156 2773857925 Microvirga vignae BR3299 Isolate Unclassified
157 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
158 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
159 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
160 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
161 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
162 2791355256 Rhizobium sp. M10 Isolate Nodule
163 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
164 2791355260 Rhizobium sp. L9 Isolate Nodule
165 2791355261 Rhizobium sp. J15 Isolate Nodule
166 2791355262 Rhizobium sp. M1 Isolate Nodule
167 2791355263 Rhizobium chutanense C5 Isolate Nodule
168 2791355264 Rhizobium sp. S9 Isolate Nodule
169 2791355265 Rhizobium sp. H4 Isolate Nodule
170 2791355266 Rhizobium sp. L43 Isolate Nodule
171 2791355267 Rhizobium sp. L18 Isolate Nodule
172 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
173 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
174 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
175 2802429633 Rhizobium anhuiense J3 Isolate Nodule
176 2802429634 Rhizobium anhuiense S10 Isolate Nodule
177 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
178 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
179 2802429637 Rhizobium anhuiense C15 Isolate Nodule
180 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
181 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
182 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
183 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
184 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
185 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
186 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
187 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
188 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
189 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
190 2838048938 Rhizobium pisi 27/80 Isolate Nodule
191 2838061910 Rhizobium phaseoli L15 Isolate Nodule
192 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
193 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
194 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
195 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
196 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
197 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
198 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
199 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
200 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
201 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
202 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
203 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
204 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
205 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
206 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
207 2841760612 Bosea sp. Tri-49 Isolate Nodule
208 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
209 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
210 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
211 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
212 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
213 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
214 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
215 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
216 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
217 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
218 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
219 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
220 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
221 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
222 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
223 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
224 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
225 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
226 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
227 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
228 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
229 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
230 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
231 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
232 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
233 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
234 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
235 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
236 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
237 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
238 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
239 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
240 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
241 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
242 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
243 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
244 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
245 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
246 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
247 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
248 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
249 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
250 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
251 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
252 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
253 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
254 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
255 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
256 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
257 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
258 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
259 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
260 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
261 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
262 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
263 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
264 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
265 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
266 2844104063 Bosea sp. Tri-39 Isolate Nodule
267 2844163670 Ensifer sp. 1H6 Isolate Unclassified
268 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
269 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
270 2851182111 Bosea sp. Tri-44 Isolate Nodule
271 2851246043 Bosea sp. Tri-54 Isolate Nodule
272 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
273 2854911287 Brucella lupini LUP21 Isolate Unclassified
274 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
275 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
276 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
277 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
278 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
279 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
280 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
281 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
282 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
283 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
284 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
285 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
286 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
287 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
288 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
289 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
290 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
291 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
292 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
293 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
294 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
295 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
296 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
297 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
298 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
299 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
300 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
301 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
302 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
303 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
304 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
305 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
306 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
307 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
308 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
309 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
310 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
311 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
312 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
313 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
314 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
315 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
316 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
317 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
318 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
319 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
320 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
321 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
322 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
323 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
324 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
325 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
326 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
327 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
328 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
329 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
330 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
331 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
332 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
333 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
334 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
335 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
336 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
337 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
338 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
339 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
340 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
341 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
342 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
343 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
344 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
345 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
346 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
347 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
348 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
349 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
350 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
351 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
352 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
353 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
354 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
355 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
356 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
357 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
358 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
359 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
360 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
361 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
362 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
363 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
364 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
365 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
366 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
367 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
368 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
369 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
370 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
371 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
372 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
373 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
374 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
375 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
376 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
377 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
378 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
379 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
380 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
381 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
382 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
383 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
384 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
385 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
386 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
387 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
388 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
389 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
390 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
391 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
392 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
393 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
394 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
395 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
396 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
397 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
398 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
399 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
400 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
401 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
402 2933599457 Rhizobium phaseoli M3 Isolate Nodule
403 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
404 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
405 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
406 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
407 2936381700 Rhizobium chutanense C16 Isolate Unclassified
408 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
409 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
410 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
411 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
412 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
413 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
414 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
415 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
416 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
417 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
418 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
419 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
420 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
421 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
422 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
423 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
424 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
425 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
426 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
427 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
428 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
429 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
430 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
431 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
432 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
433 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
434 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
435 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
436 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
437 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
438 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
439 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
440 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
441 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
442 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
443 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
444 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
445 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
446 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
447 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
448 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
449 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
450 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
451 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
452 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
453 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
454 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
455 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
456 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
457 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
458 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
459 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
460 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
461 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
462 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
463 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
464 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
465 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
466 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
467 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
468 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
469 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
470 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
471 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
472 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
473 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
474 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
475 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
476 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
477 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
478 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
479 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
480 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
481 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
482 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
483 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
484 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
485 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
486 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
487 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
488 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
489 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
490 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
491 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
492 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
493 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
494 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
495 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
496 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
497 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
498 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
499 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
500 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
501 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
502 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
503 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
504 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
505 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
506 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
507 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
508 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
509 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
510 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
511 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
512 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
513 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
514 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
515 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
516 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
517 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
518 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
519 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
520 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
521 2996893221 Rhizobium sp. R635 Isolate Nodule
522 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
523 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
524 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
525 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
526 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
527 3004167301 Mesorhizobium loti 582 Isolate Unclassified
528 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
529 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
530 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
531 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
532 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
533 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
534 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
535 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
536 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
537 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
538 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
539 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
540 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
541 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
542 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
543 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
544 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
545 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
546 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
547 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
548 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
549 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
550 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
551 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
552 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
553 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
554 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
555 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
556 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
557 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
558 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
559 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
560 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
561 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
562 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
563 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
564 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
565 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
566 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
567 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
568 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
569 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
570 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
571 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
572 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
573 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
574 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
575 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
576 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
577 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
578 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
579 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
580 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
581 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
582 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
583 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
584 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
585 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
586 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
587 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
588 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
589 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
590 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
591 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
592 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
593 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
594 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
595 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
596 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
597 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
598 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
599 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
600 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
601 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
602 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
603 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
604 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
605 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
606 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
607 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
608 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
609 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
610 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
611 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
612 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
613 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
614 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
615 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
616 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
617 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
618 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
619 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
620 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
621 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
622 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
623 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
624 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
625 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
626 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
627 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
628 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
629 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
630 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
631 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
632 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
633 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
634 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
635 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
636 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
637 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
638 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
639 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
640 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
641 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
642 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
643 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
644 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
645 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
646 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
647 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
648 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
649 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
650 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
651 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
652 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
653 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
654 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
655 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
656 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
657 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
658 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
659 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
660 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
661 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
662 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
663 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
664 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
665 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
666 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
667 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
668 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
669 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
670 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
671 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
672 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
673 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
674 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
675 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
676 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
677 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
678 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
679 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
680 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
681 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
682 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
683 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
684 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
685 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
686 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
687 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
688 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
689 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
690 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
691 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
692 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
693 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
694 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
695 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
696 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
697 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
698 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
699 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
700 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
701 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
702 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
703 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
704 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
705 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
706 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
707 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
708 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
709 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
710 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
711 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
712 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
713 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
714 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
715 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
716 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
717 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
718 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
719 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
720 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
721 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
722 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
723 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
724 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
725 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
726 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
727 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
728 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
729 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
730 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
731 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
732 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
733 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
734 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
735 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
736 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
737 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
738 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
739 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
740 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
741 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
742 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
743 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
744 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
745 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
746 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
747 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
748 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
749 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
750 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
751 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
752 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
753 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
754 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
755 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
756 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
757 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
758 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
759 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
760 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
761 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
762 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
763 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
764 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
765 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
766 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
767 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
768 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
769 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
770 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
771 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
772 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
773 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
774 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
775 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
776 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
777 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
778 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
779 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
780 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
781 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
782 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
783 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
784 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
785 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
786 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
787 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
788 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
789 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
790 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
791 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
792 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
793 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
794 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
795 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
796 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
797 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
798 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
799 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
800 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
801 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
802 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
803 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
804 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
805 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
806 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
807 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
808 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
809 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
810 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
811 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
812 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
813 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
814 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
815 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
816 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
817 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
818 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
819 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
820 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
821 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
822 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
823 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
824 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
825 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
826 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
827 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
828 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
829 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
830 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
831 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
832 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
833 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
834 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
835 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
836 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
837 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
838 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
839 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
840 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
841 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
842 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
843 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
844 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
845 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
846 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
847 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
848 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
849 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
850 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
851 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
852 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
853 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
854 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
855 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
856 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
857 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
858 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
859 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
860 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
861 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
862 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
863 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
864 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
865 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
866 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
867 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
868 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
869 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
870 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
871 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
872 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
873 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
874 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
875 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
876 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
877 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
878 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
879 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
880 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
881 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
882 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
883 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
884 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
885 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
886 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
887 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
888 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
889 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
890 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
891 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
892 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
893 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
894 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
895 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
896 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
897 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
898 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
899 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
900 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
901 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
902 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
903 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
904 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
905 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
906 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
907 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
908 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
909 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
910 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
911 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
912 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
913 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
914 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
915 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
916 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
917 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
918 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
919 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
920 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
921 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
922 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
923 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
924 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
925 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
926 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
927 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
928 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
929 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
930 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
931 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
932 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
933 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
934 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
935 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
936 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
937 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
938 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
939 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
940 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
941 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
942 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
943 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
944 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
945 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
946 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
947 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
948 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
949 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
950 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
951 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
952 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
953 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
954 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
955 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
956 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
957 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
958 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
959 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
960 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
961 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
962 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
963 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
964 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
965 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
966 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
967 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
968 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
969 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
970 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
971 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
972 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
973 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
974 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
975 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
976 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
977 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
978 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
979 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
980 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
981 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
982 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
983 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
984 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
985 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
986 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
987 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
988 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
989 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
990 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
991 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
992 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
993 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
994 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
995 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
996 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
997 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
998 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
999 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1000 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1001 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1002 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1003 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1004 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1005 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
1006 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
1007 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
1008 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1009 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
1010 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
1011 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1012 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
1013 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
1014 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
1015 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1016 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
1017 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1018 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
1019 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
1020 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
1021 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
1022 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1023 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
1024 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1025 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1026 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
1027 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1028 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1029 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
1030 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1031 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
1032 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
1033 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1034 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1035 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1036 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
1037 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1038 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
1039 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
1040 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1041 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1042 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
1043 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
1044 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1045 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
1046 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1047 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1048 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1049 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1050 8004592986 Serratia sp. S119 Isolate Unclassified
1051 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1052 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1053 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1054 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1055 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1056 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1057 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1058 8005258706 Rhizobium sp. R693 Isolate Nodule
1059 8005275841 Rhizobium sp. N4311 Isolate Nodule
1060 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1061 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1062 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1063 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1064 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1065 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1066 8005382845 Rhizobium sp. R634 Isolate Nodule
1067 8005395548 Rhizobium sp. R339 Isolate Nodule
1068 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1069 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1070 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1071 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1072 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1073 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1074 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1075 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1076 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1077 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1078 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1079 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1080 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1081 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1082 8018176218 Rhizobium sp. N122 Isolate Nodule
1083 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1084 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1085 8024501048 Rhizobium sp. H4 Isolate Nodule
1086 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1087 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1088 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1089 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
1090 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1091 8056382006 Rhizobium croatiense 13T Isolate Nodule
1092 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
1093 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1094 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.59
Metatranscriptomes 0.05
Isolates 27.36

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 13.36
Nodule 20.47
Rhizoplane 2.92
Rhizosphere 52.21
Stem 0
Stem Tuber 0
Unclassified 10.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_FSXC70212_g1 2010549000 Bacteria 867
2 JGI24740J21852_10002540 3300001979 Bacteria 8228
3 JGI24739J22299_10000109 3300001989 Bacteria 25306
4 JGI24739J22299_10039807 3300001989 Bacteria 1572
5 JGI24739J22299_10068872 3300001989 Bacteria 1104
6 JGI24735J21928_10036100 3300002067 Bacteria 1450
7 JGI24742J22300_10027710 3300002244 Bacteria 982
8 JGI25156J39149_1000137 3300002705 Bacteria 53605
9 JGI25156J39149_1000523 3300002705 Bacteria 22196
10 JGI25162J39368_1000656 3300002737 Bacteria 24441
11 JGI25162J39368_1000744 3300002737 Bacteria 22288
12 JGI25154J39366_1000106 3300002738 Bacteria 74019
13 JGI25154J39366_1000435 3300002738 Bacteria 22198
14 JGI25158J39367_1000347 3300002739 Bacteria 10132
15 JGI25158J39367_1007582 3300002739 Bacteria 1527
16 JGI25157J39369_1000154 3300002741 Bacteria 57286
17 JGI25157J39369_1000562 3300002741 Bacteria 22196
18 JGI25157J39369_1000841 3300002741 Bacteria 15215
19 JGI25164J39214_1004996 3300002772 Bacteria 1470
20 JGI25152J39213_1000009 3300002773 Bacteria 138285
21 JGI25152J39213_1003290 3300002773 Bacteria 5587
22 JGI25152J39213_1005724 3300002773 Bacteria 3551
23 JGI25152J39213_1005868 3300002773 Bacteria 3473
24 JGI25152J39213_1008747 3300002773 Bacteria 2478
25 JGI25150J39212_1000016 3300002774 Bacteria 153945
26 JGI25150J39212_1010813 3300002774 Bacteria 1681
27 JGI25150J39212_1016900 3300002774 Bacteria 1188
28 JGI25159J45721_1000083 3300002987 Bacteria 44911
29 JGI25159J45721_1000259 3300002987 Bacteria 24699
30 JGI25159J45721_1000466 3300002987 Bacteria 18688
31 JGI25159J45721_1000902 3300002987 Bacteria 12929
32 JGI25159J45721_1008601 3300002987 Bacteria 2786
33 JGI25151J46595_10000073 3300003187 Bacteria 136684
34 JGI25151J46595_10000274 3300003187 Bacteria 59318
35 JGI25151J46595_10018172 3300003187 Bacteria 3030
36 JGI25165J46597_1000015 3300003214 Bacteria 380891
37 JGI25165J46597_1000018 3300003214 Bacteria 374701
38 JGI25165J46597_1000407 3300003214 Bacteria 45582
39 JGI25165J46597_1003522 3300003214 Bacteria 3841
40 JGI25153J46596_10008048 3300003215 Bacteria 5093
41 JGI25153J46596_10012993 3300003215 Bacteria 3551
42 JGI25153J46596_10013350 3300003215 Bacteria 3473
43 rootH1_10022690 3300003316 Bacteria 6290
44 rootH1_10086971 3300003316 Bacteria 3073
45 rootH2_10074857 3300003320 Bacteria 5668
46 rootL2_10132451 3300003322 Bacteria 1026
47 rootL2_10313242 3300003322 Bacteria 1114
48 rootH1_10019588 3300003316 Bacteria 4902
49 rootH1_10019588 3300003323 Bacteria 4711
50 rootH1_10030464 3300003323 Bacteria 5430
51 rootH1_10031251 3300003323 Bacteria 1148
52 rootH1_10033851 3300003316 Bacteria 2529
53 rootH1_10033851 3300003323 Bacteria 2311
54 rootH1_10097074 3300003323 Bacteria 1359
55 rootH1_10104478 3300003323 Bacteria 1146
56 JGI25160J50197_1000005 3300003354 Bacteria 417280
57 JGI25160J50197_1000014 3300003354 Bacteria 259862
58 JGI25160J50197_1001878 3300003354 Bacteria 10079
59 JGI25160J50197_1006181 3300003354 Bacteria 4875
60 JGI25161J50226_1000022 3300003374 Bacteria 158544
61 JGI25161J50226_1000025 3300003374 Bacteria 148471
62 JGI25161J50226_1001121 3300003374 Bacteria 8987
63 Ga0006562J51391_1035319 3300003578 Bacteria 3220
64 Ga0055539_1000160 3300003752 Bacteria 63531
65 Ga0055539_1001756 3300003752 Bacteria 3757
66 Ga0055533_1000162 3300003756 Bacteria 63221
67 Ga0055525_1000742 3300003759 Bacteria 11118
68 Ga0055535_1000403 3300003761 Bacteria 40654
69 Ga0055542_1000227 3300003762 Bacteria 67082
70 Ga0055529_1000195 3300003763 Bacteria 82315
71 Ga0055529_1006674 3300003763 Bacteria 1599
72 Ga0055526_1001208 3300003771 Bacteria 18613
73 Ga0055526_1002592 3300003771 Bacteria 12087
74 Ga0055526_1006973 3300003771 Bacteria 5996
75 Ga0055526_1010076 3300003771 Bacteria 4445
76 Ga0055524_1000581 3300003775 Bacteria 26755
77 Ga0055524_1007283 3300003775 Bacteria 4721
78 Ga0055524_1019755 3300003775 Bacteria 2292
79 Ga0055524_1022464 3300003775 Bacteria 2061
80 Ga0055524_1044601 3300003775 Bacteria 1076
81 Ga0055536_1008001 3300003781 Bacteria 4627
82 Ga0055528_1000917 3300003790 Bacteria 19843
83 Ga0055528_1001036 3300003790 Bacteria 18388
84 Ga0055528_1001440 3300003790 Bacteria 14538
85 Ga0055528_1004532 3300003790 Bacteria 6666
86 Ga0055528_1026575 3300003790 Bacteria 1656
87 Ga0055528_1036732 3300003790 Bacteria 1165
88 Ga0055528_1047861 3300003790 Bacteria 889
89 Ga0055530_10019390 3300003791 Bacteria 2062
90 Ga0055540_1000050 3300003792 Bacteria 145565
91 Ga0055540_1008862 3300003792 Bacteria 3563
92 Ga0055540_1015678 3300003792 Bacteria 2191
93 Ga0055540_1019446 3300003792 Bacteria 1827
94 Ga0055540_1028599 3300003792 Bacteria 1316
95 Ga0055531_10004249 3300003794 Bacteria 8812
96 Ga0055543_1000005 3300004625 Bacteria 223621
97 Ga0055543_1000021 3300004625 Bacteria 150116
98 Ga0055543_1000324 3300004625 Bacteria 33093
99 Ga0055543_1002242 3300004625 Bacteria 6552
100 Ga0065165_1000002 3300005262 Bacteria 444192
101 Ga0065165_1000463 3300005262 Bacteria 63644
102 Ga0065165_1005453 3300005262 Bacteria 7139
103 Ga0065165_1024912 3300005262 Bacteria 2000
104 Ga0065165_1062300 3300005262 Bacteria 1017
105 Ga0065704_10025103 3300005289 Bacteria 1060
106 Ga0065715_10169762 3300005293 Bacteria 1556
107 Ga0070658_10004550 3300005327 Bacteria 11271
108 Ga0070676_10001260 3300005328 Bacteria 12754
109 Ga0070676_10009234 3300005328 Bacteria 5329
110 Ga0070676_10011240 3300005328 Bacteria 4868
111 Ga0070676_10016418 3300005328 Bacteria 4094
112 Ga0070683_100025144 3300005329 Bacteria 5344
113 Ga0070683_100093396 3300005329 Bacteria 2826
114 Ga0070683_100152822 3300005329 Bacteria 2188
115 Ga0070690_100012120 3300005330 Bacteria 5067
116 Ga0070690_100020918 3300005330 Bacteria 3991
117 Ga0070690_100034503 3300005330 Bacteria 3170
118 Ga0070690_100249148 3300005330 Bacteria 1256
119 Ga0070670_100048774 3300005331 Bacteria 3644
120 Ga0070670_100242043 3300005331 Bacteria 1571
121 Ga0070670_100789880 3300005331 Bacteria 857
122 Ga0070677_10010314 3300005333 Bacteria 3192
123 Ga0070677_10063874 3300005333 Bacteria 1527
124 Ga0070677_10119082 3300005333 Bacteria 1190
125 Ga0068869_100000109 3300005334 Bacteria 39248
126 Ga0068869_100025418 3300005334 Bacteria 4112
127 Ga0068869_100033584 3300005334 Bacteria 3622
128 Ga0068869_100362236 3300005334 Bacteria 1184
129 Ga0070666_10010714 3300005335 Bacteria 5739
130 Ga0070666_10022337 3300005335 Bacteria 4108
131 Ga0070666_10032542 3300005335 Bacteria 3445
132 Ga0070666_10051656 3300005335 Bacteria 2769
133 Ga0070682_100740513 3300005337 Bacteria 792
134 Ga0068868_100000895 3300005338 Bacteria 20275
135 Ga0068868_100000928 3300005338 Bacteria 19961
136 Ga0068868_100022186 3300005338 Bacteria 4789
137 Ga0068868_100030201 3300005338 Bacteria 4155
138 Ga0068868_100105992 3300005338 Bacteria 2280
139 Ga0068868_100107875 3300005338 Bacteria 2260
140 Ga0068868_100223636 3300005338 Bacteria 1577
141 Ga0070660_100019782 3300005339 Bacteria 4938
142 Ga0070660_100065214 3300005339 Bacteria 2834
143 Ga0070660_100230342 3300005339 Bacteria 1507
144 Ga0070660_100264068 3300005339 Bacteria 1406
145 Ga0070660_101030725 3300005339 Bacteria 696
146 Ga0070689_100003058 3300005340 Bacteria 11018
147 Ga0070689_100064787 3300005340 Bacteria 2845
148 Ga0070689_100265862 3300005340 Bacteria 1419
149 Ga0070687_100012451 3300005343 Bacteria 3759
150 Ga0070687_100123626 3300005343 Bacteria 1484
151 Ga0070661_100014534 3300005344 Bacteria 5547
152 Ga0070661_100029542 3300005344 Bacteria 3957
153 Ga0070661_100242801 3300005344 Bacteria 1387
154 Ga0070661_100387720 3300005344 Bacteria 1102
155 Ga0070692_10013623 3300005345 Bacteria 3796
156 Ga0070668_100037799 3300005347 Bacteria 3688
157 Ga0070668_100154246 3300005347 Bacteria 1860
158 Ga0070668_100429523 3300005347 Bacteria 1132
159 Ga0070668_100768920 3300005347 Bacteria 854
160 Ga0070669_100003867 3300005353 Bacteria 10823
161 Ga0070669_100010114 3300005353 Bacteria 6710
162 Ga0070669_100027346 3300005353 Bacteria 4104
163 Ga0070669_100035026 3300005353 Bacteria 3636
164 Ga0070669_100641494 3300005353 Bacteria 893
165 Ga0070675_100000621 3300005354 Bacteria 24557
166 Ga0070675_100000772 3300005354 Bacteria 22339
167 Ga0070675_100019977 3300005354 Bacteria 5344
168 Ga0070675_100202813 3300005354 Bacteria 1722
169 Ga0070675_100262046 3300005354 Bacteria 1515
170 Ga0070671_100025227 3300005355 Bacteria 4876
171 Ga0070671_100077908 3300005355 Bacteria 2770
172 Ga0070671_100125094 3300005355 Bacteria 2164
173 Ga0070671_100136348 3300005355 Bacteria 2069
174 Ga0070671_100353375 3300005355 Bacteria 1254
175 Ga0070674_100009649 3300005356 Bacteria 5790
176 Ga0070674_100043954 3300005356 Bacteria 3042
177 Ga0070674_100230532 3300005356 Bacteria 1445
178 Ga0070673_100005018 3300005364 Bacteria 8443
179 Ga0070673_100026947 3300005364 Bacteria 4254
180 Ga0070673_100031638 3300005364 Bacteria 3974
181 Ga0070673_100034172 3300005364 Bacteria 3845
182 Ga0070673_100096508 3300005364 Bacteria 2426
183 Ga0070673_100369495 3300005364 Bacteria 1277
184 Ga0070659_100011653 3300005366 Bacteria 6507
185 Ga0070659_100014156 3300005366 Bacteria 5953
186 Ga0070659_100016119 3300005366 Bacteria 5608
187 Ga0070659_100076553 3300005366 Bacteria 2668
188 Ga0070659_100223148 3300005366 Bacteria 1556
189 Ga0070659_100391073 3300005366 Bacteria 1173
190 Ga0070667_100005806 3300005367 Bacteria 10301
191 Ga0070667_100007096 3300005367 Bacteria 9313
192 Ga0070667_100025581 3300005367 Bacteria 4908
193 Ga0070667_100042070 3300005367 Bacteria 3833
194 Ga0070667_100081022 3300005367 Bacteria 2777
195 Ga0070667_100100603 3300005367 Bacteria 2497
196 Ga0070667_100199143 3300005367 Bacteria 1777
197 Ga0070667_100373681 3300005367 Bacteria 1294
198 Ga0070667_100533014 3300005367 Bacteria 1078
199 Ga0070667_100656999 3300005367 Unclassified 968
200 Ga0070667_100746268 3300005367 Bacteria 907
201 Ga0070667_100893702 3300005367 Bacteria 827
202 Ga0070667_100989641 3300005367 Bacteria 784
203 Ga0070667_101279750 3300005367 Bacteria 687
204 Ga0070714_100049991 3300005435 Bacteria 3560
205 Ga0070713_100000018 3300005436 Bacteria 118409
206 Ga0070710_10399514 3300005437 Bacteria 921
207 Ga0070710_10404875 3300005437 Bacteria 915
208 Ga0070701_10118482 3300005438 Bacteria 1488
209 Ga0070701_10139266 3300005438 Bacteria 1386
210 Ga0070700_100015826 3300005441 Bacteria 4286
211 Ga0070700_100206386 3300005441 Bacteria 1384
212 Ga0070663_100003719 3300005455 Bacteria 8843
213 Ga0070663_100064129 3300005455 Bacteria 2655
214 Ga0070663_100074899 3300005455 Bacteria 2472
215 Ga0070663_100135555 3300005455 Bacteria 1874
216 Ga0070678_100000941 3300005456 Bacteria 14965
217 Ga0070678_100295503 3300005456 Bacteria 1375
218 Ga0070678_100404392 3300005456 Bacteria 1187
219 Ga0070678_100489479 3300005456 Bacteria 1083
220 Ga0070678_100611614 3300005456 Bacteria 974
221 Ga0070678_100808854 3300005456 Bacteria 851
222 Ga0070662_100001965 3300005457 Bacteria 12626
223 Ga0070662_100074655 3300005457 Bacteria 2509
224 Ga0070662_100397392 3300005457 Bacteria 1137
225 Ga0070662_100462487 3300005457 Bacteria 1054
226 Ga0070681_10056763 3300005458 Bacteria 3896
227 Ga0068867_100005611 3300005459 Bacteria 8890
228 Ga0068867_100195236 3300005459 Bacteria 1617
229 Ga0068867_100233785 3300005459 Bacteria 1487
230 Ga0068867_100243698 3300005459 Bacteria 1459
231 Ga0068867_100309068 3300005459 Unclassified 1306
232 Ga0068867_100898180 3300005459 Bacteria 797
233 Ga0068867_100904289 3300005459 Bacteria 794
234 Ga0070706_100205588 3300005467 Bacteria 1839
235 Ga0070707_100035738 3300005468 Bacteria 4741
236 Ga0070679_100003825 3300005530 Bacteria 13821
237 Ga0070684_100019501 3300005535 Bacteria 5611
238 Ga0070684_100041554 3300005535 Bacteria 3965
239 Ga0070684_100057631 3300005535 Bacteria 3392
240 Ga0068853_100017836 3300005539 Bacteria 5863
241 Ga0068853_100023496 3300005539 Bacteria 5161
242 Ga0068853_100110330 3300005539 Bacteria 2443
243 Ga0068853_100173117 3300005539 Bacteria 1954
244 Ga0068853_100202750 3300005539 Bacteria 1805
245 Ga0068853_100251426 3300005539 Bacteria 1622
246 Ga0068853_100580305 3300005539 Bacteria 1064
247 Ga0070672_100002181 3300005543 Bacteria 12354
248 Ga0070672_100021542 3300005543 Bacteria 4719
249 Ga0070672_100041547 3300005543 Bacteria 3535
250 Ga0070672_100058354 3300005543 Bacteria 3033
251 Ga0070672_100080696 3300005543 Bacteria 2606
252 Ga0070672_100383316 3300005543 Bacteria 1203
253 Ga0070672_100422823 3300005543 Bacteria 1145
254 Ga0070672_100939630 3300005543 Bacteria 765
255 Ga0070693_100037016 3300005547 Bacteria 2718
256 Ga0070693_100320706 3300005547 Bacteria 1051
257 Ga0070693_100424186 3300005547 Bacteria 927
258 Ga0070665_100008247 3300005548 Bacteria 10541
259 Ga0070665_100037012 3300005548 Bacteria 4908
260 Ga0070665_100044042 3300005548 Bacteria 4483
261 Ga0070665_100058043 3300005548 Bacteria 3880
262 Ga0070665_100069048 3300005548 Bacteria 3542
263 Ga0070665_100133333 3300005548 Bacteria 2486
264 Ga0070665_100181467 3300005548 Bacteria 2106
265 Ga0070665_100496181 3300005548 Bacteria 1232
266 Ga0070665_101445313 3300005548 Bacteria 696
267 Ga0068855_100066535 3300005563 Bacteria 4201
268 Ga0068855_100138616 3300005563 Bacteria 2774
269 Ga0068855_100215864 3300005563 Bacteria 2153
270 Ga0068855_100285588 3300005563 Bacteria 1831
271 Ga0068855_100369898 3300005563 Bacteria 1576
272 Ga0068855_100868107 3300005563 Bacteria 955
273 Ga0068855_100868113 3300005563 Bacteria 955
274 Ga0068855_101114054 3300005563 Bacteria 825
275 Ga0070664_100011493 3300005564 Bacteria 7186
276 Ga0070664_100089333 3300005564 Bacteria 2665
277 Ga0070664_100104005 3300005564 Bacteria 2472
278 Ga0070664_100939451 3300005564 Bacteria 812
279 Ga0068857_100000535 3300005577 Bacteria 27494
280 Ga0068857_100025285 3300005577 Bacteria 5230
281 Ga0068857_100050833 3300005577 Bacteria 3676
282 Ga0068857_100059870 3300005577 Bacteria 3384
283 Ga0068857_100077462 3300005577 Bacteria 2967
284 Ga0068854_100072584 3300005578 Bacteria 2520
285 Ga0068854_100106117 3300005578 Bacteria 2113
286 Ga0068854_100107770 3300005578 Bacteria 2097
287 Ga0068854_100132320 3300005578 Bacteria 1906
288 Ga0068854_100288668 3300005578 Bacteria 1323
289 Ga0068854_100349997 3300005578 Bacteria 1209
290 Ga0068854_100986173 3300005578 Bacteria 745
291 Ga0068856_100022922 3300005614 Bacteria 6072
292 Ga0068856_100057963 3300005614 Bacteria 3824
293 Ga0068856_100076585 3300005614 Bacteria 3314
294 Ga0068856_100104259 3300005614 Bacteria 2829
295 Ga0068856_100152331 3300005614 Bacteria 2322
296 Ga0068856_100228578 3300005614 Bacteria 1876
297 Ga0068856_100228829 3300005614 Bacteria 1875
298 Ga0068856_100255630 3300005614 Bacteria 1767
299 Ga0068856_100347043 3300005614 Bacteria 1503
300 Ga0068856_100705153 3300005614 Bacteria 1029
301 Ga0068856_100791147 3300005614 Bacteria 968
302 Ga0070702_100007631 3300005615 Bacteria 5187
303 Ga0070702_100229285 3300005615 Bacteria 1247
304 Ga0068852_100013214 3300005616 Bacteria 6310
305 Ga0068852_100014330 3300005616 Bacteria 6098
306 Ga0068852_100015034 3300005616 Bacteria 5984
307 Ga0068852_100056329 3300005616 Bacteria 3397
308 Ga0068852_100070158 3300005616 Bacteria 3074
309 Ga0068852_100084266 3300005616 Bacteria 2828
310 Ga0068852_100100432 3300005616 Bacteria 2610
311 Ga0068852_100180005 3300005616 Bacteria 1987
312 Ga0068852_100268784 3300005616 Unclassified 1640
313 Ga0068852_100815977 3300005616 Bacteria 947
314 Ga0068859_100008484 3300005617 Bacteria 10396
315 Ga0068859_100020441 3300005617 Bacteria 6645
316 Ga0068859_100027077 3300005617 Bacteria 5750
317 Ga0068859_100109338 3300005617 Bacteria 2826
318 Ga0068859_100251951 3300005617 Bacteria 1856
319 Ga0068859_100423381 3300005617 Bacteria 1428
320 Ga0068859_101244512 3300005617 Bacteria 820
321 Ga0068864_100000270 3300005618 Bacteria 46170
322 Ga0068864_100003834 3300005618 Bacteria 12396
323 Ga0068864_100011737 3300005618 Bacteria 7234
324 Ga0068864_100025267 3300005618 Bacteria 5001
325 Ga0068864_100225337 3300005618 Bacteria 1731
326 Ga0068864_100420409 3300005618 Bacteria 1273
327 Ga0068866_10027919 3300005718 Bacteria 2684
328 Ga0068861_100000126 3300005719 Bacteria 39277
329 Ga0068861_100020024 3300005719 Bacteria 4785
330 Ga0068861_100024484 3300005719 Bacteria 4366
331 Ga0068851_10020460 3300005834 Bacteria 3206
332 Ga0068851_10155557 3300005834 Bacteria 1252
333 Ga0068851_10163325 3300005834 Bacteria 1225
334 Ga0068851_10373325 3300005834 Bacteria 834
335 Ga0068851_10430400 3300005834 Bacteria 781
336 Ga0068870_10013617 3300005840 Bacteria 3827
337 Ga0068863_100000679 3300005841 Bacteria 34412
338 Ga0068863_100034797 3300005841 Bacteria 4797
339 Ga0068863_100259269 3300005841 Bacteria 1680
340 Ga0068863_100397503 3300005841 Bacteria 1347
341 Ga0068863_100463579 3300005841 Bacteria 1244
342 Ga0068863_100598522 3300005841 Bacteria 1091
343 Ga0068863_100666250 3300005841 Bacteria 1033
344 Ga0068858_100000225 3300005842 Bacteria 61439
345 Ga0068858_100003892 3300005842 Bacteria 14747
346 Ga0068858_100042529 3300005842 Bacteria 4212
347 Ga0068858_100052225 3300005842 Bacteria 3781
348 Ga0068858_100095010 3300005842 Bacteria 2777
349 Ga0068858_100134936 3300005842 Bacteria 2315
350 Ga0068858_100461556 3300005842 Bacteria 1225
351 Ga0068858_100886630 3300005842 Bacteria 872
352 Ga0068860_100006887 3300005843 Bacteria 11398
353 Ga0068860_100015755 3300005843 Bacteria 7380
354 Ga0068860_100337341 3300005843 Bacteria 1482
355 Ga0068860_100524543 3300005843 Bacteria 1185
356 Ga0068862_100018535 3300005844 Bacteria 5797
357 Ga0068862_100082999 3300005844 Bacteria 2782
358 Ga0068862_100113780 3300005844 Bacteria 2378
359 Ga0068862_100437467 3300005844 Unclassified 1230
360 Ga0081538_10016898 3300005981 Bacteria 5566
361 Ga0081540_1007285 3300005983 Bacteria 7920
362 Ga0081540_1010250 3300005983 Bacteria 6364
363 Ga0070717_10422491 3300006028 Bacteria 1199
364 Ga0075365_10002167 3300006038 Bacteria 9449
365 Ga0075365_10007595 3300006038 Bacteria 6090
366 Ga0075365_10008006 3300006038 Bacteria 5966
367 Ga0075365_10010319 3300006038 Bacteria 5429
368 Ga0075365_10012364 3300006038 Bacteria 5067
369 Ga0075365_10130762 3300006038 Bacteria 1737
370 Ga0075365_10423392 3300006038 Bacteria 940
371 Ga0075365_10798963 3300006038 Bacteria 666
372 Ga0075368_10004699 3300006042 Bacteria 4645
373 Ga0075368_10267597 3300006042 Bacteria 733
374 Ga0075363_100038848 3300006048 Bacteria 2503
375 Ga0075363_100059224 3300006048 Bacteria 2059
376 Ga0075363_100096793 3300006048 Bacteria 1630
377 Ga0075363_100116507 3300006048 Bacteria 1488
378 Ga0075363_100125359 3300006048 Bacteria 1437
379 Ga0075363_100175649 3300006048 Bacteria 1217
380 Ga0075363_100264881 3300006048 Bacteria 992
381 Ga0075364_10001924 3300006051 Bacteria 11562
382 Ga0075364_10225773 3300006051 Bacteria 1271
383 Ga0075364_10294932 3300006051 Bacteria 1104
384 Ga0075364_10413934 3300006051 Bacteria 920
385 Ga0075432_10186595 3300006058 Bacteria 814
386 Ga0070715_10044099 3300006163 Bacteria 1884
387 Ga0075362_10013397 3300006177 Bacteria 3283
388 Ga0075362_10134956 3300006177 Bacteria 1176
389 Ga0075362_10296222 3300006177 Bacteria 802
390 Ga0075367_10001150 3300006178 Bacteria 11036
391 Ga0075367_10008246 3300006178 Bacteria 5388
392 Ga0075367_10018335 3300006178 Bacteria 3860
393 Ga0075367_10022064 3300006178 Bacteria 3566
394 Ga0075367_10059289 3300006178 Bacteria 2279
395 Ga0075367_10097012 3300006178 Bacteria 1798
396 Ga0075367_10144934 3300006178 Bacteria 1472
397 Ga0075367_10242020 3300006178 Bacteria 1131
398 Ga0075369_10003976 3300006186 Bacteria 5423
399 Ga0075369_10045840 3300006186 Bacteria 1881
400 Ga0075369_10054368 3300006186 Bacteria 1738
401 Ga0075369_10100652 3300006186 Bacteria 1296
402 Ga0075369_10158560 3300006186 Bacteria 1036
403 Ga0075366_10000527 3300006195 Bacteria 17745
404 Ga0075366_10050942 3300006195 Bacteria 2460
405 Ga0075366_10072032 3300006195 Bacteria 2059
406 Ga0075366_10092785 3300006195 Bacteria 1809
407 Ga0097621_100007479 3300006237 Bacteria 7817
408 Ga0097621_100018660 3300006237 Bacteria 5305
409 Ga0097621_100162654 3300006237 Bacteria 1919
410 Ga0097621_100243818 3300006237 Unclassified 1572
411 Ga0097621_100275350 3300006237 Bacteria 1480
412 Ga0097621_100286717 3300006237 Bacteria 1451
413 Ga0097621_100454211 3300006237 Bacteria 1155
414 Ga0075370_10004269 3300006353 Bacteria 6920
415 Ga0075370_10028022 3300006353 Bacteria 3129
416 Ga0075370_10064346 3300006353 Bacteria 2091
417 Ga0075370_10075341 3300006353 Bacteria 1934
418 Ga0075370_10106219 3300006353 Bacteria 1628
419 Ga0075370_10216355 3300006353 Bacteria 1132
420 Ga0068871_100078234 3300006358 Bacteria 2734
421 Ga0068871_100132455 3300006358 Bacteria 2115
422 Ga0068871_100141240 3300006358 Bacteria 2048
423 Ga0068871_100312150 3300006358 Bacteria 1382
424 Ga0075431_101186836 3300006847 Bacteria 726
425 Ga0075433_10289896 3300006852 Bacteria 1450
426 Ga0068865_100076924 3300006881 Bacteria 2383
427 Ga0068865_100178424 3300006881 Bacteria 1634
428 Ga0068865_100424004 3300006881 Bacteria 1094
429 Ga0097620_100008484 3300006931 Bacteria 10396
430 Ga0097620_100020438 3300006931 Bacteria 6645
431 Ga0097620_100027078 3300006931 Bacteria 5750
432 Ga0097620_100109345 3300006931 Bacteria 2826
433 Ga0097620_100251960 3300006931 Bacteria 1856
434 Ga0097620_100423359 3300006931 Bacteria 1428
435 Ga0097620_101244282 3300006931 Bacteria 820
436 Ga0079104_1000014 3300006946 Bacteria 337362
437 Ga0079104_1000183 3300006946 Bacteria 89496
438 Ga0105251_10000198 3300009011 Bacteria 60848
439 Ga0105244_10000037 3300009036 Bacteria 161621
440 Ga0105244_10000403 3300009036 Bacteria 40205
441 Ga0105244_10002423 3300009036 Bacteria 14083
442 Ga0105240_10000012 3300009093 Bacteria 496639
443 Ga0105240_10009833 3300009093 Bacteria 13501
444 Ga0105240_10079788 3300009093 Bacteria 4027
445 Ga0105240_10126850 3300009093 Bacteria 3065
446 Ga0105240_10141815 3300009093 Bacteria 2872
447 Ga0105240_10242127 3300009093 Bacteria 2091
448 Ga0105240_10678091 3300009093 Bacteria 1127
449 Ga0105240_10793738 3300009093 Bacteria 1026
450 Ga0111539_10022792 3300009094 Bacteria 7692
451 Ga0111539_10518546 3300009094 Bacteria 1389
452 Ga0105245_10160344 3300009098 Bacteria 2134
453 Ga0105245_10167846 3300009098 Bacteria 2088
454 Ga0105245_10532893 3300009098 Bacteria 1194
455 Ga0114129_10487396 3300009147 Bacteria 1612
456 Ga0114129_10742727 3300009147 Bacteria 1257
457 Ga0114129_11199656 3300009147 Bacteria 945
458 Ga0105243_10002671 3300009148 Bacteria 14814
459 Ga0105243_10023977 3300009148 Bacteria 4650
460 Ga0105243_10066230 3300009148 Bacteria 2905
461 Ga0105241_10269253 3300009174 Bacteria 1451
462 Ga0105242_10031513 3300009176 Bacteria 4236
463 Ga0105242_10036739 3300009176 Bacteria 3931
464 Ga0105242_10302608 3300009176 Bacteria 1460
465 Ga0105248_10006493 3300009177 Bacteria 12824
466 Ga0105248_10009628 3300009177 Bacteria 10639
467 Ga0105248_10021381 3300009177 Bacteria 7169
468 Ga0105248_10174488 3300009177 Bacteria 2423
469 Ga0105248_10208018 3300009177 Bacteria 2205
470 Ga0105248_10228802 3300009177 Bacteria 2093
471 Ga0105248_10755010 3300009177 Bacteria 1098
472 Ga0105237_10000165 3300009545 Bacteria 93713
473 Ga0105237_10058994 3300009545 Bacteria 3840
474 Ga0105237_10126562 3300009545 Bacteria 2549
475 Ga0105237_10359684 3300009545 Bacteria 1460
476 Ga0105237_10651532 3300009545 Bacteria 1060
477 Ga0105238_10007244 3300009551 Bacteria 11103
478 Ga0105238_10007894 3300009551 Bacteria 10648
479 Ga0105238_10112274 3300009551 Bacteria 2705
480 Ga0105238_10197142 3300009551 Bacteria 1989
481 Ga0105249_10032185 3300009553 Bacteria 4743
482 Ga0105249_10038924 3300009553 Bacteria 4316
483 Ga0105249_10515878 3300009553 Bacteria 1242
484 Ga0105249_10822595 3300009553 Bacteria 993
485 Ga0105249_10827093 3300009553 Bacteria 991
486 Ga0105249_11055565 3300009553 Bacteria 882
487 Ga0123340_1055299 3300009763 Bacteria 1304
488 Ga0123341_1000025 3300009765 Bacteria 71692
489 Ga0123342_1015842 3300009766 Bacteria 6728
490 Ga0105239_10000471 3300010375 Bacteria 58946
491 Ga0105239_10045062 3300010375 Bacteria 4834
492 Ga0105239_10062791 3300010375 Bacteria 4077
493 Ga0105239_10074454 3300010375 Bacteria 3733
494 Ga0105239_10078448 3300010375 Bacteria 3634
495 Ga0105239_10265712 3300010375 Bacteria 1929
496 Ga0105239_10311827 3300010375 Bacteria 1773
497 Ga0105239_10727320 3300010375 Bacteria 1135
498 Ga0105239_11028585 3300010375 Bacteria 947
499 Ga0105239_11835747 3300010375 Bacteria 703
500 Ga0105246_10691753 3300011119 Bacteria 893
501 Ga0157373_10011513 3300013100 Bacteria 6499
502 Ga0157371_10005423 3300013102 Bacteria 10765
503 Ga0157371_10051970 3300013102 Bacteria 2911
504 Ga0157370_10000343 3300013104 Bacteria 58793
505 Ga0157370_10000348 3300013104 Bacteria 58654
506 Ga0157370_10003232 3300013104 Bacteria 19242
507 Ga0157369_10000288 3300013105 Bacteria 67504
508 Ga0157369_10127996 3300013105 Bacteria 2692
509 Ga0157369_10210299 3300013105 Bacteria 2039
510 Ga0157369_10227997 3300013105 Bacteria 1948
511 Ga0171463_1013 3300013249 Bacteria 94945
512 Ga0157374_10019897 3300013296 Bacteria 5949
513 Ga0157374_10177479 3300013296 Bacteria 2079
514 Ga0157374_10292302 3300013296 Bacteria 1611
515 Ga0157378_10003823 3300013297 Bacteria 13318
516 Ga0157378_10061027 3300013297 Bacteria 3364
517 Ga0157378_10175059 3300013297 Bacteria 2015
518 Ga0157378_10212366 3300013297 Bacteria 1836
519 Ga0157378_10299170 3300013297 Bacteria 1557
520 Ga0157378_10308128 3300013297 Bacteria 1535
521 Ga0157378_10951050 3300013297 Bacteria 892
522 Ga0157378_11393369 3300013297 Bacteria 744
523 Ga0163162_10010080 3300013306 Bacteria 9185
524 Ga0163162_10018986 3300013306 Bacteria 6742
525 Ga0163162_10021486 3300013306 Bacteria 6358
526 Ga0163162_10066999 3300013306 Bacteria 3640
527 Ga0163162_10140642 3300013306 Bacteria 2527
528 Ga0163162_10205453 3300013306 Bacteria 2099
529 Ga0163162_10242733 3300013306 Bacteria 1932
530 Ga0163162_10291720 3300013306 Bacteria 1763
531 Ga0163162_10678728 3300013306 Bacteria 1153
532 Ga0163162_10696673 3300013306 Bacteria 1138
533 Ga0157372_10033146 3300013307 Bacteria 5671
534 Ga0157372_10231102 3300013307 Bacteria 2144
535 Ga0157375_10097833 3300013308 Bacteria 3010
536 Ga0157375_10285270 3300013308 Bacteria 1814
537 Ga0157375_10291660 3300013308 Bacteria 1794
538 Ga0157375_10430766 3300013308 Bacteria 1485
539 Ga0157375_10559788 3300013308 Bacteria 1304
540 Ga0157375_11024923 3300013308 Bacteria 964
541 Ga0163163_10423430 3300014325 Bacteria 1390
542 Ga0163163_10616047 3300014325 Bacteria 1149
543 Ga0163163_10746476 3300014325 Bacteria 1042
544 Ga0163163_10780138 3300014325 Bacteria 1019
545 Ga0157380_10021253 3300014326 Bacteria 4865
546 Ga0157380_10038632 3300014326 Bacteria 3707
547 Ga0157380_10053461 3300014326 Bacteria 3202
548 Ga0157380_10517566 3300014326 Bacteria 1163
549 Ga0157380_10790695 3300014326 Bacteria 965
550 Ga0157380_10821704 3300014326 Bacteria 948
551 Ga0157380_11256544 3300014326 Bacteria 786
552 Ga0182008_10055693 3300014497 Bacteria 1955
553 Ga0157377_10000013 3300014745 Bacteria 267125
554 Ga0157377_10001137 3300014745 Bacteria 11282
555 Ga0157377_10037573 3300014745 Bacteria 2669
556 Ga0157377_10355129 3300014745 Bacteria 985
557 Ga0157379_10002398 3300014968 Bacteria 15656
558 Ga0157379_10005033 3300014968 Bacteria 11338
559 Ga0157379_10011386 3300014968 Bacteria 7759
560 Ga0157379_10014287 3300014968 Bacteria 6965
561 Ga0157379_10038589 3300014968 Bacteria 4261
562 Ga0157379_10043827 3300014968 Bacteria 3995
563 Ga0157379_10062000 3300014968 Bacteria 3345
564 Ga0157376_10034022 3300014969 Bacteria 4110
565 Ga0157376_10076384 3300014969 Bacteria 2862
566 Ga0157376_10084787 3300014969 Bacteria 2729
567 Ga0157376_10240412 3300014969 Bacteria 1687
568 Ga0182006_1039762 3300015261 Bacteria 1854
569 Ga0182006_1059859 3300015261 Bacteria 1440
570 Ga0182007_10000763 3300015262 Bacteria 18048
571 Ga0182005_1005468 3300015265 Bacteria 3965
572 Ga0183363_1409 3300015690 Bacteria 3562
573 Ga0163161_10048831 3300017792 Bacteria 3057
574 Ga0163161_10077140 3300017792 Bacteria 2447
575 Ga0163161_10082554 3300017792 Bacteria 2368
576 Ga0163161_10091622 3300017792 Bacteria 2250
577 Ga0163161_10107034 3300017792 Bacteria 2087
578 Ga0163161_10159485 3300017792 Bacteria 1720
579 Ga0163161_10535122 3300017792 Bacteria 958
580 Ga0163161_10536561 3300017792 Unclassified 957
581 Ga0214544_1000130 3300021320 Bacteria 108844
582 Ga0214542_1000014 3300021321 Bacteria 233825
583 Ga0214543_1000146 3300021327 Bacteria 98609
584 Ga0209435_100025 3300025206 Bacteria 198776
585 Ga0209436_100044 3300025208 Bacteria 70547
586 Ga0209436_100162 3300025208 Bacteria 32237
587 Ga0209436_107779 3300025208 Bacteria 2201
588 Ga0209674_100003 3300025226 Bacteria 2196646
589 Ga0209672_113575 3300025228 Bacteria 972
590 Ga0209563_100192 3300025230 Bacteria 33961
591 Ga0207427_100663 3300025231 Bacteria 16489
592 Ga0209437_100022 3300025233 Bacteria 625694
593 Ga0209437_100040 3300025233 Bacteria 448096
594 Ga0209258_100291 3300025242 Bacteria 82373
595 Ga0207425_1000054 3300025245 Bacteria 153997
596 Ga0207425_1000563 3300025245 Bacteria 21840
597 Ga0209646_1000083 3300025246 Bacteria 198777
598 Ga0209646_1000127 3300025246 Bacteria 131920
599 Ga0209026_1000004 3300025250 Bacteria 949012
600 Ga0209026_1000025 3300025250 Bacteria 352548
601 Ga0209026_1000078 3300025250 Bacteria 198777
602 Ga0209026_1012212 3300025250 Bacteria 1508
603 Ga0209677_100085 3300025253 Bacteria 116046
604 Ga0209677_100107 3300025253 Bacteria 89035
605 Ga0209677_100515 3300025253 Bacteria 21525
606 Ga0209677_108945 3300025253 Bacteria 1862
607 Ga0209148_1000057 3300025254 Bacteria 360463
608 Ga0209759_1000060 3300025256 Bacteria 198777
609 Ga0209759_1000129 3300025256 Bacteria 131961
610 Ga0209759_1000197 3300025256 Bacteria 95422
611 Ga0209759_1003974 3300025256 Bacteria 5673
612 Ga0209759_1010790 3300025256 Bacteria 2649
613 Ga0209129_1000016 3300025258 Bacteria 485491
614 Ga0209129_1000108 3300025258 Bacteria 153997
615 Ga0209129_1001297 3300025258 Bacteria 14260
616 Ga0209129_1004815 3300025258 Bacteria 5088
617 Ga0209129_1006772 3300025258 Bacteria 3603
618 Ga0209129_1006906 3300025258 Bacteria 3525
619 Ga0209129_1007558 3300025258 Bacteria 3206
620 Ga0209129_1038819 3300025258 Bacteria 761
621 Ga0209233_1000010 3300025261 Bacteria 1194329
622 Ga0209233_1000031 3300025261 Bacteria 624646
623 Ga0209233_1000051 3300025261 Bacteria 447617
624 Ga0209233_1000346 3300025261 Bacteria 44177
625 Ga0209233_1006948 3300025261 Bacteria 3618
626 Ga0209565_1058203 3300025263 Bacteria 676
627 Ga0207666_1007136 3300025271 Bacteria 1464
628 Ga0209455_1000208 3300025272 Bacteria 83420
629 Ga0209455_1000224 3300025272 Bacteria 77325
630 Ga0209455_1015739 3300025272 Bacteria 1649
631 Ga0209673_1000005 3300025273 Bacteria 692788
632 Ga0209673_1000023 3300025273 Bacteria 411385
633 Ga0209673_1000212 3300025273 Bacteria 116031
634 Ga0209673_1000738 3300025273 Bacteria 45021
635 Ga0209673_1001452 3300025273 Bacteria 22431
636 Ga0209673_1029612 3300025273 Bacteria 1740
637 Ga0209673_1053764 3300025273 Bacteria 1047
638 Ga0209673_1080594 3300025273 Bacteria 747
639 Ga0209130_1000001 3300025284 Bacteria 831557
640 Ga0209130_1000010 3300025284 Bacteria 444920
641 Ga0209130_1000013 3300025284 Bacteria 412810
642 Ga0209130_1019868 3300025284 Bacteria 1548
643 Ga0207673_1000918 3300025290 Bacteria 3174
644 Ga0209675_1043675 3300025291 Bacteria 963
645 Ga0209676_1005657 3300025292 Bacteria 6436
646 Ga0209025_1000189 3300025294 Bacteria 153997
647 Ga0209025_1000300 3300025294 Bacteria 110956
648 Ga0209025_1002184 3300025294 Bacteria 21713
649 Ga0209025_1002603 3300025294 Bacteria 18593
650 Ga0209025_1004543 3300025294 Bacteria 11960
651 Ga0209025_1056157 3300025294 Bacteria 1516
652 Ga0209025_1067969 3300025294 Bacteria 1284
653 Ga0209564_1000025 3300025295 Bacteria 520535
654 Ga0209564_1000112 3300025295 Bacteria 211939
655 Ga0209564_1001278 3300025295 Bacteria 27680
656 Ga0209564_1001823 3300025295 Bacteria 19549
657 Ga0209564_1007604 3300025295 Bacteria 5559
658 Ga0209564_1011616 3300025295 Bacteria 3926
659 Ga0209564_1026842 3300025295 Bacteria 1889
660 Ga0209564_1029039 3300025295 Bacteria 1750
661 Ga0209758_1000053 3300025297 Bacteria 337751
662 Ga0209758_1000162 3300025297 Bacteria 153997
663 Ga0209758_1001361 3300025297 Bacteria 29297
664 Ga0209758_1001669 3300025297 Bacteria 25096
665 Ga0209758_1001814 3300025297 Bacteria 23603
666 Ga0209758_1006808 3300025297 Bacteria 8018
667 Ga0209758_1011938 3300025297 Bacteria 4941
668 Ga0209758_1016362 3300025297 Bacteria 3773
669 Ga0209758_1031255 3300025297 Bacteria 2188
670 Ga0209758_1054398 3300025297 Bacteria 1368
671 Ga0209050_1012499 3300025298 Bacteria 3885
672 Ga0209050_1021630 3300025298 Bacteria 2338
673 Ga0209256_1000682 3300025299 Bacteria 45685
674 Ga0209256_1000828 3300025299 Bacteria 39174
675 Ga0209256_1001472 3300025299 Bacteria 24098
676 Ga0209256_1005449 3300025299 Bacteria 7325
677 Ga0209256_1006490 3300025299 Bacteria 6158
678 Ga0209256_1018918 3300025299 Bacteria 2215
679 Ga0209256_1024559 3300025299 Bacteria 1772
680 Ga0209256_1035268 3300025299 Bacteria 1323
681 Ga0209256_1044948 3300025299 Bacteria 1100
682 Ga0209256_1059372 3300025299 Bacteria 896
683 Ga0209256_1061702 3300025299 Bacteria 871
684 Ga0207426_1000005 3300025302 Bacteria 1037188
685 Ga0207426_1000022 3300025302 Bacteria 547377
686 Ga0207426_1000035 3300025302 Bacteria 448327
687 Ga0207426_1000036 3300025302 Bacteria 444920
688 Ga0207426_1002507 3300025302 Bacteria 11560
689 Ga0209051_1000249 3300025303 Bacteria 90988
690 Ga0209051_1000354 3300025303 Bacteria 68119
691 Ga0209051_1003488 3300025303 Bacteria 10288
692 Ga0209051_1007471 3300025303 Bacteria 5965
693 Ga0209051_1012393 3300025303 Bacteria 4127
694 Ga0209051_1015051 3300025303 Bacteria 3578
695 Ga0209051_1015466 3300025303 Bacteria 3507
696 Ga0209051_1016212 3300025303 Bacteria 3386
697 Ga0209051_1018238 3300025303 Bacteria 3110
698 Ga0209257_1015285 3300025304 Bacteria 3211
699 Ga0209257_1019467 3300025304 Bacteria 2555
700 Ga0209257_1032100 3300025304 Bacteria 1670
701 Ga0209257_1033816 3300025304 Bacteria 1602
702 Ga0207697_10002645 3300025315 Bacteria 9173
703 Ga0207697_10005514 3300025315 Bacteria 5869
704 Ga0207697_10024046 3300025315 Bacteria 2495
705 Ga0207656_10006336 3300025321 Bacteria 4244
706 Ga0207656_10006584 3300025321 Bacteria 4188
707 Ga0207656_10069172 3300025321 Bacteria 1566
708 Ga0207656_10103144 3300025321 Bacteria 1310
709 Ga0207656_10161076 3300025321 Bacteria 1068
710 Ga0207655_1000117 3300025728 Bacteria 161655
711 Ga0207713_1020865 3300025735 Bacteria 3157
712 Ga0207682_10003790 3300025893 Bacteria 6491
713 Ga0207682_10016767 3300025893 Bacteria 2859
714 Ga0207682_10026959 3300025893 Bacteria 2286
715 Ga0207642_10036079 3300025899 Bacteria 2118
716 Ga0207642_10194466 3300025899 Bacteria 1116
717 Ga0207642_10248448 3300025899 Bacteria 1008
718 Ga0207688_10001682 3300025901 Bacteria 11710
719 Ga0207688_10030555 3300025901 Bacteria 2971
720 Ga0207688_10119420 3300025901 Bacteria 1537
721 Ga0207680_10000416 3300025903 Bacteria 20261
722 Ga0207680_10025108 3300025903 Bacteria 3283
723 Ga0207680_10245688 3300025903 Bacteria 1235
724 Ga0207647_10004710 3300025904 Bacteria 10101
725 Ga0207647_10041929 3300025904 Bacteria 2874
726 Ga0207647_10078474 3300025904 Bacteria 1983
727 Ga0207645_10001481 3300025907 Bacteria 19198
728 Ga0207645_10014278 3300025907 Bacteria 5319
729 Ga0207645_10015476 3300025907 Bacteria 5065
730 Ga0207645_10022550 3300025907 Bacteria 4095
731 Ga0207645_10030541 3300025907 Bacteria 3472
732 Ga0207643_10002283 3300025908 Bacteria 10438
733 Ga0207705_10000625 3300025909 Bacteria 29536
734 Ga0207705_10048791 3300025909 Bacteria 3047
735 Ga0207705_10051510 3300025909 Bacteria 2963
736 Ga0207705_10112090 3300025909 Bacteria 2016
737 Ga0207705_10141660 3300025909 Bacteria 1796
738 Ga0207705_10198955 3300025909 Bacteria 1518
739 Ga0207684_10002597 3300025910 Bacteria 18082
740 Ga0207654_10159710 3300025911 Bacteria 1455
741 Ga0207695_10000120 3300025913 Bacteria 234247
742 Ga0207695_10022029 3300025913 Bacteria 7250
743 Ga0207695_10063883 3300025913 Bacteria 3793
744 Ga0207695_10101432 3300025913 Bacteria 2872
745 Ga0207671_10005869 3300025914 Bacteria 11152
746 Ga0207671_10006498 3300025914 Bacteria 10400
747 Ga0207671_10058639 3300025914 Bacteria 2854
748 Ga0207671_10074921 3300025914 Bacteria 2530
749 Ga0207671_10188081 3300025914 Bacteria 1609
750 Ga0207671_10485790 3300025914 Bacteria 984
751 Ga0207693_10045045 3300025915 Bacteria 3467
752 Ga0207662_10001442 3300025918 Bacteria 11539
753 Ga0207662_10029230 3300025918 Bacteria 3192
754 Ga0207662_10034420 3300025918 Bacteria 2957
755 Ga0207657_10032593 3300025919 Bacteria 4705
756 Ga0207657_10068924 3300025919 Bacteria 3004
757 Ga0207657_10076636 3300025919 Bacteria 2820
758 Ga0207657_10091021 3300025919 Bacteria 2545
759 Ga0207657_10179246 3300025919 Bacteria 1713
760 Ga0207657_10405447 3300025919 Bacteria 1072
761 Ga0207657_10727149 3300025919 Bacteria 770
762 Ga0207649_10009516 3300025920 Bacteria 5319
763 Ga0207649_10036887 3300025920 Bacteria 2948
764 Ga0207652_10015677 3300025921 Bacteria 6171
765 Ga0207681_10000826 3300025923 Bacteria 20436
766 Ga0207681_10018269 3300025923 Bacteria 4416
767 Ga0207681_10049567 3300025923 Bacteria 2839
768 Ga0207681_10283321 3300025923 Bacteria 1305
769 Ga0207681_10393913 3300025923 Bacteria 1117
770 Ga0207694_10003375 3300025924 Bacteria 12715
771 Ga0207694_10215673 3300025924 Bacteria 1564
772 Ga0207694_10393672 3300025924 Bacteria 1151
773 Ga0207650_10002771 3300025925 Bacteria 12104
774 Ga0207650_10044510 3300025925 Bacteria 3263
775 Ga0207650_10095034 3300025925 Bacteria 2284
776 Ga0207650_10108359 3300025925 Bacteria 2147
777 Ga0207650_10165870 3300025925 Bacteria 1753
778 Ga0207650_10296131 3300025925 Bacteria 1320
779 Ga0207659_10001869 3300025926 Bacteria 12468
780 Ga0207659_10002398 3300025926 Bacteria 11149
781 Ga0207659_10011351 3300025926 Bacteria 5625
782 Ga0207659_10169198 3300025926 Bacteria 1723
783 Ga0207687_10036867 3300025927 Bacteria 3333
784 Ga0207687_10141822 3300025927 Bacteria 1823
785 Ga0207687_10332870 3300025927 Bacteria 1232
786 Ga0207687_10598211 3300025927 Bacteria 929
787 Ga0207700_10000052 3300025928 Bacteria 76498
788 Ga0207644_10000223 3300025931 Bacteria 39200
789 Ga0207644_10000543 3300025931 Bacteria 24519
790 Ga0207644_10003185 3300025931 Bacteria 10567
791 Ga0207644_10008458 3300025931 Bacteria 6736
792 Ga0207644_10019053 3300025931 Bacteria 4651
793 Ga0207690_10018974 3300025932 Bacteria 4223
794 Ga0207690_10025602 3300025932 Bacteria 3707
795 Ga0207690_10126134 3300025932 Bacteria 1867
796 Ga0207690_10217509 3300025932 Bacteria 1460
797 Ga0207690_10431819 3300025932 Bacteria 1056
798 Ga0207706_10000736 3300025933 Bacteria 34115
799 Ga0207706_10003460 3300025933 Bacteria 15072
800 Ga0207706_10130237 3300025933 Bacteria 2213
801 Ga0207706_10487205 3300025933 Bacteria 1065
802 Ga0207686_10169686 3300025934 Bacteria 1537
803 Ga0207709_10005372 3300025935 Bacteria 7286
804 Ga0207709_10006706 3300025935 Bacteria 6452
805 Ga0207670_10214048 3300025936 Bacteria 1471
806 Ga0207669_10002740 3300025937 Bacteria 7551
807 Ga0207669_10016706 3300025937 Bacteria 3738
808 Ga0207669_10100124 3300025937 Bacteria 1913
809 Ga0207669_10106274 3300025937 Bacteria 1869
810 Ga0207669_10178965 3300025937 Bacteria 1518
811 Ga0207669_10558916 3300025937 Bacteria 924
812 Ga0207704_10002371 3300025938 Bacteria 8463
813 Ga0207704_10020597 3300025938 Bacteria 3493
814 Ga0207704_10022772 3300025938 Bacteria 3363
815 Ga0207704_10095530 3300025938 Bacteria 1965
816 Ga0207704_10133173 3300025938 Bacteria 1725
817 Ga0207704_10281057 3300025938 Bacteria 1265
818 Ga0207704_10419024 3300025938 Bacteria 1061
819 Ga0207704_10467395 3300025938 Bacteria 1010
820 Ga0207691_10004886 3300025940 Bacteria 12955
821 Ga0207691_10018207 3300025940 Bacteria 6653
822 Ga0207691_10021499 3300025940 Bacteria 6092
823 Ga0207691_10053661 3300025940 Bacteria 3679
824 Ga0207691_10074883 3300025940 Bacteria 3053
825 Ga0207691_10089902 3300025940 Bacteria 2753
826 Ga0207691_10103580 3300025940 Bacteria 2537
827 Ga0207691_10151848 3300025940 Unclassified 2036
828 Ga0207691_10164989 3300025940 Bacteria 1941
829 Ga0207711_10002545 3300025941 Bacteria 16235
830 Ga0207711_10007597 3300025941 Bacteria 9068
831 Ga0207711_10034440 3300025941 Bacteria 4289
832 Ga0207711_10047277 3300025941 Bacteria 3678
833 Ga0207711_10056557 3300025941 Bacteria 3371
834 Ga0207711_10473011 3300025941 Bacteria 1167
835 Ga0207711_10534347 3300025941 Bacteria 1094
836 Ga0207711_10590015 3300025941 Bacteria 1037
837 Ga0207689_10000259 3300025942 Bacteria 47474
838 Ga0207689_10001323 3300025942 Bacteria 23878
839 Ga0207689_10019394 3300025942 Bacteria 5732
840 Ga0207689_10025240 3300025942 Bacteria 4981
841 Ga0207661_10033466 3300025944 Bacteria 3989
842 Ga0207661_10571633 3300025944 Bacteria 1036
843 Ga0207679_10004670 3300025945 Bacteria 8534
844 Ga0207679_10013547 3300025945 Bacteria 5344
845 Ga0207679_10859123 3300025945 Bacteria 829
846 Ga0207667_10029470 3300025949 Bacteria 5952
847 Ga0207667_10035301 3300025949 Bacteria 5364
848 Ga0207667_10035853 3300025949 Bacteria 5321
849 Ga0207667_10055665 3300025949 Bacteria 4158
850 Ga0207667_10634863 3300025949 Bacteria 1075
851 Ga0207667_11206426 3300025949 Bacteria 736
852 Ga0207651_10001900 3300025960 Bacteria 9800
853 Ga0207651_10007058 3300025960 Bacteria 5958
854 Ga0207651_10033406 3300025960 Bacteria 3318
855 Ga0207651_10072585 3300025960 Bacteria 2444
856 Ga0207651_10110633 3300025960 Bacteria 2061
857 Ga0207651_10259272 3300025960 Bacteria 1426
858 Ga0207712_10050088 3300025961 Bacteria 2915
859 Ga0207712_10371102 3300025961 Bacteria 1195
860 Ga0207712_10541641 3300025961 Bacteria 1000
861 Ga0207712_10973330 3300025961 Bacteria 752
862 Ga0207668_10012347 3300025972 Bacteria 5226
863 Ga0207668_10035224 3300025972 Bacteria 3330
864 Ga0207668_10290848 3300025972 Bacteria 1344
865 Ga0207640_10036401 3300025981 Bacteria 3089
866 Ga0207640_10066295 3300025981 Bacteria 2412
867 Ga0207640_10072693 3300025981 Bacteria 2321
868 Ga0207640_10335157 3300025981 Bacteria 1210
869 Ga0207640_10365045 3300025981 Bacteria 1165
870 Ga0207640_10703352 3300025981 Bacteria 867
871 Ga0207640_10820422 3300025981 Bacteria 807
872 Ga0207658_10002825 3300025986 Bacteria 12451
873 Ga0207658_10005463 3300025986 Bacteria 8720
874 Ga0207658_10023760 3300025986 Bacteria 4282
875 Ga0207658_10036559 3300025986 Bacteria 3521
876 Ga0207658_10052457 3300025986 Bacteria 3010
877 Ga0207658_10086237 3300025986 Bacteria 2421
878 Ga0207658_10148591 3300025986 Bacteria 1906
879 Ga0207658_10201013 3300025986 Bacteria 1664
880 Ga0207658_10364065 3300025986 Bacteria 1262
881 Ga0207658_10473957 3300025986 Bacteria 1111
882 Ga0207658_11007142 3300025986 Bacteria 760
883 Ga0207677_10001436 3300026023 Bacteria 12666
884 Ga0207677_10011722 3300026023 Bacteria 5008
885 Ga0207677_10015290 3300026023 Bacteria 4509
886 Ga0207677_10068294 3300026023 Bacteria 2494
887 Ga0207677_10174490 3300026023 Bacteria 1685
888 Ga0207677_10433647 3300026023 Bacteria 1122
889 Ga0207677_10539610 3300026023 Bacteria 1015
890 Ga0207703_10000408 3300026035 Bacteria 45772
891 Ga0207703_10000504 3300026035 Bacteria 40430
892 Ga0207703_10007335 3300026035 Bacteria 8764
893 Ga0207703_10065549 3300026035 Bacteria 2985
894 Ga0207703_10116560 3300026035 Bacteria 2287
895 Ga0207703_10258828 3300026035 Bacteria 1572
896 Ga0207703_10465906 3300026035 Bacteria 1182
897 Ga0207639_10010731 3300026041 Bacteria 6346
898 Ga0207639_10083505 3300026041 Bacteria 2535
899 Ga0207639_10231071 3300026041 Bacteria 1603
900 Ga0207678_10003576 3300026067 Bacteria 13974
901 Ga0207678_10123964 3300026067 Bacteria 2205
902 Ga0207678_10236582 3300026067 Bacteria 1564
903 Ga0207708_10000558 3300026075 Bacteria 28801
904 Ga0207708_10046044 3300026075 Bacteria 3323
905 Ga0207708_10252510 3300026075 Bacteria 1421
906 Ga0207702_10011425 3300026078 Bacteria 7401
907 Ga0207702_10055620 3300026078 Bacteria 3356
908 Ga0207702_10074159 3300026078 Bacteria 2936
909 Ga0207702_10176078 3300026078 Bacteria 1966
910 Ga0207702_10203762 3300026078 Bacteria 1835
911 Ga0207702_10209102 3300026078 Bacteria 1813
912 Ga0207702_10568939 3300026078 Bacteria 1110
913 Ga0207702_10750935 3300026078 Bacteria 963
914 Ga0207641_10002065 3300026088 Bacteria 19074
915 Ga0207641_10004421 3300026088 Bacteria 12179
916 Ga0207641_10178863 3300026088 Bacteria 1941
917 Ga0207641_10345476 3300026088 Bacteria 1417
918 Ga0207641_10754848 3300026088 Bacteria 960
919 Ga0207648_10000006 3300026089 Bacteria 223855
920 Ga0207648_10010711 3300026089 Bacteria 8665
921 Ga0207648_10053834 3300026089 Bacteria 3516
922 Ga0207648_10127708 3300026089 Bacteria 2237
923 Ga0207648_10264293 3300026089 Bacteria 1536
924 Ga0207648_10269565 3300026089 Bacteria 1521
925 Ga0207648_10277978 3300026089 Unclassified 1497
926 Ga0207648_10329262 3300026089 Bacteria 1374
927 Ga0207676_10000269 3300026095 Bacteria 45280
928 Ga0207676_10018994 3300026095 Bacteria 5007
929 Ga0207676_10022527 3300026095 Bacteria 4633
930 Ga0207676_10022675 3300026095 Bacteria 4619
931 Ga0207676_10082855 3300026095 Bacteria 2610
932 Ga0207674_10002376 3300026116 Bacteria 23789
933 Ga0207674_10026017 3300026116 Bacteria 6227
934 Ga0207674_10031643 3300026116 Bacteria 5555
935 Ga0207674_10074635 3300026116 Bacteria 3402
936 Ga0207674_10214850 3300026116 Bacteria 1872
937 Ga0207675_100000307 3300026118 Bacteria 46857
938 Ga0207675_100002315 3300026118 Bacteria 18913
939 Ga0207675_100002610 3300026118 Bacteria 17839
940 Ga0207675_100033253 3300026118 Bacteria 4805
941 Ga0207675_100033725 3300026118 Bacteria 4770
942 Ga0207675_100034412 3300026118 Bacteria 4724
943 Ga0207675_100061406 3300026118 Bacteria 3508
944 Ga0207675_100192930 3300026118 Bacteria 1954
945 Ga0207683_10001051 3300026121 Bacteria 25171
946 Ga0207683_10009047 3300026121 Bacteria 8487
947 Ga0207683_10011779 3300026121 Bacteria 7463
948 Ga0207683_10140183 3300026121 Bacteria 2178
949 Ga0207683_10221055 3300026121 Bacteria 1726
950 Ga0207683_10333903 3300026121 Bacteria 1389
951 Ga0207683_10346718 3300026121 Bacteria 1362
952 Ga0207683_10362558 3300026121 Bacteria 1331
953 Ga0207683_10409034 3300026121 Bacteria 1249
954 Ga0207683_10604826 3300026121 Bacteria 1015
955 Ga0207698_10004189 3300026142 Bacteria 8776
956 Ga0207698_10012346 3300026142 Bacteria 5586
957 Ga0207698_10025234 3300026142 Bacteria 4184
958 Ga0207698_10101682 3300026142 Bacteria 2384
959 Ga0207698_10144575 3300026142 Bacteria 2054
960 Ga0207698_10225286 3300026142 Bacteria 1698
961 Ga0207698_10419167 3300026142 Bacteria 1284
962 Ga0209281_1000032 3300027111 Bacteria 401727
963 Ga0209281_1001369 3300027111 Bacteria 15026
964 Ga0209371_1004078 3300027312 Bacteria 6583
965 Ga0209968_1013722 3300027526 Bacteria 1273
966 Ga0210002_1007602 3300027617 Bacteria 1645
967 Ga0209998_10008846 3300027717 Bacteria 2085
968 Ga0209813_10023660 3300027866 Bacteria 1748
969 Ga0209813_10043387 3300027866 Bacteria 1378
970 Ga0209813_10059974 3300027866 Bacteria 1212
971 Ga0209813_10190147 3300027866 Bacteria 755
972 Ga0209974_10000445 3300027876 Bacteria 13695
973 Ga0207428_10626383 3300027907 Bacteria 773
974 Ga0268266_10029943 3300028379 Bacteria 4626
975 Ga0268266_10082233 3300028379 Bacteria 2809
976 Ga0268266_10131420 3300028379 Bacteria 2239
977 Ga0268266_10153701 3300028379 Bacteria 2077
978 Ga0268266_10163214 3300028379 Bacteria 2017
979 Ga0268266_10299975 3300028379 Bacteria 1498
980 Ga0268266_10489607 3300028379 Bacteria 1173
981 Ga0268266_10506409 3300028379 Bacteria 1153
982 Ga0268266_11051058 3300028379 Bacteria 788
983 Ga0268265_10040778 3300028380 Bacteria 3430
984 Ga0268265_10114171 3300028380 Bacteria 2211
985 Ga0268265_10514039 3300028380 Bacteria 1131
986 Ga0268264_10020371 3300028381 Bacteria 5420
987 Ga0268264_10029957 3300028381 Bacteria 4462
988 Ga0268264_10039273 3300028381 Bacteria 3910
989 Ga0268264_10121640 3300028381 Bacteria 2301
990 Ga0268264_10133185 3300028381 Bacteria 2207
991 Ga0268264_10167671 3300028381 Bacteria 1984
992 Ga0307515_10000375 3300028794 Bacteria 109285
993 Ga0307515_10005525 3300028794 Bacteria 25589
994 Ga0307515_10013701 3300028794 Bacteria 15109
995 Ga0268256_1002543 3300030500 Bacteria 9162
996 Ga0307511_10131150 3300030521 Bacteria 1509
997 Ga0265329_10099663 3300031242 Bacteria 924
998 Ga0265340_10044760 3300031247 Bacteria 2165
999 Ga0265339_10073917 3300031249 Bacteria 1812
1000 Ga0265331_10094631 3300031250 Bacteria 1379
1001 Ga0265316_10084030 3300031344 Bacteria 2438
1002 Ga0307513_10002502 3300031456 Bacteria 25439
1003 Ga0307513_10018285 3300031456 Bacteria 8379
1004 Ga0307513_10243339 3300031456 Bacteria 1602
1005 Ga0307513_10551724 3300031456 Bacteria 865
1006 Ga0307509_10001328 3300031507 Bacteria 41879
1007 Ga0307509_10033331 3300031507 Bacteria 5670
1008 Ga0307408_100027204 3300031548 Bacteria 3939
1009 Ga0307408_100207039 3300031548 Bacteria 1592
1010 Ga0307408_100272653 3300031548 Bacteria 1405
1011 Ga0307408_100404427 3300031548 Bacteria 1173
1012 Ga0265313_10026994 3300031595 Bacteria 3013
1013 Ga0307508_10077400 3300031616 Bacteria 2905
1014 Ga0265314_10012378 3300031711 Bacteria 6965
1015 Ga0265342_10070611 3300031712 Bacteria 2037
1016 Ga0307516_10000662 3300031730 Bacteria 46543
1017 Ga0307516_10007532 3300031730 Bacteria 12496
1018 Ga0307405_10059257 3300031731 Bacteria 2412
1019 Ga0307413_10001878 3300031824 Bacteria 8299
1020 Ga0307406_10023234 3300031901 Bacteria 3686
1021 Ga0307406_10061831 3300031901 Bacteria 2420
1022 Ga0307406_10285536 3300031901 Bacteria 1261
1023 Ga0307406_11007418 3300031901 Bacteria 715
1024 Ga0307412_10001094 3300031911 Bacteria 15530
1025 Ga0307412_10394783 3300031911 Bacteria 1124
1026 Ga0307409_100002844 3300031995 Bacteria 9155
1027 Ga0307409_100041713 3300031995 Bacteria 3430
1028 Ga0307416_100001574 3300032002 Bacteria 12514
1029 Ga0307416_100002602 3300032002 Bacteria 10424
1030 Ga0307416_100057914 3300032002 Bacteria 3138
1031 Ga0307416_100334684 3300032002 Bacteria 1523
1032 Ga0307414_10091577 3300032004 Bacteria 2260
1033 Ga0307414_10097273 3300032004 Bacteria 2205
1034 Ga0307414_10114978 3300032004 Bacteria 2057
1035 Ga0307414_10200850 3300032004 Bacteria 1621
1036 Ga0307414_10218193 3300032004 Bacteria 1564
1037 Ga0307414_10278232 3300032004 Bacteria 1405
1038 Ga0307414_10659293 3300032004 Bacteria 944
1039 Ga0307414_10858263 3300032004 Bacteria 830
1040 Ga0307411_10056023 3300032005 Bacteria 2596
1041 Ga0307411_10142911 3300032005 Bacteria 1767
1042 Ga0307411_10460559 3300032005 Bacteria 1066
1043 Ga0307411_10527103 3300032005 Bacteria 1004
1044 Ga0307415_100007051 3300032126 Bacteria 6113
1045 Ga0307510_10187942 3300033180 Bacteria 1618
1046 Ga0373959_0006169 3300034820 Bacteria 1983
1047 Ga0373940_0021250 3300035088 Bacteria 1657
1048 Ga0373936_0044308 3300035113 Bacteria 1790
1049 Ga0373941_0053875 3300035115 Bacteria 1288
1050 Ga0373953_0065968 3300035117 Bacteria 1487
1051 Ga0373954_0047471 3300035118 Bacteria 2010
1052 Ga0373957_0024701 3300035120 Bacteria 2160
1053 Ga0373943_0017569 3300035170 Bacteria 3273
1054 Ga0373955_0084035 3300035172 Bacteria 1804
1055 Ga0316574_0459332 3300035398 Bacteria 797
1056 Ga0373924_0052712 3300035410 Bacteria 1689
1057 Ga0373931_0001075 3300035691 Bacteria 11550
1058 Ga0373931_0054830 3300035691 Bacteria 2132
1059 Ga0373927_0059272 3300035695 Bacteria 2476
1060 Ga0373927_0706812 3300035695 Bacteria 666
1061 Ga0373933_0000057 3300035724 Bacteria 66100
1062 Ga0373947_0073171 3300035725 Bacteria 2106
1063 Ga0373937_0015648 3300036401 Bacteria 6716
1064 Ga0373937_0174464 3300036401 Bacteria 2017
1065 Ga0373925_0242691 3300037068 Bacteria 1443
1066 Ga0373925_0595786 3300037068 Bacteria 910
1067 Ga0395899_0000005 3300037312 Bacteria 772966
1068 Ga0395899_0000729 3300037312 Bacteria 32868
1069 Ga0395899_0084318 3300037312 Bacteria 2310
1070 Ga0395899_0176329 3300037312 Bacteria 1503
1071 Ga0395900_0000003 3300037418 Bacteria 587648
1072 Ga0395900_0053623 3300037418 Bacteria 4150
1073 Ga0395900_0106065 3300037418 Bacteria 2886
1074 Ga0395900_0106286 3300037418 Bacteria 2883
1075 Ga0395900_0127056 3300037418 Bacteria 2615
1076 Ga0395900_0802608 3300037418 Bacteria 869
1077 Ga0395898_0000003 3300037466 Bacteria 772986
1078 Ga0395898_0000195 3300037466 Bacteria 155796
1079 Ga0395898_0044774 3300037466 Bacteria 4353
1080 Ga0395898_0248555 3300037466 Bacteria 1696
1081 Ga0395898_0432294 3300037466 Bacteria 1254
1082 Ga0395898_1053351 3300037466 Bacteria 748
1083 Ga0395905_0015787 3300037471 Bacteria 7174
1084 Ga0395905_0041614 3300037471 Bacteria 4311
1085 Ga0395905_0047229 3300037471 Bacteria 4036
1086 Ga0395905_0062649 3300037471 Bacteria 3479
1087 Ga0395905_0077524 3300037471 Bacteria 3114
1088 Ga0395905_0109842 3300037471 Bacteria 2589
1089 Ga0395905_0122201 3300037471 Bacteria 2448
1090 Ga0395905_0324699 3300037471 Bacteria 1429
1091 Ga0436364_0698594 3300037853 Bacteria 5635
1092 Ga0436364_1521153 3300037853 Bacteria 3271
1093 Ga0395901_0000012 3300038443 Bacteria 381361
1094 Ga0395901_0000038 3300038443 Bacteria 210534
1095 Ga0395901_0001277 3300038443 Bacteria 26706
1096 Ga0395901_0013219 3300038443 Bacteria 8381
1097 Ga0395901_0034009 3300038443 Bacteria 5263
1098 Ga0395901_0246976 3300038443 Bacteria 1860
1099 Ga0395901_0588452 3300038443 Bacteria 1123
1100 Ga0395901_0728011 3300038443 Bacteria 987
1101 Ga0400483_246615 3300039062 Bacteria 3000
1102 Ga0436365_1498206 3300039437 Bacteria 3774
1103 Ga0436365_1805396 3300039437 Bacteria 1419
1104 Ga0436363_0482532 3300039450 Bacteria 7189
1105 Ga0436363_0541622 3300039450 Bacteria 4653
1106 Ga0439436_0005356 3300041404 Bacteria 3936
1107 Ga0439436_0060725 3300041404 Bacteria 1059
1108 Ga0439438_028498 3300041405 Bacteria 1502
1109 Ga0439438_084326 3300041405 Bacteria 778
1110 Ga0439466_0076357 3300041411 Bacteria 1061
1111 Ga0439465_0017127 3300041413 Bacteria 2261
1112 Ga0439465_0033120 3300041413 Bacteria 1652
1113 Ga0439465_0034315 3300041413 Bacteria 1624
1114 Ga0439465_0069363 3300041413 Bacteria 1180
1115 Ga0439465_0089500 3300041413 Bacteria 1051
1116 Ga0451833_0022715 3300041491 Bacteria 1284
1117 Ga0451833_0262634 3300041491 Bacteria 661
1118 Ga0451833_1190930 3300041491 Bacteria 910
1119 Ga0451835_1112531 3300041492 Bacteria 2614
1120 Ga0451837_1671410 3300041494 Bacteria 1012
1121 Ga0451845_0221428 3300041501 Bacteria 1697
1122 Ga0451845_0821064 3300041501 Bacteria 2084
1123 Ga0451853_1015694 3300041512 Bacteria 825
1124 Ga0451853_1447831 3300041512 Bacteria 3923
1125 Ga0451853_1733039 3300041512 Bacteria 1015
1126 Ga0439432_007309 3300042006 Bacteria 3918
1127 Ga0439449_0033819 3300042007 Bacteria 1904
1128 Ga0439449_0070138 3300042007 Bacteria 1292
1129 Ga0439449_0078029 3300042007 Bacteria 1221
1130 Ga0439452_000009 3300042010 Bacteria 569493
1131 Ga0439455_0047256 3300042012 Bacteria 1117
1132 Ga0450906_003973 3300042145 Bacteria 3129
1133 Ga0450909_041573 3300042185 Bacteria 708
1134 Ga0439434_0154498 3300042435 Bacteria 761
1135 Ga0439464_0004864 3300042439 Bacteria 3445
1136 Ga0466969_0005411 3300044656 Bacteria 6794
1137 Ga0466969_0023384 3300044656 Bacteria 3185
1138 Ga0466972_0103414 3300044658 Bacteria 1347
1139 Ga0466973_0065732 3300044659 Bacteria 3256
1140 Ga0466965_0003828 3300044683 Bacteria 6643
1141 Ga0466965_0004407 3300044683 Bacteria 6258
1142 Ga0466965_0053833 3300044683 Bacteria 2000
1143 Ga0466965_0162018 3300044683 Bacteria 1173
1144 Ga0466966_0000035 3300044684 Bacteria 98928
1145 Ga0466966_0000198 3300044684 Bacteria 40082
1146 Ga0466966_0001168 3300044684 Bacteria 16883
1147 Ga0466966_0068761 3300044684 Bacteria 2223
1148 Ga0466966_0070976 3300044684 Bacteria 2183
1149 Ga0466961_0000336 3300044693 Bacteria 30807
1150 Ga0466961_0000612 3300044693 Bacteria 22494
1151 Ga0466961_0051454 3300044693 Bacteria 2630
1152 Ga0466961_0250504 3300044693 Bacteria 1087
1153 Ga0466963_0004869 3300044694 Bacteria 7823
1154 Ga0466963_0006557 3300044694 Bacteria 6894
1155 Ga0466963_0021658 3300044694 Bacteria 4058
1156 Ga0466963_0040541 3300044694 Bacteria 3052
1157 Ga0466964_0067742 3300044706 Bacteria 1501
1158 Ga0466964_0121287 3300044706 Bacteria 1179
1159 Ga0466971_0001651 3300044719 Bacteria 9433
1160 Ga0466971_0009252 3300044719 Bacteria 4305
1161 Ga0466971_0075630 3300044719 Bacteria 1531
1162 Ga0466970_0002904 3300044765 Bacteria 8301
1163 Ga0466970_0105728 3300044765 Bacteria 1535
1164 Ga0466957_0012504 3300044842 Bacteria 4912
1165 Ga0466957_0038351 3300044842 Bacteria 2887
1166 Ga0466957_0048030 3300044842 Bacteria 2594
1167 Ga0466959_0026579 3300045049 Bacteria 4289
1168 Ga0466959_0049086 3300045049 Bacteria 3100
1169 Ga0466959_0083940 3300045049 Bacteria 2293
1170 Ga0466959_0178919 3300045049 Bacteria 1484
1171 Ga0451576_0178637 3300045051 Bacteria 2216
1172 Ga0451576_0220891 3300045051 Bacteria 1978
1173 Ga0451576_0349392 3300045051 Bacteria 1548
1174 Ga0466958_0003881 3300045836 Bacteria 7823
1175 Ga0466958_0030845 3300045836 Bacteria 3186
1176 Ga0466958_0076274 3300045836 Bacteria 2058
1177 Ga0466958_0100342 3300045836 Bacteria 1799
1178 Ga0466958_0104893 3300045836 Bacteria 1761
1179 Ga0466958_0141157 3300045836 Bacteria 1516
1180 Ga0466967_0113105 3300045976 Bacteria 2497
1181 Ga0466967_0139106 3300045976 Bacteria 2260
1182 Ga0466967_0483430 3300045976 Bacteria 1213
1183 Ga0466967_1497625 3300045976 Bacteria 672
1184 Ga0495592_0000352 3300046454 Bacteria 37494
1185 Ga0495603_0517187 3300046455 Bacteria 684
1186 Ga0495638_0021565 3300046460 Bacteria 4242
1187 Ga0495650_0073727 3300046471 Bacteria 1332
1188 Ga0495650_0116891 3300046471 Bacteria 985
1189 Ga0495580_0119663 3300046472 Bacteria 1829
1190 Ga0495605_0000656 3300046474 Bacteria 26399
1191 Ga0495605_0072931 3300046474 Bacteria 1618
1192 Ga0495639_0034523 3300046475 Bacteria 2263
1193 Ga0495585_0084023 3300046492 Bacteria 1722
1194 Ga0495607_0036759 3300046501 Bacteria 2948
1195 Ga0495583_0000313 3300046506 Bacteria 76539
1196 Ga0495583_0036571 3300046506 Bacteria 2334
1197 Ga0495606_0001364 3300046507 Bacteria 33033
1198 Ga0495606_0001607 3300046507 Bacteria 29481
1199 Ga0495606_0040174 3300046507 Bacteria 3146
1200 Ga0495606_0168843 3300046507 Bacteria 1271
1201 Ga0495610_0012498 3300046512 Bacteria 5105
1202 Ga0495631_0000923 3300046518 Bacteria 18319
1203 Ga0495631_0069673 3300046518 Bacteria 1521
1204 Ga0495631_0070087 3300046518 Bacteria 1516
1205 Ga0495632_0081758 3300046519 Bacteria 1540
1206 Ga0495643_0002915 3300046522 Bacteria 12974
1207 Ga0495643_0007905 3300046522 Bacteria 6792
1208 Ga0495643_0165626 3300046522 Bacteria 1084
1209 Ga0495586_0366471 3300046535 Bacteria 828
1210 Ga0495598_0021406 3300046537 Bacteria 1720
1211 Ga0495621_0006769 3300046539 Bacteria 3364
1212 Ga0495621_0014656 3300046539 Bacteria 2485
1213 Ga0495621_0186132 3300046539 Bacteria 831
1214 Ga0495597_0022857 3300046542 Bacteria 2897
1215 Ga0495597_0083477 3300046542 Bacteria 1364
1216 Ga0495633_0200942 3300046558 Bacteria 915
1217 Ga0495633_0202733 3300046558 Bacteria 910
1218 Ga0495656_0000884 3300046615 Bacteria 9698
1219 Ga0495668_0011868 3300046616 Bacteria 5193
1220 Ga0495668_0476669 3300046616 Bacteria 687
1221 Ga0495611_0018352 3300046648 Bacteria 3000
1222 Ga0495625_0004259 3300046660 Bacteria 13628
1223 Ga0495625_0171941 3300046660 Bacteria 1446
1224 Ga0495625_0285144 3300046660 Bacteria 1061
1225 Ga0495588_0029691 3300046674 Bacteria 2744
1226 Ga0495647_0002237 3300046681 Bacteria 6066
1227 Ga0495647_0090910 3300046681 Bacteria 1251
1228 Ga0495658_0026757 3300046683 Bacteria 3095
1229 Ga0495658_0043354 3300046683 Bacteria 2516
1230 Ga0495658_0114107 3300046683 Bacteria 1627
1231 Ga0495658_0137075 3300046683 Bacteria 1494
1232 Ga0495669_0018434 3300046684 Bacteria 3002
1233 Ga0495670_0179602 3300046691 Bacteria 1117
1234 Ga0495670_0460544 3300046691 Bacteria 689
1235 Ga0495671_0058269 3300046692 Bacteria 1911
1236 Ga0495649_0000665 3300046694 Bacteria 28093
1237 Ga0495589_0006421 3300046794 Bacteria 6206
1238 Ga0495600_0115097 3300046809 Bacteria 1751
1239 Ga0495600_0220855 3300046809 Bacteria 1212
1240 Ga0495660_0062761 3300046810 Bacteria 1991
1241 Ga0495660_0155778 3300046810 Bacteria 1124
1242 Ga0495581_0435796 3300047315 Bacteria 764
1243 Ga0495672_0049491 3300047320 Bacteria 2487
1244 Ga0495676_0566133 3300047321 Bacteria 742
1245 Ga0495680_0146953 3300047322 Bacteria 1721
1246 Ga0495687_074300 3300047443 Bacteria 1352
1247 Ga0495675_0157922 3300047444 Bacteria 1398
1248 Ga0495681_0184670 3300047470 Bacteria 855
1249 Ga0495684_0081239 3300047471 Bacteria 2460
1250 Ga0495686_0006771 3300047472 Bacteria 8703
1251 Ga0495686_0084127 3300047472 Bacteria 1939
1252 Ga0495626_0110637 3300048091 Bacteria 1190
1253 Ga0496100_0032367 3300048903 Bacteria 3261
1254 Ga0496100_0069676 3300048903 Bacteria 2343
1255 Ga0496100_0094754 3300048903 Bacteria 2045
1256 Ga0496100_0109234 3300048903 Bacteria 1919
1257 Ga0496100_0317195 3300048903 Bacteria 1170
1258 Ga0496101_0005191 3300048904 Bacteria 8284
1259 Ga0496101_0018036 3300048904 Bacteria 4793
1260 Ga0496101_0072335 3300048904 Bacteria 2531
1261 Ga0496102_0004684 3300048905 Bacteria 11571
1262 Ga0496102_0029586 3300048905 Bacteria 4902
1263 Ga0496102_0042628 3300048905 Bacteria 4113
1264 Ga0496102_0141534 3300048905 Bacteria 2256
1265 Ga0496102_0246661 3300048905 Bacteria 1684
1266 Ga0496102_0287645 3300048905 Bacteria 1549
1267 Ga0496102_0410713 3300048905 Bacteria 1272
1268 Ga0496102_0491432 3300048905 Bacteria 1149
1269 Ga0496103_0001141 3300048906 Bacteria 18434
1270 Ga0496103_0138489 3300048906 Bacteria 1556
1271 Ga0496104_0033621 3300048907 Bacteria 4779
1272 Ga0496104_0149429 3300048907 Bacteria 2243
1273 Ga0496104_0200149 3300048907 Bacteria 1909
1274 Ga0496104_0259575 3300048907 Bacteria 1650
1275 Ga0496104_0913166 3300048907 Bacteria 783
1276 Ga0496105_0024032 3300048908 Bacteria 4950
1277 Ga0496105_0024345 3300048908 Bacteria 4918
1278 Ga0496105_0174019 3300048908 Bacteria 1764
1279 Ga0496105_0482790 3300048908 Bacteria 975
1280 Ga0496106_0000269 3300048909 Bacteria 36744
1281 Ga0496106_0002032 3300048909 Bacteria 15215
1282 Ga0496106_0082536 3300048909 Bacteria 2470
1283 Ga0496107_0009689 3300048910 Bacteria 6678
1284 Ga0496107_0238682 3300048910 Bacteria 1353
1285 Ga0496108_0180946 3300048911 Bacteria 1826
1286 Ga0496108_0571435 3300048911 Bacteria 986
1287 Ga0496108_0574932 3300048911 Bacteria 982
1288 Ga0496109_0008278 3300048912 Bacteria 8830
1289 Ga0496109_0050006 3300048912 Bacteria 3808
1290 Ga0496109_0092273 3300048912 Bacteria 2801
1291 Ga0496110_0005584 3300048913 Bacteria 9874
1292 Ga0496110_0195204 3300048913 Bacteria 1838
1293 Ga0496110_0297235 3300048913 Bacteria 1471
1294 Ga0496110_0311716 3300048913 Bacteria 1433
1295 Ga0496110_0327576 3300048913 Bacteria 1395
1296 Ga0496112_0017411 3300048915 Bacteria 6750
1297 Ga0496112_0056538 3300048915 Bacteria 3862
1298 Ga0496112_0812197 3300048915 Bacteria 860
1299 Ga0496113_0116715 3300048916 Bacteria 2083
1300 Ga0496113_0431101 3300048916 Bacteria 1059
1301 Ga0496114_0008095 3300048917 Bacteria 8325
1302 Ga0496114_0009654 3300048917 Bacteria 7665
1303 Ga0496114_0127883 3300048917 Bacteria 2192
1304 Ga0496114_0135507 3300048917 Bacteria 2129
1305 Ga0496114_0496413 3300048917 Bacteria 1080
1306 Ga0496114_0591408 3300048917 Bacteria 979
1307 Ga0496115_0040075 3300048918 Bacteria 3722
1308 Ga0496116_0000065 3300048919 Bacteria 265193
1309 Ga0496116_0006609 3300048919 Bacteria 10491
1310 Ga0496116_0011599 3300048919 Bacteria 7273
1311 Ga0496116_0057009 3300048919 Bacteria 2557
1312 Ga0496116_0079756 3300048919 Bacteria 2035
1313 Ga0496116_0159381 3300048919 Bacteria 1240
1314 Ga0496116_0162962 3300048919 Bacteria 1220
1315 Ga0496117_0000866 3300048920 Bacteria 46705
1316 Ga0496117_0002913 3300048920 Bacteria 20708
1317 Ga0496117_0013051 3300048920 Bacteria 7274
1318 Ga0496117_0050229 3300048920 Bacteria 2958
1319 Ga0496117_0083586 3300048920 Bacteria 2086
1320 Ga0496117_0121928 3300048920 Bacteria 1599
1321 Ga0496117_0253991 3300048920 Bacteria 957
1322 Ga0496117_0530204 3300048920 Bacteria 565
1323 Ga0496118_0003707 3300048921 Bacteria 18924
1324 Ga0496118_0008892 3300048921 Bacteria 10264
1325 Ga0496118_0013019 3300048921 Bacteria 7913
1326 Ga0496118_0199382 3300048921 Bacteria 1187
1327 Ga0496118_0220971 3300048921 Bacteria 1102
1328 Ga0496119_0007795 3300048922 Bacteria 9551
1329 Ga0496119_0039398 3300048922 Bacteria 3037
1330 Ga0496119_0055029 3300048922 Bacteria 2419
1331 Ga0496119_0081512 3300048922 Bacteria 1863
1332 Ga0496120_0008875 3300048923 Bacteria 7205
1333 Ga0496120_0009699 3300048923 Bacteria 6793
1334 Ga0496120_0034977 3300048923 Bacteria 3005
1335 Ga0496120_0139655 3300048923 Bacteria 1231
1336 Ga0496120_0162375 3300048923 Bacteria 1112
1337 Ga0496120_0192844 3300048923 Bacteria 992
1338 Ga0496121_0000174 3300048924 Bacteria 143186
1339 Ga0496121_0003584 3300048924 Bacteria 21925
1340 Ga0496121_0055728 3300048924 Bacteria 3290
1341 Ga0496121_0056408 3300048924 Bacteria 3263
1342 Ga0496121_0057718 3300048924 Bacteria 3215
1343 Ga0496121_0097359 3300048924 Bacteria 2280
1344 Ga0496121_0121803 3300048924 Bacteria 1969
1345 Ga0496121_0149667 3300048924 Bacteria 1719
1346 Ga0496121_0171636 3300048924 Bacteria 1574
1347 Ga0496121_0179798 3300048924 Bacteria 1528
1348 Ga0496121_0196712 3300048924 Bacteria 1440
1349 Ga0496121_0396374 3300048924 Bacteria 905
1350 Ga0496121_0618368 3300048924 Bacteria 665
1351 Ga0496122_0011815 3300048925 Bacteria 8781
1352 Ga0496122_0035663 3300048925 Bacteria 4040
1353 Ga0496122_0066433 3300048925 Bacteria 2605
1354 Ga0496122_0086269 3300048925 Bacteria 2161
1355 Ga0496122_0132391 3300048925 Bacteria 1581
1356 Ga0496122_0139655 3300048925 Bacteria 1518
1357 Ga0496123_0028116 3300048926 Bacteria 4170
1358 Ga0496123_0042384 3300048926 Bacteria 3141
1359 Ga0496123_0081801 3300048926 Bacteria 1960
1360 Ga0496123_0230474 3300048926 Bacteria 927
1361 Ga0496124_0000200 3300048927 Bacteria 117910
1362 Ga0496124_0001776 3300048927 Bacteria 29988
1363 Ga0496124_0003927 3300048927 Bacteria 17758
1364 Ga0496124_0030008 3300048927 Bacteria 4835
1365 Ga0496124_0047267 3300048927 Bacteria 3682
1366 Ga0496124_0069789 3300048927 Bacteria 2916
1367 Ga0496124_0071883 3300048927 Bacteria 2866
1368 Ga0496124_0258095 3300048927 Bacteria 1284
1369 Ga0496124_0295942 3300048927 Bacteria 1172
1370 Ga0496125_0000048 3300048928 Bacteria 290651
1371 Ga0496125_0000115 3300048928 Bacteria 181994
1372 Ga0496125_0000982 3300048928 Bacteria 44569
1373 Ga0496125_0024616 3300048928 Bacteria 5530
1374 Ga0496125_0067409 3300048928 Bacteria 2820
1375 Ga0496125_0077925 3300048928 Bacteria 2551
1376 Ga0496125_0107652 3300048928 Bacteria 2030
1377 Ga0496125_0186218 3300048928 Bacteria 1376
1378 Ga0496125_0187175 3300048928 Bacteria 1371
1379 Ga0496126_0019281 3300048929 Bacteria 6720
1380 Ga0496126_0088806 3300048929 Bacteria 2722
1381 Ga0496126_0127413 3300048929 Bacteria 2202
1382 Ga0496126_0479018 3300048929 Bacteria 997
1383 Ga0496126_0877422 3300048929 Bacteria 682
1384 Ga0501298_024284 3300049521 Bacteria 1154
1385 Ga0501031_0056043 3300049568 Bacteria 2568
1386 Ga0501031_0280265 3300049568 Bacteria 1081
1387 Ga0501031_0310805 3300049568 Bacteria 1021
1388 Ga0501031_0538050 3300049568 Bacteria 753
1389 Ga0501032_0000023 3300049569 Bacteria 146435
1390 Ga0501032_0035515 3300049569 Bacteria 3407
1391 Ga0501032_0042316 3300049569 Bacteria 3090
1392 Ga0501032_0158743 3300049569 Bacteria 1485
1393 Ga0501032_0231499 3300049569 Bacteria 1201
1394 Ga0501032_0284598 3300049569 Bacteria 1070
1395 Ga0501033_0000104 3300049570 Bacteria 81029
1396 Ga0501033_0001017 3300049570 Bacteria 25466
1397 Ga0501033_0038718 3300049570 Bacteria 3562
1398 Ga0501033_0039506 3300049570 Bacteria 3524
1399 Ga0501033_0063901 3300049570 Bacteria 2709
1400 Ga0501033_0103823 3300049570 Bacteria 2072
1401 Ga0501033_0211047 3300049570 Bacteria 1384
1402 Ga0501033_0289624 3300049570 Bacteria 1155
1403 Ga0501034_0000116 3300049571 Bacteria 146442
1404 Ga0501034_0000162 3300049571 Bacteria 125834
1405 Ga0501034_0083017 3300049571 Bacteria 3206
1406 Ga0501034_0097881 3300049571 Bacteria 2929
1407 Ga0501034_0183645 3300049571 Bacteria 2055
1408 Ga0501034_0300812 3300049571 Bacteria 1541
1409 Ga0501034_0493449 3300049571 Bacteria 1139
1410 Ga0501034_0902885 3300049571 Bacteria 771
1411 Ga0501034_1247817 3300049571 Bacteria 621
1412 Ga0501036_0000015 3300049572 Bacteria 146442
1413 Ga0501036_0227988 3300049572 Bacteria 1564
1414 Ga0501036_0385722 3300049572 Bacteria 1169
1415 Ga0501036_0541326 3300049572 Bacteria 968
1416 Ga0501037_0000023 3300049573 Bacteria 146542
1417 Ga0501037_0000035 3300049573 Bacteria 125589
1418 Ga0501037_0155691 3300049573 Bacteria 1631
1419 Ga0501037_0234782 3300049573 Bacteria 1287
1420 Ga0501038_0000025 3300049574 Bacteria 146542
1421 Ga0501038_0023128 3300049574 Bacteria 5561
1422 Ga0501038_0368599 3300049574 Bacteria 1116
1423 Ga0501038_0522109 3300049574 Bacteria 906
1424 Ga0501039_0000037 3300049575 Bacteria 122286
1425 Ga0501039_0159654 3300049575 Bacteria 1772
1426 Ga0501039_0207273 3300049575 Bacteria 1541
1427 Ga0501040_0006421 3300049576 Bacteria 7635
1428 Ga0501041_0472878 3300049577 Bacteria 796
1429 Ga0501042_0317510 3300049578 Bacteria 1126
1430 Ga0501043_0000031 3300049579 Bacteria 140707
1431 Ga0501043_0000070 3300049579 Bacteria 89839
1432 Ga0501043_0000071 3300049579 Bacteria 89105
1433 Ga0501043_0023763 3300049579 Bacteria 4808
1434 Ga0501043_0085371 3300049579 Bacteria 2480
1435 Ga0501043_0326502 3300049579 Bacteria 1169
1436 Ga0501043_0412182 3300049579 Bacteria 1020
1437 Ga0501046_0000311 3300049580 Bacteria 48905
1438 Ga0501046_0029834 3300049580 Bacteria 4431
1439 Ga0501046_0144281 3300049580 Bacteria 1799
1440 Ga0501046_0395767 3300049580 Bacteria 998
1441 Ga0501046_0530893 3300049580 Bacteria 840
1442 Ga0501047_0000087 3300049581 Bacteria 117516
1443 Ga0501047_0002287 3300049581 Bacteria 18325
1444 Ga0501047_0022828 3300049581 Bacteria 6007
1445 Ga0501047_0078456 3300049581 Bacteria 3175
1446 Ga0501047_0202116 3300049581 Bacteria 1848
1447 Ga0501047_0220841 3300049581 Bacteria 1751
1448 Ga0501047_0297357 3300049581 Bacteria 1457
1449 Ga0501047_0311468 3300049581 Bacteria 1415
1450 Ga0501048_0000226 3300049582 Bacteria 37156
1451 Ga0501048_0557492 3300049582 Bacteria 822
1452 Ga0501048_0564249 3300049582 Bacteria 817
1453 Ga0501067_0015101 3300049583 Bacteria 4273
1454 Ga0501068_0005004 3300049584 Bacteria 7218
1455 Ga0501068_0328135 3300049584 Bacteria 982
1456 Ga0501069_0000136 3300049585 Bacteria 32144
1457 Ga0501069_0049438 3300049585 Bacteria 2337
1458 Ga0501069_0232197 3300049585 Bacteria 1074
1459 Ga0501070_0000202 3300049586 Bacteria 55898
1460 Ga0501070_0000422 3300049586 Bacteria 38458
1461 Ga0501070_0006568 3300049586 Bacteria 9898
1462 Ga0501070_0010179 3300049586 Bacteria 7960
1463 Ga0501070_0022526 3300049586 Bacteria 5277
1464 Ga0501070_0060029 3300049586 Bacteria 3152
1465 Ga0501070_0077138 3300049586 Bacteria 2758
1466 Ga0501070_0440136 3300049586 Bacteria 1052
1467 Ga0501071_0001465 3300049587 Bacteria 13695
1468 Ga0501071_0067873 3300049587 Bacteria 2594
1469 Ga0501072_0466182 3300049588 Bacteria 1000
1470 Ga0501073_0027594 3300049589 Bacteria 4060
1471 Ga0501073_0323530 3300049589 Bacteria 1064
1472 Ga0501074_0000024 3300049590 Bacteria 68886
1473 Ga0501074_0157201 3300049590 Bacteria 1624
1474 Ga0501074_0534348 3300049590 Bacteria 830
1475 Ga0501076_0242941 3300049592 Bacteria 1473
1476 Ga0501077_0022616 3300049593 Bacteria 3983
1477 Ga0501225_0065977 3300049705 Bacteria 1023
1478 Ga0501080_0000429 3300049742 Bacteria 32423
1479 Ga0501080_0000963 3300049742 Bacteria 23558
1480 Ga0501080_0265394 3300049742 Bacteria 1563
1481 Ga0501080_0503803 3300049742 Bacteria 1082
1482 Ga0501083_0000200 3300049744 Bacteria 38409
1483 Ga0501083_0010111 3300049744 Bacteria 6647
1484 Ga0501083_0110838 3300049744 Bacteria 1805
1485 Ga0501241_037925 3300049758 Bacteria 927
1486 Ga0501265_000721 3300049762 Bacteria 3618
1487 Ga0501280_001590 3300049776 Bacteria 4078
1488 Ga0501281_02092 3300049777 Bacteria 1484
1489 Ga0501035_0000036 3300049822 Bacteria 165008
1490 Ga0501035_0000074 3300049822 Bacteria 122269
1491 Ga0501035_0000723 3300049822 Bacteria 35738
1492 Ga0501035_0002648 3300049822 Bacteria 17423
1493 Ga0501035_0008594 3300049822 Bacteria 9501
1494 Ga0501035_0032962 3300049822 Bacteria 4711
1495 Ga0501035_0087522 3300049822 Bacteria 2745
1496 Ga0501035_0125755 3300049822 Bacteria 2238
1497 Ga0501035_0159957 3300049822 Bacteria 1950
1498 Ga0501044_0000011 3300049823 Bacteria 257385
1499 Ga0501044_0000069 3300049823 Bacteria 125974
1500 Ga0501044_0004538 3300049823 Bacteria 15525
1501 Ga0501044_0008293 3300049823 Bacteria 11391
1502 Ga0501044_0034203 3300049823 Bacteria 5332
1503 Ga0501044_0034206 3300049823 Bacteria 5332
1504 Ga0501044_0039584 3300049823 Bacteria 4917
1505 Ga0501044_0076189 3300049823 Bacteria 3405
1506 Ga0501044_0079139 3300049823 Bacteria 3331
1507 Ga0501044_0175065 3300049823 Bacteria 2115
1508 Ga0501044_0176365 3300049823 Bacteria 2106
1509 Ga0501044_0250617 3300049823 Bacteria 1712
1510 Ga0501045_0101064 3300049824 Bacteria 2134
1511 Ga0501045_0489401 3300049824 Bacteria 914
1512 nmdc:mga03683_486071_c1 3300050489 Bacteria 597
1513 nmdc:mga03n38_76581_c1 3300050490 Bacteria 1561
1514 nmdc:mga03n38_8598_c1 3300050490 Bacteria 1343
1515 nmdc:mga00v17_102948_c1 3300050491 Bacteria 1804
1516 nmdc:mga00v17_11078_c1 3300050491 Bacteria 4947
1517 nmdc:mga00v17_20863_c1 3300050491 Bacteria 3759
1518 nmdc:mga00v17_594075_c1 3300050491 Bacteria 714
1519 nmdc:mga0yw44_137179_c1 3300050492 Bacteria 1588
1520 nmdc:mga0yw44_17647_c1 3300050492 Bacteria 3889
1521 nmdc:mga0yw44_2420_c1 3300050492 Bacteria 7946
1522 nmdc:mga0yw44_26588_c1 3300050492 Bacteria 3307
1523 nmdc:mga0k408_11975_c1 3300050493 Bacteria 4732
1524 nmdc:mga0k408_13145_c1 3300050493 Bacteria 4535
1525 nmdc:mga0k408_13887_c1 3300050493 Bacteria 3763
1526 nmdc:mga0k408_319783_c1 3300050493 Bacteria 926
1527 nmdc:mga0k408_34788_c1 3300050493 Bacteria 2885
1528 nmdc:mga06z11_1261_c1 3300050494 Bacteria 9369
1529 nmdc:mga06z11_14948_c1 3300050494 Bacteria 3452
1530 nmdc:mga06z11_158670_c1 3300050494 Bacteria 1291
1531 nmdc:mga06z11_247352_c1 3300050494 Bacteria 1049
1532 nmdc:mga06z11_35364_c1 3300050494 Bacteria 2458
1533 nmdc:mga04h51_153595_c1 3300050495 Bacteria 881
1534 nmdc:mga04h51_344332_c1 3300050495 Bacteria 615
1535 nmdc:mga04h51_55610_c1 3300050495 Bacteria 1341
1536 nmdc:mga07m45_104832_c1 3300050496 Bacteria 1626
1537 nmdc:mga07m45_10536_c1 3300050496 Bacteria 1908
1538 nmdc:mga07m45_16474_c2 3300050496 Bacteria 2724
1539 nmdc:mga07m45_93500_c1 3300050496 Bacteria 1724
1540 nmdc:mga05p37_270609_c1 3300050507 Bacteria 2030
1541 nmdc:mga0qj67_398601_c1 3300050509 Bacteria 1110
1542 nmdc:mga06r32_1237570_c1 3300050510 Bacteria 692
1543 nmdc:mga06r32_989868_c1 3300050510 Bacteria 794
1544 nmdc:mga08y16_103169_c1 3300050511 Bacteria 2969
1545 nmdc:mga08y16_414253_c1 3300050511 Bacteria 1378
1546 nmdc:mga0n895_464316_c1 3300050512 Bacteria 1277
1547 nmdc:mga0n895_577473_c1 3300050512 Bacteria 1128
1548 nmdc:mga0rr50_511315_c1 3300050513 Bacteria 1021
1549 nmdc:mga0sz30_11929_c1 3300050516 Bacteria 3369
1550 nmdc:mga0sz30_7432_c2 3300050516 Bacteria 3344
1551 Ga0495601_0031506 3300053077 Bacteria 3296
1552 Ga0500635_0000072 3300053080 Bacteria 66335
1553 Ga0495595_0082470 3300053084 Bacteria 1534
1554 Ga0495619_0097152 3300053085 Bacteria 2001
1555 Ga0500578_0183781 3300053086 Bacteria 1287
1556 Ga0500651_0241138 3300053093 Bacteria 1054
1557 Ga0500660_139892 3300053100 Bacteria 964
1558 Ga0500557_001166 3300053105 Bacteria 4086
1559 Ga0500569_046751 3300053109 Bacteria 1291
1560 Ga0500594_0006266 3300053118 Bacteria 2669
1561 Ga0500618_000008 3300053125 Bacteria 214678
1562 Ga0500618_003329 3300053125 Bacteria 5557
1563 Ga0500618_011676 3300053125 Bacteria 2322
1564 Ga0500628_038589 3300053129 Bacteria 1079
1565 Ga0500658_0000458 3300053134 Bacteria 17401
1566 Ga0500658_0024481 3300053134 Bacteria 2313
1567 Ga0500658_0221890 3300053134 Bacteria 867
1568 Ga0500568_0000019 3300053139 Bacteria 195696
1569 Ga0500568_0000152 3300053139 Bacteria 60089
1570 Ga0500568_0000695 3300053139 Bacteria 24132
1571 Ga0500577_0001225 3300053142 Bacteria 6566
1572 Ga0500604_0065295 3300053151 Bacteria 1151
1573 Ga0500616_0005593 3300053153 Bacteria 8487
1574 Ga0500616_0012753 3300053153 Bacteria 4906
1575 Ga0500616_0140514 3300053153 Bacteria 1129
1576 Ga0500620_000018 3300053155 Bacteria 33396
1577 Ga0500622_0000185 3300053156 Bacteria 66073
1578 Ga0500624_003879 3300053157 Bacteria 1961
1579 Ga0500633_0019408 3300053160 Bacteria 2032
1580 Ga0500634_0000001 3300053161 Bacteria 258285
1581 Ga0500634_0011993 3300053161 Bacteria 4497
1582 Ga0500636_0077761 3300053177 Bacteria 1916
1583 Ga0500636_0204139 3300053177 Bacteria 1043
1584 Ga0501084_0151587 3300054114 Bacteria 1954
1585 Ga0501084_0237865 3300054114 Bacteria 1537
1586 Ga0500661_011828 3300055283 Bacteria 1578
1587 Ga0501082_0082917 3300060353 Bacteria 2766
1588 Ga0501082_0732848 3300060353 Bacteria 865
1589 Ga0501082_0852826 3300060353 Bacteria 797
1590 Ga0466962_0004499 3300061719 Bacteria 6682
1591 Ga0466962_0007394 3300061719 Bacteria 5269
1592 Ga0466962_0018487 3300061719 Bacteria 3352
1593 Ga0466962_0095510 3300061719 Bacteria 1425
1594 Ga0466962_0129463 3300061719 Bacteria 1219
1595 Ga0530510_0872702 3300061734 Bacteria 687

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048924 Ga0496121_0196712 Ga0496121_0196712_928_1419 159
2 3300048919 Ga0496116_0057009 Ga0496116_0057009_2041_2532 160
3 3300048920 Ga0496117_0530204 Ga0496117_0530204_15_506 160
4 3300050489 nmdc:mga03683_486071_c1 nmdc:mga03683_486071_c1_76_585 167
5 3300050495 nmdc:mga04h51_344332_c1 nmdc:mga04h51_344332_c1_88_597 167
6 3300041411 Ga0439466_0076357 Ga0439466_0076357_27_569 176
7 3300046691 Ga0495670_0460544 Ga0495670_0460544_14_556 176
8 3300049570 Ga0501033_0103823 Ga0501033_0103823_39_581 176
9 3300049571 Ga0501034_1247817 Ga0501034_1247817_69_611 176
10 iso_pu_bacteria 2924718760 2924719745 177
11 3300005334 Ga0068869_100362236 Ga0068869_1003622362 180
12 3300005337 Ga0070682_100740513 Ga0070682_1007405131 180
13 3300005354 Ga0070675_100262046 Ga0070675_1002620462 180
14 3300005367 Ga0070667_100656999 Ga0070667_1006569991 180
15 3300005459 Ga0068867_100309068 Ga0068867_1003090682 180
16 3300005548 Ga0070665_101445313 Ga0070665_1014453131 180
17 3300005616 Ga0068852_100268784 Ga0068852_1002687842 180
18 3300005617 Ga0068859_101244512 Ga0068859_1012445121 180
19 3300005844 Ga0068862_100437467 Ga0068862_1004374672 180
20 3300006237 Ga0097621_100243818 Ga0097621_1002438182 180
21 3300006358 Ga0068871_100141240 Ga0068871_1001412402 180
22 3300006931 Ga0097620_101244282 Ga0097620_1012442822 180
23 3300010375 Ga0105239_11835747 Ga0105239_118357472 180
24 3300013297 Ga0157378_10175059 Ga0157378_101750594 180
25 3300017792 Ga0163161_10536561 Ga0163161_105365612 180
26 3300025940 Ga0207691_10151848 Ga0207691_101518482 180
27 3300026089 Ga0207648_10277978 Ga0207648_102779782 180
28 3300028380 Ga0268265_10514039 Ga0268265_105140392 180
29 3300045976 Ga0466967_1497625 Ga0466967_1497625_32_589 181
30 3300046542 Ga0495597_0083477 Ga0495597_0083477_784_1341 181
31 3300013306 Ga0163162_10696673 Ga0163162_106966732 182
32 3300014325 Ga0163163_10780138 Ga0163163_107801381 182
33 3300060353 Ga0501082_0732848 Ga0501082_0732848_226_813 182
34 3300046683 Ga0495658_0137075 Ga0495658_0137075_27_602 186
35 3300049579 Ga0501043_0326502 Ga0501043_0326502_476_1051 186
36 3300049742 Ga0501080_0503803 Ga0501080_0503803_61_636 186
37 3300049823 Ga0501044_0250617 Ga0501044_0250617_100_675 186
38 3300050512 nmdc:mga0n895_577473_c1 nmdc:mga0n895_577473_c1_37_606 186
39 iso_pu_bacteria 8004703790 8004708508 186
40 3300005347 Ga0070668_100429523 Ga0070668_1004295232 187
41 3300005356 Ga0070674_100230532 Ga0070674_1002305322 187
42 3300005459 Ga0068867_100898180 Ga0068867_1008981802 187
43 3300005844 Ga0068862_100113780 Ga0068862_1001137802 187
44 3300005981 Ga0081538_10016898 Ga0081538_100168984 187
45 3300006847 Ga0075431_101186836 Ga0075431_1011868361 187
46 3300009147 Ga0114129_10742727 Ga0114129_107427271 187
47 3300025937 Ga0207669_10100124 Ga0207669_101001242 187
48 3300025938 Ga0207704_10133173 Ga0207704_101331732 187
49 3300026118 Ga0207675_100034412 Ga0207675_1000344122 187
50 3300045976 Ga0466967_0113105 Ga0466967_0113105_32_607 187
51 3300048924 Ga0496121_0121803 Ga0496121_0121803_1368_1946 187
52 3300048925 Ga0496122_0132391 Ga0496122_0132391_522_1100 187
53 3300048928 Ga0496125_0000048 Ga0496125_0000048_78668_79246 187
54 3300050507 nmdc:mga05p37_270609_c1 nmdc:mga05p37_270609_c1_896_1465 187
55 3300050510 nmdc:mga06r32_1237570_c1 nmdc:mga06r32_1237570_c1_102_671 187
56 3300050510 nmdc:mga06r32_989868_c1 nmdc:mga06r32_989868_c1_52_621 187
57 3300053142 Ga0500577_0001225 Ga0500577_0001225_1822_2400 187
58 iso_pu_bacteria 2643221629 2644169081 187
59 iso_pu_bacteria 2643221662 2644350493 187
60 iso_pu_bacteria 2842333319 2842338104 187
61 iso_pu_bacteria 2885350715 2885356007 187
62 iso_pu_bacteria 2888343758 2888346455 187
63 3300005367 Ga0070667_101279750 Ga0070667_1012797501 188
64 3300005455 Ga0070663_100135555 Ga0070663_1001355552 188
65 3300006051 Ga0075364_10294932 Ga0075364_102949321 188
66 3300037853 Ga0436364_0698594 Ga0436364_0698594_1396_2004 188
67 3300039450 Ga0436363_0482532 Ga0436363_0482532_3815_4423 188
68 3300048919 Ga0496116_0011599 Ga0496116_0011599_3520_4101 188
69 3300048928 Ga0496125_0024616 Ga0496125_0024616_4216_4797 188
70 3300009147 Ga0114129_10487396 Ga0114129_104873962 189
71 3300046681 Ga0495647_0002237 Ga0495647_0002237_324_908 189
72 3300006353 Ga0075370_10216355 Ga0075370_102163552 190
73 3300050491 nmdc:mga00v17_102948_c1 nmdc:mga00v17_102948_c1_714_1292 190
74 3300050493 nmdc:mga0k408_13145_c1 nmdc:mga0k408_13145_c1_1902_2480 190
75 3300050494 nmdc:mga06z11_158670_c1 nmdc:mga06z11_158670_c1_540_1118 190
76 3300050496 nmdc:mga07m45_104832_c1 nmdc:mga07m45_104832_c1_515_1093 190
77 3300031456 Ga0307513_10551724 Ga0307513_105517242 191
78 3300031548 Ga0307408_100207039 Ga0307408_1002070392 191
79 3300031901 Ga0307406_11007418 Ga0307406_110074181 191
80 3300032004 Ga0307414_10218193 Ga0307414_102181932 191
81 3300032004 Ga0307414_10659293 Ga0307414_106592932 191
82 3300032005 Ga0307411_10142911 Ga0307411_101429112 191
83 3300032005 Ga0307411_10527103 Ga0307411_105271032 191
84 3300035398 Ga0316574_0459332 Ga0316574_0459332_16_612 191
85 3300035695 Ga0373927_0706812 Ga0373927_0706812_17_598 191
86 3300041413 Ga0439465_0033120 Ga0439465_0033120_671_1252 191
87 3300042435 Ga0439434_0154498 Ga0439434_0154498_160_741 191
88 3300048911 Ga0496108_0180946 Ga0496108_0180946_552_1133 191
89 3300050509 nmdc:mga0qj67_398601_c1 nmdc:mga0qj67_398601_c1_518_1099 191
90 iso_pu_bacteria 2929199973 2929200422 192
91 iso_pu_bacteria 8055909800 8055914738 192
92 iso_pu_bacteria 2643221591 2643966274 193
93 3300035724 Ga0373933_0000057 Ga0373933_0000057_53625_54224 194
94 3300005455 Ga0070663_100064129 Ga0070663_1000641293 195
95 3300005614 Ga0068856_100705153 Ga0068856_1007051532 195
96 3300053139 Ga0500568_0000019 Ga0500568_0000019_150256_150855 195
97 3300053157 Ga0500624_003879 Ga0500624_003879_1134_1736 195
98 3300053161 Ga0500634_0000001 Ga0500634_0000001_80900_81502 195
99 3300053161 Ga0500634_0011993 Ga0500634_0011993_1051_1653 195
100 iso_pu_bacteria 2509276021 2509385856 195
101 iso_pu_bacteria 2509276033 2509448086 195
102 iso_pu_bacteria 2510065019 2510136842 195
103 iso_pu_bacteria 2510461076 2510899868 195
104 iso_pu_bacteria 2510461076 2510900464 195
105 iso_pu_bacteria 2510917030 2511196474 195
106 iso_pu_bacteria 2513237084 2513569749 195
107 iso_pu_bacteria 2513237085 2513576601 195
108 iso_pu_bacteria 2513237093 2513631722 195
109 iso_pu_bacteria 2513237103 2513713427 195
110 iso_pu_bacteria 2513237144 2513911663 195
111 iso_pu_bacteria 2513237159 2513996353 195
112 iso_pu_bacteria 2513237162 2514021327 195
113 iso_pu_bacteria 2515075009 2515115426 195
114 iso_pu_bacteria 2515154113 2515636152 195
115 iso_pu_bacteria 2515154114 2515644691 195
116 iso_pu_bacteria 2515154116 2515657972 195
117 iso_pu_bacteria 2515154134 2515742279 195
118 iso_pu_bacteria 2516653077 2517041557 195
119 iso_pu_bacteria 2516653085 2517080833 195
120 iso_pu_bacteria 2517093000 2517099031 195
121 iso_pu_bacteria 2517287029 2517410734 195
122 iso_pu_bacteria 2519899620 2520380666 195
123 iso_pu_bacteria 2529292951 2530644398 195
124 iso_pu_bacteria 2582581298 2585221685 195
125 iso_pu_bacteria 2585427526 2585524512 195
126 iso_pu_bacteria 2585427528 2585539095 195
127 iso_pu_bacteria 2585427529 2585544145 195
128 iso_pu_bacteria 2585427593 2585837045 195
129 iso_pu_bacteria 2599185170 2599414608 195
130 iso_pu_bacteria 2615840624 2616295091 195
131 iso_pu_bacteria 2718217882 2719183570 195
132 iso_pu_bacteria 2718217927 2719388323 195
133 iso_pu_bacteria 2718217997 2719667927 195
134 iso_pu_bacteria 2718218009 2719728011 195
135 iso_pu_bacteria 2718218199 2720494690 195
136 iso_pu_bacteria 2718218232 2720611026 195
137 iso_pu_bacteria 2718218233 2720616194 195
138 iso_pu_bacteria 2718218235 2720629275 195
139 iso_pu_bacteria 2718218269 2720771847 195
140 iso_pu_bacteria 2718218363 2721144872 195
141 iso_pu_bacteria 2718218365 2721155611 195
142 iso_pu_bacteria 2718218366 2721166959 195
143 iso_pu_bacteria 2718218423 2721402946 195
144 iso_pu_bacteria 2721755514 2722837937 195
145 iso_pu_bacteria 2721755556 2723029251 195
146 iso_pu_bacteria 2721755684 2723562884 195
147 iso_pu_bacteria 2721755685 2723570874 195
148 iso_pu_bacteria 2721755809 2724035303 195
149 iso_pu_bacteria 2721755810 2724042205 195
150 iso_pu_bacteria 2721755819 2724086667 195
151 iso_pu_bacteria 2721755822 2724106825 195
152 iso_pu_bacteria 2721755823 2724107633 195
153 iso_pu_bacteria 2724679232 2725946478 195
154 iso_pu_bacteria 2728369352 2730105565 195
155 iso_pu_bacteria 2728369365 2730161710 195
156 iso_pu_bacteria 2728369397 2730300718 195
157 iso_pu_bacteria 2738541333 2739033553 195
158 iso_pu_bacteria 2765235942 2766068721 195
159 iso_pu_bacteria 2791355256 2793296549 195
160 iso_pu_bacteria 2791355259 2793314927 195
161 iso_pu_bacteria 2791355260 2793321561 195
162 iso_pu_bacteria 2791355261 2793325939 195
163 iso_pu_bacteria 2791355262 2793332947 195
164 iso_pu_bacteria 2791355263 2793340245 195
165 iso_pu_bacteria 2791355264 2793346049 195
166 iso_pu_bacteria 2791355265 2793355261 195
167 iso_pu_bacteria 2791355266 2793357903 195
168 iso_pu_bacteria 2791355267 2793366671 195
169 iso_pu_bacteria 2802429605 2805927941 195
170 iso_pu_bacteria 2802429606 2805933787 195
171 iso_pu_bacteria 2802429633 2806044950 195
172 iso_pu_bacteria 2802429634 2806053891 195
173 iso_pu_bacteria 2802429635 2806060017 195
174 iso_pu_bacteria 2802429636 2806065929 195
175 iso_pu_bacteria 2802429637 2806075459 195
176 iso_pu_bacteria 2838016132 2838019345 195
177 iso_pu_bacteria 2838022645 2838024889 195
178 iso_pu_bacteria 2838035591 2838036969 195
179 iso_pu_bacteria 2838048938 2838050421 195
180 iso_pu_bacteria 2838061910 2838063123 195
181 iso_pu_bacteria 2838068647 2838071684 195
182 iso_pu_bacteria 2838661181 2838661992 195
183 iso_pu_bacteria 2838668709 2838674678 195
184 iso_pu_bacteria 2838680041 2838684287 195
185 iso_pu_bacteria 2838686498 2838692198 195
186 iso_pu_bacteria 2838694306 2838699778 195
187 iso_pu_bacteria 2838701080 2838705221 195
188 iso_pu_bacteria 2838707686 2838711937 195
189 iso_pu_bacteria 2838729681 2838734579 195
190 iso_pu_bacteria 2838742623 2838747761 195
191 iso_pu_bacteria 2841851746 2841853526 195
192 iso_pu_bacteria 2842077413 2842081753 195
193 iso_pu_bacteria 2842110456 2842114542 195
194 iso_pu_bacteria 2842118031 2842122330 195
195 iso_pu_bacteria 2842146304 2842150288 195
196 iso_pu_bacteria 2842156927 2842161391 195
197 iso_pu_bacteria 2842163707 2842167406 195
198 iso_pu_bacteria 2842180545 2842186344 195
199 iso_pu_bacteria 2842192696 2842195109 195
200 iso_pu_bacteria 2842198810 2842201974 195
201 iso_pu_bacteria 2842205361 2842210474 195
202 iso_pu_bacteria 2842217011 2842223587 195
203 iso_pu_bacteria 2842229732 2842235254 195
204 iso_pu_bacteria 2842237096 2842241349 195
205 iso_pu_bacteria 2842243621 2842246321 195
206 iso_pu_bacteria 2842250916 2842254974 195
207 iso_pu_bacteria 2842257432 2842260818 195
208 iso_pu_bacteria 2842264693 2842267884 195
209 iso_pu_bacteria 2842271015 2842276109 195
210 iso_pu_bacteria 2842278818 2842283928 195
211 iso_pu_bacteria 2842291075 2842295409 195
212 iso_pu_bacteria 2842304105 2842310533 195
213 iso_pu_bacteria 2842311132 2842311911 195
214 iso_pu_bacteria 2842317721 2842319293 195
215 iso_pu_bacteria 2842370503 2842375953 195
216 iso_pu_bacteria 2842377471 2842381815 195
217 iso_pu_bacteria 2842384541 2842388878 195
218 iso_pu_bacteria 2842395702 2842396773 195
219 iso_pu_bacteria 2842422224 2842425317 195
220 iso_pu_bacteria 2842428310 2842432047 195
221 iso_pu_bacteria 2842434925 2842438159 195
222 iso_pu_bacteria 2842441272 2842443855 195
223 iso_pu_bacteria 2842447887 2842449882 195
224 iso_pu_bacteria 2842462802 2842466145 195
225 iso_pu_bacteria 2842469257 2842472871 195
226 iso_pu_bacteria 2842489311 2842491740 195
227 iso_pu_bacteria 2842495871 2842502041 195
228 iso_pu_bacteria 2842521101 2842521921 195
229 iso_pu_bacteria 2844454524 2844461315 195
230 iso_pu_bacteria 2857516855 2857522339 195
231 iso_pu_bacteria 2919100787 2919103361 195
232 iso_pu_bacteria 2933016740 2933019198 195
233 iso_pu_bacteria 2933570622 2933577044 195
234 iso_pu_bacteria 2933586486 2933590602 195
235 iso_pu_bacteria 2933599457 2933602480 195
236 iso_pu_bacteria 2935894831 2935898372 195
237 iso_pu_bacteria 2935901341 2935906810 195
238 iso_pu_bacteria 2936367885 2936370538 195
239 iso_pu_bacteria 2936375103 2936378197 195
240 iso_pu_bacteria 2936381700 2936384295 195
241 iso_pu_bacteria 2996893221 2996896681 195
242 iso_pu_bacteria 3005445848 3005451526 195
243 iso_pu_bacteria 639633055 639651434 195
244 iso_pu_bacteria 8005282627 8005287958 195
245 iso_pu_bacteria 8005289223 8005290529 195
246 iso_pu_bacteria 8005301065 8005305174 195
247 iso_pu_bacteria 8005307578 8005313267 195
248 iso_pu_bacteria 8005376324 8005382207 195
249 iso_pu_bacteria 8005430974 8005431353 195
250 iso_pu_bacteria 8005460587 8005466651 195
251 iso_pu_bacteria 8005556819 8005562014 195
252 iso_pu_bacteria 8005563573 8005567246 195
253 iso_pu_bacteria 8005570704 8005576190 195
254 iso_pu_bacteria 8005619151 8005625479 195
255 iso_pu_bacteria 8005626139 8005630464 195
256 iso_pu_bacteria 8005688590 8005689196 195
257 iso_pu_bacteria 8005695170 8005696955 195
258 iso_pu_bacteria 8018127388 8018127715 195
259 iso_pu_bacteria 8018163183 8018165806 195
260 iso_pu_bacteria 8023680758 8023688413 195
261 iso_pu_bacteria 8024479707 8024484057 195
262 iso_pu_bacteria 8024501048 8024505415 195
263 iso_pu_bacteria 8056382006 8056383167 195
264 iso_pu_bacteria 8057874678 8057880741 195
265 3300005435 Ga0070714_100049991 Ga0070714_1000499913 196
266 3300005983 Ga0081540_1007285 Ga0081540_10072854 196
267 3300037466 Ga0395898_1053351 Ga0395898_1053351_77_697 196
268 iso_pu_bacteria 2503198000 2503203914 196
269 iso_pu_bacteria 2508501127 2509139811 196
270 iso_pu_bacteria 2509276018 2509369298 196
271 iso_pu_bacteria 2510065059 2510316813 196
272 iso_pu_bacteria 2510461069 2510840788 196
273 iso_pu_bacteria 2510917022 2511132888 196
274 iso_pu_bacteria 2510917028 2511184201 196
275 iso_pu_bacteria 2512875016 2512929288 196
276 iso_pu_bacteria 2512875024 2512964100 196
277 iso_pu_bacteria 2513237090 2513611405 196
278 iso_pu_bacteria 2513237164 2514034157 196
279 iso_pu_bacteria 2513237305 2514421329 196
280 iso_pu_bacteria 2513237351 2514586067 196
281 iso_pu_bacteria 2516143018 2516207837 196
282 iso_pu_bacteria 2524023209 2524457142 196
283 iso_pu_bacteria 2534681796 2535519968 196
284 iso_pu_bacteria 2582581283 2585169667 196
285 iso_pu_bacteria 2582581294 2585202816 196
286 iso_pu_bacteria 2582581299 2585228136 196
287 iso_pu_bacteria 2582581304 2585255837 196
288 iso_pu_bacteria 2582581306 2585267280 196
289 iso_pu_bacteria 2582581307 2585272397 196
290 iso_pu_bacteria 2582581308 2585278459 196
291 iso_pu_bacteria 2582581315 2585324697 196
292 iso_pu_bacteria 2582581316 2585332129 196
293 iso_pu_bacteria 2582581865 2585386349 196
294 iso_pu_bacteria 2582581866 2585393373 196
295 iso_pu_bacteria 2582581867 2585401183 196
296 iso_pu_bacteria 2585427527 2585535499 196
297 iso_pu_bacteria 2585427530 2585552244 196
298 iso_pu_bacteria 2585427531 2585561540 196
299 iso_pu_bacteria 2585427590 2585821668 196
300 iso_pu_bacteria 2585427594 2585847617 196
301 iso_pu_bacteria 2585427608 2585899388 196
302 iso_pu_bacteria 2585427609 2585906768 196
303 iso_pu_bacteria 2585427633 2585992471 196
304 iso_pu_bacteria 2585427634 2586003223 196
305 iso_pu_bacteria 2585428125 2587982189 196
306 iso_pu_bacteria 2588253730 2588514843 196
307 iso_pu_bacteria 2599185156 2599335920 196
308 iso_pu_bacteria 2599185236 2599720507 196
309 iso_pu_bacteria 2599185301 2599936861 196
310 iso_pu_bacteria 2599185352 2600197969 196
311 iso_pu_bacteria 2615840626 2616307977 196
312 iso_pu_bacteria 2615840698 2616552552 196
313 iso_pu_bacteria 2617270742 2617381708 196
314 iso_pu_bacteria 2643221557 2643806950 196
315 iso_pu_bacteria 2643221595 2643986296 196
316 iso_pu_bacteria 2643221599 2644006751 196
317 iso_pu_bacteria 2643221607 2644050399 196
318 iso_pu_bacteria 2643221610 2644068094 196
319 iso_pu_bacteria 2643221618 2644110445 196
320 iso_pu_bacteria 2643221623 2644130504 196
321 iso_pu_bacteria 2643221626 2644144980 196
322 iso_pu_bacteria 2643221627 2644152528 196
323 iso_pu_bacteria 2643221634 2644191661 196
324 iso_pu_bacteria 2643221636 2644205627 196
325 iso_pu_bacteria 2643221643 2644242031 196
326 iso_pu_bacteria 2643221653 2644299452 196
327 iso_pu_bacteria 2643221655 2644307197 196
328 iso_pu_bacteria 2643221659 2644337081 196
329 iso_pu_bacteria 2643221668 2644380053 196
330 iso_pu_bacteria 2643221675 2644419002 196
331 iso_pu_bacteria 2643221680 2644452383 196
332 iso_pu_bacteria 2643221686 2644483317 196
333 iso_pu_bacteria 2643221688 2644495120 196
334 iso_pu_bacteria 2643221689 2644499525 196
335 iso_pu_bacteria 2643221698 2644540595 196
336 iso_pu_bacteria 2643221712 2644613277 196
337 iso_pu_bacteria 2643221719 2644657680 196
338 iso_pu_bacteria 2643221723 2644674729 196
339 iso_pu_bacteria 2643221726 2644688225 196
340 iso_pu_bacteria 2643221736 2644747141 196
341 iso_pu_bacteria 2657244999 2657686010 196
342 iso_pu_bacteria 2667528174 2671112972 196
343 iso_pu_bacteria 2687453392 2688600616 196
344 iso_pu_bacteria 2693429783 2694630965 196
345 iso_pu_bacteria 2693429784 2694636537 196
346 iso_pu_bacteria 2721755686 2723575279 196
347 iso_pu_bacteria 2738541293 2738803959 196
348 iso_pu_bacteria 2738543024 2739310167 196
349 iso_pu_bacteria 2751185821 2753463196 196
350 iso_pu_bacteria 2756170246 2756672778 196
351 iso_pu_bacteria 2765235802 2765466788 196
352 iso_pu_bacteria 2767802442 2770196203 196
353 iso_pu_bacteria 2775507266 2778178191 196
354 iso_pu_bacteria 2791355091 2792621421 196
355 iso_pu_bacteria 2791355092 2792627891 196
356 iso_pu_bacteria 2791355094 2792643645 196
357 iso_pu_bacteria 2791355123 2792745811 196
358 iso_pu_bacteria 2802429268 2804755284 196
359 iso_pu_bacteria 2818991272 2819244028 196
360 iso_pu_bacteria 2818991448 2819610264 196
361 iso_pu_bacteria 2818991453 2819640128 196
362 iso_pu_bacteria 2821123053 2821128946 196
363 iso_pu_bacteria 2838029111 2838033815 196
364 iso_pu_bacteria 2838074704 2838075890 196
365 iso_pu_bacteria 2838736955 2838742261 196
366 iso_pu_bacteria 2840764183 2840765160 196
367 iso_pu_bacteria 2841734538 2841735475 196
368 iso_pu_bacteria 2841760612 2841764305 196
369 iso_pu_bacteria 2841840854 2841846117 196
370 iso_pu_bacteria 2842140634 2842145821 196
371 iso_pu_bacteria 2842298080 2842299304 196
372 iso_pu_bacteria 2842357229 2842358771 196
373 iso_pu_bacteria 2842475841 2842480562 196
374 iso_pu_bacteria 2842482326 2842484135 196
375 iso_pu_bacteria 2842502639 2842507157 196
376 iso_pu_bacteria 2842509118 2842512202 196
377 iso_pu_bacteria 2842871566 2842874876 196
378 iso_pu_bacteria 2842922631 2842926926 196
379 iso_pu_bacteria 2844002411 2844005235 196
380 iso_pu_bacteria 2844009547 2844015966 196
381 iso_pu_bacteria 2844104063 2844108240 196
382 iso_pu_bacteria 2844163670 2844167869 196
383 iso_pu_bacteria 2851182111 2851185582 196
384 iso_pu_bacteria 2851246043 2851250740 196
385 iso_pu_bacteria 2852387548 2852394544 196
386 iso_pu_bacteria 2854911287 2854916456 196
387 iso_pu_bacteria 2855872281 2855875565 196
388 iso_pu_bacteria 2856314179 2856314233 196
389 iso_pu_bacteria 2856320880 2856326371 196
390 iso_pu_bacteria 2856334872 2856339486 196
391 iso_pu_bacteria 2856342000 2856347857 196
392 iso_pu_bacteria 2856349417 2856355923 196
393 iso_pu_bacteria 2856364286 2856369362 196
394 iso_pu_bacteria 2857349434 2857351256 196
395 iso_pu_bacteria 2857367948 2857372264 196
396 iso_pu_bacteria 2857531043 2857536397 196
397 iso_pu_bacteria 2869234852 2869241147 196
398 iso_pu_bacteria 2869242130 2869248847 196
399 iso_pu_bacteria 2869249662 2869255669 196
400 iso_pu_bacteria 2869256925 2869256979 196
401 iso_pu_bacteria 2869264136 2869268482 196
402 iso_pu_bacteria 2869271264 2869273579 196
403 iso_pu_bacteria 2869278585 2869284005 196
404 iso_pu_bacteria 2869285874 2869286565 196
405 iso_pu_bacteria 2871429161 2871434718 196
406 iso_pu_bacteria 2871435913 2871442080 196
407 iso_pu_bacteria 2871451962 2871456854 196
408 iso_pu_bacteria 2871459585 2871460648 196
409 iso_pu_bacteria 2871466892 2871472991 196
410 iso_pu_bacteria 2871474448 2871476186 196
411 iso_pu_bacteria 2871481445 2871482351 196
412 iso_pu_bacteria 2871488783 2871494634 196
413 iso_pu_bacteria 2871495908 2871496612 196
414 iso_pu_bacteria 2874109183 2874111248 196
415 iso_pu_bacteria 2874116593 2874122885 196
416 iso_pu_bacteria 2874123672 2874123918 196
417 iso_pu_bacteria 2874131515 2874133118 196
418 iso_pu_bacteria 2874139085 2874144623 196
419 iso_pu_bacteria 2874146452 2874149923 196
420 iso_pu_bacteria 2874155637 2874158181 196
421 iso_pu_bacteria 2874162495 2874164323 196
422 iso_pu_bacteria 2874168670 2874173908 196
423 iso_pu_bacteria 2876363079 2876367156 196
424 iso_pu_bacteria 2876369609 2876372904 196
425 iso_pu_bacteria 2876377896 2876384484 196
426 iso_pu_bacteria 2876386047 2876391188 196
427 iso_pu_bacteria 2876392853 2876398339 196
428 iso_pu_bacteria 2876399893 2876404072 196
429 iso_pu_bacteria 2876406927 2876411239 196
430 iso_pu_bacteria 2876413966 2876416385 196
431 iso_pu_bacteria 2876420981 2876424022 196
432 iso_pu_bacteria 2878730984 2878736736 196
433 iso_pu_bacteria 2878738818 2878744001 196
434 iso_pu_bacteria 2878745973 2878751851 196
435 iso_pu_bacteria 2878753008 2878758784 196
436 iso_pu_bacteria 2878760144 2878760839 196
437 iso_pu_bacteria 2878767105 2878767802 196
438 iso_pu_bacteria 2878774303 2878779411 196
439 iso_pu_bacteria 2878781027 2878786472 196
440 iso_pu_bacteria 2878788777 2878794716 196
441 iso_pu_bacteria 2881147464 2881151213 196
442 iso_pu_bacteria 2881155292 2881161711 196
443 iso_pu_bacteria 2881161766 2881167428 196
444 iso_pu_bacteria 2881845957 2881846175 196
445 iso_pu_bacteria 2881853255 2881859247 196
446 iso_pu_bacteria 2881861095 2881862455 196
447 iso_pu_bacteria 2882632389 2882636173 196
448 iso_pu_bacteria 2882912400 2882915096 196
449 iso_pu_bacteria 2885305155 2885309325 196
450 iso_pu_bacteria 2885312484 2885312792 196
451 iso_pu_bacteria 2885312484 2885318662 196
452 iso_pu_bacteria 2885318864 2885319397 196
453 iso_pu_bacteria 2885326080 2885328726 196
454 iso_pu_bacteria 2885334103 2885338561 196
455 iso_pu_bacteria 2885342637 2885349851 196
456 iso_pu_bacteria 2888337043 2888342058 196
457 iso_pu_bacteria 2888350351 2888355651 196
458 iso_pu_bacteria 2889010040 2889010587 196
459 iso_pu_bacteria 2889016732 2889017711 196
460 iso_pu_bacteria 2896384573 2896388333 196
461 iso_pu_bacteria 2903448605 2903453376 196
462 iso_pu_bacteria 2903492973 2903503977 196
463 iso_pu_bacteria 2903492973 2903504797 196
464 iso_pu_bacteria 2903513507 2903520766 196
465 iso_pu_bacteria 2903521522 2903526647 196
466 iso_pu_bacteria 2903528002 2903530734 196
467 iso_pu_bacteria 2903540706 2903541410 196
468 iso_pu_bacteria 2904578770 2904581687 196
469 iso_pu_bacteria 2904659560 2904664894 196
470 iso_pu_bacteria 2906308376 2906314249 196
471 iso_pu_bacteria 2906321335 2906327415 196
472 iso_pu_bacteria 2906354277 2906355484 196
473 iso_pu_bacteria 2906363423 2906368798 196
474 iso_pu_bacteria 2906370794 2906373097 196
475 iso_pu_bacteria 2906378014 2906385045 196
476 iso_pu_bacteria 2906386501 2906392054 196
477 iso_pu_bacteria 2906393657 2906395566 196
478 iso_pu_bacteria 2906401398 2906403703 196
479 iso_pu_bacteria 2906408224 2906412257 196
480 iso_pu_bacteria 2906414383 2906414655 196
481 iso_pu_bacteria 2906427513 2906435362 196
482 iso_pu_bacteria 2913295892 2913296007 196
483 iso_pu_bacteria 2915986958 2915987881 196
484 iso_pu_bacteria 2919119836 2919123351 196
485 iso_pu_bacteria 2919408235 2919412761 196
486 iso_pu_bacteria 2920760137 2920764441 196
487 iso_pu_bacteria 2920822456 2920828035 196
488 iso_pu_bacteria 2921257292 2921263294 196
489 iso_pu_bacteria 2922130491 2922135743 196
490 iso_pu_bacteria 2922151315 2922152164 196
491 iso_pu_bacteria 2922172374 2922175458 196
492 iso_pu_bacteria 2922178524 2922181336 196
493 iso_pu_bacteria 2922185730 2922191285 196
494 iso_pu_bacteria 2924193448 2924198408 196
495 iso_pu_bacteria 2924207177 2924210339 196
496 iso_pu_bacteria 2924228884 2924230740 196
497 iso_pu_bacteria 2924710171 2924716395 196
498 iso_pu_bacteria 2924733363 2924738807 196
499 iso_pu_bacteria 2924741084 2924743895 196
500 iso_pu_bacteria 2924748358 2924751997 196
501 iso_pu_bacteria 2924762789 2924765017 196
502 iso_pu_bacteria 2924776078 2924781918 196
503 iso_pu_bacteria 2924784321 2924788986 196
504 iso_pu_bacteria 2929138655 2929143785 196
505 iso_pu_bacteria 2937023124 2937024432 196
506 iso_pu_bacteria 2937071275 2937074206 196
507 iso_pu_bacteria 2937813078 2937815641 196
508 iso_pu_bacteria 2937822353 2937824351 196
509 iso_pu_bacteria 2937836603 2937842291 196
510 iso_pu_bacteria 2937843397 2937848065 196
511 iso_pu_bacteria 2937848649 2937850324 196
512 iso_pu_bacteria 2937861824 2937868711 196
513 iso_pu_bacteria 2937868953 2937874243 196
514 iso_pu_bacteria 2937877337 2937884753 196
515 iso_pu_bacteria 2937972304 2937978026 196
516 iso_pu_bacteria 2937980651 2937983932 196
517 iso_pu_bacteria 2937994558 2937995266 196
518 iso_pu_bacteria 2938014810 2938017057 196
519 iso_pu_bacteria 2941499720 2941503026 196
520 iso_pu_bacteria 2957382221 2957385881 196
521 iso_pu_bacteria 2957395598 2957400616 196
522 iso_pu_bacteria 2957402308 2957406088 196
523 iso_pu_bacteria 2957415311 2957418415 196
524 iso_pu_bacteria 2958034702 2958040394 196
525 iso_pu_bacteria 2958041894 2958055242 196
526 iso_pu_bacteria 2958064165 2958068239 196
527 iso_pu_bacteria 2958071322 2958075527 196
528 iso_pu_bacteria 2958084443 2958092062 196
529 iso_pu_bacteria 2958100919 2958107279 196
530 iso_pu_bacteria 2958108152 2958114631 196
531 iso_pu_bacteria 2958122699 2958127823 196
532 iso_pu_bacteria 2958130278 2958130968 196
533 iso_pu_bacteria 2958137437 2958143344 196
534 iso_pu_bacteria 2958144490 2958144770 196
535 iso_pu_bacteria 2958158011 2958162394 196
536 iso_pu_bacteria 2958165035 2958165742 196
537 iso_pu_bacteria 2958172287 2958176949 196
538 iso_pu_bacteria 2958179912 2958184889 196
539 iso_pu_bacteria 2960584000 2960584573 196
540 iso_pu_bacteria 2961077736 2961083056 196
541 iso_pu_bacteria 2961114664 2961119893 196
542 iso_pu_bacteria 2961127735 2961132620 196
543 iso_pu_bacteria 2961136820 2961140458 196
544 iso_pu_bacteria 2961163497 2961164201 196
545 iso_pu_bacteria 2961170736 2961176138 196
546 iso_pu_bacteria 2961183825 2961190523 196
547 iso_pu_bacteria 2963644680 2963649949 196
548 iso_pu_bacteria 2964615318 2964620960 196
549 iso_pu_bacteria 2964663802 2964667280 196
550 iso_pu_bacteria 2964705432 2964707354 196
551 iso_pu_bacteria 2965018300 2965019190 196
552 iso_pu_bacteria 2965025482 2965027010 196
553 iso_pu_bacteria 2965032056 2965037108 196
554 iso_pu_bacteria 2965040258 2965045882 196
555 iso_pu_bacteria 2965047637 2965048870 196
556 iso_pu_bacteria 2965089291 2965095850 196
557 iso_pu_bacteria 2965110997 2965111510 196
558 iso_pu_bacteria 2965119406 2965126638 196
559 iso_pu_bacteria 2967755722 2967756064 196
560 iso_pu_bacteria 2967996073 2968002025 196
561 iso_pu_bacteria 2968003550 2968008951 196
562 iso_pu_bacteria 2968016561 2968021980 196
563 iso_pu_bacteria 2968083720 2968086740 196
564 iso_pu_bacteria 2968110612 2968116250 196
565 iso_pu_bacteria 2968117919 2968119851 196
566 iso_pu_bacteria 2968138860 2968141242 196
567 iso_pu_bacteria 2968171901 2968172601 196
568 iso_pu_bacteria 2970082768 2970084708 196
569 iso_pu_bacteria 2970102677 2970103836 196
570 iso_pu_bacteria 2970164137 2970166147 196
571 iso_pu_bacteria 2970469710 2970474570 196
572 iso_pu_bacteria 2970489779 2970491871 196
573 iso_pu_bacteria 2970503327 2970508804 196
574 iso_pu_bacteria 2970510686 2970514709 196
575 iso_pu_bacteria 2970524798 2970528009 196
576 iso_pu_bacteria 2970532167 2970538562 196
577 iso_pu_bacteria 2970547951 2970549748 196
578 iso_pu_bacteria 2970554993 2970555694 196
579 iso_pu_bacteria 2970593180 2970598617 196
580 iso_pu_bacteria 2970619444 2970626418 196
581 iso_pu_bacteria 2970627176 2970628632 196
582 iso_pu_bacteria 2977821940 2977827324 196
583 iso_pu_bacteria 2977828996 2977836594 196
584 iso_pu_bacteria 2977843712 2977845877 196
585 iso_pu_bacteria 2977851361 2977855681 196
586 iso_pu_bacteria 2977864932 2977867192 196
587 iso_pu_bacteria 2977872689 2977873275 196
588 iso_pu_bacteria 2977898635 2977907138 196
589 iso_pu_bacteria 2977907340 2977910758 196
590 iso_pu_bacteria 2977915119 2977919549 196
591 iso_pu_bacteria 2977922695 2977927987 196
592 iso_pu_bacteria 2977935797 2977941163 196
593 iso_pu_bacteria 2977942078 2977942649 196
594 iso_pu_bacteria 2977950692 2977952658 196
595 iso_pu_bacteria 2977957713 2977960404 196
596 iso_pu_bacteria 2977971508 2977974372 196
597 iso_pu_bacteria 2977986579 2977991677 196
598 iso_pu_bacteria 2979710463 2979717577 196
599 iso_pu_bacteria 2979742915 2979751574 196
600 iso_pu_bacteria 2979764755 2979767271 196
601 iso_pu_bacteria 2979772303 2979779213 196
602 iso_pu_bacteria 2979793036 2979797487 196
603 iso_pu_bacteria 2979808191 2979811548 196
604 iso_pu_bacteria 2987636660 2987638440 196
605 iso_pu_bacteria 2987645492 2987648048 196
606 iso_pu_bacteria 2987652177 2987654549 196
607 iso_pu_bacteria 2987659509 2987660207 196
608 iso_pu_bacteria 2987666974 2987667923 196
609 iso_pu_bacteria 2987673487 2987675237 196
610 iso_pu_bacteria 2989349275 2989351861 196
611 iso_pu_bacteria 2989776772 2989780564 196
612 iso_pu_bacteria 2996348954 2996353979 196
613 iso_pu_bacteria 2996386984 2996391262 196
614 iso_pu_bacteria 3000135777 3000141080 196
615 iso_pu_bacteria 3002141150 3002146108 196
616 iso_pu_bacteria 3004167301 3004171489 196
617 iso_pu_bacteria 3004188549 3004189256 196
618 iso_pu_bacteria 3004195979 3004200308 196
619 iso_pu_bacteria 3004203850 3004205317 196
620 iso_pu_bacteria 3004211236 3004213629 196
621 iso_pu_bacteria 3004218560 3004223220 196
622 iso_pu_bacteria 3004232784 3004239099 196
623 iso_pu_bacteria 3004239961 3004246458 196
624 iso_pu_bacteria 3004248173 3004251384 196
625 iso_pu_bacteria 3004268573 3004270281 196
626 iso_pu_bacteria 3004275668 3004280647 196
627 iso_pu_bacteria 3004289098 3004291654 196
628 iso_pu_bacteria 3004334049 3004338798 196
629 iso_pu_bacteria 3005409236 3005414027 196
630 iso_pu_bacteria 3005416602 3005421048 196
631 iso_pu_bacteria 3005452660 3005458120 196
632 iso_pu_bacteria 637000159 637079046 196
633 iso_pu_bacteria 640427133 640487206 196
634 iso_pu_bacteria 649633066 649875068 196
635 iso_pu_bacteria 651053060 651175083 196
636 iso_pu_bacteria 8004300914 8004303613 196
637 iso_pu_bacteria 8004361976 8004365936 196
638 iso_pu_bacteria 8004374579 8004380305 196
639 iso_pu_bacteria 8004387939 8004393739 196
640 iso_pu_bacteria 8004633249 8004639422 196
641 iso_pu_bacteria 8004640170 8004640939 196
642 iso_pu_bacteria 8004695233 8004696791 196
643 iso_pu_bacteria 8004714634 8004720507 196
644 iso_pu_bacteria 8004727605 8004733788 196
645 iso_pu_bacteria 8005246636 8005250284 196
646 iso_pu_bacteria 8005258706 8005263958 196
647 iso_pu_bacteria 8005314921 8005319217 196
648 iso_pu_bacteria 8005484373 8005489450 196
649 iso_pu_bacteria 8005542996 8005547693 196
650 iso_pu_bacteria 8005645114 8005648038 196
651 iso_pu_bacteria 8046767195 8046774622 196
652 iso_pu_bacteria 8054558443 8054561604 196
653 iso_pu_bacteria 8055617313 8055620118 196
654 iso_pu_bacteria 8057529695 8057533632 196
655 iso_pu_bacteria 8057575449 8057577721 196
656 3300006177 Ga0075362_10134956 Ga0075362_101349562 197
657 3300048913 Ga0496110_0297235 Ga0496110_0297235_663_1268 197
658 3300048924 Ga0496121_0179798 Ga0496121_0179798_378_983 197
659 3300048927 Ga0496124_0295942 Ga0496124_0295942_464_1066 197
660 3300048928 Ga0496125_0000115 Ga0496125_0000115_168049_168654 197
661 iso_pu_bacteria 2643221564 2643839631 197
662 iso_pu_bacteria 2643221580 2643909926 197
663 iso_pu_bacteria 2643221674 2644412485 197
664 iso_pu_bacteria 2838042994 2838046515 197
665 iso_pu_bacteria 2841864319 2841869656 197
666 iso_pu_bacteria 2842285085 2842289811 197
667 iso_pu_bacteria 2842341865 2842343897 197
668 iso_pu_bacteria 2842363717 2842368274 197
669 iso_pu_bacteria 2842402390 2842407048 197
670 iso_pu_bacteria 2842409023 2842413941 197
671 iso_pu_bacteria 2842415677 2842420582 197
672 iso_pu_bacteria 2996310559 2996315595 197
673 iso_pu_bacteria 3003930520 3003931536 197
674 iso_pu_bacteria 8005275841 8005277039 197
675 iso_pu_bacteria 8005382845 8005388560 197
676 iso_pu_bacteria 8005395548 8005399347 197
677 iso_pu_bacteria 8018176218 8018182855 197
678 iso_pu_bacteria 8056375014 8056375283 197
679 3300042007 Ga0439449_0033819 Ga0439449_0033819_11_637 198
680 3300053134 Ga0500658_0000458 Ga0500658_0000458_11435_12043 198
681 iso_pu_bacteria 2643221551 2643776189 198
682 iso_pu_bacteria 2643221555 2643794636 198
683 3300002739 JGI25158J39367_1000347 JGI25158J39367_10003474 199
684 3300002741 JGI25157J39369_1000841 JGI25157J39369_10008417 199
685 3300002773 JGI25152J39213_1005724 JGI25152J39213_10057242 199
686 3300002773 JGI25152J39213_1005868 JGI25152J39213_10058682 199
687 3300002773 JGI25152J39213_1008747 JGI25152J39213_10087473 199
688 3300002774 JGI25150J39212_1010813 JGI25150J39212_10108132 199
689 3300002774 JGI25150J39212_1016900 JGI25150J39212_10169002 199
690 3300002987 JGI25159J45721_1000259 JGI25159J45721_100025925 199
691 3300003187 JGI25151J46595_10000274 JGI25151J46595_1000027448 199
692 3300003187 JGI25151J46595_10018172 JGI25151J46595_100181722 199
693 3300003215 JGI25153J46596_10012993 JGI25153J46596_100129932 199
694 3300003215 JGI25153J46596_10013350 JGI25153J46596_100133502 199
695 3300003323 rootH1_10104478 rootH1_101044782 199
696 3300003354 JGI25160J50197_1001878 JGI25160J50197_10018781 199
697 3300003354 JGI25160J50197_1006181 JGI25160J50197_10061813 199
698 3300003374 JGI25161J50226_1000025 JGI25161J50226_100002571 199
699 3300003771 Ga0055526_1001208 Ga0055526_10012087 199
700 3300003771 Ga0055526_1006973 Ga0055526_10069732 199
701 3300003775 Ga0055524_1019755 Ga0055524_10197552 199
702 3300003790 Ga0055528_1001036 Ga0055528_100103618 199
703 3300003790 Ga0055528_1001440 Ga0055528_100144012 199
704 3300003790 Ga0055528_1026575 Ga0055528_10265752 199
705 3300003790 Ga0055528_1036732 Ga0055528_10367322 199
706 3300003790 Ga0055528_1047861 Ga0055528_10478612 199
707 3300003792 Ga0055540_1000050 Ga0055540_100005035 199
708 3300003792 Ga0055540_1019446 Ga0055540_10194461 199
709 3300004625 Ga0055543_1000021 Ga0055543_1000021124 199
710 3300004625 Ga0055543_1002242 Ga0055543_10022422 199
711 3300005262 Ga0065165_1024912 Ga0065165_10249124 199
712 3300005262 Ga0065165_1062300 Ga0065165_10623001 199
713 3300005338 Ga0068868_100107875 Ga0068868_1001078751 199
714 3300005355 Ga0070671_100025227 Ga0070671_1000252275 199
715 3300005367 Ga0070667_100199143 Ga0070667_1001991432 199
716 3300005841 Ga0068863_100598522 Ga0068863_1005985222 199
717 3300006038 Ga0075365_10008006 Ga0075365_100080065 199
718 3300006048 Ga0075363_100175649 Ga0075363_1001756492 199
719 3300006177 Ga0075362_10013397 Ga0075362_100133975 199
720 3300006178 Ga0075367_10022064 Ga0075367_100220645 199
721 3300006186 Ga0075369_10158560 Ga0075369_101585601 199
722 3300006195 Ga0075366_10050942 Ga0075366_100509421 199
723 3300006237 Ga0097621_100275350 Ga0097621_1002753502 199
724 3300006353 Ga0075370_10004269 Ga0075370_100042693 199
725 3300009093 Ga0105240_10079788 Ga0105240_100797883 199
726 3300009765 Ga0123341_1000025 Ga0123341_100002512 199
727 3300009766 Ga0123342_1015842 Ga0123342_10158422 199
728 3300013297 Ga0157378_10003823 Ga0157378_100038233 199
729 3300025208 Ga0209436_100044 Ga0209436_10004425 199
730 3300025245 Ga0207425_1000563 Ga0207425_10005636 199
731 3300025250 Ga0209026_1000025 Ga0209026_100002529 199
732 3300025256 Ga0209759_1000197 Ga0209759_10001974 199
733 3300025258 Ga0209129_1001297 Ga0209129_10012979 199
734 3300025258 Ga0209129_1004815 Ga0209129_10048153 199
735 3300025258 Ga0209129_1006772 Ga0209129_10067722 199
736 3300025258 Ga0209129_1006906 Ga0209129_10069062 199
737 3300025273 Ga0209673_1000023 Ga0209673_1000023133 199
738 3300025273 Ga0209673_1000212 Ga0209673_100021273 199
739 3300025273 Ga0209673_1000738 Ga0209673_100073838 199
740 3300025273 Ga0209673_1001452 Ga0209673_100145225 199
741 3300025273 Ga0209673_1080594 Ga0209673_10805942 199
742 3300025284 Ga0209130_1000001 Ga0209130_1000001145 199
743 3300025291 Ga0209675_1043675 Ga0209675_10436751 199
744 3300025294 Ga0209025_1000300 Ga0209025_100030072 199
745 3300025294 Ga0209025_1002603 Ga0209025_10026032 199
746 3300025294 Ga0209025_1004543 Ga0209025_10045433 199
747 3300025295 Ga0209564_1000112 Ga0209564_1000112150 199
748 3300025295 Ga0209564_1001278 Ga0209564_10012788 199
749 3300025295 Ga0209564_1001823 Ga0209564_10018238 199
750 3300025295 Ga0209564_1011616 Ga0209564_10116162 199
751 3300025297 Ga0209758_1000053 Ga0209758_1000053260 199
752 3300025297 Ga0209758_1001669 Ga0209758_10016696 199
753 3300025297 Ga0209758_1001814 Ga0209758_10018146 199
754 3300025297 Ga0209758_1006808 Ga0209758_10068082 199
755 3300025297 Ga0209758_1011938 Ga0209758_10119385 199
756 3300025297 Ga0209758_1054398 Ga0209758_10543982 199
757 3300025298 Ga0209050_1021630 Ga0209050_10216302 199
758 3300025299 Ga0209256_1000682 Ga0209256_100068230 199
759 3300025299 Ga0209256_1005449 Ga0209256_10054495 199
760 3300025299 Ga0209256_1018918 Ga0209256_10189182 199
761 3300025299 Ga0209256_1035268 Ga0209256_10352682 199
762 3300025302 Ga0207426_1000005 Ga0207426_1000005750 199
763 3300025302 Ga0207426_1000035 Ga0207426_1000035349 199
764 3300025303 Ga0209051_1000249 Ga0209051_100024952 199
765 3300025303 Ga0209051_1003488 Ga0209051_10034886 199
766 3300025303 Ga0209051_1015466 Ga0209051_10154664 199
767 3300025303 Ga0209051_1018238 Ga0209051_10182382 199
768 3300025304 Ga0209257_1015285 Ga0209257_10152852 199
769 3300025304 Ga0209257_1033816 Ga0209257_10338162 199
770 3300025913 Ga0207695_10063883 Ga0207695_100638834 199
771 3300025931 Ga0207644_10019053 Ga0207644_100190532 199
772 3300025986 Ga0207658_10148591 Ga0207658_101485912 199
773 3300026023 Ga0207677_10433647 Ga0207677_104336472 199
774 3300026075 Ga0207708_10252510 Ga0207708_102525101 199
775 3300026088 Ga0207641_10345476 Ga0207641_103454763 199
776 3300027866 Ga0209813_10043387 Ga0209813_100433872 199
777 3300028379 Ga0268266_11051058 Ga0268266_110510581 199
778 3300028794 Ga0307515_10005525 Ga0307515_1000552515 199
779 3300031456 Ga0307513_10018285 Ga0307513_100182856 199
780 3300031901 Ga0307406_10285536 Ga0307406_102855362 199
781 3300041404 Ga0439436_0060725 Ga0439436_0060725_385_996 199
782 3300041413 Ga0439465_0017127 Ga0439465_0017127_227_838 199
783 3300041413 Ga0439465_0089500 Ga0439465_0089500_103_714 199
784 3300041491 Ga0451833_0022715 Ga0451833_0022715_414_1025 199
785 3300041491 Ga0451833_0262634 Ga0451833_0262634_38_649 199
786 3300041492 Ga0451835_1112531 Ga0451835_1112531_463_1074 199
787 3300041494 Ga0451837_1671410 Ga0451837_1671410_16_627 199
788 3300041501 Ga0451845_0221428 Ga0451845_0221428_669_1280 199
789 3300041501 Ga0451845_0821064 Ga0451845_0821064_183_794 199
790 3300041512 Ga0451853_1015694 Ga0451853_1015694_111_722 199
791 3300042007 Ga0439449_0070138 Ga0439449_0070138_648_1259 199
792 3300046474 Ga0495605_0000656 Ga0495605_0000656_13706_14317 199
793 3300046474 Ga0495605_0072931 Ga0495605_0072931_454_1065 199
794 3300046501 Ga0495607_0036759 Ga0495607_0036759_1150_1761 199
795 3300046506 Ga0495583_0036571 Ga0495583_0036571_972_1583 199
796 3300046507 Ga0495606_0168843 Ga0495606_0168843_50_661 199
797 3300046512 Ga0495610_0012498 Ga0495610_0012498_82_693 199
798 3300046518 Ga0495631_0000923 Ga0495631_0000923_302_913 199
799 3300046518 Ga0495631_0069673 Ga0495631_0069673_808_1419 199
800 3300046519 Ga0495632_0081758 Ga0495632_0081758_883_1494 199
801 3300046522 Ga0495643_0002915 Ga0495643_0002915_2743_3354 199
802 3300046522 Ga0495643_0007905 Ga0495643_0007905_1951_2562 199
803 3300046522 Ga0495643_0165626 Ga0495643_0165626_460_1071 199
804 3300046542 Ga0495597_0022857 Ga0495597_0022857_164_775 199
805 3300046558 Ga0495633_0200942 Ga0495633_0200942_225_836 199
806 3300046616 Ga0495668_0011868 Ga0495668_0011868_284_895 199
807 3300046648 Ga0495611_0018352 Ga0495611_0018352_208_819 199
808 3300046660 Ga0495625_0004259 Ga0495625_0004259_7731_8342 199
809 3300046810 Ga0495660_0062761 Ga0495660_0062761_16_627 199
810 3300046810 Ga0495660_0155778 Ga0495660_0155778_354_965 199
811 3300047320 Ga0495672_0049491 Ga0495672_0049491_1434_2045 199
812 3300048091 Ga0495626_0110637 Ga0495626_0110637_414_1025 199
813 3300048905 Ga0496102_0491432 Ga0496102_0491432_258_869 199
814 3300048909 Ga0496106_0000269 Ga0496106_0000269_1360_1971 199
815 3300048920 Ga0496117_0013051 Ga0496117_0013051_27_638 199
816 3300048921 Ga0496118_0013019 Ga0496118_0013019_343_954 199
817 3300048924 Ga0496121_0055728 Ga0496121_0055728_1992_2603 199
818 3300048926 Ga0496123_0230474 Ga0496123_0230474_190_801 199
819 3300048927 Ga0496124_0069789 Ga0496124_0069789_630_1241 199
820 3300048928 Ga0496125_0186218 Ga0496125_0186218_52_663 199
821 3300049568 Ga0501031_0280265 Ga0501031_0280265_85_696 199
822 3300049569 Ga0501032_0000023 Ga0501032_0000023_82309_82917 199
823 3300049569 Ga0501032_0231499 Ga0501032_0231499_341_952 199
824 3300049569 Ga0501032_0284598 Ga0501032_0284598_198_809 199
825 3300049570 Ga0501033_0000104 Ga0501033_0000104_18589_19197 199
826 3300049571 Ga0501034_0000116 Ga0501034_0000116_63526_64134 199
827 3300049572 Ga0501036_0000015 Ga0501036_0000015_63526_64134 199
828 3300049572 Ga0501036_0385722 Ga0501036_0385722_238_849 199
829 3300049573 Ga0501037_0000023 Ga0501037_0000023_63626_64234 199
830 3300049573 Ga0501037_0234782 Ga0501037_0234782_245_856 199
831 3300049574 Ga0501038_0000025 Ga0501038_0000025_63626_64234 199
832 3300049574 Ga0501038_0368599 Ga0501038_0368599_382_993 199
833 3300049575 Ga0501039_0000037 Ga0501039_0000037_63526_64134 199
834 3300049576 Ga0501040_0006421 Ga0501040_0006421_2146_2754 199
835 3300049579 Ga0501043_0000070 Ga0501043_0000070_6962_7570 199
836 3300049579 Ga0501043_0412182 Ga0501043_0412182_279_890 199
837 3300049581 Ga0501047_0002287 Ga0501047_0002287_2143_2751 199
838 3300049581 Ga0501047_0202116 Ga0501047_0202116_960_1571 199
839 3300049581 Ga0501047_0311468 Ga0501047_0311468_542_1153 199
840 3300049583 Ga0501067_0015101 Ga0501067_0015101_2640_3251 199
841 3300049586 Ga0501070_0022526 Ga0501070_0022526_3125_3733 199
842 3300049589 Ga0501073_0323530 Ga0501073_0323530_103_714 199
843 3300049590 Ga0501074_0157201 Ga0501074_0157201_168_776 199
844 3300049592 Ga0501076_0242941 Ga0501076_0242941_392_1003 199
845 3300049593 Ga0501077_0022616 Ga0501077_0022616_2941_3552 199
846 3300049744 Ga0501083_0010111 Ga0501083_0010111_2951_3562 199
847 3300049822 Ga0501035_0000074 Ga0501035_0000074_63507_64115 199
848 3300049822 Ga0501035_0159957 Ga0501035_0159957_193_804 199
849 3300049823 Ga0501044_0000069 Ga0501044_0000069_61841_62449 199
850 3300050494 nmdc:mga06z11_35364_c1 nmdc:mga06z11_35364_c1_1733_2344 199
851 3300050496 nmdc:mga07m45_10536_c1 nmdc:mga07m45_10536_c1_736_1347 199
852 3300053086 Ga0500578_0183781 Ga0500578_0183781_463_1074 199
853 3300053105 Ga0500557_001166 Ga0500557_001166_3270_3881 199
854 3300053109 Ga0500569_046751 Ga0500569_046751_163_774 199
855 3300053118 Ga0500594_0006266 Ga0500594_0006266_258_869 199
856 3300053129 Ga0500628_038589 Ga0500628_038589_102_713 199
857 3300053134 Ga0500658_0024481 Ga0500658_0024481_1300_1911 199
858 3300053139 Ga0500568_0000152 Ga0500568_0000152_15_626 199
859 3300053139 Ga0500568_0000695 Ga0500568_0000695_8578_9189 199
860 3300053151 Ga0500604_0065295 Ga0500604_0065295_113_724 199
861 3300053153 Ga0500616_0005593 Ga0500616_0005593_5441_6052 199
862 3300053153 Ga0500616_0012753 Ga0500616_0012753_3833_4444 199
863 3300053156 Ga0500622_0000185 Ga0500622_0000185_52840_53451 199
864 3300053160 Ga0500633_0019408 Ga0500633_0019408_1328_1939 199
865 3300054114 Ga0501084_0151587 Ga0501084_0151587_1003_1614 199
866 3300054114 Ga0501084_0237865 Ga0501084_0237865_481_1092 199
867 iso_pu_bacteria 2599185299 2599928601 199
868 iso_pu_bacteria 2648501693 2650898176 199
869 iso_pu_bacteria 2684622997 2686355180 199
870 iso_pu_bacteria 2808606414 2809127465 199
871 iso_pu_bacteria 2840878972 2840883342 199
872 iso_pu_bacteria 2847797336 2847798093 199
873 iso_pu_bacteria 2869169390 2869170286 199
874 iso_pu_bacteria 2884086401 2884088663 199
875 iso_pu_bacteria 2984494565 2984495084 199
876 iso_pu_bacteria 2990261002 2990263165 199
877 iso_pu_bacteria 8004592986 8004596638 199
878 3300001979 JGI24740J21852_10002540 JGI24740J21852_1000254010 200
879 3300001989 JGI24739J22299_10039807 JGI24739J22299_100398072 200
880 3300001989 JGI24739J22299_10068872 JGI24739J22299_100688721 200
881 3300002067 JGI24735J21928_10036100 JGI24735J21928_100361002 200
882 3300002705 JGI25156J39149_1000523 JGI25156J39149_10005239 200
883 3300002737 JGI25162J39368_1000656 JGI25162J39368_10006567 200
884 3300002737 JGI25162J39368_1000744 JGI25162J39368_100074415 200
885 3300002738 JGI25154J39366_1000435 JGI25154J39366_10004359 200
886 3300002739 JGI25158J39367_1007582 JGI25158J39367_10075822 200
887 3300002741 JGI25157J39369_1000562 JGI25157J39369_10005629 200
888 3300002773 JGI25152J39213_1000009 JGI25152J39213_1000009119 200
889 3300002773 JGI25152J39213_1003290 JGI25152J39213_10032905 200
890 3300002774 JGI25150J39212_1000016 JGI25150J39212_100001616 200
891 3300002987 JGI25159J45721_1000083 JGI25159J45721_100008340 200
892 3300002987 JGI25159J45721_1000466 JGI25159J45721_100046611 200
893 3300002987 JGI25159J45721_1000902 JGI25159J45721_100090213 200
894 3300002987 JGI25159J45721_1008601 JGI25159J45721_10086012 200
895 3300003187 JGI25151J46595_10000073 JGI25151J46595_10000073118 200
896 3300003214 JGI25165J46597_1000015 JGI25165J46597_1000015301 200
897 3300003214 JGI25165J46597_1000018 JGI25165J46597_1000018250 200
898 3300003214 JGI25165J46597_1000407 JGI25165J46597_100040737 200
899 3300003214 JGI25165J46597_1003522 JGI25165J46597_10035224 200
900 3300003215 JGI25153J46596_10008048 JGI25153J46596_100080485 200
901 3300003322 rootL2_10132451 rootL2_101324512 200
902 3300003323 rootH1_10031251 rootH1_100312512 200
903 3300003323 rootH1_10033851 rootH1_100338513 200
904 3300003354 JGI25160J50197_1000005 JGI25160J50197_100000546 200
905 3300003354 JGI25160J50197_1000014 JGI25160J50197_1000014191 200
906 3300003374 JGI25161J50226_1000022 JGI25161J50226_100002291 200
907 3300003374 JGI25161J50226_1001121 JGI25161J50226_10011215 200
908 3300003578 Ga0006562J51391_1035319 Ga0006562J51391_10353192 200
909 3300003762 Ga0055542_1000227 Ga0055542_100022750 200
910 3300003763 Ga0055529_1006674 Ga0055529_10066742 200
911 3300003771 Ga0055526_1002592 Ga0055526_100259211 200
912 3300003771 Ga0055526_1010076 Ga0055526_10100765 200
913 3300003775 Ga0055524_1000581 Ga0055524_10005816 200
914 3300003775 Ga0055524_1007283 Ga0055524_10072834 200
915 3300003775 Ga0055524_1022464 Ga0055524_10224643 200
916 3300003775 Ga0055524_1044601 Ga0055524_10446012 200
917 3300003781 Ga0055536_1008001 Ga0055536_10080015 200
918 3300003790 Ga0055528_1000917 Ga0055528_100091711 200
919 3300003790 Ga0055528_1004532 Ga0055528_10045325 200
920 3300003791 Ga0055530_10019390 Ga0055530_100193903 200
921 3300003792 Ga0055540_1008862 Ga0055540_10088622 200
922 3300003792 Ga0055540_1015678 Ga0055540_10156783 200
923 3300003792 Ga0055540_1028599 Ga0055540_10285992 200
924 3300003794 Ga0055531_10004249 Ga0055531_100042492 200
925 3300004625 Ga0055543_1000005 Ga0055543_100000542 200
926 3300004625 Ga0055543_1000324 Ga0055543_100032426 200
927 3300005262 Ga0065165_1000002 Ga0065165_1000002344 200
928 3300005262 Ga0065165_1000463 Ga0065165_100046323 200
929 3300005262 Ga0065165_1005453 Ga0065165_10054532 200
930 3300005289 Ga0065704_10025103 Ga0065704_100251032 200
931 3300005339 Ga0070660_100065214 Ga0070660_1000652141 200
932 3300005339 Ga0070660_101030725 Ga0070660_1010307251 200
933 3300005367 Ga0070667_100081022 Ga0070667_1000810222 200
934 3300005367 Ga0070667_100746268 Ga0070667_1007462682 200
935 3300005455 Ga0070663_100074899 Ga0070663_1000748994 200
936 3300005459 Ga0068867_100195236 Ga0068867_1001952362 200
937 3300005539 Ga0068853_100023496 Ga0068853_1000234964 200
938 3300005539 Ga0068853_100173117 Ga0068853_1001731173 200
939 3300005539 Ga0068853_100251426 Ga0068853_1002514262 200
940 3300005548 Ga0070665_100037012 Ga0070665_1000370122 200
941 3300005548 Ga0070665_100044042 Ga0070665_1000440422 200
942 3300005548 Ga0070665_100069048 Ga0070665_1000690482 200
943 3300005548 Ga0070665_100496181 Ga0070665_1004961812 200
944 3300005563 Ga0068855_100285588 Ga0068855_1002855882 200
945 3300005563 Ga0068855_100369898 Ga0068855_1003698982 200
946 3300005563 Ga0068855_100868113 Ga0068855_1008681131 200
947 3300005563 Ga0068855_101114054 Ga0068855_1011140541 200
948 3300005577 Ga0068857_100059870 Ga0068857_1000598702 200
949 3300005578 Ga0068854_100288668 Ga0068854_1002886682 200
950 3300005578 Ga0068854_100986173 Ga0068854_1009861731 200
951 3300005614 Ga0068856_100057963 Ga0068856_1000579633 200
952 3300005614 Ga0068856_100228578 Ga0068856_1002285782 200
953 3300005614 Ga0068856_100228829 Ga0068856_1002288292 200
954 3300005616 Ga0068852_100070158 Ga0068852_1000701582 200
955 3300005834 Ga0068851_10373325 Ga0068851_103733252 200
956 3300005834 Ga0068851_10430400 Ga0068851_104304001 200
957 3300005983 Ga0081540_1010250 Ga0081540_10102506 200
958 3300006038 Ga0075365_10002167 Ga0075365_1000216711 200
959 3300006038 Ga0075365_10007595 Ga0075365_100075953 200
960 3300006038 Ga0075365_10012364 Ga0075365_100123646 200
961 3300006038 Ga0075365_10130762 Ga0075365_101307622 200
962 3300006038 Ga0075365_10423392 Ga0075365_104233921 200
963 3300006038 Ga0075365_10798963 Ga0075365_107989631 200
964 3300006042 Ga0075368_10267597 Ga0075368_102675972 200
965 3300006048 Ga0075363_100038848 Ga0075363_1000388482 200
966 3300006048 Ga0075363_100059224 Ga0075363_1000592243 200
967 3300006048 Ga0075363_100096793 Ga0075363_1000967931 200
968 3300006048 Ga0075363_100116507 Ga0075363_1001165072 200
969 3300006048 Ga0075363_100125359 Ga0075363_1001253592 200
970 3300006051 Ga0075364_10001924 Ga0075364_100019247 200
971 3300006051 Ga0075364_10225773 Ga0075364_102257732 200
972 3300006051 Ga0075364_10413934 Ga0075364_104139342 200
973 3300006177 Ga0075362_10296222 Ga0075362_102962222 200
974 3300006178 Ga0075367_10001150 Ga0075367_100011506 200
975 3300006178 Ga0075367_10008246 Ga0075367_100082466 200
976 3300006178 Ga0075367_10018335 Ga0075367_100183352 200
977 3300006178 Ga0075367_10097012 Ga0075367_100970122 200
978 3300006178 Ga0075367_10144934 Ga0075367_101449341 200
979 3300006178 Ga0075367_10242020 Ga0075367_102420202 200
980 3300006186 Ga0075369_10003976 Ga0075369_100039762 200
981 3300006186 Ga0075369_10045840 Ga0075369_100458403 200
982 3300006186 Ga0075369_10054368 Ga0075369_100543683 200
983 3300006186 Ga0075369_10100652 Ga0075369_101006522 200
984 3300006353 Ga0075370_10075341 Ga0075370_100753414 200
985 3300006353 Ga0075370_10106219 Ga0075370_101062192 200
986 3300006946 Ga0079104_1000014 Ga0079104_100001431 200
987 3300006946 Ga0079104_1000183 Ga0079104_100018382 200
988 3300009093 Ga0105240_10000012 Ga0105240_1000001234 200
989 3300009093 Ga0105240_10242127 Ga0105240_102421272 200
990 3300009093 Ga0105240_10678091 Ga0105240_106780912 200
991 3300009093 Ga0105240_10793738 Ga0105240_107937381 200
992 3300009148 Ga0105243_10023977 Ga0105243_100239777 200
993 3300009174 Ga0105241_10269253 Ga0105241_102692532 200
994 3300009177 Ga0105248_10755010 Ga0105248_107550102 200
995 3300009545 Ga0105237_10000165 Ga0105237_1000016545 200
996 3300009551 Ga0105238_10007244 Ga0105238_1000724411 200
997 3300009551 Ga0105238_10197142 Ga0105238_101971422 200
998 3300009553 Ga0105249_11055565 Ga0105249_110555652 200
999 3300009763 Ga0123340_1055299 Ga0123340_10552992 200
1000 3300010375 Ga0105239_10000471 Ga0105239_1000047128 200
1001 3300010375 Ga0105239_10045062 Ga0105239_100450627 200
1002 3300010375 Ga0105239_10074454 Ga0105239_100744543 200
1003 3300010375 Ga0105239_10078448 Ga0105239_100784482 200
1004 3300010375 Ga0105239_10265712 Ga0105239_102657122 200
1005 3300010375 Ga0105239_10311827 Ga0105239_103118272 200
1006 3300010375 Ga0105239_11028585 Ga0105239_110285852 200
1007 3300011119 Ga0105246_10691753 Ga0105246_106917532 200
1008 3300013104 Ga0157370_10003232 Ga0157370_100032324 200
1009 3300013105 Ga0157369_10127996 Ga0157369_101279962 200
1010 3300013249 Ga0171463_1013 Ga0171463_101366 200
1011 3300013296 Ga0157374_10292302 Ga0157374_102923022 200
1012 3300013306 Ga0163162_10140642 Ga0163162_101406422 200
1013 3300014325 Ga0163163_10746476 Ga0163163_107464762 200
1014 3300014497 Ga0182008_10055693 Ga0182008_100556932 200
1015 3300015261 Ga0182006_1059859 Ga0182006_10598592 200
1016 3300015262 Ga0182007_10000763 Ga0182007_100007635 200
1017 3300015265 Ga0182005_1005468 Ga0182005_10054683 200
1018 3300015690 Ga0183363_1409 Ga0183363_14092 200
1019 3300021320 Ga0214544_1000130 Ga0214544_100013046 200
1020 3300021321 Ga0214542_1000014 Ga0214542_100001457 200
1021 3300021327 Ga0214543_1000146 Ga0214543_100014657 200
1022 3300025206 Ga0209435_100025 Ga0209435_100025176 200
1023 3300025208 Ga0209436_100162 Ga0209436_10016216 200
1024 3300025208 Ga0209436_107779 Ga0209436_1077792 200
1025 3300025233 Ga0209437_100022 Ga0209437_100022311 200
1026 3300025233 Ga0209437_100040 Ga0209437_100040348 200
1027 3300025245 Ga0207425_1000054 Ga0207425_100005417 200
1028 3300025246 Ga0209646_1000083 Ga0209646_1000083176 200
1029 3300025250 Ga0209026_1000078 Ga0209026_1000078176 200
1030 3300025253 Ga0209677_100515 Ga0209677_1005157 200
1031 3300025253 Ga0209677_108945 Ga0209677_1089453 200
1032 3300025254 Ga0209148_1000057 Ga0209148_100005753 200
1033 3300025256 Ga0209759_1000060 Ga0209759_1000060176 200
1034 3300025258 Ga0209129_1000016 Ga0209129_1000016267 200
1035 3300025258 Ga0209129_1000108 Ga0209129_100010817 200
1036 3300025258 Ga0209129_1007558 Ga0209129_10075585 200
1037 3300025258 Ga0209129_1038819 Ga0209129_10388192 200
1038 3300025261 Ga0209233_1000010 Ga0209233_1000010398 200
1039 3300025261 Ga0209233_1000031 Ga0209233_1000031311 200
1040 3300025261 Ga0209233_1000051 Ga0209233_1000051349 200
1041 3300025261 Ga0209233_1000346 Ga0209233_10003467 200
1042 3300025261 Ga0209233_1006948 Ga0209233_10069485 200
1043 3300025263 Ga0209565_1058203 Ga0209565_10582031 200
1044 3300025272 Ga0209455_1000224 Ga0209455_10002249 200
1045 3300025272 Ga0209455_1015739 Ga0209455_10157392 200
1046 3300025273 Ga0209673_1000005 Ga0209673_1000005329 200
1047 3300025273 Ga0209673_1029612 Ga0209673_10296122 200
1048 3300025273 Ga0209673_1053764 Ga0209673_10537642 200
1049 3300025284 Ga0209130_1000010 Ga0209130_1000010340 200
1050 3300025284 Ga0209130_1000013 Ga0209130_1000013339 200
1051 3300025284 Ga0209130_1019868 Ga0209130_10198682 200
1052 3300025292 Ga0209676_1005657 Ga0209676_10056576 200
1053 3300025294 Ga0209025_1000189 Ga0209025_100018917 200
1054 3300025294 Ga0209025_1002184 Ga0209025_100218413 200
1055 3300025294 Ga0209025_1056157 Ga0209025_10561572 200
1056 3300025294 Ga0209025_1067969 Ga0209025_10679692 200
1057 3300025295 Ga0209564_1000025 Ga0209564_10000255 200
1058 3300025295 Ga0209564_1007604 Ga0209564_10076045 200
1059 3300025295 Ga0209564_1026842 Ga0209564_10268421 200
1060 3300025295 Ga0209564_1029039 Ga0209564_10290392 200
1061 3300025297 Ga0209758_1000162 Ga0209758_1000162137 200
1062 3300025297 Ga0209758_1001361 Ga0209758_100136123 200
1063 3300025297 Ga0209758_1016362 Ga0209758_10163622 200
1064 3300025297 Ga0209758_1031255 Ga0209758_10312552 200
1065 3300025298 Ga0209050_1012499 Ga0209050_10124993 200
1066 3300025299 Ga0209256_1000828 Ga0209256_100082835 200
1067 3300025299 Ga0209256_1001472 Ga0209256_10014728 200
1068 3300025299 Ga0209256_1006490 Ga0209256_10064902 200
1069 3300025299 Ga0209256_1024559 Ga0209256_10245592 200
1070 3300025299 Ga0209256_1044948 Ga0209256_10449482 200
1071 3300025299 Ga0209256_1059372 Ga0209256_10593721 200
1072 3300025299 Ga0209256_1061702 Ga0209256_10617021 200
1073 3300025302 Ga0207426_1000022 Ga0207426_100002242 200
1074 3300025302 Ga0207426_1000036 Ga0207426_1000036340 200
1075 3300025302 Ga0207426_1002507 Ga0207426_10025073 200
1076 3300025303 Ga0209051_1012393 Ga0209051_10123934 200
1077 3300025303 Ga0209051_1015051 Ga0209051_10150512 200
1078 3300025304 Ga0209257_1019467 Ga0209257_10194672 200
1079 3300025321 Ga0207656_10103144 Ga0207656_101031442 200
1080 3300025904 Ga0207647_10004710 Ga0207647_100047109 200
1081 3300025904 Ga0207647_10041929 Ga0207647_100419293 200
1082 3300025904 Ga0207647_10078474 Ga0207647_100784743 200
1083 3300025909 Ga0207705_10048791 Ga0207705_100487913 200
1084 3300025909 Ga0207705_10198955 Ga0207705_101989551 200
1085 3300025911 Ga0207654_10159710 Ga0207654_101597102 200
1086 3300025913 Ga0207695_10000120 Ga0207695_10000120180 200
1087 3300025914 Ga0207671_10005869 Ga0207671_100058692 200
1088 3300025914 Ga0207671_10006498 Ga0207671_100064986 200
1089 3300025914 Ga0207671_10188081 Ga0207671_101880812 200
1090 3300025914 Ga0207671_10485790 Ga0207671_104857902 200
1091 3300025919 Ga0207657_10068924 Ga0207657_100689242 200
1092 3300025919 Ga0207657_10727149 Ga0207657_107271491 200
1093 3300025924 Ga0207694_10003375 Ga0207694_1000337511 200
1094 3300025941 Ga0207711_10590015 Ga0207711_105900152 200
1095 3300025949 Ga0207667_10035853 Ga0207667_100358532 200
1096 3300025949 Ga0207667_11206426 Ga0207667_112064261 200
1097 3300025961 Ga0207712_10973330 Ga0207712_109733302 200
1098 3300025981 Ga0207640_10066295 Ga0207640_100662953 200
1099 3300025981 Ga0207640_10335157 Ga0207640_103351572 200
1100 3300025981 Ga0207640_10703352 Ga0207640_107033522 200
1101 3300025986 Ga0207658_10052457 Ga0207658_100524572 200
1102 3300026041 Ga0207639_10010731 Ga0207639_100107313 200
1103 3300026067 Ga0207678_10123964 Ga0207678_101239642 200
1104 3300026078 Ga0207702_10176078 Ga0207702_101760782 200
1105 3300026078 Ga0207702_10203762 Ga0207702_102037622 200
1106 3300026078 Ga0207702_10568939 Ga0207702_105689391 200
1107 3300026089 Ga0207648_10053834 Ga0207648_100538342 200
1108 3300026116 Ga0207674_10074635 Ga0207674_100746354 200
1109 3300026142 Ga0207698_10225286 Ga0207698_102252862 200
1110 3300027111 Ga0209281_1000032 Ga0209281_100003233 200
1111 3300027111 Ga0209281_1001369 Ga0209281_100136915 200
1112 3300027312 Ga0209371_1004078 Ga0209371_10040786 200
1113 3300027866 Ga0209813_10059974 Ga0209813_100599742 200
1114 3300027866 Ga0209813_10190147 Ga0209813_101901471 200
1115 3300028379 Ga0268266_10131420 Ga0268266_101314203 200
1116 3300028379 Ga0268266_10163214 Ga0268266_101632142 200
1117 3300028379 Ga0268266_10489607 Ga0268266_104896072 200
1118 3300028794 Ga0307515_10000375 Ga0307515_10000375103 200
1119 3300028794 Ga0307515_10013701 Ga0307515_100137018 200
1120 3300030500 Ga0268256_1002543 Ga0268256_10025439 200
1121 3300031242 Ga0265329_10099663 Ga0265329_100996632 200
1122 3300031247 Ga0265340_10044760 Ga0265340_100447602 200
1123 3300031249 Ga0265339_10073917 Ga0265339_100739172 200
1124 3300031250 Ga0265331_10094631 Ga0265331_100946312 200
1125 3300031344 Ga0265316_10084030 Ga0265316_100840303 200
1126 3300031456 Ga0307513_10002502 Ga0307513_1000250213 200
1127 3300031456 Ga0307513_10243339 Ga0307513_102433392 200
1128 3300031548 Ga0307408_100027204 Ga0307408_1000272047 200
1129 3300031548 Ga0307408_100404427 Ga0307408_1004044272 200
1130 3300031595 Ga0265313_10026994 Ga0265313_100269943 200
1131 3300031711 Ga0265314_10012378 Ga0265314_100123788 200
1132 3300031712 Ga0265342_10070611 Ga0265342_100706113 200
1133 3300031901 Ga0307406_10061831 Ga0307406_100618312 200
1134 3300031911 Ga0307412_10001094 Ga0307412_1000109417 200
1135 3300032004 Ga0307414_10114978 Ga0307414_101149782 200
1136 3300032004 Ga0307414_10200850 Ga0307414_102008502 200
1137 3300037418 Ga0395900_0053623 Ga0395900_0053623_3282_3896 200
1138 3300037418 Ga0395900_0106065 Ga0395900_0106065_1017_1631 200
1139 3300037418 Ga0395900_0802608 Ga0395900_0802608_245_859 200
1140 3300037466 Ga0395898_0248555 Ga0395898_0248555_634_1248 200
1141 3300037471 Ga0395905_0015787 Ga0395905_0015787_3275_3889 200
1142 3300037471 Ga0395905_0047229 Ga0395905_0047229_898_1512 200
1143 3300037471 Ga0395905_0077524 Ga0395905_0077524_2356_2970 200
1144 3300037471 Ga0395905_0122201 Ga0395905_0122201_886_1500 200
1145 3300038443 Ga0395901_0013219 Ga0395901_0013219_2218_2832 200
1146 3300038443 Ga0395901_0034009 Ga0395901_0034009_2081_2695 200
1147 3300038443 Ga0395901_0246976 Ga0395901_0246976_579_1193 200
1148 3300038443 Ga0395901_0728011 Ga0395901_0728011_60_674 200
1149 3300041404 Ga0439436_0005356 Ga0439436_0005356_1941_2555 200
1150 3300041405 Ga0439438_028498 Ga0439438_028498_840_1454 200
1151 3300041405 Ga0439438_084326 Ga0439438_084326_38_652 200
1152 3300041413 Ga0439465_0034315 Ga0439465_0034315_929_1543 200
1153 3300041413 Ga0439465_0069363 Ga0439465_0069363_534_1148 200
1154 3300041512 Ga0451853_1733039 Ga0451853_1733039_151_765 200
1155 3300042007 Ga0439449_0078029 Ga0439449_0078029_276_890 200
1156 3300042145 Ga0450906_003973 Ga0450906_003973_179_793 200
1157 3300042185 Ga0450909_041573 Ga0450909_041573_16_630 200
1158 3300044683 Ga0466965_0162018 Ga0466965_0162018_477_1094 200
1159 3300044684 Ga0466966_0070976 Ga0466966_0070976_1341_1955 200
1160 3300044694 Ga0466963_0040541 Ga0466963_0040541_1914_2528 200
1161 3300044706 Ga0466964_0121287 Ga0466964_0121287_410_1024 200
1162 3300045836 Ga0466958_0100342 Ga0466958_0100342_1106_1720 200
1163 3300046455 Ga0495603_0517187 Ga0495603_0517187_32_652 200
1164 3300046460 Ga0495638_0021565 Ga0495638_0021565_637_1251 200
1165 3300046492 Ga0495585_0084023 Ga0495585_0084023_26_643 200
1166 3300046507 Ga0495606_0001364 Ga0495606_0001364_26343_26957 200
1167 3300046518 Ga0495631_0070087 Ga0495631_0070087_313_930 200
1168 3300046558 Ga0495633_0202733 Ga0495633_0202733_43_657 200
1169 3300046616 Ga0495668_0476669 Ga0495668_0476669_35_649 200
1170 3300046660 Ga0495625_0171941 Ga0495625_0171941_11_625 200
1171 3300046660 Ga0495625_0285144 Ga0495625_0285144_138_752 200
1172 3300046674 Ga0495588_0029691 Ga0495588_0029691_12_626 200
1173 3300046691 Ga0495670_0179602 Ga0495670_0179602_321_935 200
1174 3300047443 Ga0495687_074300 Ga0495687_074300_628_1242 200
1175 3300047470 Ga0495681_0184670 Ga0495681_0184670_29_643 200
1176 3300047472 Ga0495686_0084127 Ga0495686_0084127_1045_1659 200
1177 3300048903 Ga0496100_0069676 Ga0496100_0069676_862_1476 200
1178 3300048903 Ga0496100_0094754 Ga0496100_0094754_658_1272 200
1179 3300048904 Ga0496101_0018036 Ga0496101_0018036_342_956 200
1180 3300048904 Ga0496101_0072335 Ga0496101_0072335_427_1041 200
1181 3300048905 Ga0496102_0004684 Ga0496102_0004684_8213_8827 200
1182 3300048905 Ga0496102_0042628 Ga0496102_0042628_2498_3112 200
1183 3300048905 Ga0496102_0287645 Ga0496102_0287645_103_717 200
1184 3300048906 Ga0496103_0001141 Ga0496103_0001141_1814_2428 200
1185 3300048906 Ga0496103_0138489 Ga0496103_0138489_903_1517 200
1186 3300048907 Ga0496104_0913166 Ga0496104_0913166_109_723 200
1187 3300048908 Ga0496105_0024345 Ga0496105_0024345_1559_2173 200
1188 3300048908 Ga0496105_0482790 Ga0496105_0482790_41_655 200
1189 3300048911 Ga0496108_0571435 Ga0496108_0571435_37_651 200
1190 3300048913 Ga0496110_0311716 Ga0496110_0311716_228_842 200
1191 3300048915 Ga0496112_0017411 Ga0496112_0017411_588_1202 200
1192 3300048915 Ga0496112_0056538 Ga0496112_0056538_2813_3427 200
1193 3300048916 Ga0496113_0116715 Ga0496113_0116715_114_728 200
1194 3300048916 Ga0496113_0431101 Ga0496113_0431101_361_975 200
1195 3300048917 Ga0496114_0496413 Ga0496114_0496413_11_625 200
1196 3300048919 Ga0496116_0006609 Ga0496116_0006609_9463_10077 200
1197 3300048919 Ga0496116_0079756 Ga0496116_0079756_57_671 200
1198 3300048919 Ga0496116_0159381 Ga0496116_0159381_487_1101 200
1199 3300048919 Ga0496116_0162962 Ga0496116_0162962_188_802 200
1200 3300048920 Ga0496117_0002913 Ga0496117_0002913_16953_17567 200
1201 3300048920 Ga0496117_0050229 Ga0496117_0050229_128_742 200
1202 3300048920 Ga0496117_0083586 Ga0496117_0083586_1176_1790 200
1203 3300048920 Ga0496117_0121928 Ga0496117_0121928_97_711 200
1204 3300048920 Ga0496117_0253991 Ga0496117_0253991_162_776 200
1205 3300048921 Ga0496118_0003707 Ga0496118_0003707_16953_17567 200
1206 3300048921 Ga0496118_0008892 Ga0496118_0008892_7710_8324 200
1207 3300048921 Ga0496118_0199382 Ga0496118_0199382_30_644 200
1208 3300048922 Ga0496119_0007795 Ga0496119_0007795_2659_3273 200
1209 3300048922 Ga0496119_0039398 Ga0496119_0039398_1649_2263 200
1210 3300048922 Ga0496119_0055029 Ga0496119_0055029_1618_2232 200
1211 3300048922 Ga0496119_0081512 Ga0496119_0081512_214_828 200
1212 3300048923 Ga0496120_0008875 Ga0496120_0008875_2070_2684 200
1213 3300048923 Ga0496120_0009699 Ga0496120_0009699_3748_4362 200
1214 3300048923 Ga0496120_0034977 Ga0496120_0034977_715_1329 200
1215 3300048923 Ga0496120_0139655 Ga0496120_0139655_396_1010 200
1216 3300048923 Ga0496120_0162375 Ga0496120_0162375_21_635 200
1217 3300048923 Ga0496120_0192844 Ga0496120_0192844_135_749 200
1218 3300048924 Ga0496121_0000174 Ga0496121_0000174_112116_112730 200
1219 3300048924 Ga0496121_0003584 Ga0496121_0003584_3688_4302 200
1220 3300048924 Ga0496121_0056408 Ga0496121_0056408_294_908 200
1221 3300048924 Ga0496121_0057718 Ga0496121_0057718_1811_2425 200
1222 3300048924 Ga0496121_0097359 Ga0496121_0097359_260_874 200
1223 3300048924 Ga0496121_0149667 Ga0496121_0149667_457_1071 200
1224 3300048924 Ga0496121_0171636 Ga0496121_0171636_744_1358 200
1225 3300048924 Ga0496121_0396374 Ga0496121_0396374_170_784 200
1226 3300048924 Ga0496121_0618368 Ga0496121_0618368_10_624 200
1227 3300048925 Ga0496122_0011815 Ga0496122_0011815_7276_7890 200
1228 3300048925 Ga0496122_0035663 Ga0496122_0035663_944_1558 200
1229 3300048925 Ga0496122_0066433 Ga0496122_0066433_1538_2152 200
1230 3300048925 Ga0496122_0086269 Ga0496122_0086269_254_868 200
1231 3300048925 Ga0496122_0139655 Ga0496122_0139655_397_1011 200
1232 3300048926 Ga0496123_0028116 Ga0496123_0028116_3320_3934 200
1233 3300048926 Ga0496123_0042384 Ga0496123_0042384_775_1389 200
1234 3300048926 Ga0496123_0081801 Ga0496123_0081801_769_1383 200
1235 3300048927 Ga0496124_0000200 Ga0496124_0000200_38900_39514 200
1236 3300048927 Ga0496124_0001776 Ga0496124_0001776_27522_28136 200
1237 3300048927 Ga0496124_0003927 Ga0496124_0003927_10725_11339 200
1238 3300048927 Ga0496124_0030008 Ga0496124_0030008_105_719 200
1239 3300048927 Ga0496124_0047267 Ga0496124_0047267_1818_2432 200
1240 3300048927 Ga0496124_0071883 Ga0496124_0071883_2107_2721 200
1241 3300048927 Ga0496124_0258095 Ga0496124_0258095_44_658 200
1242 3300048928 Ga0496125_0000982 Ga0496125_0000982_8620_9234 200
1243 3300048928 Ga0496125_0067409 Ga0496125_0067409_231_845 200
1244 3300048928 Ga0496125_0077925 Ga0496125_0077925_1622_2236 200
1245 3300048928 Ga0496125_0107652 Ga0496125_0107652_480_1094 200
1246 3300048928 Ga0496125_0187175 Ga0496125_0187175_41_655 200
1247 3300048929 Ga0496126_0019281 Ga0496126_0019281_882_1496 200
1248 3300048929 Ga0496126_0088806 Ga0496126_0088806_198_812 200
1249 3300048929 Ga0496126_0127413 Ga0496126_0127413_761_1378 200
1250 3300048929 Ga0496126_0479018 Ga0496126_0479018_214_828 200
1251 3300048929 Ga0496126_0877422 Ga0496126_0877422_13_627 200
1252 3300049568 Ga0501031_0056043 Ga0501031_0056043_1772_2386 200
1253 3300049568 Ga0501031_0310805 Ga0501031_0310805_62_676 200
1254 3300049568 Ga0501031_0538050 Ga0501031_0538050_79_693 200
1255 3300049569 Ga0501032_0035515 Ga0501032_0035515_2538_3152 200
1256 3300049569 Ga0501032_0042316 Ga0501032_0042316_2143_2757 200
1257 3300049569 Ga0501032_0158743 Ga0501032_0158743_273_887 200
1258 3300049570 Ga0501033_0001017 Ga0501033_0001017_409_1023 200
1259 3300049570 Ga0501033_0038718 Ga0501033_0038718_725_1339 200
1260 3300049570 Ga0501033_0039506 Ga0501033_0039506_2697_3311 200
1261 3300049570 Ga0501033_0063901 Ga0501033_0063901_1735_2349 200
1262 3300049570 Ga0501033_0289624 Ga0501033_0289624_411_1025 200
1263 3300049571 Ga0501034_0083017 Ga0501034_0083017_2037_2651 200
1264 3300049571 Ga0501034_0097881 Ga0501034_0097881_1242_1856 200
1265 3300049571 Ga0501034_0183645 Ga0501034_0183645_97_711 200
1266 3300049571 Ga0501034_0300812 Ga0501034_0300812_729_1343 200
1267 3300049571 Ga0501034_0493449 Ga0501034_0493449_35_649 200
1268 3300049571 Ga0501034_0902885 Ga0501034_0902885_92_706 200
1269 3300049572 Ga0501036_0227988 Ga0501036_0227988_405_1019 200
1270 3300049572 Ga0501036_0541326 Ga0501036_0541326_48_662 200
1271 3300049573 Ga0501037_0000035 Ga0501037_0000035_10192_10806 200
1272 3300049574 Ga0501038_0023128 Ga0501038_0023128_2695_3309 200
1273 3300049575 Ga0501039_0159654 Ga0501039_0159654_409_1023 200
1274 3300049579 Ga0501043_0000031 Ga0501043_0000031_105252_105866 200
1275 3300049579 Ga0501043_0023763 Ga0501043_0023763_2849_3463 200
1276 3300049579 Ga0501043_0085371 Ga0501043_0085371_1063_1677 200
1277 3300049580 Ga0501046_0144281 Ga0501046_0144281_1140_1754 200
1278 3300049580 Ga0501046_0395767 Ga0501046_0395767_55_669 200
1279 3300049580 Ga0501046_0530893 Ga0501046_0530893_39_653 200
1280 3300049581 Ga0501047_0022828 Ga0501047_0022828_1247_1861 200
1281 3300049581 Ga0501047_0078456 Ga0501047_0078456_2113_2727 200
1282 3300049581 Ga0501047_0220841 Ga0501047_0220841_132_746 200
1283 3300049581 Ga0501047_0297357 Ga0501047_0297357_641_1255 200
1284 3300049582 Ga0501048_0557492 Ga0501048_0557492_98_712 200
1285 3300049582 Ga0501048_0564249 Ga0501048_0564249_53_667 200
1286 3300049584 Ga0501068_0005004 Ga0501068_0005004_621_1235 200
1287 3300049584 Ga0501068_0328135 Ga0501068_0328135_17_631 200
1288 3300049585 Ga0501069_0000136 Ga0501069_0000136_10196_10810 200
1289 3300049585 Ga0501069_0049438 Ga0501069_0049438_1360_1974 200
1290 3300049585 Ga0501069_0232197 Ga0501069_0232197_155_769 200
1291 3300049586 Ga0501070_0000202 Ga0501070_0000202_48146_48760 200
1292 3300049586 Ga0501070_0000422 Ga0501070_0000422_27065_27679 200
1293 3300049586 Ga0501070_0006568 Ga0501070_0006568_4169_4783 200
1294 3300049586 Ga0501070_0010179 Ga0501070_0010179_2138_2752 200
1295 3300049586 Ga0501070_0077138 Ga0501070_0077138_770_1384 200
1296 3300049586 Ga0501070_0440136 Ga0501070_0440136_167_781 200
1297 3300049587 Ga0501071_0001465 Ga0501071_0001465_51_665 200
1298 3300049587 Ga0501071_0067873 Ga0501071_0067873_417_1031 200
1299 3300049589 Ga0501073_0027594 Ga0501073_0027594_1330_1944 200
1300 3300049590 Ga0501074_0000024 Ga0501074_0000024_58319_58933 200
1301 3300049590 Ga0501074_0534348 Ga0501074_0534348_171_785 200
1302 3300049742 Ga0501080_0000429 Ga0501080_0000429_12364_12978 200
1303 3300049742 Ga0501080_0000963 Ga0501080_0000963_22757_23371 200
1304 3300049742 Ga0501080_0265394 Ga0501080_0265394_123_737 200
1305 3300049744 Ga0501083_0000200 Ga0501083_0000200_28964_29578 200
1306 3300049744 Ga0501083_0110838 Ga0501083_0110838_719_1333 200
1307 3300049758 Ga0501241_037925 Ga0501241_037925_35_652 200
1308 3300049776 Ga0501280_001590 Ga0501280_001590_3029_3643 200
1309 3300049822 Ga0501035_0000036 Ga0501035_0000036_49611_50225 200
1310 3300049822 Ga0501035_0000723 Ga0501035_0000723_28324_28938 200
1311 3300049822 Ga0501035_0008594 Ga0501035_0008594_8120_8734 200
1312 3300049822 Ga0501035_0032962 Ga0501035_0032962_121_735 200
1313 3300049822 Ga0501035_0087522 Ga0501035_0087522_158_772 200
1314 3300049822 Ga0501035_0125755 Ga0501035_0125755_1513_2127 200
1315 3300049823 Ga0501044_0000011 Ga0501044_0000011_158325_158939 200
1316 3300049823 Ga0501044_0004538 Ga0501044_0004538_4608_5222 200
1317 3300049823 Ga0501044_0008293 Ga0501044_0008293_895_1509 200
1318 3300049823 Ga0501044_0034203 Ga0501044_0034203_1590_2204 200
1319 3300049823 Ga0501044_0039584 Ga0501044_0039584_1964_2578 200
1320 3300049823 Ga0501044_0076189 Ga0501044_0076189_2779_3393 200
1321 3300049823 Ga0501044_0079139 Ga0501044_0079139_2613_3227 200
1322 3300049823 Ga0501044_0175065 Ga0501044_0175065_1398_2012 200
1323 3300049824 Ga0501045_0489401 Ga0501045_0489401_166_780 200
1324 3300050490 nmdc:mga03n38_76581_c1 nmdc:mga03n38_76581_c1_737_1351 200
1325 3300050490 nmdc:mga03n38_8598_c1 nmdc:mga03n38_8598_c1_694_1308 200
1326 3300050491 nmdc:mga00v17_11078_c1 nmdc:mga00v17_11078_c1_2620_3234 200
1327 3300050491 nmdc:mga00v17_20863_c1 nmdc:mga00v17_20863_c1_2389_3003 200
1328 3300050491 nmdc:mga00v17_594075_c1 nmdc:mga00v17_594075_c1_13_627 200
1329 3300050492 nmdc:mga0yw44_137179_c1 nmdc:mga0yw44_137179_c1_344_958 200
1330 3300050492 nmdc:mga0yw44_17647_c1 nmdc:mga0yw44_17647_c1_2645_3259 200
1331 3300050492 nmdc:mga0yw44_2420_c1 nmdc:mga0yw44_2420_c1_6105_6719 200
1332 3300050493 nmdc:mga0k408_319783_c1 nmdc:mga0k408_319783_c1_112_726 200
1333 3300050494 nmdc:mga06z11_1261_c1 nmdc:mga06z11_1261_c1_5029_5643 200
1334 3300050494 nmdc:mga06z11_14948_c1 nmdc:mga06z11_14948_c1_1906_2520 200
1335 3300050495 nmdc:mga04h51_153595_c1 nmdc:mga04h51_153595_c1_64_678 200
1336 3300050496 nmdc:mga07m45_93500_c1 nmdc:mga07m45_93500_c1_367_981 200
1337 3300050516 nmdc:mga0sz30_11929_c1 nmdc:mga0sz30_11929_c1_1945_2559 200
1338 3300050516 nmdc:mga0sz30_7432_c2 nmdc:mga0sz30_7432_c2_899_1513 200
1339 3300053100 Ga0500660_139892 Ga0500660_139892_133_744 200
1340 3300053125 Ga0500618_000008 Ga0500618_000008_51618_52232 200
1341 3300053125 Ga0500618_003329 Ga0500618_003329_1534_2148 200
1342 3300053125 Ga0500618_011676 Ga0500618_011676_723_1337 200
1343 3300053134 Ga0500658_0221890 Ga0500658_0221890_73_687 200
1344 3300053153 Ga0500616_0140514 Ga0500616_0140514_224_838 200
1345 3300053155 Ga0500620_000018 Ga0500620_000018_22091_22705 200
1346 3300053177 Ga0500636_0077761 Ga0500636_0077761_28_642 200
1347 3300060353 Ga0501082_0082917 Ga0501082_0082917_1341_1955 200
1348 3300061719 Ga0466962_0095510 Ga0466962_0095510_704_1318 200
1349 iso_pu_bacteria 2958092219 2958098894 200
1350 iso_pu_bacteria 3000376612 3000379187 200
1351 3300003316 rootH1_10086971 rootH1_100869712 201
1352 3300005338 Ga0068868_100223636 Ga0068868_1002236362 201
1353 3300005367 Ga0070667_100893702 Ga0070667_1008937021 201
1354 3300005617 Ga0068859_100423381 Ga0068859_1004233812 201
1355 3300005842 Ga0068858_100461556 Ga0068858_1004615562 201
1356 3300005843 Ga0068860_100337341 Ga0068860_1003373412 201
1357 3300006163 Ga0070715_10044099 Ga0070715_100440991 201
1358 3300006237 Ga0097621_100286717 Ga0097621_1002867172 201
1359 3300006353 Ga0075370_10028022 Ga0075370_100280222 201
1360 3300006931 Ga0097620_100423359 Ga0097620_1004233592 201
1361 3300009098 Ga0105245_10167846 Ga0105245_101678462 201
1362 3300009545 Ga0105237_10058994 Ga0105237_100589942 201
1363 3300013306 Ga0163162_10291720 Ga0163162_102917202 201
1364 3300014325 Ga0163163_10423430 Ga0163163_104234302 201
1365 3300014968 Ga0157379_10062000 Ga0157379_100620003 201
1366 3300025927 Ga0207687_10332870 Ga0207687_103328702 201
1367 3300025927 Ga0207687_10598211 Ga0207687_105982112 201
1368 3300025986 Ga0207658_10036559 Ga0207658_100365592 201
1369 3300025986 Ga0207658_10086237 Ga0207658_100862372 201
1370 3300026035 Ga0207703_10465906 Ga0207703_104659062 201
1371 3300031507 Ga0307509_10001328 Ga0307509_1000132825 201
1372 3300031507 Ga0307509_10033331 Ga0307509_100333315 201
1373 3300031616 Ga0307508_10077400 Ga0307508_100774002 201
1374 3300031730 Ga0307516_10000662 Ga0307516_1000066237 201
1375 3300032004 Ga0307414_10097273 Ga0307414_100972733 201
1376 3300032004 Ga0307414_10278232 Ga0307414_102782322 201
1377 3300032004 Ga0307414_10858263 Ga0307414_108582632 201
1378 3300035691 Ga0373931_0054830 Ga0373931_0054830_88_723 201
1379 3300044656 Ga0466969_0023384 Ga0466969_0023384_1656_2306 201
1380 3300044659 Ga0466973_0065732 Ga0466973_0065732_2258_2908 201
1381 3300044683 Ga0466965_0003828 Ga0466965_0003828_3298_3948 201
1382 3300044693 Ga0466961_0051454 Ga0466961_0051454_1933_2583 201
1383 3300044694 Ga0466963_0004869 Ga0466963_0004869_4319_4969 201
1384 3300044719 Ga0466971_0001651 Ga0466971_0001651_6851_7501 201
1385 3300044765 Ga0466970_0105728 Ga0466970_0105728_348_998 201
1386 3300044842 Ga0466957_0012504 Ga0466957_0012504_3894_4544 201
1387 3300045836 Ga0466958_0030845 Ga0466958_0030845_885_1535 201
1388 3300046454 Ga0495592_0000352 Ga0495592_0000352_22237_22872 201
1389 3300046471 Ga0495650_0116891 Ga0495650_0116891_141_776 201
1390 3300046472 Ga0495580_0119663 Ga0495580_0119663_861_1496 201
1391 3300046681 Ga0495647_0090910 Ga0495647_0090910_335_970 201
1392 3300046683 Ga0495658_0114107 Ga0495658_0114107_688_1323 201
1393 3300048907 Ga0496104_0200149 Ga0496104_0200149_618_1253 201
1394 3300048908 Ga0496105_0024032 Ga0496105_0024032_3632_4267 201
1395 3300048917 Ga0496114_0127883 Ga0496114_0127883_340_975 201
1396 3300048917 Ga0496114_0135507 Ga0496114_0135507_247_882 201
1397 3300049571 Ga0501034_0000162 Ga0501034_0000162_27852_28472 201
1398 3300050496 nmdc:mga07m45_16474_c2 nmdc:mga07m45_16474_c2_324_965 201
1399 3300053084 Ga0495595_0082470 Ga0495595_0082470_425_1060 201
1400 3300053093 Ga0500651_0241138 Ga0500651_0241138_258_893 201
1401 3300053177 Ga0500636_0204139 Ga0500636_0204139_295_930 201
1402 3300061719 Ga0466962_0018487 Ga0466962_0018487_759_1409 201
1403 iso_pu_bacteria 2773857925 2774870879 201
1404 iso_pu_bacteria 643348564 643599819 201
1405 3300005468 Ga0070707_100035738 Ga0070707_1000357385 202
1406 3300006042 Ga0075368_10004699 Ga0075368_100046996 202
1407 3300006048 Ga0075363_100264881 Ga0075363_1002648812 202
1408 3300006178 Ga0075367_10059289 Ga0075367_100592891 202
1409 3300006195 Ga0075366_10092785 Ga0075366_100927852 202
1410 3300006353 Ga0075370_10064346 Ga0075370_100643461 202
1411 3300009036 Ga0105244_10000403 Ga0105244_100004037 202
1412 3300025910 Ga0207684_10002597 Ga0207684_1000259717 202
1413 3300027866 Ga0209813_10023660 Ga0209813_100236602 202
1414 3300037312 Ga0395899_0000729 Ga0395899_0000729_20914_21540 202
1415 3300037471 Ga0395905_0062649 Ga0395905_0062649_1053_1682 202
1416 3300037471 Ga0395905_0109842 Ga0395905_0109842_1129_1755 202
1417 3300037471 Ga0395905_0324699 Ga0395905_0324699_473_1099 202
1418 3300044658 Ga0466972_0103414 Ga0466972_0103414_518_1144 202
1419 3300045049 Ga0466959_0178919 Ga0466959_0178919_13_639 202
1420 3300047315 Ga0495581_0435796 Ga0495581_0435796_34_663 202
1421 3300049570 Ga0501033_0211047 Ga0501033_0211047_402_1025 202
1422 3300049573 Ga0501037_0155691 Ga0501037_0155691_28_651 202
1423 3300049580 Ga0501046_0029834 Ga0501046_0029834_2171_2794 202
1424 3300049586 Ga0501070_0060029 Ga0501070_0060029_1597_2220 202
1425 3300049822 Ga0501035_0002648 Ga0501035_0002648_15213_15836 202
1426 3300049823 Ga0501044_0176365 Ga0501044_0176365_997_1620 202
1427 3300050493 nmdc:mga0k408_13887_c1 nmdc:mga0k408_13887_c1_1247_1891 202
1428 3300050494 nmdc:mga06z11_247352_c1 nmdc:mga06z11_247352_c1_372_1016 202
1429 3300050495 nmdc:mga04h51_55610_c1 nmdc:mga04h51_55610_c1_260_904 202
1430 3300061719 Ga0466962_0129463 Ga0466962_0129463_163_789 202
1431 iso_pu_bacteria 2895511927 2895516956 202
1432 iso_pu_bacteria 3003665799 3003672614 202
1433 3300001989 JGI24739J22299_10000109 JGI24739J22299_1000010918 203
1434 3300002705 JGI25156J39149_1000137 JGI25156J39149_100013727 203
1435 3300002738 JGI25154J39366_1000106 JGI25154J39366_100010646 203
1436 3300002741 JGI25157J39369_1000154 JGI25157J39369_100015424 203
1437 3300002772 JGI25164J39214_1004996 JGI25164J39214_10049962 203
1438 3300003316 rootH1_10022690 rootH1_100226904 203
1439 3300003320 rootH2_10074857 rootH2_100748572 203
1440 3300003322 rootL2_10313242 rootL2_103132421 203
1441 3300003323 rootH1_10019588 rootH1_100195884 203
1442 3300003323 rootH1_10030464 rootH1_100304643 203
1443 3300003752 Ga0055539_1000160 Ga0055539_100016044 203
1444 3300003752 Ga0055539_1001756 Ga0055539_10017561 203
1445 3300003756 Ga0055533_1000162 Ga0055533_100016244 203
1446 3300003759 Ga0055525_1000742 Ga0055525_10007422 203
1447 3300003761 Ga0055535_1000403 Ga0055535_10004036 203
1448 3300003763 Ga0055529_1000195 Ga0055529_10001956 203
1449 3300005327 Ga0070658_10004550 Ga0070658_100045508 203
1450 3300005330 Ga0070690_100020918 Ga0070690_1000209184 203
1451 3300005339 Ga0070660_100264068 Ga0070660_1002640681 203
1452 3300005353 Ga0070669_100641494 Ga0070669_1006414941 203
1453 3300005364 Ga0070673_100031638 Ga0070673_1000316384 203
1454 3300005364 Ga0070673_100369495 Ga0070673_1003694952 203
1455 3300005366 Ga0070659_100076553 Ga0070659_1000765532 203
1456 3300005456 Ga0070678_100404392 Ga0070678_1004043922 203
1457 3300005459 Ga0068867_100233785 Ga0068867_1002337852 203
1458 3300005467 Ga0070706_100205588 Ga0070706_1002055882 203
1459 3300005543 Ga0070672_100080696 Ga0070672_1000806962 203
1460 3300005543 Ga0070672_100939630 Ga0070672_1009396301 203
1461 3300005548 Ga0070665_100008247 Ga0070665_1000082473 203
1462 3300005563 Ga0068855_100215864 Ga0068855_1002158643 203
1463 3300005563 Ga0068855_100868107 Ga0068855_1008681072 203
1464 3300005577 Ga0068857_100000535 Ga0068857_10000053522 203
1465 3300005614 Ga0068856_100022922 Ga0068856_1000229225 203
1466 3300005614 Ga0068856_100791147 Ga0068856_1007911471 203
1467 3300005616 Ga0068852_100056329 Ga0068852_1000563294 203
1468 3300006195 Ga0075366_10000527 Ga0075366_1000052711 203
1469 3300006195 Ga0075366_10072032 Ga0075366_100720322 203
1470 3300009011 Ga0105251_10000198 Ga0105251_1000019855 203
1471 3300009036 Ga0105244_10000037 Ga0105244_10000037116 203
1472 3300009036 Ga0105244_10002423 Ga0105244_100024236 203
1473 3300009093 Ga0105240_10009833 Ga0105240_100098337 203
1474 3300009093 Ga0105240_10141815 Ga0105240_101418153 203
1475 3300009098 Ga0105245_10160344 Ga0105245_101603442 203
1476 3300009148 Ga0105243_10002671 Ga0105243_100026716 203
1477 3300009177 Ga0105248_10174488 Ga0105248_101744883 203
1478 3300009545 Ga0105237_10126562 Ga0105237_101265623 203
1479 3300013102 Ga0157371_10005423 Ga0157371_100054233 203
1480 3300013104 Ga0157370_10000343 Ga0157370_1000034315 203
1481 3300013104 Ga0157370_10000348 Ga0157370_100003487 203
1482 3300013105 Ga0157369_10000288 Ga0157369_1000028845 203
1483 3300013296 Ga0157374_10019897 Ga0157374_100198973 203
1484 3300013306 Ga0163162_10242733 Ga0163162_102427333 203
1485 3300013308 Ga0157375_10430766 Ga0157375_104307662 203
1486 3300014745 Ga0157377_10000013 Ga0157377_10000013111 203
1487 3300015261 Ga0182006_1039762 Ga0182006_10397622 203
1488 3300017792 Ga0163161_10082554 Ga0163161_100825543 203
1489 3300025226 Ga0209674_100003 Ga0209674_10000311 203
1490 3300025228 Ga0209672_113575 Ga0209672_1135752 203
1491 3300025230 Ga0209563_100192 Ga0209563_10019211 203
1492 3300025231 Ga0207427_100663 Ga0207427_10066316 203
1493 3300025242 Ga0209258_100291 Ga0209258_1002917 203
1494 3300025246 Ga0209646_1000127 Ga0209646_1000127110 203
1495 3300025250 Ga0209026_1000004 Ga0209026_1000004852 203
1496 3300025250 Ga0209026_1012212 Ga0209026_10122122 203
1497 3300025253 Ga0209677_100085 Ga0209677_10008581 203
1498 3300025253 Ga0209677_100107 Ga0209677_10010711 203
1499 3300025256 Ga0209759_1000129 Ga0209759_100012924 203
1500 3300025256 Ga0209759_1003974 Ga0209759_10039742 203
1501 3300025256 Ga0209759_1010790 Ga0209759_10107903 203
1502 3300025272 Ga0209455_1000208 Ga0209455_100020867 203
1503 3300025303 Ga0209051_1000354 Ga0209051_100035444 203
1504 3300025303 Ga0209051_1007471 Ga0209051_10074713 203
1505 3300025303 Ga0209051_1016212 Ga0209051_10162122 203
1506 3300025304 Ga0209257_1032100 Ga0209257_10321002 203
1507 3300025728 Ga0207655_1000117 Ga0207655_1000117115 203
1508 3300025735 Ga0207713_1020865 Ga0207713_10208653 203
1509 3300025909 Ga0207705_10000625 Ga0207705_1000062519 203
1510 3300025909 Ga0207705_10141660 Ga0207705_101416602 203
1511 3300025913 Ga0207695_10022029 Ga0207695_100220293 203
1512 3300025913 Ga0207695_10101432 Ga0207695_101014322 203
1513 3300025914 Ga0207671_10074921 Ga0207671_100749213 203
1514 3300025919 Ga0207657_10405447 Ga0207657_104054472 203
1515 3300025923 Ga0207681_10049567 Ga0207681_100495672 203
1516 3300025932 Ga0207690_10431819 Ga0207690_104318192 203
1517 3300025935 Ga0207709_10005372 Ga0207709_100053726 203
1518 3300025949 Ga0207667_10029470 Ga0207667_100294705 203
1519 3300025949 Ga0207667_10634863 Ga0207667_106348632 203
1520 3300025960 Ga0207651_10033406 Ga0207651_100334064 203
1521 3300026078 Ga0207702_10055620 Ga0207702_100556202 203
1522 3300026078 Ga0207702_10750935 Ga0207702_107509351 203
1523 3300026089 Ga0207648_10000006 Ga0207648_10000006140 203
1524 3300026089 Ga0207648_10264293 Ga0207648_102642932 203
1525 3300026118 Ga0207675_100033725 Ga0207675_1000337253 203
1526 3300026121 Ga0207683_10140183 Ga0207683_101401831 203
1527 3300026121 Ga0207683_10221055 Ga0207683_102210552 203
1528 3300026121 Ga0207683_10362558 Ga0207683_103625582 203
1529 3300028379 Ga0268266_10029943 Ga0268266_100299435 203
1530 3300028379 Ga0268266_10506409 Ga0268266_105064092 203
1531 3300028381 Ga0268264_10167671 Ga0268264_101676711 203
1532 3300030521 Ga0307511_10131150 Ga0307511_101311502 203
1533 3300031911 Ga0307412_10394783 Ga0307412_103947832 203
1534 3300032002 Ga0307416_100057914 Ga0307416_1000579143 203
1535 3300032002 Ga0307416_100334684 Ga0307416_1003346842 203
1536 3300032005 Ga0307411_10460559 Ga0307411_104605592 203
1537 3300034820 Ga0373959_0006169 Ga0373959_0006169_227_847 203
1538 3300035695 Ga0373927_0059272 Ga0373927_0059272_1570_2190 203
1539 3300037312 Ga0395899_0000005 Ga0395899_0000005_666187_666855 203
1540 3300037312 Ga0395899_0084318 Ga0395899_0084318_23_697 203
1541 3300037312 Ga0395899_0176329 Ga0395899_0176329_652_1272 203
1542 3300037418 Ga0395900_0000003 Ga0395900_0000003_106112_106780 203
1543 3300037418 Ga0395900_0106286 Ga0395900_0106286_801_1475 203
1544 3300037418 Ga0395900_0127056 Ga0395900_0127056_816_1490 203
1545 3300037466 Ga0395898_0000003 Ga0395898_0000003_666207_666875 203
1546 3300037466 Ga0395898_0000195 Ga0395898_0000195_119775_120449 203
1547 3300037466 Ga0395898_0044774 Ga0395898_0044774_3067_3741 203
1548 3300037466 Ga0395898_0432294 Ga0395898_0432294_201_821 203
1549 3300037471 Ga0395905_0041614 Ga0395905_0041614_663_1283 203
1550 3300038443 Ga0395901_0000012 Ga0395901_0000012_150715_151389 203
1551 3300038443 Ga0395901_0000038 Ga0395901_0000038_20091_20756 203
1552 3300038443 Ga0395901_0001277 Ga0395901_0001277_18875_19495 203
1553 3300038443 Ga0395901_0588452 Ga0395901_0588452_448_1068 203
1554 3300039062 Ga0400483_246615 Ga0400483_246615_1399_2019 203
1555 3300039437 Ga0436365_1805396 Ga0436365_1805396_734_1360 203
1556 3300042006 Ga0439432_007309 Ga0439432_007309_594_1214 203
1557 3300042010 Ga0439452_000009 Ga0439452_000009_315477_316097 203
1558 3300044656 Ga0466969_0005411 Ga0466969_0005411_5332_6000 203
1559 3300044683 Ga0466965_0004407 Ga0466965_0004407_459_1079 203
1560 3300044683 Ga0466965_0053833 Ga0466965_0053833_1011_1679 203
1561 3300044684 Ga0466966_0000035 Ga0466966_0000035_2853_3521 203
1562 3300044684 Ga0466966_0000198 Ga0466966_0000198_23878_24498 203
1563 3300044684 Ga0466966_0001168 Ga0466966_0001168_13276_13971 203
1564 3300044684 Ga0466966_0068761 Ga0466966_0068761_722_1351 203
1565 3300044693 Ga0466961_0000336 Ga0466961_0000336_27530_28198 203
1566 3300044693 Ga0466961_0000612 Ga0466961_0000612_9356_9985 203
1567 3300044693 Ga0466961_0250504 Ga0466961_0250504_57_725 203
1568 3300044694 Ga0466963_0006557 Ga0466963_0006557_3758_4426 203
1569 3300044694 Ga0466963_0021658 Ga0466963_0021658_1720_2415 203
1570 3300044706 Ga0466964_0067742 Ga0466964_0067742_131_799 203
1571 3300044719 Ga0466971_0009252 Ga0466971_0009252_1800_2468 203
1572 3300044719 Ga0466971_0075630 Ga0466971_0075630_276_971 203
1573 3300044765 Ga0466970_0002904 Ga0466970_0002904_5550_6218 203
1574 3300044842 Ga0466957_0038351 Ga0466957_0038351_974_1669 203
1575 3300044842 Ga0466957_0048030 Ga0466957_0048030_679_1347 203
1576 3300045049 Ga0466959_0026579 Ga0466959_0026579_1437_2105 203
1577 3300045049 Ga0466959_0049086 Ga0466959_0049086_2383_3051 203
1578 3300045049 Ga0466959_0083940 Ga0466959_0083940_1583_2203 203
1579 3300045836 Ga0466958_0003881 Ga0466958_0003881_738_1406 203
1580 3300045836 Ga0466958_0076274 Ga0466958_0076274_1356_2024 203
1581 3300045836 Ga0466958_0104893 Ga0466958_0104893_647_1342 203
1582 3300045836 Ga0466958_0141157 Ga0466958_0141157_754_1374 203
1583 3300045976 Ga0466967_0139106 Ga0466967_0139106_1425_2045 203
1584 3300046471 Ga0495650_0073727 Ga0495650_0073727_209_829 203
1585 3300046475 Ga0495639_0034523 Ga0495639_0034523_1170_1790 203
1586 3300046506 Ga0495583_0000313 Ga0495583_0000313_42803_43423 203
1587 3300046507 Ga0495606_0001607 Ga0495606_0001607_2492_3112 203
1588 3300046539 Ga0495621_0014656 Ga0495621_0014656_272_892 203
1589 3300046615 Ga0495656_0000884 Ga0495656_0000884_1821_2441 203
1590 3300046684 Ga0495669_0018434 Ga0495669_0018434_1620_2240 203
1591 3300046692 Ga0495671_0058269 Ga0495671_0058269_810_1430 203
1592 3300046694 Ga0495649_0000665 Ga0495649_0000665_5376_5996 203
1593 3300046794 Ga0495589_0006421 Ga0495589_0006421_714_1334 203
1594 3300048912 Ga0496109_0092273 Ga0496109_0092273_762_1382 203
1595 3300048913 Ga0496110_0195204 Ga0496110_0195204_598_1224 203
1596 3300048919 Ga0496116_0000065 Ga0496116_0000065_56111_56731 203
1597 3300048920 Ga0496117_0000866 Ga0496117_0000866_45949_46569 203
1598 3300048921 Ga0496118_0220971 Ga0496118_0220971_291_911 203
1599 3300049521 Ga0501298_024284 Ga0501298_024284_271_891 203
1600 3300049579 Ga0501043_0000071 Ga0501043_0000071_25575_26198 203
1601 3300049580 Ga0501046_0000311 Ga0501046_0000311_25573_26196 203
1602 3300049581 Ga0501047_0000087 Ga0501047_0000087_91140_91763 203
1603 3300049582 Ga0501048_0000226 Ga0501048_0000226_26897_27520 203
1604 3300049705 Ga0501225_0065977 Ga0501225_0065977_97_717 203
1605 3300049762 Ga0501265_000721 Ga0501265_000721_2929_3549 203
1606 3300049777 Ga0501281_02092 Ga0501281_02092_68_688 203
1607 3300049824 Ga0501045_0101064 Ga0501045_0101064_564_1187 203
1608 3300050493 nmdc:mga0k408_11975_c1 nmdc:mga0k408_11975_c1_2402_3022 203
1609 3300050493 nmdc:mga0k408_34788_c1 nmdc:mga0k408_34788_c1_1266_1886 203
1610 3300053080 Ga0500635_0000072 Ga0500635_0000072_46280_46900 203
1611 3300055283 Ga0500661_011828 Ga0500661_011828_126_746 203
1612 3300061719 Ga0466962_0004499 Ga0466962_0004499_3998_4693 203
1613 3300061719 Ga0466962_0007394 Ga0466962_0007394_521_1141 203
1614 3300003323 rootH1_10097074 rootH1_100970742 204
1615 3300005293 Ga0065715_10169762 Ga0065715_101697621 204
1616 3300005328 Ga0070676_10009234 Ga0070676_100092342 204
1617 3300005328 Ga0070676_10016418 Ga0070676_100164182 204
1618 3300005329 Ga0070683_100152822 Ga0070683_1001528222 204
1619 3300005330 Ga0070690_100012120 Ga0070690_1000121202 204
1620 3300005331 Ga0070670_100242043 Ga0070670_1002420432 204
1621 3300005333 Ga0070677_10010314 Ga0070677_100103142 204
1622 3300005334 Ga0068869_100000109 Ga0068869_10000010912 204
1623 3300005334 Ga0068869_100025418 Ga0068869_1000254183 204
1624 3300005335 Ga0070666_10010714 Ga0070666_100107142 204
1625 3300005338 Ga0068868_100000895 Ga0068868_10000089512 204
1626 3300005338 Ga0068868_100000928 Ga0068868_1000009288 204
1627 3300005340 Ga0070689_100265862 Ga0070689_1002658622 204
1628 3300005347 Ga0070668_100154246 Ga0070668_1001542461 204
1629 3300005353 Ga0070669_100010114 Ga0070669_1000101147 204
1630 3300005353 Ga0070669_100027346 Ga0070669_1000273462 204
1631 3300005354 Ga0070675_100000621 Ga0070675_10000062110 204
1632 3300005354 Ga0070675_100000772 Ga0070675_10000077211 204
1633 3300005355 Ga0070671_100353375 Ga0070671_1003533752 204
1634 3300005364 Ga0070673_100005018 Ga0070673_1000050182 204
1635 3300005366 Ga0070659_100011653 Ga0070659_1000116533 204
1636 3300005367 Ga0070667_100005806 Ga0070667_1000058068 204
1637 3300005455 Ga0070663_100003719 Ga0070663_1000037193 204
1638 3300005457 Ga0070662_100001965 Ga0070662_1000019659 204
1639 3300005457 Ga0070662_100397392 Ga0070662_1003973921 204
1640 3300005459 Ga0068867_100243698 Ga0068867_1002436982 204
1641 3300005539 Ga0068853_100110330 Ga0068853_1001103302 204
1642 3300005543 Ga0070672_100041547 Ga0070672_1000415472 204
1643 3300005547 Ga0070693_100037016 Ga0070693_1000370162 204
1644 3300005548 Ga0070665_100133333 Ga0070665_1001333333 204
1645 3300005577 Ga0068857_100050833 Ga0068857_1000508332 204
1646 3300005578 Ga0068854_100107770 Ga0068854_1001077702 204
1647 3300005614 Ga0068856_100152331 Ga0068856_1001523312 204
1648 3300005615 Ga0070702_100229285 Ga0070702_1002292852 204
1649 3300005616 Ga0068852_100014330 Ga0068852_1000143303 204
1650 3300005616 Ga0068852_100180005 Ga0068852_1001800052 204
1651 3300005617 Ga0068859_100008484 Ga0068859_1000084843 204
1652 3300005618 Ga0068864_100000270 Ga0068864_10000027011 204
1653 3300005719 Ga0068861_100000126 Ga0068861_10000012612 204
1654 3300005719 Ga0068861_100020024 Ga0068861_1000200242 204
1655 3300005834 Ga0068851_10163325 Ga0068851_101633252 204
1656 3300005841 Ga0068863_100000679 Ga0068863_1000006799 204
1657 3300005841 Ga0068863_100463579 Ga0068863_1004635792 204
1658 3300005842 Ga0068858_100000225 Ga0068858_10000022511 204
1659 3300005842 Ga0068858_100134936 Ga0068858_1001349363 204
1660 3300005844 Ga0068862_100082999 Ga0068862_1000829992 204
1661 3300006237 Ga0097621_100007479 Ga0097621_1000074797 204
1662 3300006237 Ga0097621_100018660 Ga0097621_1000186605 204
1663 3300006358 Ga0068871_100078234 Ga0068871_1000782343 204
1664 3300006881 Ga0068865_100178424 Ga0068865_1001784242 204
1665 3300006931 Ga0097620_100008484 Ga0097620_1000084843 204
1666 3300009093 Ga0105240_10126850 Ga0105240_101268501 204
1667 3300009094 Ga0111539_10518546 Ga0111539_105185462 204
1668 3300009098 Ga0105245_10532893 Ga0105245_105328932 204
1669 3300009148 Ga0105243_10066230 Ga0105243_100662301 204
1670 3300009176 Ga0105242_10302608 Ga0105242_103026082 204
1671 3300009177 Ga0105248_10009628 Ga0105248_100096284 204
1672 3300009177 Ga0105248_10021381 Ga0105248_100213813 204
1673 3300009177 Ga0105248_10228802 Ga0105248_102288022 204
1674 3300009545 Ga0105237_10359684 Ga0105237_103596842 204
1675 3300009551 Ga0105238_10112274 Ga0105238_101122742 204
1676 3300009553 Ga0105249_10032185 Ga0105249_100321853 204
1677 3300009553 Ga0105249_10515878 Ga0105249_105158782 204
1678 3300010375 Ga0105239_10727320 Ga0105239_107273202 204
1679 3300013297 Ga0157378_11393369 Ga0157378_113933691 204
1680 3300013306 Ga0163162_10018986 Ga0163162_100189865 204
1681 3300013306 Ga0163162_10021486 Ga0163162_100214864 204
1682 3300013306 Ga0163162_10205453 Ga0163162_102054533 204
1683 3300013307 Ga0157372_10231102 Ga0157372_102311022 204
1684 3300013308 Ga0157375_10097833 Ga0157375_100978332 204
1685 3300013308 Ga0157375_10285270 Ga0157375_102852702 204
1686 3300014326 Ga0157380_10038632 Ga0157380_100386323 204
1687 3300014326 Ga0157380_10790695 Ga0157380_107906952 204
1688 3300014745 Ga0157377_10001137 Ga0157377_100011379 204
1689 3300014968 Ga0157379_10002398 Ga0157379_1000239812 204
1690 3300014968 Ga0157379_10011386 Ga0157379_100113868 204
1691 3300014969 Ga0157376_10076384 Ga0157376_100763843 204
1692 3300014969 Ga0157376_10240412 Ga0157376_102404122 204
1693 3300017792 Ga0163161_10048831 Ga0163161_100488314 204
1694 3300017792 Ga0163161_10077140 Ga0163161_100771403 204
1695 3300017792 Ga0163161_10159485 Ga0163161_101594852 204
1696 3300025271 Ga0207666_1007136 Ga0207666_10071362 204
1697 3300025315 Ga0207697_10024046 Ga0207697_100240463 204
1698 3300025321 Ga0207656_10161076 Ga0207656_101610762 204
1699 3300025893 Ga0207682_10016767 Ga0207682_100167672 204
1700 3300025901 Ga0207688_10030555 Ga0207688_100305552 204
1701 3300025903 Ga0207680_10000416 Ga0207680_1000041613 204
1702 3300025907 Ga0207645_10022550 Ga0207645_100225502 204
1703 3300025907 Ga0207645_10030541 Ga0207645_100305412 204
1704 3300025919 Ga0207657_10076636 Ga0207657_100766362 204
1705 3300025923 Ga0207681_10018269 Ga0207681_100182692 204
1706 3300025923 Ga0207681_10393913 Ga0207681_103939132 204
1707 3300025924 Ga0207694_10215673 Ga0207694_102156732 204
1708 3300025925 Ga0207650_10108359 Ga0207650_101083593 204
1709 3300025926 Ga0207659_10001869 Ga0207659_1000186910 204
1710 3300025926 Ga0207659_10002398 Ga0207659_100023988 204
1711 3300025927 Ga0207687_10036867 Ga0207687_100368672 204
1712 3300025931 Ga0207644_10000543 Ga0207644_1000054319 204
1713 3300025932 Ga0207690_10025602 Ga0207690_100256022 204
1714 3300025933 Ga0207706_10000736 Ga0207706_1000073623 204
1715 3300025933 Ga0207706_10130237 Ga0207706_101302372 204
1716 3300025936 Ga0207670_10214048 Ga0207670_102140482 204
1717 3300025937 Ga0207669_10106274 Ga0207669_101062742 204
1718 3300025938 Ga0207704_10020597 Ga0207704_100205974 204
1719 3300025940 Ga0207691_10103580 Ga0207691_101035802 204
1720 3300025941 Ga0207711_10002545 Ga0207711_100025457 204
1721 3300025941 Ga0207711_10034440 Ga0207711_100344402 204
1722 3300025942 Ga0207689_10000259 Ga0207689_1000025935 204
1723 3300025942 Ga0207689_10025240 Ga0207689_100252403 204
1724 3300025960 Ga0207651_10001900 Ga0207651_100019005 204
1725 3300025961 Ga0207712_10050088 Ga0207712_100500883 204
1726 3300025961 Ga0207712_10541641 Ga0207712_105416412 204
1727 3300025972 Ga0207668_10035224 Ga0207668_100352242 204
1728 3300025981 Ga0207640_10072693 Ga0207640_100726932 204
1729 3300025986 Ga0207658_10005463 Ga0207658_100054636 204
1730 3300026023 Ga0207677_10001436 Ga0207677_1000143612 204
1731 3300026023 Ga0207677_10011722 Ga0207677_100117223 204
1732 3300026035 Ga0207703_10000408 Ga0207703_1000040835 204
1733 3300026035 Ga0207703_10116560 Ga0207703_101165602 204
1734 3300026041 Ga0207639_10083505 Ga0207639_100835053 204
1735 3300026067 Ga0207678_10236582 Ga0207678_102365822 204
1736 3300026078 Ga0207702_10074159 Ga0207702_100741592 204
1737 3300026088 Ga0207641_10002065 Ga0207641_1000206511 204
1738 3300026088 Ga0207641_10754848 Ga0207641_107548482 204
1739 3300026089 Ga0207648_10269565 Ga0207648_102695652 204
1740 3300026095 Ga0207676_10000269 Ga0207676_1000026935 204
1741 3300026095 Ga0207676_10082855 Ga0207676_100828552 204
1742 3300026116 Ga0207674_10026017 Ga0207674_100260172 204
1743 3300026118 Ga0207675_100000307 Ga0207675_10000030712 204
1744 3300026118 Ga0207675_100033253 Ga0207675_1000332535 204
1745 3300026118 Ga0207675_100192930 Ga0207675_1001929302 204
1746 3300026121 Ga0207683_10001051 Ga0207683_1000105114 204
1747 3300026142 Ga0207698_10004189 Ga0207698_100041898 204
1748 3300026142 Ga0207698_10012346 Ga0207698_100123465 204
1749 3300027907 Ga0207428_10626383 Ga0207428_106263831 204
1750 3300028379 Ga0268266_10082233 Ga0268266_100822332 204
1751 3300028381 Ga0268264_10029957 Ga0268264_100299575 204
1752 3300033180 Ga0307510_10187942 Ga0307510_101879423 204
1753 3300035088 Ga0373940_0021250 Ga0373940_0021250_676_1311 204
1754 3300035115 Ga0373941_0053875 Ga0373941_0053875_631_1266 204
1755 3300035691 Ga0373931_0001075 Ga0373931_0001075_7871_8506 204
1756 3300045051 Ga0451576_0220891 Ga0451576_0220891_1169_1804 204
1757 3300045976 Ga0466967_0483430 Ga0466967_0483430_356_979 204
1758 3300047321 Ga0495676_0566133 Ga0495676_0566133_17_652 204
1759 3300047472 Ga0495686_0006771 Ga0495686_0006771_2960_3586 204
1760 3300048903 Ga0496100_0109234 Ga0496100_0109234_1129_1764 204
1761 3300048904 Ga0496101_0005191 Ga0496101_0005191_5704_6339 204
1762 3300048905 Ga0496102_0029586 Ga0496102_0029586_456_1091 204
1763 3300048907 Ga0496104_0149429 Ga0496104_0149429_1243_1905 204
1764 3300048908 Ga0496105_0174019 Ga0496105_0174019_111_746 204
1765 3300048909 Ga0496106_0002032 Ga0496106_0002032_2345_2980 204
1766 3300048910 Ga0496107_0009689 Ga0496107_0009689_915_1550 204
1767 3300048910 Ga0496107_0238682 Ga0496107_0238682_579_1241 204
1768 3300048912 Ga0496109_0050006 Ga0496109_0050006_1684_2346 204
1769 3300048913 Ga0496110_0005584 Ga0496110_0005584_7534_8169 204
1770 3300048917 Ga0496114_0009654 Ga0496114_0009654_1237_1872 204
1771 3300048917 Ga0496114_0591408 Ga0496114_0591408_157_819 204
1772 3300048918 Ga0496115_0040075 Ga0496115_0040075_183_818 204
1773 3300050512 nmdc:mga0n895_464316_c1 nmdc:mga0n895_464316_c1_446_1081 204
1774 3300002244 JGI24742J22300_10027710 JGI24742J22300_100277102 205
1775 3300005328 Ga0070676_10001260 Ga0070676_100012602 205
1776 3300005329 Ga0070683_100093396 Ga0070683_1000933963 205
1777 3300005330 Ga0070690_100034503 Ga0070690_1000345031 205
1778 3300005331 Ga0070670_100048774 Ga0070670_1000487742 205
1779 3300005333 Ga0070677_10063874 Ga0070677_100638742 205
1780 3300005333 Ga0070677_10119082 Ga0070677_101190822 205
1781 3300005335 Ga0070666_10022337 Ga0070666_100223374 205
1782 3300005335 Ga0070666_10032542 Ga0070666_100325422 205
1783 3300005338 Ga0068868_100030201 Ga0068868_1000302014 205
1784 3300005339 Ga0070660_100019782 Ga0070660_1000197826 205
1785 3300005340 Ga0070689_100003058 Ga0070689_1000030584 205
1786 3300005344 Ga0070661_100029542 Ga0070661_1000295423 205
1787 3300005344 Ga0070661_100242801 Ga0070661_1002428012 205
1788 3300005345 Ga0070692_10013623 Ga0070692_100136232 205
1789 3300005347 Ga0070668_100768920 Ga0070668_1007689201 205
1790 3300005353 Ga0070669_100035026 Ga0070669_1000350264 205
1791 3300005355 Ga0070671_100077908 Ga0070671_1000779082 205
1792 3300005355 Ga0070671_100125094 Ga0070671_1001250943 205
1793 3300005356 Ga0070674_100043954 Ga0070674_1000439542 205
1794 3300005364 Ga0070673_100026947 Ga0070673_1000269475 205
1795 3300005364 Ga0070673_100096508 Ga0070673_1000965083 205
1796 3300005366 Ga0070659_100016119 Ga0070659_1000161192 205
1797 3300005366 Ga0070659_100223148 Ga0070659_1002231482 205
1798 3300005366 Ga0070659_100391073 Ga0070659_1003910732 205
1799 3300005367 Ga0070667_100042070 Ga0070667_1000420703 205
1800 3300005367 Ga0070667_100100603 Ga0070667_1001006032 205
1801 3300005367 Ga0070667_100373681 Ga0070667_1003736812 205
1802 3300005367 Ga0070667_100533014 Ga0070667_1005330142 205
1803 3300005367 Ga0070667_100989641 Ga0070667_1009896411 205
1804 3300005436 Ga0070713_100000018 Ga0070713_10000001879 205
1805 3300005437 Ga0070710_10399514 Ga0070710_103995142 205
1806 3300005437 Ga0070710_10404875 Ga0070710_104048752 205
1807 3300005438 Ga0070701_10118482 Ga0070701_101184822 205
1808 3300005441 Ga0070700_100015826 Ga0070700_1000158262 205
1809 3300005456 Ga0070678_100000941 Ga0070678_10000094112 205
1810 3300005456 Ga0070678_100611614 Ga0070678_1006116141 205
1811 3300005456 Ga0070678_100808854 Ga0070678_1008088541 205
1812 3300005457 Ga0070662_100074655 Ga0070662_1000746552 205
1813 3300005459 Ga0068867_100904289 Ga0068867_1009042891 205
1814 3300005535 Ga0070684_100019501 Ga0070684_1000195013 205
1815 3300005539 Ga0068853_100202750 Ga0068853_1002027502 205
1816 3300005539 Ga0068853_100580305 Ga0068853_1005803051 205
1817 3300005543 Ga0070672_100058354 Ga0070672_1000583543 205
1818 3300005543 Ga0070672_100383316 Ga0070672_1003833162 205
1819 3300005547 Ga0070693_100320706 Ga0070693_1003207061 205
1820 3300005548 Ga0070665_100058043 Ga0070665_1000580432 205
1821 3300005563 Ga0068855_100066535 Ga0068855_1000665353 205
1822 3300005564 Ga0070664_100939451 Ga0070664_1009394512 205
1823 3300005577 Ga0068857_100025285 Ga0068857_1000252855 205
1824 3300005578 Ga0068854_100072584 Ga0068854_1000725842 205
1825 3300005578 Ga0068854_100132320 Ga0068854_1001323202 205
1826 3300005578 Ga0068854_100349997 Ga0068854_1003499972 205
1827 3300005614 Ga0068856_100104259 Ga0068856_1001042592 205
1828 3300005614 Ga0068856_100347043 Ga0068856_1003470432 205
1829 3300005615 Ga0070702_100007631 Ga0070702_1000076315 205
1830 3300005616 Ga0068852_100100432 Ga0068852_1001004322 205
1831 3300005617 Ga0068859_100020441 Ga0068859_1000204411 205
1832 3300005617 Ga0068859_100251951 Ga0068859_1002519513 205
1833 3300005618 Ga0068864_100003834 Ga0068864_1000038344 205
1834 3300005718 Ga0068866_10027919 Ga0068866_100279192 205
1835 3300005834 Ga0068851_10020460 Ga0068851_100204602 205
1836 3300005840 Ga0068870_10013617 Ga0068870_100136174 205
1837 3300005842 Ga0068858_100042529 Ga0068858_1000425295 205
1838 3300005842 Ga0068858_100052225 Ga0068858_1000522252 205
1839 3300005842 Ga0068858_100886630 Ga0068858_1008866301 205
1840 3300006028 Ga0070717_10422491 Ga0070717_104224912 205
1841 3300006038 Ga0075365_10010319 Ga0075365_100103193 205
1842 3300006358 Ga0068871_100132455 Ga0068871_1001324552 205
1843 3300006358 Ga0068871_100312150 Ga0068871_1003121502 205
1844 3300006852 Ga0075433_10289896 Ga0075433_102898962 205
1845 3300006881 Ga0068865_100076924 Ga0068865_1000769243 205
1846 3300006931 Ga0097620_100020438 Ga0097620_1000204381 205
1847 3300006931 Ga0097620_100251960 Ga0097620_1002519603 205
1848 3300009094 Ga0111539_10022792 Ga0111539_100227929 205
1849 3300009147 Ga0114129_11199656 Ga0114129_111996562 205
1850 3300009176 Ga0105242_10036739 Ga0105242_100367394 205
1851 3300009177 Ga0105248_10006493 Ga0105248_100064936 205
1852 3300009545 Ga0105237_10651532 Ga0105237_106515322 205
1853 3300009553 Ga0105249_10822595 Ga0105249_108225952 205
1854 3300009553 Ga0105249_10827093 Ga0105249_108270932 205
1855 3300010375 Ga0105239_10062791 Ga0105239_100627912 205
1856 3300013105 Ga0157369_10210299 Ga0157369_102102992 205
1857 3300013105 Ga0157369_10227997 Ga0157369_102279972 205
1858 3300013296 Ga0157374_10177479 Ga0157374_101774792 205
1859 3300013297 Ga0157378_10299170 Ga0157378_102991702 205
1860 3300013297 Ga0157378_10308128 Ga0157378_103081281 205
1861 3300013297 Ga0157378_10951050 Ga0157378_109510502 205
1862 3300013306 Ga0163162_10066999 Ga0163162_100669991 205
1863 3300013306 Ga0163162_10678728 Ga0163162_106787282 205
1864 3300013307 Ga0157372_10033146 Ga0157372_100331462 205
1865 3300013308 Ga0157375_10291660 Ga0157375_102916601 205
1866 3300014325 Ga0163163_10616047 Ga0163163_106160471 205
1867 3300014326 Ga0157380_10821704 Ga0157380_108217042 205
1868 3300014326 Ga0157380_11256544 Ga0157380_112565441 205
1869 3300014745 Ga0157377_10037573 Ga0157377_100375734 205
1870 3300014968 Ga0157379_10014287 Ga0157379_100142876 205
1871 3300014968 Ga0157379_10038589 Ga0157379_100385895 205
1872 3300014969 Ga0157376_10084787 Ga0157376_100847874 205
1873 3300017792 Ga0163161_10091622 Ga0163161_100916222 205
1874 3300017792 Ga0163161_10535122 Ga0163161_105351222 205
1875 3300025290 Ga0207673_1000918 Ga0207673_10009184 205
1876 3300025315 Ga0207697_10002645 Ga0207697_100026457 205
1877 3300025321 Ga0207656_10006336 Ga0207656_100063362 205
1878 3300025321 Ga0207656_10069172 Ga0207656_100691722 205
1879 3300025893 Ga0207682_10003790 Ga0207682_100037902 205
1880 3300025899 Ga0207642_10248448 Ga0207642_102484482 205
1881 3300025901 Ga0207688_10001682 Ga0207688_100016827 205
1882 3300025903 Ga0207680_10025108 Ga0207680_100251084 205
1883 3300025907 Ga0207645_10001481 Ga0207645_100014817 205
1884 3300025908 Ga0207643_10002283 Ga0207643_100022837 205
1885 3300025909 Ga0207705_10051510 Ga0207705_100515104 205
1886 3300025914 Ga0207671_10058639 Ga0207671_100586394 205
1887 3300025915 Ga0207693_10045045 Ga0207693_100450454 205
1888 3300025918 Ga0207662_10001442 Ga0207662_100014425 205
1889 3300025919 Ga0207657_10032593 Ga0207657_100325934 205
1890 3300025920 Ga0207649_10036887 Ga0207649_100368872 205
1891 3300025923 Ga0207681_10283321 Ga0207681_102833212 205
1892 3300025925 Ga0207650_10002771 Ga0207650_100027718 205
1893 3300025925 Ga0207650_10044510 Ga0207650_100445102 205
1894 3300025926 Ga0207659_10011351 Ga0207659_100113516 205
1895 3300025928 Ga0207700_10000052 Ga0207700_1000005256 205
1896 3300025931 Ga0207644_10003185 Ga0207644_100031855 205
1897 3300025932 Ga0207690_10018974 Ga0207690_100189743 205
1898 3300025932 Ga0207690_10126134 Ga0207690_101261342 205
1899 3300025933 Ga0207706_10003460 Ga0207706_100034607 205
1900 3300025937 Ga0207669_10002740 Ga0207669_100027403 205
1901 3300025937 Ga0207669_10016706 Ga0207669_100167064 205
1902 3300025938 Ga0207704_10281057 Ga0207704_102810572 205
1903 3300025940 Ga0207691_10004886 Ga0207691_100048864 205
1904 3300025940 Ga0207691_10018207 Ga0207691_100182077 205
1905 3300025940 Ga0207691_10074883 Ga0207691_100748833 205
1906 3300025941 Ga0207711_10007597 Ga0207711_100075972 205
1907 3300025941 Ga0207711_10047277 Ga0207711_100472772 205
1908 3300025942 Ga0207689_10019394 Ga0207689_100193944 205
1909 3300025944 Ga0207661_10571633 Ga0207661_105716332 205
1910 3300025945 Ga0207679_10013547 Ga0207679_100135473 205
1911 3300025945 Ga0207679_10859123 Ga0207679_108591231 205
1912 3300025949 Ga0207667_10055665 Ga0207667_100556653 205
1913 3300025960 Ga0207651_10072585 Ga0207651_100725853 205
1914 3300025960 Ga0207651_10110633 Ga0207651_101106332 205
1915 3300025961 Ga0207712_10371102 Ga0207712_103711022 205
1916 3300025972 Ga0207668_10290848 Ga0207668_102908482 205
1917 3300025981 Ga0207640_10036401 Ga0207640_100364012 205
1918 3300025981 Ga0207640_10820422 Ga0207640_108204222 205
1919 3300025986 Ga0207658_10023760 Ga0207658_100237603 205
1920 3300025986 Ga0207658_10201013 Ga0207658_102010132 205
1921 3300025986 Ga0207658_10473957 Ga0207658_104739572 205
1922 3300026023 Ga0207677_10174490 Ga0207677_101744903 205
1923 3300026023 Ga0207677_10539610 Ga0207677_105396101 205
1924 3300026035 Ga0207703_10065549 Ga0207703_100655492 205
1925 3300026035 Ga0207703_10258828 Ga0207703_102588282 205
1926 3300026067 Ga0207678_10003576 Ga0207678_1000357614 205
1927 3300026075 Ga0207708_10000558 Ga0207708_1000055819 205
1928 3300026089 Ga0207648_10010711 Ga0207648_100107118 205
1929 3300026095 Ga0207676_10022527 Ga0207676_100225274 205
1930 3300026116 Ga0207674_10002376 Ga0207674_100023768 205
1931 3300026116 Ga0207674_10214850 Ga0207674_102148502 205
1932 3300026118 Ga0207675_100002315 Ga0207675_1000023156 205
1933 3300026118 Ga0207675_100061406 Ga0207675_1000614062 205
1934 3300026121 Ga0207683_10009047 Ga0207683_100090473 205
1935 3300026121 Ga0207683_10011779 Ga0207683_100117796 205
1936 3300026121 Ga0207683_10409034 Ga0207683_104090342 205
1937 3300026121 Ga0207683_10604826 Ga0207683_106048262 205
1938 3300026142 Ga0207698_10025234 Ga0207698_100252344 205
1939 3300026142 Ga0207698_10101682 Ga0207698_101016823 205
1940 3300027526 Ga0209968_1013722 Ga0209968_10137222 205
1941 3300027617 Ga0210002_1007602 Ga0210002_10076023 205
1942 3300027717 Ga0209998_10008846 Ga0209998_100088462 205
1943 3300027876 Ga0209974_10000445 Ga0209974_1000044510 205
1944 3300028379 Ga0268266_10299975 Ga0268266_102999752 205
1945 3300028380 Ga0268265_10114171 Ga0268265_101141713 205
1946 3300028381 Ga0268264_10121640 Ga0268264_101216402 205
1947 3300031548 Ga0307408_100272653 Ga0307408_1002726532 205
1948 3300031730 Ga0307516_10007532 Ga0307516_100075323 205
1949 3300031824 Ga0307413_10001878 Ga0307413_100018782 205
1950 3300031901 Ga0307406_10023234 Ga0307406_100232343 205
1951 3300031995 Ga0307409_100002844 Ga0307409_1000028442 205
1952 3300032002 Ga0307416_100002602 Ga0307416_1000026022 205
1953 3300032004 Ga0307414_10091577 Ga0307414_100915773 205
1954 3300032005 Ga0307411_10056023 Ga0307411_100560233 205
1955 3300035113 Ga0373936_0044308 Ga0373936_0044308_743_1399 205
1956 3300036401 Ga0373937_0015648 Ga0373937_0015648_5685_6323 205
1957 3300037068 Ga0373925_0242691 Ga0373925_0242691_439_1077 205
1958 3300037068 Ga0373925_0595786 Ga0373925_0595786_24_662 205
1959 3300037853 Ga0436364_1521153 Ga0436364_1521153_660_1295 205
1960 3300039437 Ga0436365_1498206 Ga0436365_1498206_14_649 205
1961 3300041491 Ga0451833_1190930 Ga0451833_1190930_80_721 205
1962 3300041512 Ga0451853_1447831 Ga0451853_1447831_803_1441 205
1963 3300042012 Ga0439455_0047256 Ga0439455_0047256_192_881 205
1964 3300042439 Ga0439464_0004864 Ga0439464_0004864_834_1523 205
1965 3300045051 Ga0451576_0178637 Ga0451576_0178637_790_1425 205
1966 3300046537 Ga0495598_0021406 Ga0495598_0021406_955_1593 205
1967 3300046539 Ga0495621_0006769 Ga0495621_0006769_78_716 205
1968 3300048903 Ga0496100_0032367 Ga0496100_0032367_1038_1676 205
1969 3300048903 Ga0496100_0317195 Ga0496100_0317195_128_754 205
1970 3300048905 Ga0496102_0141534 Ga0496102_0141534_405_1043 205
1971 3300048905 Ga0496102_0246661 Ga0496102_0246661_36_674 205
1972 3300048905 Ga0496102_0410713 Ga0496102_0410713_535_1161 205
1973 3300048907 Ga0496104_0033621 Ga0496104_0033621_1158_1796 205
1974 3300048907 Ga0496104_0259575 Ga0496104_0259575_602_1228 205
1975 3300048909 Ga0496106_0082536 Ga0496106_0082536_593_1231 205
1976 3300048912 Ga0496109_0008278 Ga0496109_0008278_4287_4925 205
1977 3300048915 Ga0496112_0812197 Ga0496112_0812197_175_813 205
1978 3300048917 Ga0496114_0008095 Ga0496114_0008095_1802_2440 205
1979 3300049574 Ga0501038_0522109 Ga0501038_0522109_169_795 205
1980 3300049575 Ga0501039_0207273 Ga0501039_0207273_125_751 205
1981 3300049577 Ga0501041_0472878 Ga0501041_0472878_86_712 205
1982 3300049578 Ga0501042_0317510 Ga0501042_0317510_239_865 205
1983 3300049588 Ga0501072_0466182 Ga0501072_0466182_171_797 205
1984 3300049823 Ga0501044_0034206 Ga0501044_0034206_4527_5153 205
1985 3300050492 nmdc:mga0yw44_26588_c1 nmdc:mga0yw44_26588_c1_745_1377 205
1986 3300050511 nmdc:mga08y16_103169_c1 nmdc:mga08y16_103169_c1_1921_2559 205
1987 3300050513 nmdc:mga0rr50_511315_c1 nmdc:mga0rr50_511315_c1_76_714 205
1988 3300060353 Ga0501082_0852826 Ga0501082_0852826_49_675 205
1989 3300061734 Ga0530510_0872702 Ga0530510_0872702_38_664 205
1990 2010549000 RicEn_FSXC70212_g1 RicEn_530520 206
1991 3300005328 Ga0070676_10011240 Ga0070676_100112406 206
1992 3300005329 Ga0070683_100025144 Ga0070683_1000251443 206
1993 3300005330 Ga0070690_100249148 Ga0070690_1002491482 206
1994 3300005331 Ga0070670_100789880 Ga0070670_1007898802 206
1995 3300005334 Ga0068869_100033584 Ga0068869_1000335843 206
1996 3300005335 Ga0070666_10051656 Ga0070666_100516562 206
1997 3300005338 Ga0068868_100022186 Ga0068868_1000221862 206
1998 3300005338 Ga0068868_100105992 Ga0068868_1001059922 206
1999 3300005339 Ga0070660_100230342 Ga0070660_1002303422 206
2000 3300005340 Ga0070689_100064787 Ga0070689_1000647872 206
2001 3300005343 Ga0070687_100012451 Ga0070687_1000124513 206
2002 3300005343 Ga0070687_100123626 Ga0070687_1001236262 206
2003 3300005344 Ga0070661_100014534 Ga0070661_1000145343 206
2004 3300005344 Ga0070661_100387720 Ga0070661_1003877201 206
2005 3300005347 Ga0070668_100037799 Ga0070668_1000377992 206
2006 3300005353 Ga0070669_100003867 Ga0070669_1000038673 206
2007 3300005354 Ga0070675_100019977 Ga0070675_1000199773 206
2008 3300005354 Ga0070675_100202813 Ga0070675_1002028132 206
2009 3300005355 Ga0070671_100136348 Ga0070671_1001363482 206
2010 3300005356 Ga0070674_100009649 Ga0070674_1000096493 206
2011 3300005364 Ga0070673_100034172 Ga0070673_1000341722 206
2012 3300005366 Ga0070659_100014156 Ga0070659_1000141565 206
2013 3300005367 Ga0070667_100007096 Ga0070667_1000070969 206
2014 3300005367 Ga0070667_100025581 Ga0070667_1000255815 206
2015 3300005438 Ga0070701_10139266 Ga0070701_101392662 206
2016 3300005441 Ga0070700_100206386 Ga0070700_1002063862 206
2017 3300005456 Ga0070678_100295503 Ga0070678_1002955032 206
2018 3300005456 Ga0070678_100489479 Ga0070678_1004894792 206
2019 3300005457 Ga0070662_100462487 Ga0070662_1004624872 206
2020 3300005458 Ga0070681_10056763 Ga0070681_100567633 206
2021 3300005459 Ga0068867_100005611 Ga0068867_1000056118 206
2022 3300005530 Ga0070679_100003825 Ga0070679_10000382513 206
2023 3300005535 Ga0070684_100041554 Ga0070684_1000415543 206
2024 3300005535 Ga0070684_100057631 Ga0070684_1000576311 206
2025 3300005539 Ga0068853_100017836 Ga0068853_1000178363 206
2026 3300005543 Ga0070672_100002181 Ga0070672_1000021819 206
2027 3300005543 Ga0070672_100021542 Ga0070672_1000215423 206
2028 3300005543 Ga0070672_100422823 Ga0070672_1004228232 206
2029 3300005547 Ga0070693_100424186 Ga0070693_1004241861 206
2030 3300005548 Ga0070665_100181467 Ga0070665_1001814672 206
2031 3300005563 Ga0068855_100138616 Ga0068855_1001386162 206
2032 3300005564 Ga0070664_100011493 Ga0070664_1000114935 206
2033 3300005564 Ga0070664_100089333 Ga0070664_1000893332 206
2034 3300005564 Ga0070664_100104005 Ga0070664_1001040053 206
2035 3300005577 Ga0068857_100077462 Ga0068857_1000774622 206
2036 3300005578 Ga0068854_100106117 Ga0068854_1001061172 206
2037 3300005614 Ga0068856_100076585 Ga0068856_1000765853 206
2038 3300005614 Ga0068856_100255630 Ga0068856_1002556302 206
2039 3300005616 Ga0068852_100013214 Ga0068852_1000132148 206
2040 3300005616 Ga0068852_100015034 Ga0068852_1000150345 206
2041 3300005616 Ga0068852_100084266 Ga0068852_1000842662 206
2042 3300005616 Ga0068852_100815977 Ga0068852_1008159772 206
2043 3300005617 Ga0068859_100027077 Ga0068859_1000270774 206
2044 3300005617 Ga0068859_100109338 Ga0068859_1001093383 206
2045 3300005618 Ga0068864_100011737 Ga0068864_1000117375 206
2046 3300005618 Ga0068864_100025267 Ga0068864_1000252672 206
2047 3300005618 Ga0068864_100225337 Ga0068864_1002253372 206
2048 3300005618 Ga0068864_100420409 Ga0068864_1004204092 206
2049 3300005719 Ga0068861_100024484 Ga0068861_1000244842 206
2050 3300005834 Ga0068851_10155557 Ga0068851_101555572 206
2051 3300005841 Ga0068863_100034797 Ga0068863_1000347973 206
2052 3300005841 Ga0068863_100259269 Ga0068863_1002592692 206
2053 3300005841 Ga0068863_100397503 Ga0068863_1003975032 206
2054 3300005841 Ga0068863_100666250 Ga0068863_1006662501 206
2055 3300005842 Ga0068858_100003892 Ga0068858_10000389210 206
2056 3300005842 Ga0068858_100095010 Ga0068858_1000950102 206
2057 3300005843 Ga0068860_100006887 Ga0068860_1000068873 206
2058 3300005843 Ga0068860_100015755 Ga0068860_1000157553 206
2059 3300005843 Ga0068860_100524543 Ga0068860_1005245432 206
2060 3300005844 Ga0068862_100018535 Ga0068862_1000185352 206
2061 3300006058 Ga0075432_10186595 Ga0075432_101865951 206
2062 3300006237 Ga0097621_100162654 Ga0097621_1001626542 206
2063 3300006237 Ga0097621_100454211 Ga0097621_1004542111 206
2064 3300006881 Ga0068865_100424004 Ga0068865_1004240042 206
2065 3300006931 Ga0097620_100027078 Ga0097620_1000270782 206
2066 3300006931 Ga0097620_100109345 Ga0097620_1001093453 206
2067 3300009176 Ga0105242_10031513 Ga0105242_100315133 206
2068 3300009177 Ga0105248_10208018 Ga0105248_102080182 206
2069 3300009551 Ga0105238_10007894 Ga0105238_100078947 206
2070 3300009553 Ga0105249_10038924 Ga0105249_100389242 206
2071 3300013100 Ga0157373_10011513 Ga0157373_100115133 206
2072 3300013102 Ga0157371_10051970 Ga0157371_100519702 206
2073 3300013297 Ga0157378_10061027 Ga0157378_100610274 206
2074 3300013297 Ga0157378_10212366 Ga0157378_102123662 206
2075 3300013306 Ga0163162_10010080 Ga0163162_100100802 206
2076 3300013308 Ga0157375_10559788 Ga0157375_105597882 206
2077 3300013308 Ga0157375_11024923 Ga0157375_110249232 206
2078 3300014326 Ga0157380_10021253 Ga0157380_100212532 206
2079 3300014326 Ga0157380_10053461 Ga0157380_100534612 206
2080 3300014326 Ga0157380_10517566 Ga0157380_105175662 206
2081 3300014745 Ga0157377_10355129 Ga0157377_103551292 206
2082 3300014968 Ga0157379_10005033 Ga0157379_100050339 206
2083 3300014968 Ga0157379_10043827 Ga0157379_100438273 206
2084 3300014969 Ga0157376_10034022 Ga0157376_100340222 206
2085 3300017792 Ga0163161_10107034 Ga0163161_101070342 206
2086 3300025315 Ga0207697_10005514 Ga0207697_100055142 206
2087 3300025321 Ga0207656_10006584 Ga0207656_100065842 206
2088 3300025893 Ga0207682_10026959 Ga0207682_100269592 206
2089 3300025899 Ga0207642_10036079 Ga0207642_100360793 206
2090 3300025899 Ga0207642_10194466 Ga0207642_101944662 206
2091 3300025901 Ga0207688_10119420 Ga0207688_101194202 206
2092 3300025903 Ga0207680_10245688 Ga0207680_102456882 206
2093 3300025907 Ga0207645_10014278 Ga0207645_100142786 206
2094 3300025907 Ga0207645_10015476 Ga0207645_100154763 206
2095 3300025909 Ga0207705_10112090 Ga0207705_101120902 206
2096 3300025918 Ga0207662_10029230 Ga0207662_100292302 206
2097 3300025918 Ga0207662_10034420 Ga0207662_100344202 206
2098 3300025919 Ga0207657_10091021 Ga0207657_100910212 206
2099 3300025919 Ga0207657_10179246 Ga0207657_101792462 206
2100 3300025920 Ga0207649_10009516 Ga0207649_100095163 206
2101 3300025921 Ga0207652_10015677 Ga0207652_100156773 206
2102 3300025923 Ga0207681_10000826 Ga0207681_100008269 206
2103 3300025924 Ga0207694_10393672 Ga0207694_103936722 206
2104 3300025925 Ga0207650_10095034 Ga0207650_100950342 206
2105 3300025925 Ga0207650_10165870 Ga0207650_101658702 206
2106 3300025925 Ga0207650_10296131 Ga0207650_102961312 206
2107 3300025926 Ga0207659_10169198 Ga0207659_101691982 206
2108 3300025927 Ga0207687_10141822 Ga0207687_101418222 206
2109 3300025931 Ga0207644_10000223 Ga0207644_1000022323 206
2110 3300025931 Ga0207644_10008458 Ga0207644_100084583 206
2111 3300025932 Ga0207690_10217509 Ga0207690_102175092 206
2112 3300025933 Ga0207706_10487205 Ga0207706_104872051 206
2113 3300025934 Ga0207686_10169686 Ga0207686_101696862 206
2114 3300025935 Ga0207709_10006706 Ga0207709_100067065 206
2115 3300025937 Ga0207669_10178965 Ga0207669_101789652 206
2116 3300025937 Ga0207669_10558916 Ga0207669_105589162 206
2117 3300025938 Ga0207704_10002371 Ga0207704_100023718 206
2118 3300025938 Ga0207704_10022772 Ga0207704_100227723 206
2119 3300025938 Ga0207704_10095530 Ga0207704_100955302 206
2120 3300025938 Ga0207704_10419024 Ga0207704_104190242 206
2121 3300025938 Ga0207704_10467395 Ga0207704_104673952 206
2122 3300025940 Ga0207691_10021499 Ga0207691_100214992 206
2123 3300025940 Ga0207691_10053661 Ga0207691_100536612 206
2124 3300025940 Ga0207691_10089902 Ga0207691_100899022 206
2125 3300025940 Ga0207691_10164989 Ga0207691_101649893 206
2126 3300025941 Ga0207711_10056557 Ga0207711_100565572 206
2127 3300025941 Ga0207711_10473011 Ga0207711_104730112 206
2128 3300025941 Ga0207711_10534347 Ga0207711_105343472 206
2129 3300025942 Ga0207689_10001323 Ga0207689_100013235 206
2130 3300025944 Ga0207661_10033466 Ga0207661_100334664 206
2131 3300025945 Ga0207679_10004670 Ga0207679_100046705 206
2132 3300025949 Ga0207667_10035301 Ga0207667_100353015 206
2133 3300025960 Ga0207651_10007058 Ga0207651_100070585 206
2134 3300025960 Ga0207651_10259272 Ga0207651_102592722 206
2135 3300025972 Ga0207668_10012347 Ga0207668_100123473 206
2136 3300025981 Ga0207640_10365045 Ga0207640_103650451 206
2137 3300025986 Ga0207658_10002825 Ga0207658_100028252 206
2138 3300025986 Ga0207658_10364065 Ga0207658_103640652 206
2139 3300025986 Ga0207658_11007142 Ga0207658_110071421 206
2140 3300026023 Ga0207677_10015290 Ga0207677_100152901 206
2141 3300026023 Ga0207677_10068294 Ga0207677_100682943 206
2142 3300026035 Ga0207703_10000504 Ga0207703_1000050430 206
2143 3300026035 Ga0207703_10007335 Ga0207703_100073356 206
2144 3300026041 Ga0207639_10231071 Ga0207639_102310712 206
2145 3300026075 Ga0207708_10046044 Ga0207708_100460442 206
2146 3300026078 Ga0207702_10011425 Ga0207702_100114255 206
2147 3300026078 Ga0207702_10209102 Ga0207702_102091022 206
2148 3300026088 Ga0207641_10004421 Ga0207641_1000442111 206
2149 3300026088 Ga0207641_10178863 Ga0207641_101788632 206
2150 3300026089 Ga0207648_10127708 Ga0207648_101277083 206
2151 3300026089 Ga0207648_10329262 Ga0207648_103292622 206
2152 3300026095 Ga0207676_10018994 Ga0207676_100189944 206
2153 3300026095 Ga0207676_10022675 Ga0207676_100226755 206
2154 3300026116 Ga0207674_10031643 Ga0207674_100316434 206
2155 3300026118 Ga0207675_100002610 Ga0207675_10000261013 206
2156 3300026121 Ga0207683_10333903 Ga0207683_103339031 206
2157 3300026121 Ga0207683_10346718 Ga0207683_103467182 206
2158 3300026142 Ga0207698_10144575 Ga0207698_101445752 206
2159 3300026142 Ga0207698_10419167 Ga0207698_104191672 206
2160 3300028379 Ga0268266_10153701 Ga0268266_101537012 206
2161 3300028380 Ga0268265_10040778 Ga0268265_100407783 206
2162 3300028381 Ga0268264_10020371 Ga0268264_100203713 206
2163 3300028381 Ga0268264_10039273 Ga0268264_100392734 206
2164 3300028381 Ga0268264_10133185 Ga0268264_101331851 206
2165 3300031731 Ga0307405_10059257 Ga0307405_100592572 206
2166 3300031995 Ga0307409_100041713 Ga0307409_1000417133 206
2167 3300032002 Ga0307416_100001574 Ga0307416_1000015744 206
2168 3300032126 Ga0307415_100007051 Ga0307415_1000070512 206
2169 3300035117 Ga0373953_0065968 Ga0373953_0065968_631_1323 206
2170 3300035118 Ga0373954_0047471 Ga0373954_0047471_631_1323 206
2171 3300035120 Ga0373957_0024701 Ga0373957_0024701_1038_1730 206
2172 3300035170 Ga0373943_0017569 Ga0373943_0017569_1808_2500 206
2173 3300035172 Ga0373955_0084035 Ga0373955_0084035_269_961 206
2174 3300035410 Ga0373924_0052712 Ga0373924_0052712_134_826 206
2175 3300035725 Ga0373947_0073171 Ga0373947_0073171_116_808 206
2176 3300036401 Ga0373937_0174464 Ga0373937_0174464_731_1441 206
2177 3300039450 Ga0436363_0541622 Ga0436363_0541622_2961_3653 206
2178 3300045051 Ga0451576_0349392 Ga0451576_0349392_287_976 206
2179 3300046507 Ga0495606_0040174 Ga0495606_0040174_2097_2744 206
2180 3300046535 Ga0495586_0366471 Ga0495586_0366471_14_706 206
2181 3300046539 Ga0495621_0186132 Ga0495621_0186132_44_736 206
2182 3300046683 Ga0495658_0026757 Ga0495658_0026757_1129_1821 206
2183 3300046683 Ga0495658_0043354 Ga0495658_0043354_854_1546 206
2184 3300046809 Ga0495600_0115097 Ga0495600_0115097_481_1173 206
2185 3300046809 Ga0495600_0220855 Ga0495600_0220855_317_1009 206
2186 3300047322 Ga0495680_0146953 Ga0495680_0146953_66_758 206
2187 3300047444 Ga0495675_0157922 Ga0495675_0157922_208_900 206
2188 3300047471 Ga0495684_0081239 Ga0495684_0081239_951_1643 206
2189 3300048911 Ga0496108_0574932 Ga0496108_0574932_241_933 206
2190 3300048913 Ga0496110_0327576 Ga0496110_0327576_458_1150 206
2191 3300050511 nmdc:mga08y16_414253_c1 nmdc:mga08y16_414253_c1_444_1133 206
2192 3300053077 Ga0495601_0031506 Ga0495601_0031506_2016_2708 206
2193 3300053085 Ga0495619_0097152 Ga0495619_0097152_997_1689 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00775

Dioxygenase_C

Dioxygenase

60

227

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1eo9-assembly1.cif.gz_A crystal structure of acinetobacter sp. adp1 protocatechuate 3,4-dioxygenase at ph < 7.0 0.9386 8 206
2bux-assembly1.cif.gz_A crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r133h 0.9369 8 206
2bum-assembly1.cif.gz_A crystal structure of wild-type protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 0.9366 8 206
1eo9-assembly1.cif.gz_A crystal structure of acinetobacter sp. adp1 protocatechuate 3,4-dioxygenase at ph < 7.0 0.9205 8 206
2bux-assembly1.cif.gz_A crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r133h 0.9188 8 206
ID Description Score Start End Superfamily
1ykkA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8909 5 206 2.60.130.10
1ykkA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8823 5 206 2.60.130.10
4iltA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7497 34 197 2.60.130.10
2boyB00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7492 41 194 2.60.130.10
1eo2B00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7439 1 205 2.60.130.10
ID Description Score Start End GO Terms
AF-A0A526QD84-F1-model_v4 Protocatechuate 3,4-dioxygenase subunit alpha 0.9826 115 206 GO:0005506
GO:0016702
AF-A0A358H0J6-F1-model_v4 deleted 0.982 39 206
AF-A0A529XP50-F1-model_v4 deleted 0.9811 103 206
AF-A0A240C2B3-F1-model_v4 Protocatechuate 3,4-dioxygenase alpha chain (EC 1.13.11.3) 0.9794 93 206 GO:0005506
GO:0009056
GO:0018578
AF-A0A378B320-F1-model_v4 Protocatechuate 3,4-dioxygenase subunit alpha (EC 1.13.11.3) 0.9767 129 206 GO:0005506
GO:0018578

Feature Viewer

pLDDT pTM Quality
87.36 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map