F496530
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2193 | 1094 | 1595 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300005614|Ga0068856_100255630|Ga0068856_1002556302 |
| Length | 236 |
| Sequence | MSRFDPPPIPDAIAGFSSRAAASTNQQQLRPLMRETASQTAGPYVHIGLAPKAAGFDIFEHNFGNVLVTPQTKGERIRIEGRVLDGIGTPVRDVLVEIWQANAAGRYRHPGDRQAGKAIDETFRGWGRAASDFETGVYSFETIKPGPVMGRNGRVMAPHINFWVVARGINIGLNTRMYFSDEAEANAKDPVINLVEWESRRRTLIAEREDGKGKSGTLYRFDIRLQGDNETVFFDI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 3 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 4 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 5 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 6 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 7 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 8 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 9 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 10 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 11 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 12 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 13 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 14 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 15 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 16 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 17 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 18 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 19 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 20 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 21 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 22 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 23 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 24 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 25 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 26 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 27 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 28 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 29 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 30 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 31 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 32 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 33 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 34 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 35 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 36 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 37 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 38 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 39 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 40 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 41 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 42 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 43 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 44 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 45 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 46 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 47 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 48 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 49 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 50 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 51 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 52 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 53 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 54 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 55 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 56 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 57 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 58 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 59 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 60 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 61 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 62 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 63 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 64 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 65 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 66 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 67 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 68 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 69 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 70 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 71 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 72 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 73 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 74 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 75 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 76 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 77 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 78 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 79 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 80 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 81 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 82 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 83 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 84 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 85 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 86 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 87 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 88 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 89 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 90 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 91 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 92 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 93 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 94 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 95 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 96 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 97 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 98 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 99 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 100 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 101 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 102 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 103 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 104 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 105 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 106 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 107 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 108 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 109 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 110 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 111 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 112 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 113 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 114 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 115 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 116 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 117 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 118 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 119 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 120 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 121 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 122 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 123 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 124 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 125 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 126 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 127 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 128 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 129 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 130 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 131 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 132 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 133 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 134 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 135 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 136 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 137 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 138 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 139 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 140 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 141 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 142 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 143 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 144 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 145 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 146 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 147 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 148 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 149 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 150 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 151 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 152 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 153 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 154 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 155 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 156 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 157 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 158 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 159 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 160 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 161 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 162 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 163 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 164 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 165 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 166 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 167 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 168 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 169 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 170 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 171 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 172 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 173 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 174 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 175 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 176 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 177 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 178 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 179 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 180 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 181 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 182 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 183 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 184 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 185 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 186 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 187 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 188 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 189 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 190 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 191 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 192 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 193 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 194 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 195 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 196 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 197 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 198 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 199 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 200 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 201 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 202 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 203 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 204 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 205 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 206 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 207 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 208 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 209 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 210 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 211 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 212 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 213 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 214 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 215 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 216 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 217 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 218 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 219 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 220 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 221 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 222 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 223 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 224 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 225 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 226 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 227 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 228 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 229 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 230 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 231 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 232 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 233 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 234 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 235 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 236 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 237 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 238 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 239 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 240 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 241 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 242 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 243 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 244 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 245 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 246 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 247 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 248 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 249 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 250 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 251 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 252 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 253 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 254 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 255 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 256 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 257 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 258 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 259 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 260 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 261 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 262 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 263 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 264 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 265 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 266 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 267 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 268 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 269 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 270 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 271 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 272 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 273 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 274 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 275 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 276 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 277 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 278 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 279 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 280 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 281 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 282 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 283 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 284 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 285 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 286 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 287 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 288 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 289 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 290 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 291 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 292 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 293 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 294 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 295 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 296 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 297 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 298 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 299 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 300 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 301 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 302 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 303 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 304 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 305 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 306 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 307 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 308 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 309 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 310 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 311 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 312 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 313 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 314 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 315 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 316 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 317 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 318 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 319 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 320 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 321 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 322 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 323 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 324 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 325 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 326 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 327 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 328 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 329 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 330 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 331 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 332 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 333 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 334 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 335 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 336 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 337 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 338 | 2884086401 | Kluyvera sp. PO2S7 | Isolate | Rhizosphere |
| 339 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 340 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 341 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 342 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 343 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 344 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 345 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 346 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 347 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 348 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 349 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 350 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 351 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 352 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 353 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 354 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 355 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 356 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 357 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 358 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 359 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 360 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 361 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 362 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 363 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 364 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 365 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 366 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 367 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 368 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 369 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 370 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 371 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 372 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 373 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 374 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 375 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 376 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 377 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 378 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 379 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 380 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 381 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 382 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 383 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 384 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 385 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 386 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 387 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 388 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 389 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 390 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 391 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 392 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 393 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 394 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 395 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 396 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 397 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 398 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 399 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 400 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 401 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 402 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 403 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 404 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 405 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 406 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 407 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 408 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 409 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 410 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 411 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 412 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 413 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 414 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 415 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 416 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 417 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 418 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 419 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 420 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 421 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 422 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 423 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 424 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 425 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 426 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 427 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 428 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 429 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 430 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 431 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 432 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 433 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 434 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 435 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 436 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 437 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 438 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 439 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 440 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 441 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 442 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 443 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 444 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 445 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 446 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 447 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 448 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 449 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 450 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 451 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 452 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 453 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 454 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 455 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 456 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 457 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 458 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 459 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 460 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 461 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 462 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 463 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 464 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 465 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 466 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 467 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 468 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 469 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 470 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 471 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 472 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 473 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 474 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 475 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 476 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 477 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 478 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 479 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 480 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 481 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 482 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 483 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 484 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 485 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 486 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 487 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 488 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 489 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 490 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 491 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 492 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 493 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 494 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 495 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 496 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 497 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 498 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 499 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 500 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 501 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 502 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 503 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 504 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 505 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 506 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 507 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 508 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 509 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 510 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 511 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 512 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 513 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 514 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 515 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 516 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 517 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 518 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 519 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 520 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 521 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 522 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 523 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 524 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 525 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 526 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 527 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 528 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 529 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 530 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 531 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 532 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 533 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 534 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 535 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 536 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 537 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 538 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 539 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 540 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 541 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 542 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 543 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 544 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 545 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 546 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 547 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 548 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 549 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 550 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 551 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 552 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 553 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 554 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 555 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 556 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 557 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 558 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 559 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 560 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 561 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 562 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 563 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 564 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 565 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 566 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 567 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 568 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 569 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 570 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 571 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 572 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 573 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 574 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 575 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 576 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 577 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 578 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 579 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 580 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 581 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 582 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 583 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 584 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 585 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 586 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 587 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 588 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 589 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 590 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 591 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 592 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 593 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 594 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 595 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 596 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 597 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 598 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 599 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 600 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 601 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 602 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 603 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 604 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 605 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 606 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 607 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 608 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 609 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 610 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 611 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 612 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 613 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 614 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 615 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 616 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 617 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 618 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 619 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 620 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 621 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 622 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 623 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 624 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 625 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 626 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 627 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 628 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 629 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 630 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 631 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 632 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 633 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 634 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 635 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 636 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 637 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 638 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 639 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 640 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 641 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 642 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 643 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 644 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 645 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 646 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 647 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 648 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 649 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 650 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 651 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 652 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 653 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 654 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 655 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 656 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 657 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 658 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 659 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 660 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 661 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 662 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 663 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 664 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 665 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 666 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 667 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 668 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 669 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 670 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 671 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 672 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 673 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 674 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 675 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 676 | 3300009763 | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix | Metagenome | Nodule |
| 677 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 678 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 679 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 680 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 681 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 682 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 683 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 684 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 685 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 686 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 687 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 688 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 689 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 690 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 691 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 692 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 693 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 694 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 695 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 696 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 697 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 698 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 699 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 700 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 701 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 702 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 703 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 704 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 705 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 706 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 707 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 708 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 709 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 710 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 711 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 712 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 713 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 714 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 715 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 716 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 717 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 718 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 719 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 720 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 721 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 722 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 723 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 724 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 725 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 726 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 727 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 728 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 729 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 730 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 731 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 732 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 733 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 734 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 735 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 736 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 737 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 738 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 739 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 740 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 741 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 742 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 743 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 744 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 745 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 746 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 747 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 748 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 749 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 750 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 751 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 752 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 753 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 754 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 755 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 756 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 757 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 758 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 759 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 760 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 761 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 762 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 763 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 764 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 765 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 766 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 767 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 768 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 769 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 770 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 771 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 772 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 773 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 774 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 775 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 776 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 777 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 778 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 779 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 780 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 781 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 782 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 783 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 784 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 785 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 786 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 787 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 788 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 789 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 790 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 791 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 792 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 793 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 794 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 795 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 796 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 797 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 798 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 799 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 800 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 801 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 802 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 803 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 804 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 805 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 806 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 807 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 808 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 809 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 810 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 811 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 812 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 813 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 814 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 815 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 816 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 817 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 818 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 819 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 820 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 821 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 822 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 823 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 824 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 825 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 826 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 827 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 828 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 829 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 830 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 831 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 832 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 833 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 834 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 835 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 836 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 837 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 838 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 839 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 840 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 841 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 842 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 843 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 844 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 845 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 846 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 847 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 848 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 849 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 850 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 851 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 852 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 853 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 854 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 855 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 856 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 857 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 858 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 859 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 860 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 861 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 862 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 863 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 864 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 865 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 866 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 867 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 868 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 869 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 870 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 871 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 872 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 873 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 874 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 875 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 876 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 877 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 878 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 879 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 880 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 881 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 882 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 883 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 884 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 885 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 886 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 887 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 888 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 889 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 890 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 891 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 892 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 893 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 894 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 895 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 896 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 897 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 898 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 899 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 900 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 901 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 902 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 903 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 904 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 905 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 906 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 907 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 908 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 909 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 910 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 911 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 912 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 913 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 914 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 915 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 916 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 917 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 918 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 919 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 920 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 921 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 922 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 923 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 924 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 925 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 926 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 927 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 928 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 929 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 930 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 931 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 932 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 933 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 934 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 935 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 936 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 937 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 938 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 939 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 940 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 941 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 942 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 943 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 944 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 945 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 946 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 947 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 948 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 949 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 950 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 951 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 952 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 953 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 954 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 955 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 956 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 957 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 958 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 959 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 960 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 961 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 962 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 963 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 964 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 965 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 966 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 967 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 968 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 969 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 970 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 971 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 972 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 973 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 974 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 975 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 976 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 977 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 978 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 979 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 980 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 981 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 982 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 983 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 984 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 985 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 986 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 987 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 988 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 989 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 990 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 991 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 992 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 993 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 994 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 995 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 996 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 997 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 998 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 999 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 1000 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 1001 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 1002 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 1003 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 1004 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 1005 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 1006 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 1007 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 1008 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 1009 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 1010 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 1011 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 1012 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 1013 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 1014 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 1015 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 1016 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 1017 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 1018 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 1019 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 1020 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 1021 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 1022 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 1023 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 1024 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 1025 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 1026 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 1027 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 1028 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 1029 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 1030 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 1031 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 1032 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 1033 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 1034 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 1035 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1036 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 1037 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1038 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 1039 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 1040 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 1041 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1042 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 1043 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 1044 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 1045 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
| 1046 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 1047 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 1048 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 1049 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 1050 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 1051 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 1052 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1053 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 1054 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1055 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 1056 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 1057 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 1058 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1059 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1060 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1061 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1062 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1063 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1064 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1065 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1066 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1067 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1068 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1069 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1070 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1071 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1072 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1073 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1074 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1075 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1076 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1077 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1078 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1079 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1080 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1081 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1082 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1083 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1084 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1085 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1086 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1087 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 1088 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1089 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 1090 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1091 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1092 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
| 1093 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1094 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.59 |
| Metatranscriptomes | 0.05 |
| Isolates | 27.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.09 |
| Bulb | 0 |
| Endosphere | 13.36 |
| Nodule | 20.47 |
| Rhizoplane | 2.92 |
| Rhizosphere | 52.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.94 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_FSXC70212_g1 | 2010549000 | Bacteria | 867 |
| 2 | JGI24740J21852_10002540 | 3300001979 | Bacteria | 8228 |
| 3 | JGI24739J22299_10000109 | 3300001989 | Bacteria | 25306 |
| 4 | JGI24739J22299_10039807 | 3300001989 | Bacteria | 1572 |
| 5 | JGI24739J22299_10068872 | 3300001989 | Bacteria | 1104 |
| 6 | JGI24735J21928_10036100 | 3300002067 | Bacteria | 1450 |
| 7 | JGI24742J22300_10027710 | 3300002244 | Bacteria | 982 |
| 8 | JGI25156J39149_1000137 | 3300002705 | Bacteria | 53605 |
| 9 | JGI25156J39149_1000523 | 3300002705 | Bacteria | 22196 |
| 10 | JGI25162J39368_1000656 | 3300002737 | Bacteria | 24441 |
| 11 | JGI25162J39368_1000744 | 3300002737 | Bacteria | 22288 |
| 12 | JGI25154J39366_1000106 | 3300002738 | Bacteria | 74019 |
| 13 | JGI25154J39366_1000435 | 3300002738 | Bacteria | 22198 |
| 14 | JGI25158J39367_1000347 | 3300002739 | Bacteria | 10132 |
| 15 | JGI25158J39367_1007582 | 3300002739 | Bacteria | 1527 |
| 16 | JGI25157J39369_1000154 | 3300002741 | Bacteria | 57286 |
| 17 | JGI25157J39369_1000562 | 3300002741 | Bacteria | 22196 |
| 18 | JGI25157J39369_1000841 | 3300002741 | Bacteria | 15215 |
| 19 | JGI25164J39214_1004996 | 3300002772 | Bacteria | 1470 |
| 20 | JGI25152J39213_1000009 | 3300002773 | Bacteria | 138285 |
| 21 | JGI25152J39213_1003290 | 3300002773 | Bacteria | 5587 |
| 22 | JGI25152J39213_1005724 | 3300002773 | Bacteria | 3551 |
| 23 | JGI25152J39213_1005868 | 3300002773 | Bacteria | 3473 |
| 24 | JGI25152J39213_1008747 | 3300002773 | Bacteria | 2478 |
| 25 | JGI25150J39212_1000016 | 3300002774 | Bacteria | 153945 |
| 26 | JGI25150J39212_1010813 | 3300002774 | Bacteria | 1681 |
| 27 | JGI25150J39212_1016900 | 3300002774 | Bacteria | 1188 |
| 28 | JGI25159J45721_1000083 | 3300002987 | Bacteria | 44911 |
| 29 | JGI25159J45721_1000259 | 3300002987 | Bacteria | 24699 |
| 30 | JGI25159J45721_1000466 | 3300002987 | Bacteria | 18688 |
| 31 | JGI25159J45721_1000902 | 3300002987 | Bacteria | 12929 |
| 32 | JGI25159J45721_1008601 | 3300002987 | Bacteria | 2786 |
| 33 | JGI25151J46595_10000073 | 3300003187 | Bacteria | 136684 |
| 34 | JGI25151J46595_10000274 | 3300003187 | Bacteria | 59318 |
| 35 | JGI25151J46595_10018172 | 3300003187 | Bacteria | 3030 |
| 36 | JGI25165J46597_1000015 | 3300003214 | Bacteria | 380891 |
| 37 | JGI25165J46597_1000018 | 3300003214 | Bacteria | 374701 |
| 38 | JGI25165J46597_1000407 | 3300003214 | Bacteria | 45582 |
| 39 | JGI25165J46597_1003522 | 3300003214 | Bacteria | 3841 |
| 40 | JGI25153J46596_10008048 | 3300003215 | Bacteria | 5093 |
| 41 | JGI25153J46596_10012993 | 3300003215 | Bacteria | 3551 |
| 42 | JGI25153J46596_10013350 | 3300003215 | Bacteria | 3473 |
| 43 | rootH1_10022690 | 3300003316 | Bacteria | 6290 |
| 44 | rootH1_10086971 | 3300003316 | Bacteria | 3073 |
| 45 | rootH2_10074857 | 3300003320 | Bacteria | 5668 |
| 46 | rootL2_10132451 | 3300003322 | Bacteria | 1026 |
| 47 | rootL2_10313242 | 3300003322 | Bacteria | 1114 |
| 48 | rootH1_10019588 | 3300003316 | Bacteria | 4902 |
| 49 | rootH1_10019588 | 3300003323 | Bacteria | 4711 |
| 50 | rootH1_10030464 | 3300003323 | Bacteria | 5430 |
| 51 | rootH1_10031251 | 3300003323 | Bacteria | 1148 |
| 52 | rootH1_10033851 | 3300003316 | Bacteria | 2529 |
| 53 | rootH1_10033851 | 3300003323 | Bacteria | 2311 |
| 54 | rootH1_10097074 | 3300003323 | Bacteria | 1359 |
| 55 | rootH1_10104478 | 3300003323 | Bacteria | 1146 |
| 56 | JGI25160J50197_1000005 | 3300003354 | Bacteria | 417280 |
| 57 | JGI25160J50197_1000014 | 3300003354 | Bacteria | 259862 |
| 58 | JGI25160J50197_1001878 | 3300003354 | Bacteria | 10079 |
| 59 | JGI25160J50197_1006181 | 3300003354 | Bacteria | 4875 |
| 60 | JGI25161J50226_1000022 | 3300003374 | Bacteria | 158544 |
| 61 | JGI25161J50226_1000025 | 3300003374 | Bacteria | 148471 |
| 62 | JGI25161J50226_1001121 | 3300003374 | Bacteria | 8987 |
| 63 | Ga0006562J51391_1035319 | 3300003578 | Bacteria | 3220 |
| 64 | Ga0055539_1000160 | 3300003752 | Bacteria | 63531 |
| 65 | Ga0055539_1001756 | 3300003752 | Bacteria | 3757 |
| 66 | Ga0055533_1000162 | 3300003756 | Bacteria | 63221 |
| 67 | Ga0055525_1000742 | 3300003759 | Bacteria | 11118 |
| 68 | Ga0055535_1000403 | 3300003761 | Bacteria | 40654 |
| 69 | Ga0055542_1000227 | 3300003762 | Bacteria | 67082 |
| 70 | Ga0055529_1000195 | 3300003763 | Bacteria | 82315 |
| 71 | Ga0055529_1006674 | 3300003763 | Bacteria | 1599 |
| 72 | Ga0055526_1001208 | 3300003771 | Bacteria | 18613 |
| 73 | Ga0055526_1002592 | 3300003771 | Bacteria | 12087 |
| 74 | Ga0055526_1006973 | 3300003771 | Bacteria | 5996 |
| 75 | Ga0055526_1010076 | 3300003771 | Bacteria | 4445 |
| 76 | Ga0055524_1000581 | 3300003775 | Bacteria | 26755 |
| 77 | Ga0055524_1007283 | 3300003775 | Bacteria | 4721 |
| 78 | Ga0055524_1019755 | 3300003775 | Bacteria | 2292 |
| 79 | Ga0055524_1022464 | 3300003775 | Bacteria | 2061 |
| 80 | Ga0055524_1044601 | 3300003775 | Bacteria | 1076 |
| 81 | Ga0055536_1008001 | 3300003781 | Bacteria | 4627 |
| 82 | Ga0055528_1000917 | 3300003790 | Bacteria | 19843 |
| 83 | Ga0055528_1001036 | 3300003790 | Bacteria | 18388 |
| 84 | Ga0055528_1001440 | 3300003790 | Bacteria | 14538 |
| 85 | Ga0055528_1004532 | 3300003790 | Bacteria | 6666 |
| 86 | Ga0055528_1026575 | 3300003790 | Bacteria | 1656 |
| 87 | Ga0055528_1036732 | 3300003790 | Bacteria | 1165 |
| 88 | Ga0055528_1047861 | 3300003790 | Bacteria | 889 |
| 89 | Ga0055530_10019390 | 3300003791 | Bacteria | 2062 |
| 90 | Ga0055540_1000050 | 3300003792 | Bacteria | 145565 |
| 91 | Ga0055540_1008862 | 3300003792 | Bacteria | 3563 |
| 92 | Ga0055540_1015678 | 3300003792 | Bacteria | 2191 |
| 93 | Ga0055540_1019446 | 3300003792 | Bacteria | 1827 |
| 94 | Ga0055540_1028599 | 3300003792 | Bacteria | 1316 |
| 95 | Ga0055531_10004249 | 3300003794 | Bacteria | 8812 |
| 96 | Ga0055543_1000005 | 3300004625 | Bacteria | 223621 |
| 97 | Ga0055543_1000021 | 3300004625 | Bacteria | 150116 |
| 98 | Ga0055543_1000324 | 3300004625 | Bacteria | 33093 |
| 99 | Ga0055543_1002242 | 3300004625 | Bacteria | 6552 |
| 100 | Ga0065165_1000002 | 3300005262 | Bacteria | 444192 |
| 101 | Ga0065165_1000463 | 3300005262 | Bacteria | 63644 |
| 102 | Ga0065165_1005453 | 3300005262 | Bacteria | 7139 |
| 103 | Ga0065165_1024912 | 3300005262 | Bacteria | 2000 |
| 104 | Ga0065165_1062300 | 3300005262 | Bacteria | 1017 |
| 105 | Ga0065704_10025103 | 3300005289 | Bacteria | 1060 |
| 106 | Ga0065715_10169762 | 3300005293 | Bacteria | 1556 |
| 107 | Ga0070658_10004550 | 3300005327 | Bacteria | 11271 |
| 108 | Ga0070676_10001260 | 3300005328 | Bacteria | 12754 |
| 109 | Ga0070676_10009234 | 3300005328 | Bacteria | 5329 |
| 110 | Ga0070676_10011240 | 3300005328 | Bacteria | 4868 |
| 111 | Ga0070676_10016418 | 3300005328 | Bacteria | 4094 |
| 112 | Ga0070683_100025144 | 3300005329 | Bacteria | 5344 |
| 113 | Ga0070683_100093396 | 3300005329 | Bacteria | 2826 |
| 114 | Ga0070683_100152822 | 3300005329 | Bacteria | 2188 |
| 115 | Ga0070690_100012120 | 3300005330 | Bacteria | 5067 |
| 116 | Ga0070690_100020918 | 3300005330 | Bacteria | 3991 |
| 117 | Ga0070690_100034503 | 3300005330 | Bacteria | 3170 |
| 118 | Ga0070690_100249148 | 3300005330 | Bacteria | 1256 |
| 119 | Ga0070670_100048774 | 3300005331 | Bacteria | 3644 |
| 120 | Ga0070670_100242043 | 3300005331 | Bacteria | 1571 |
| 121 | Ga0070670_100789880 | 3300005331 | Bacteria | 857 |
| 122 | Ga0070677_10010314 | 3300005333 | Bacteria | 3192 |
| 123 | Ga0070677_10063874 | 3300005333 | Bacteria | 1527 |
| 124 | Ga0070677_10119082 | 3300005333 | Bacteria | 1190 |
| 125 | Ga0068869_100000109 | 3300005334 | Bacteria | 39248 |
| 126 | Ga0068869_100025418 | 3300005334 | Bacteria | 4112 |
| 127 | Ga0068869_100033584 | 3300005334 | Bacteria | 3622 |
| 128 | Ga0068869_100362236 | 3300005334 | Bacteria | 1184 |
| 129 | Ga0070666_10010714 | 3300005335 | Bacteria | 5739 |
| 130 | Ga0070666_10022337 | 3300005335 | Bacteria | 4108 |
| 131 | Ga0070666_10032542 | 3300005335 | Bacteria | 3445 |
| 132 | Ga0070666_10051656 | 3300005335 | Bacteria | 2769 |
| 133 | Ga0070682_100740513 | 3300005337 | Bacteria | 792 |
| 134 | Ga0068868_100000895 | 3300005338 | Bacteria | 20275 |
| 135 | Ga0068868_100000928 | 3300005338 | Bacteria | 19961 |
| 136 | Ga0068868_100022186 | 3300005338 | Bacteria | 4789 |
| 137 | Ga0068868_100030201 | 3300005338 | Bacteria | 4155 |
| 138 | Ga0068868_100105992 | 3300005338 | Bacteria | 2280 |
| 139 | Ga0068868_100107875 | 3300005338 | Bacteria | 2260 |
| 140 | Ga0068868_100223636 | 3300005338 | Bacteria | 1577 |
| 141 | Ga0070660_100019782 | 3300005339 | Bacteria | 4938 |
| 142 | Ga0070660_100065214 | 3300005339 | Bacteria | 2834 |
| 143 | Ga0070660_100230342 | 3300005339 | Bacteria | 1507 |
| 144 | Ga0070660_100264068 | 3300005339 | Bacteria | 1406 |
| 145 | Ga0070660_101030725 | 3300005339 | Bacteria | 696 |
| 146 | Ga0070689_100003058 | 3300005340 | Bacteria | 11018 |
| 147 | Ga0070689_100064787 | 3300005340 | Bacteria | 2845 |
| 148 | Ga0070689_100265862 | 3300005340 | Bacteria | 1419 |
| 149 | Ga0070687_100012451 | 3300005343 | Bacteria | 3759 |
| 150 | Ga0070687_100123626 | 3300005343 | Bacteria | 1484 |
| 151 | Ga0070661_100014534 | 3300005344 | Bacteria | 5547 |
| 152 | Ga0070661_100029542 | 3300005344 | Bacteria | 3957 |
| 153 | Ga0070661_100242801 | 3300005344 | Bacteria | 1387 |
| 154 | Ga0070661_100387720 | 3300005344 | Bacteria | 1102 |
| 155 | Ga0070692_10013623 | 3300005345 | Bacteria | 3796 |
| 156 | Ga0070668_100037799 | 3300005347 | Bacteria | 3688 |
| 157 | Ga0070668_100154246 | 3300005347 | Bacteria | 1860 |
| 158 | Ga0070668_100429523 | 3300005347 | Bacteria | 1132 |
| 159 | Ga0070668_100768920 | 3300005347 | Bacteria | 854 |
| 160 | Ga0070669_100003867 | 3300005353 | Bacteria | 10823 |
| 161 | Ga0070669_100010114 | 3300005353 | Bacteria | 6710 |
| 162 | Ga0070669_100027346 | 3300005353 | Bacteria | 4104 |
| 163 | Ga0070669_100035026 | 3300005353 | Bacteria | 3636 |
| 164 | Ga0070669_100641494 | 3300005353 | Bacteria | 893 |
| 165 | Ga0070675_100000621 | 3300005354 | Bacteria | 24557 |
| 166 | Ga0070675_100000772 | 3300005354 | Bacteria | 22339 |
| 167 | Ga0070675_100019977 | 3300005354 | Bacteria | 5344 |
| 168 | Ga0070675_100202813 | 3300005354 | Bacteria | 1722 |
| 169 | Ga0070675_100262046 | 3300005354 | Bacteria | 1515 |
| 170 | Ga0070671_100025227 | 3300005355 | Bacteria | 4876 |
| 171 | Ga0070671_100077908 | 3300005355 | Bacteria | 2770 |
| 172 | Ga0070671_100125094 | 3300005355 | Bacteria | 2164 |
| 173 | Ga0070671_100136348 | 3300005355 | Bacteria | 2069 |
| 174 | Ga0070671_100353375 | 3300005355 | Bacteria | 1254 |
| 175 | Ga0070674_100009649 | 3300005356 | Bacteria | 5790 |
| 176 | Ga0070674_100043954 | 3300005356 | Bacteria | 3042 |
| 177 | Ga0070674_100230532 | 3300005356 | Bacteria | 1445 |
| 178 | Ga0070673_100005018 | 3300005364 | Bacteria | 8443 |
| 179 | Ga0070673_100026947 | 3300005364 | Bacteria | 4254 |
| 180 | Ga0070673_100031638 | 3300005364 | Bacteria | 3974 |
| 181 | Ga0070673_100034172 | 3300005364 | Bacteria | 3845 |
| 182 | Ga0070673_100096508 | 3300005364 | Bacteria | 2426 |
| 183 | Ga0070673_100369495 | 3300005364 | Bacteria | 1277 |
| 184 | Ga0070659_100011653 | 3300005366 | Bacteria | 6507 |
| 185 | Ga0070659_100014156 | 3300005366 | Bacteria | 5953 |
| 186 | Ga0070659_100016119 | 3300005366 | Bacteria | 5608 |
| 187 | Ga0070659_100076553 | 3300005366 | Bacteria | 2668 |
| 188 | Ga0070659_100223148 | 3300005366 | Bacteria | 1556 |
| 189 | Ga0070659_100391073 | 3300005366 | Bacteria | 1173 |
| 190 | Ga0070667_100005806 | 3300005367 | Bacteria | 10301 |
| 191 | Ga0070667_100007096 | 3300005367 | Bacteria | 9313 |
| 192 | Ga0070667_100025581 | 3300005367 | Bacteria | 4908 |
| 193 | Ga0070667_100042070 | 3300005367 | Bacteria | 3833 |
| 194 | Ga0070667_100081022 | 3300005367 | Bacteria | 2777 |
| 195 | Ga0070667_100100603 | 3300005367 | Bacteria | 2497 |
| 196 | Ga0070667_100199143 | 3300005367 | Bacteria | 1777 |
| 197 | Ga0070667_100373681 | 3300005367 | Bacteria | 1294 |
| 198 | Ga0070667_100533014 | 3300005367 | Bacteria | 1078 |
| 199 | Ga0070667_100656999 | 3300005367 | Unclassified | 968 |
| 200 | Ga0070667_100746268 | 3300005367 | Bacteria | 907 |
| 201 | Ga0070667_100893702 | 3300005367 | Bacteria | 827 |
| 202 | Ga0070667_100989641 | 3300005367 | Bacteria | 784 |
| 203 | Ga0070667_101279750 | 3300005367 | Bacteria | 687 |
| 204 | Ga0070714_100049991 | 3300005435 | Bacteria | 3560 |
| 205 | Ga0070713_100000018 | 3300005436 | Bacteria | 118409 |
| 206 | Ga0070710_10399514 | 3300005437 | Bacteria | 921 |
| 207 | Ga0070710_10404875 | 3300005437 | Bacteria | 915 |
| 208 | Ga0070701_10118482 | 3300005438 | Bacteria | 1488 |
| 209 | Ga0070701_10139266 | 3300005438 | Bacteria | 1386 |
| 210 | Ga0070700_100015826 | 3300005441 | Bacteria | 4286 |
| 211 | Ga0070700_100206386 | 3300005441 | Bacteria | 1384 |
| 212 | Ga0070663_100003719 | 3300005455 | Bacteria | 8843 |
| 213 | Ga0070663_100064129 | 3300005455 | Bacteria | 2655 |
| 214 | Ga0070663_100074899 | 3300005455 | Bacteria | 2472 |
| 215 | Ga0070663_100135555 | 3300005455 | Bacteria | 1874 |
| 216 | Ga0070678_100000941 | 3300005456 | Bacteria | 14965 |
| 217 | Ga0070678_100295503 | 3300005456 | Bacteria | 1375 |
| 218 | Ga0070678_100404392 | 3300005456 | Bacteria | 1187 |
| 219 | Ga0070678_100489479 | 3300005456 | Bacteria | 1083 |
| 220 | Ga0070678_100611614 | 3300005456 | Bacteria | 974 |
| 221 | Ga0070678_100808854 | 3300005456 | Bacteria | 851 |
| 222 | Ga0070662_100001965 | 3300005457 | Bacteria | 12626 |
| 223 | Ga0070662_100074655 | 3300005457 | Bacteria | 2509 |
| 224 | Ga0070662_100397392 | 3300005457 | Bacteria | 1137 |
| 225 | Ga0070662_100462487 | 3300005457 | Bacteria | 1054 |
| 226 | Ga0070681_10056763 | 3300005458 | Bacteria | 3896 |
| 227 | Ga0068867_100005611 | 3300005459 | Bacteria | 8890 |
| 228 | Ga0068867_100195236 | 3300005459 | Bacteria | 1617 |
| 229 | Ga0068867_100233785 | 3300005459 | Bacteria | 1487 |
| 230 | Ga0068867_100243698 | 3300005459 | Bacteria | 1459 |
| 231 | Ga0068867_100309068 | 3300005459 | Unclassified | 1306 |
| 232 | Ga0068867_100898180 | 3300005459 | Bacteria | 797 |
| 233 | Ga0068867_100904289 | 3300005459 | Bacteria | 794 |
| 234 | Ga0070706_100205588 | 3300005467 | Bacteria | 1839 |
| 235 | Ga0070707_100035738 | 3300005468 | Bacteria | 4741 |
| 236 | Ga0070679_100003825 | 3300005530 | Bacteria | 13821 |
| 237 | Ga0070684_100019501 | 3300005535 | Bacteria | 5611 |
| 238 | Ga0070684_100041554 | 3300005535 | Bacteria | 3965 |
| 239 | Ga0070684_100057631 | 3300005535 | Bacteria | 3392 |
| 240 | Ga0068853_100017836 | 3300005539 | Bacteria | 5863 |
| 241 | Ga0068853_100023496 | 3300005539 | Bacteria | 5161 |
| 242 | Ga0068853_100110330 | 3300005539 | Bacteria | 2443 |
| 243 | Ga0068853_100173117 | 3300005539 | Bacteria | 1954 |
| 244 | Ga0068853_100202750 | 3300005539 | Bacteria | 1805 |
| 245 | Ga0068853_100251426 | 3300005539 | Bacteria | 1622 |
| 246 | Ga0068853_100580305 | 3300005539 | Bacteria | 1064 |
| 247 | Ga0070672_100002181 | 3300005543 | Bacteria | 12354 |
| 248 | Ga0070672_100021542 | 3300005543 | Bacteria | 4719 |
| 249 | Ga0070672_100041547 | 3300005543 | Bacteria | 3535 |
| 250 | Ga0070672_100058354 | 3300005543 | Bacteria | 3033 |
| 251 | Ga0070672_100080696 | 3300005543 | Bacteria | 2606 |
| 252 | Ga0070672_100383316 | 3300005543 | Bacteria | 1203 |
| 253 | Ga0070672_100422823 | 3300005543 | Bacteria | 1145 |
| 254 | Ga0070672_100939630 | 3300005543 | Bacteria | 765 |
| 255 | Ga0070693_100037016 | 3300005547 | Bacteria | 2718 |
| 256 | Ga0070693_100320706 | 3300005547 | Bacteria | 1051 |
| 257 | Ga0070693_100424186 | 3300005547 | Bacteria | 927 |
| 258 | Ga0070665_100008247 | 3300005548 | Bacteria | 10541 |
| 259 | Ga0070665_100037012 | 3300005548 | Bacteria | 4908 |
| 260 | Ga0070665_100044042 | 3300005548 | Bacteria | 4483 |
| 261 | Ga0070665_100058043 | 3300005548 | Bacteria | 3880 |
| 262 | Ga0070665_100069048 | 3300005548 | Bacteria | 3542 |
| 263 | Ga0070665_100133333 | 3300005548 | Bacteria | 2486 |
| 264 | Ga0070665_100181467 | 3300005548 | Bacteria | 2106 |
| 265 | Ga0070665_100496181 | 3300005548 | Bacteria | 1232 |
| 266 | Ga0070665_101445313 | 3300005548 | Bacteria | 696 |
| 267 | Ga0068855_100066535 | 3300005563 | Bacteria | 4201 |
| 268 | Ga0068855_100138616 | 3300005563 | Bacteria | 2774 |
| 269 | Ga0068855_100215864 | 3300005563 | Bacteria | 2153 |
| 270 | Ga0068855_100285588 | 3300005563 | Bacteria | 1831 |
| 271 | Ga0068855_100369898 | 3300005563 | Bacteria | 1576 |
| 272 | Ga0068855_100868107 | 3300005563 | Bacteria | 955 |
| 273 | Ga0068855_100868113 | 3300005563 | Bacteria | 955 |
| 274 | Ga0068855_101114054 | 3300005563 | Bacteria | 825 |
| 275 | Ga0070664_100011493 | 3300005564 | Bacteria | 7186 |
| 276 | Ga0070664_100089333 | 3300005564 | Bacteria | 2665 |
| 277 | Ga0070664_100104005 | 3300005564 | Bacteria | 2472 |
| 278 | Ga0070664_100939451 | 3300005564 | Bacteria | 812 |
| 279 | Ga0068857_100000535 | 3300005577 | Bacteria | 27494 |
| 280 | Ga0068857_100025285 | 3300005577 | Bacteria | 5230 |
| 281 | Ga0068857_100050833 | 3300005577 | Bacteria | 3676 |
| 282 | Ga0068857_100059870 | 3300005577 | Bacteria | 3384 |
| 283 | Ga0068857_100077462 | 3300005577 | Bacteria | 2967 |
| 284 | Ga0068854_100072584 | 3300005578 | Bacteria | 2520 |
| 285 | Ga0068854_100106117 | 3300005578 | Bacteria | 2113 |
| 286 | Ga0068854_100107770 | 3300005578 | Bacteria | 2097 |
| 287 | Ga0068854_100132320 | 3300005578 | Bacteria | 1906 |
| 288 | Ga0068854_100288668 | 3300005578 | Bacteria | 1323 |
| 289 | Ga0068854_100349997 | 3300005578 | Bacteria | 1209 |
| 290 | Ga0068854_100986173 | 3300005578 | Bacteria | 745 |
| 291 | Ga0068856_100022922 | 3300005614 | Bacteria | 6072 |
| 292 | Ga0068856_100057963 | 3300005614 | Bacteria | 3824 |
| 293 | Ga0068856_100076585 | 3300005614 | Bacteria | 3314 |
| 294 | Ga0068856_100104259 | 3300005614 | Bacteria | 2829 |
| 295 | Ga0068856_100152331 | 3300005614 | Bacteria | 2322 |
| 296 | Ga0068856_100228578 | 3300005614 | Bacteria | 1876 |
| 297 | Ga0068856_100228829 | 3300005614 | Bacteria | 1875 |
| 298 | Ga0068856_100255630 | 3300005614 | Bacteria | 1767 |
| 299 | Ga0068856_100347043 | 3300005614 | Bacteria | 1503 |
| 300 | Ga0068856_100705153 | 3300005614 | Bacteria | 1029 |
| 301 | Ga0068856_100791147 | 3300005614 | Bacteria | 968 |
| 302 | Ga0070702_100007631 | 3300005615 | Bacteria | 5187 |
| 303 | Ga0070702_100229285 | 3300005615 | Bacteria | 1247 |
| 304 | Ga0068852_100013214 | 3300005616 | Bacteria | 6310 |
| 305 | Ga0068852_100014330 | 3300005616 | Bacteria | 6098 |
| 306 | Ga0068852_100015034 | 3300005616 | Bacteria | 5984 |
| 307 | Ga0068852_100056329 | 3300005616 | Bacteria | 3397 |
| 308 | Ga0068852_100070158 | 3300005616 | Bacteria | 3074 |
| 309 | Ga0068852_100084266 | 3300005616 | Bacteria | 2828 |
| 310 | Ga0068852_100100432 | 3300005616 | Bacteria | 2610 |
| 311 | Ga0068852_100180005 | 3300005616 | Bacteria | 1987 |
| 312 | Ga0068852_100268784 | 3300005616 | Unclassified | 1640 |
| 313 | Ga0068852_100815977 | 3300005616 | Bacteria | 947 |
| 314 | Ga0068859_100008484 | 3300005617 | Bacteria | 10396 |
| 315 | Ga0068859_100020441 | 3300005617 | Bacteria | 6645 |
| 316 | Ga0068859_100027077 | 3300005617 | Bacteria | 5750 |
| 317 | Ga0068859_100109338 | 3300005617 | Bacteria | 2826 |
| 318 | Ga0068859_100251951 | 3300005617 | Bacteria | 1856 |
| 319 | Ga0068859_100423381 | 3300005617 | Bacteria | 1428 |
| 320 | Ga0068859_101244512 | 3300005617 | Bacteria | 820 |
| 321 | Ga0068864_100000270 | 3300005618 | Bacteria | 46170 |
| 322 | Ga0068864_100003834 | 3300005618 | Bacteria | 12396 |
| 323 | Ga0068864_100011737 | 3300005618 | Bacteria | 7234 |
| 324 | Ga0068864_100025267 | 3300005618 | Bacteria | 5001 |
| 325 | Ga0068864_100225337 | 3300005618 | Bacteria | 1731 |
| 326 | Ga0068864_100420409 | 3300005618 | Bacteria | 1273 |
| 327 | Ga0068866_10027919 | 3300005718 | Bacteria | 2684 |
| 328 | Ga0068861_100000126 | 3300005719 | Bacteria | 39277 |
| 329 | Ga0068861_100020024 | 3300005719 | Bacteria | 4785 |
| 330 | Ga0068861_100024484 | 3300005719 | Bacteria | 4366 |
| 331 | Ga0068851_10020460 | 3300005834 | Bacteria | 3206 |
| 332 | Ga0068851_10155557 | 3300005834 | Bacteria | 1252 |
| 333 | Ga0068851_10163325 | 3300005834 | Bacteria | 1225 |
| 334 | Ga0068851_10373325 | 3300005834 | Bacteria | 834 |
| 335 | Ga0068851_10430400 | 3300005834 | Bacteria | 781 |
| 336 | Ga0068870_10013617 | 3300005840 | Bacteria | 3827 |
| 337 | Ga0068863_100000679 | 3300005841 | Bacteria | 34412 |
| 338 | Ga0068863_100034797 | 3300005841 | Bacteria | 4797 |
| 339 | Ga0068863_100259269 | 3300005841 | Bacteria | 1680 |
| 340 | Ga0068863_100397503 | 3300005841 | Bacteria | 1347 |
| 341 | Ga0068863_100463579 | 3300005841 | Bacteria | 1244 |
| 342 | Ga0068863_100598522 | 3300005841 | Bacteria | 1091 |
| 343 | Ga0068863_100666250 | 3300005841 | Bacteria | 1033 |
| 344 | Ga0068858_100000225 | 3300005842 | Bacteria | 61439 |
| 345 | Ga0068858_100003892 | 3300005842 | Bacteria | 14747 |
| 346 | Ga0068858_100042529 | 3300005842 | Bacteria | 4212 |
| 347 | Ga0068858_100052225 | 3300005842 | Bacteria | 3781 |
| 348 | Ga0068858_100095010 | 3300005842 | Bacteria | 2777 |
| 349 | Ga0068858_100134936 | 3300005842 | Bacteria | 2315 |
| 350 | Ga0068858_100461556 | 3300005842 | Bacteria | 1225 |
| 351 | Ga0068858_100886630 | 3300005842 | Bacteria | 872 |
| 352 | Ga0068860_100006887 | 3300005843 | Bacteria | 11398 |
| 353 | Ga0068860_100015755 | 3300005843 | Bacteria | 7380 |
| 354 | Ga0068860_100337341 | 3300005843 | Bacteria | 1482 |
| 355 | Ga0068860_100524543 | 3300005843 | Bacteria | 1185 |
| 356 | Ga0068862_100018535 | 3300005844 | Bacteria | 5797 |
| 357 | Ga0068862_100082999 | 3300005844 | Bacteria | 2782 |
| 358 | Ga0068862_100113780 | 3300005844 | Bacteria | 2378 |
| 359 | Ga0068862_100437467 | 3300005844 | Unclassified | 1230 |
| 360 | Ga0081538_10016898 | 3300005981 | Bacteria | 5566 |
| 361 | Ga0081540_1007285 | 3300005983 | Bacteria | 7920 |
| 362 | Ga0081540_1010250 | 3300005983 | Bacteria | 6364 |
| 363 | Ga0070717_10422491 | 3300006028 | Bacteria | 1199 |
| 364 | Ga0075365_10002167 | 3300006038 | Bacteria | 9449 |
| 365 | Ga0075365_10007595 | 3300006038 | Bacteria | 6090 |
| 366 | Ga0075365_10008006 | 3300006038 | Bacteria | 5966 |
| 367 | Ga0075365_10010319 | 3300006038 | Bacteria | 5429 |
| 368 | Ga0075365_10012364 | 3300006038 | Bacteria | 5067 |
| 369 | Ga0075365_10130762 | 3300006038 | Bacteria | 1737 |
| 370 | Ga0075365_10423392 | 3300006038 | Bacteria | 940 |
| 371 | Ga0075365_10798963 | 3300006038 | Bacteria | 666 |
| 372 | Ga0075368_10004699 | 3300006042 | Bacteria | 4645 |
| 373 | Ga0075368_10267597 | 3300006042 | Bacteria | 733 |
| 374 | Ga0075363_100038848 | 3300006048 | Bacteria | 2503 |
| 375 | Ga0075363_100059224 | 3300006048 | Bacteria | 2059 |
| 376 | Ga0075363_100096793 | 3300006048 | Bacteria | 1630 |
| 377 | Ga0075363_100116507 | 3300006048 | Bacteria | 1488 |
| 378 | Ga0075363_100125359 | 3300006048 | Bacteria | 1437 |
| 379 | Ga0075363_100175649 | 3300006048 | Bacteria | 1217 |
| 380 | Ga0075363_100264881 | 3300006048 | Bacteria | 992 |
| 381 | Ga0075364_10001924 | 3300006051 | Bacteria | 11562 |
| 382 | Ga0075364_10225773 | 3300006051 | Bacteria | 1271 |
| 383 | Ga0075364_10294932 | 3300006051 | Bacteria | 1104 |
| 384 | Ga0075364_10413934 | 3300006051 | Bacteria | 920 |
| 385 | Ga0075432_10186595 | 3300006058 | Bacteria | 814 |
| 386 | Ga0070715_10044099 | 3300006163 | Bacteria | 1884 |
| 387 | Ga0075362_10013397 | 3300006177 | Bacteria | 3283 |
| 388 | Ga0075362_10134956 | 3300006177 | Bacteria | 1176 |
| 389 | Ga0075362_10296222 | 3300006177 | Bacteria | 802 |
| 390 | Ga0075367_10001150 | 3300006178 | Bacteria | 11036 |
| 391 | Ga0075367_10008246 | 3300006178 | Bacteria | 5388 |
| 392 | Ga0075367_10018335 | 3300006178 | Bacteria | 3860 |
| 393 | Ga0075367_10022064 | 3300006178 | Bacteria | 3566 |
| 394 | Ga0075367_10059289 | 3300006178 | Bacteria | 2279 |
| 395 | Ga0075367_10097012 | 3300006178 | Bacteria | 1798 |
| 396 | Ga0075367_10144934 | 3300006178 | Bacteria | 1472 |
| 397 | Ga0075367_10242020 | 3300006178 | Bacteria | 1131 |
| 398 | Ga0075369_10003976 | 3300006186 | Bacteria | 5423 |
| 399 | Ga0075369_10045840 | 3300006186 | Bacteria | 1881 |
| 400 | Ga0075369_10054368 | 3300006186 | Bacteria | 1738 |
| 401 | Ga0075369_10100652 | 3300006186 | Bacteria | 1296 |
| 402 | Ga0075369_10158560 | 3300006186 | Bacteria | 1036 |
| 403 | Ga0075366_10000527 | 3300006195 | Bacteria | 17745 |
| 404 | Ga0075366_10050942 | 3300006195 | Bacteria | 2460 |
| 405 | Ga0075366_10072032 | 3300006195 | Bacteria | 2059 |
| 406 | Ga0075366_10092785 | 3300006195 | Bacteria | 1809 |
| 407 | Ga0097621_100007479 | 3300006237 | Bacteria | 7817 |
| 408 | Ga0097621_100018660 | 3300006237 | Bacteria | 5305 |
| 409 | Ga0097621_100162654 | 3300006237 | Bacteria | 1919 |
| 410 | Ga0097621_100243818 | 3300006237 | Unclassified | 1572 |
| 411 | Ga0097621_100275350 | 3300006237 | Bacteria | 1480 |
| 412 | Ga0097621_100286717 | 3300006237 | Bacteria | 1451 |
| 413 | Ga0097621_100454211 | 3300006237 | Bacteria | 1155 |
| 414 | Ga0075370_10004269 | 3300006353 | Bacteria | 6920 |
| 415 | Ga0075370_10028022 | 3300006353 | Bacteria | 3129 |
| 416 | Ga0075370_10064346 | 3300006353 | Bacteria | 2091 |
| 417 | Ga0075370_10075341 | 3300006353 | Bacteria | 1934 |
| 418 | Ga0075370_10106219 | 3300006353 | Bacteria | 1628 |
| 419 | Ga0075370_10216355 | 3300006353 | Bacteria | 1132 |
| 420 | Ga0068871_100078234 | 3300006358 | Bacteria | 2734 |
| 421 | Ga0068871_100132455 | 3300006358 | Bacteria | 2115 |
| 422 | Ga0068871_100141240 | 3300006358 | Bacteria | 2048 |
| 423 | Ga0068871_100312150 | 3300006358 | Bacteria | 1382 |
| 424 | Ga0075431_101186836 | 3300006847 | Bacteria | 726 |
| 425 | Ga0075433_10289896 | 3300006852 | Bacteria | 1450 |
| 426 | Ga0068865_100076924 | 3300006881 | Bacteria | 2383 |
| 427 | Ga0068865_100178424 | 3300006881 | Bacteria | 1634 |
| 428 | Ga0068865_100424004 | 3300006881 | Bacteria | 1094 |
| 429 | Ga0097620_100008484 | 3300006931 | Bacteria | 10396 |
| 430 | Ga0097620_100020438 | 3300006931 | Bacteria | 6645 |
| 431 | Ga0097620_100027078 | 3300006931 | Bacteria | 5750 |
| 432 | Ga0097620_100109345 | 3300006931 | Bacteria | 2826 |
| 433 | Ga0097620_100251960 | 3300006931 | Bacteria | 1856 |
| 434 | Ga0097620_100423359 | 3300006931 | Bacteria | 1428 |
| 435 | Ga0097620_101244282 | 3300006931 | Bacteria | 820 |
| 436 | Ga0079104_1000014 | 3300006946 | Bacteria | 337362 |
| 437 | Ga0079104_1000183 | 3300006946 | Bacteria | 89496 |
| 438 | Ga0105251_10000198 | 3300009011 | Bacteria | 60848 |
| 439 | Ga0105244_10000037 | 3300009036 | Bacteria | 161621 |
| 440 | Ga0105244_10000403 | 3300009036 | Bacteria | 40205 |
| 441 | Ga0105244_10002423 | 3300009036 | Bacteria | 14083 |
| 442 | Ga0105240_10000012 | 3300009093 | Bacteria | 496639 |
| 443 | Ga0105240_10009833 | 3300009093 | Bacteria | 13501 |
| 444 | Ga0105240_10079788 | 3300009093 | Bacteria | 4027 |
| 445 | Ga0105240_10126850 | 3300009093 | Bacteria | 3065 |
| 446 | Ga0105240_10141815 | 3300009093 | Bacteria | 2872 |
| 447 | Ga0105240_10242127 | 3300009093 | Bacteria | 2091 |
| 448 | Ga0105240_10678091 | 3300009093 | Bacteria | 1127 |
| 449 | Ga0105240_10793738 | 3300009093 | Bacteria | 1026 |
| 450 | Ga0111539_10022792 | 3300009094 | Bacteria | 7692 |
| 451 | Ga0111539_10518546 | 3300009094 | Bacteria | 1389 |
| 452 | Ga0105245_10160344 | 3300009098 | Bacteria | 2134 |
| 453 | Ga0105245_10167846 | 3300009098 | Bacteria | 2088 |
| 454 | Ga0105245_10532893 | 3300009098 | Bacteria | 1194 |
| 455 | Ga0114129_10487396 | 3300009147 | Bacteria | 1612 |
| 456 | Ga0114129_10742727 | 3300009147 | Bacteria | 1257 |
| 457 | Ga0114129_11199656 | 3300009147 | Bacteria | 945 |
| 458 | Ga0105243_10002671 | 3300009148 | Bacteria | 14814 |
| 459 | Ga0105243_10023977 | 3300009148 | Bacteria | 4650 |
| 460 | Ga0105243_10066230 | 3300009148 | Bacteria | 2905 |
| 461 | Ga0105241_10269253 | 3300009174 | Bacteria | 1451 |
| 462 | Ga0105242_10031513 | 3300009176 | Bacteria | 4236 |
| 463 | Ga0105242_10036739 | 3300009176 | Bacteria | 3931 |
| 464 | Ga0105242_10302608 | 3300009176 | Bacteria | 1460 |
| 465 | Ga0105248_10006493 | 3300009177 | Bacteria | 12824 |
| 466 | Ga0105248_10009628 | 3300009177 | Bacteria | 10639 |
| 467 | Ga0105248_10021381 | 3300009177 | Bacteria | 7169 |
| 468 | Ga0105248_10174488 | 3300009177 | Bacteria | 2423 |
| 469 | Ga0105248_10208018 | 3300009177 | Bacteria | 2205 |
| 470 | Ga0105248_10228802 | 3300009177 | Bacteria | 2093 |
| 471 | Ga0105248_10755010 | 3300009177 | Bacteria | 1098 |
| 472 | Ga0105237_10000165 | 3300009545 | Bacteria | 93713 |
| 473 | Ga0105237_10058994 | 3300009545 | Bacteria | 3840 |
| 474 | Ga0105237_10126562 | 3300009545 | Bacteria | 2549 |
| 475 | Ga0105237_10359684 | 3300009545 | Bacteria | 1460 |
| 476 | Ga0105237_10651532 | 3300009545 | Bacteria | 1060 |
| 477 | Ga0105238_10007244 | 3300009551 | Bacteria | 11103 |
| 478 | Ga0105238_10007894 | 3300009551 | Bacteria | 10648 |
| 479 | Ga0105238_10112274 | 3300009551 | Bacteria | 2705 |
| 480 | Ga0105238_10197142 | 3300009551 | Bacteria | 1989 |
| 481 | Ga0105249_10032185 | 3300009553 | Bacteria | 4743 |
| 482 | Ga0105249_10038924 | 3300009553 | Bacteria | 4316 |
| 483 | Ga0105249_10515878 | 3300009553 | Bacteria | 1242 |
| 484 | Ga0105249_10822595 | 3300009553 | Bacteria | 993 |
| 485 | Ga0105249_10827093 | 3300009553 | Bacteria | 991 |
| 486 | Ga0105249_11055565 | 3300009553 | Bacteria | 882 |
| 487 | Ga0123340_1055299 | 3300009763 | Bacteria | 1304 |
| 488 | Ga0123341_1000025 | 3300009765 | Bacteria | 71692 |
| 489 | Ga0123342_1015842 | 3300009766 | Bacteria | 6728 |
| 490 | Ga0105239_10000471 | 3300010375 | Bacteria | 58946 |
| 491 | Ga0105239_10045062 | 3300010375 | Bacteria | 4834 |
| 492 | Ga0105239_10062791 | 3300010375 | Bacteria | 4077 |
| 493 | Ga0105239_10074454 | 3300010375 | Bacteria | 3733 |
| 494 | Ga0105239_10078448 | 3300010375 | Bacteria | 3634 |
| 495 | Ga0105239_10265712 | 3300010375 | Bacteria | 1929 |
| 496 | Ga0105239_10311827 | 3300010375 | Bacteria | 1773 |
| 497 | Ga0105239_10727320 | 3300010375 | Bacteria | 1135 |
| 498 | Ga0105239_11028585 | 3300010375 | Bacteria | 947 |
| 499 | Ga0105239_11835747 | 3300010375 | Bacteria | 703 |
| 500 | Ga0105246_10691753 | 3300011119 | Bacteria | 893 |
| 501 | Ga0157373_10011513 | 3300013100 | Bacteria | 6499 |
| 502 | Ga0157371_10005423 | 3300013102 | Bacteria | 10765 |
| 503 | Ga0157371_10051970 | 3300013102 | Bacteria | 2911 |
| 504 | Ga0157370_10000343 | 3300013104 | Bacteria | 58793 |
| 505 | Ga0157370_10000348 | 3300013104 | Bacteria | 58654 |
| 506 | Ga0157370_10003232 | 3300013104 | Bacteria | 19242 |
| 507 | Ga0157369_10000288 | 3300013105 | Bacteria | 67504 |
| 508 | Ga0157369_10127996 | 3300013105 | Bacteria | 2692 |
| 509 | Ga0157369_10210299 | 3300013105 | Bacteria | 2039 |
| 510 | Ga0157369_10227997 | 3300013105 | Bacteria | 1948 |
| 511 | Ga0171463_1013 | 3300013249 | Bacteria | 94945 |
| 512 | Ga0157374_10019897 | 3300013296 | Bacteria | 5949 |
| 513 | Ga0157374_10177479 | 3300013296 | Bacteria | 2079 |
| 514 | Ga0157374_10292302 | 3300013296 | Bacteria | 1611 |
| 515 | Ga0157378_10003823 | 3300013297 | Bacteria | 13318 |
| 516 | Ga0157378_10061027 | 3300013297 | Bacteria | 3364 |
| 517 | Ga0157378_10175059 | 3300013297 | Bacteria | 2015 |
| 518 | Ga0157378_10212366 | 3300013297 | Bacteria | 1836 |
| 519 | Ga0157378_10299170 | 3300013297 | Bacteria | 1557 |
| 520 | Ga0157378_10308128 | 3300013297 | Bacteria | 1535 |
| 521 | Ga0157378_10951050 | 3300013297 | Bacteria | 892 |
| 522 | Ga0157378_11393369 | 3300013297 | Bacteria | 744 |
| 523 | Ga0163162_10010080 | 3300013306 | Bacteria | 9185 |
| 524 | Ga0163162_10018986 | 3300013306 | Bacteria | 6742 |
| 525 | Ga0163162_10021486 | 3300013306 | Bacteria | 6358 |
| 526 | Ga0163162_10066999 | 3300013306 | Bacteria | 3640 |
| 527 | Ga0163162_10140642 | 3300013306 | Bacteria | 2527 |
| 528 | Ga0163162_10205453 | 3300013306 | Bacteria | 2099 |
| 529 | Ga0163162_10242733 | 3300013306 | Bacteria | 1932 |
| 530 | Ga0163162_10291720 | 3300013306 | Bacteria | 1763 |
| 531 | Ga0163162_10678728 | 3300013306 | Bacteria | 1153 |
| 532 | Ga0163162_10696673 | 3300013306 | Bacteria | 1138 |
| 533 | Ga0157372_10033146 | 3300013307 | Bacteria | 5671 |
| 534 | Ga0157372_10231102 | 3300013307 | Bacteria | 2144 |
| 535 | Ga0157375_10097833 | 3300013308 | Bacteria | 3010 |
| 536 | Ga0157375_10285270 | 3300013308 | Bacteria | 1814 |
| 537 | Ga0157375_10291660 | 3300013308 | Bacteria | 1794 |
| 538 | Ga0157375_10430766 | 3300013308 | Bacteria | 1485 |
| 539 | Ga0157375_10559788 | 3300013308 | Bacteria | 1304 |
| 540 | Ga0157375_11024923 | 3300013308 | Bacteria | 964 |
| 541 | Ga0163163_10423430 | 3300014325 | Bacteria | 1390 |
| 542 | Ga0163163_10616047 | 3300014325 | Bacteria | 1149 |
| 543 | Ga0163163_10746476 | 3300014325 | Bacteria | 1042 |
| 544 | Ga0163163_10780138 | 3300014325 | Bacteria | 1019 |
| 545 | Ga0157380_10021253 | 3300014326 | Bacteria | 4865 |
| 546 | Ga0157380_10038632 | 3300014326 | Bacteria | 3707 |
| 547 | Ga0157380_10053461 | 3300014326 | Bacteria | 3202 |
| 548 | Ga0157380_10517566 | 3300014326 | Bacteria | 1163 |
| 549 | Ga0157380_10790695 | 3300014326 | Bacteria | 965 |
| 550 | Ga0157380_10821704 | 3300014326 | Bacteria | 948 |
| 551 | Ga0157380_11256544 | 3300014326 | Bacteria | 786 |
| 552 | Ga0182008_10055693 | 3300014497 | Bacteria | 1955 |
| 553 | Ga0157377_10000013 | 3300014745 | Bacteria | 267125 |
| 554 | Ga0157377_10001137 | 3300014745 | Bacteria | 11282 |
| 555 | Ga0157377_10037573 | 3300014745 | Bacteria | 2669 |
| 556 | Ga0157377_10355129 | 3300014745 | Bacteria | 985 |
| 557 | Ga0157379_10002398 | 3300014968 | Bacteria | 15656 |
| 558 | Ga0157379_10005033 | 3300014968 | Bacteria | 11338 |
| 559 | Ga0157379_10011386 | 3300014968 | Bacteria | 7759 |
| 560 | Ga0157379_10014287 | 3300014968 | Bacteria | 6965 |
| 561 | Ga0157379_10038589 | 3300014968 | Bacteria | 4261 |
| 562 | Ga0157379_10043827 | 3300014968 | Bacteria | 3995 |
| 563 | Ga0157379_10062000 | 3300014968 | Bacteria | 3345 |
| 564 | Ga0157376_10034022 | 3300014969 | Bacteria | 4110 |
| 565 | Ga0157376_10076384 | 3300014969 | Bacteria | 2862 |
| 566 | Ga0157376_10084787 | 3300014969 | Bacteria | 2729 |
| 567 | Ga0157376_10240412 | 3300014969 | Bacteria | 1687 |
| 568 | Ga0182006_1039762 | 3300015261 | Bacteria | 1854 |
| 569 | Ga0182006_1059859 | 3300015261 | Bacteria | 1440 |
| 570 | Ga0182007_10000763 | 3300015262 | Bacteria | 18048 |
| 571 | Ga0182005_1005468 | 3300015265 | Bacteria | 3965 |
| 572 | Ga0183363_1409 | 3300015690 | Bacteria | 3562 |
| 573 | Ga0163161_10048831 | 3300017792 | Bacteria | 3057 |
| 574 | Ga0163161_10077140 | 3300017792 | Bacteria | 2447 |
| 575 | Ga0163161_10082554 | 3300017792 | Bacteria | 2368 |
| 576 | Ga0163161_10091622 | 3300017792 | Bacteria | 2250 |
| 577 | Ga0163161_10107034 | 3300017792 | Bacteria | 2087 |
| 578 | Ga0163161_10159485 | 3300017792 | Bacteria | 1720 |
| 579 | Ga0163161_10535122 | 3300017792 | Bacteria | 958 |
| 580 | Ga0163161_10536561 | 3300017792 | Unclassified | 957 |
| 581 | Ga0214544_1000130 | 3300021320 | Bacteria | 108844 |
| 582 | Ga0214542_1000014 | 3300021321 | Bacteria | 233825 |
| 583 | Ga0214543_1000146 | 3300021327 | Bacteria | 98609 |
| 584 | Ga0209435_100025 | 3300025206 | Bacteria | 198776 |
| 585 | Ga0209436_100044 | 3300025208 | Bacteria | 70547 |
| 586 | Ga0209436_100162 | 3300025208 | Bacteria | 32237 |
| 587 | Ga0209436_107779 | 3300025208 | Bacteria | 2201 |
| 588 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 589 | Ga0209672_113575 | 3300025228 | Bacteria | 972 |
| 590 | Ga0209563_100192 | 3300025230 | Bacteria | 33961 |
| 591 | Ga0207427_100663 | 3300025231 | Bacteria | 16489 |
| 592 | Ga0209437_100022 | 3300025233 | Bacteria | 625694 |
| 593 | Ga0209437_100040 | 3300025233 | Bacteria | 448096 |
| 594 | Ga0209258_100291 | 3300025242 | Bacteria | 82373 |
| 595 | Ga0207425_1000054 | 3300025245 | Bacteria | 153997 |
| 596 | Ga0207425_1000563 | 3300025245 | Bacteria | 21840 |
| 597 | Ga0209646_1000083 | 3300025246 | Bacteria | 198777 |
| 598 | Ga0209646_1000127 | 3300025246 | Bacteria | 131920 |
| 599 | Ga0209026_1000004 | 3300025250 | Bacteria | 949012 |
| 600 | Ga0209026_1000025 | 3300025250 | Bacteria | 352548 |
| 601 | Ga0209026_1000078 | 3300025250 | Bacteria | 198777 |
| 602 | Ga0209026_1012212 | 3300025250 | Bacteria | 1508 |
| 603 | Ga0209677_100085 | 3300025253 | Bacteria | 116046 |
| 604 | Ga0209677_100107 | 3300025253 | Bacteria | 89035 |
| 605 | Ga0209677_100515 | 3300025253 | Bacteria | 21525 |
| 606 | Ga0209677_108945 | 3300025253 | Bacteria | 1862 |
| 607 | Ga0209148_1000057 | 3300025254 | Bacteria | 360463 |
| 608 | Ga0209759_1000060 | 3300025256 | Bacteria | 198777 |
| 609 | Ga0209759_1000129 | 3300025256 | Bacteria | 131961 |
| 610 | Ga0209759_1000197 | 3300025256 | Bacteria | 95422 |
| 611 | Ga0209759_1003974 | 3300025256 | Bacteria | 5673 |
| 612 | Ga0209759_1010790 | 3300025256 | Bacteria | 2649 |
| 613 | Ga0209129_1000016 | 3300025258 | Bacteria | 485491 |
| 614 | Ga0209129_1000108 | 3300025258 | Bacteria | 153997 |
| 615 | Ga0209129_1001297 | 3300025258 | Bacteria | 14260 |
| 616 | Ga0209129_1004815 | 3300025258 | Bacteria | 5088 |
| 617 | Ga0209129_1006772 | 3300025258 | Bacteria | 3603 |
| 618 | Ga0209129_1006906 | 3300025258 | Bacteria | 3525 |
| 619 | Ga0209129_1007558 | 3300025258 | Bacteria | 3206 |
| 620 | Ga0209129_1038819 | 3300025258 | Bacteria | 761 |
| 621 | Ga0209233_1000010 | 3300025261 | Bacteria | 1194329 |
| 622 | Ga0209233_1000031 | 3300025261 | Bacteria | 624646 |
| 623 | Ga0209233_1000051 | 3300025261 | Bacteria | 447617 |
| 624 | Ga0209233_1000346 | 3300025261 | Bacteria | 44177 |
| 625 | Ga0209233_1006948 | 3300025261 | Bacteria | 3618 |
| 626 | Ga0209565_1058203 | 3300025263 | Bacteria | 676 |
| 627 | Ga0207666_1007136 | 3300025271 | Bacteria | 1464 |
| 628 | Ga0209455_1000208 | 3300025272 | Bacteria | 83420 |
| 629 | Ga0209455_1000224 | 3300025272 | Bacteria | 77325 |
| 630 | Ga0209455_1015739 | 3300025272 | Bacteria | 1649 |
| 631 | Ga0209673_1000005 | 3300025273 | Bacteria | 692788 |
| 632 | Ga0209673_1000023 | 3300025273 | Bacteria | 411385 |
| 633 | Ga0209673_1000212 | 3300025273 | Bacteria | 116031 |
| 634 | Ga0209673_1000738 | 3300025273 | Bacteria | 45021 |
| 635 | Ga0209673_1001452 | 3300025273 | Bacteria | 22431 |
| 636 | Ga0209673_1029612 | 3300025273 | Bacteria | 1740 |
| 637 | Ga0209673_1053764 | 3300025273 | Bacteria | 1047 |
| 638 | Ga0209673_1080594 | 3300025273 | Bacteria | 747 |
| 639 | Ga0209130_1000001 | 3300025284 | Bacteria | 831557 |
| 640 | Ga0209130_1000010 | 3300025284 | Bacteria | 444920 |
| 641 | Ga0209130_1000013 | 3300025284 | Bacteria | 412810 |
| 642 | Ga0209130_1019868 | 3300025284 | Bacteria | 1548 |
| 643 | Ga0207673_1000918 | 3300025290 | Bacteria | 3174 |
| 644 | Ga0209675_1043675 | 3300025291 | Bacteria | 963 |
| 645 | Ga0209676_1005657 | 3300025292 | Bacteria | 6436 |
| 646 | Ga0209025_1000189 | 3300025294 | Bacteria | 153997 |
| 647 | Ga0209025_1000300 | 3300025294 | Bacteria | 110956 |
| 648 | Ga0209025_1002184 | 3300025294 | Bacteria | 21713 |
| 649 | Ga0209025_1002603 | 3300025294 | Bacteria | 18593 |
| 650 | Ga0209025_1004543 | 3300025294 | Bacteria | 11960 |
| 651 | Ga0209025_1056157 | 3300025294 | Bacteria | 1516 |
| 652 | Ga0209025_1067969 | 3300025294 | Bacteria | 1284 |
| 653 | Ga0209564_1000025 | 3300025295 | Bacteria | 520535 |
| 654 | Ga0209564_1000112 | 3300025295 | Bacteria | 211939 |
| 655 | Ga0209564_1001278 | 3300025295 | Bacteria | 27680 |
| 656 | Ga0209564_1001823 | 3300025295 | Bacteria | 19549 |
| 657 | Ga0209564_1007604 | 3300025295 | Bacteria | 5559 |
| 658 | Ga0209564_1011616 | 3300025295 | Bacteria | 3926 |
| 659 | Ga0209564_1026842 | 3300025295 | Bacteria | 1889 |
| 660 | Ga0209564_1029039 | 3300025295 | Bacteria | 1750 |
| 661 | Ga0209758_1000053 | 3300025297 | Bacteria | 337751 |
| 662 | Ga0209758_1000162 | 3300025297 | Bacteria | 153997 |
| 663 | Ga0209758_1001361 | 3300025297 | Bacteria | 29297 |
| 664 | Ga0209758_1001669 | 3300025297 | Bacteria | 25096 |
| 665 | Ga0209758_1001814 | 3300025297 | Bacteria | 23603 |
| 666 | Ga0209758_1006808 | 3300025297 | Bacteria | 8018 |
| 667 | Ga0209758_1011938 | 3300025297 | Bacteria | 4941 |
| 668 | Ga0209758_1016362 | 3300025297 | Bacteria | 3773 |
| 669 | Ga0209758_1031255 | 3300025297 | Bacteria | 2188 |
| 670 | Ga0209758_1054398 | 3300025297 | Bacteria | 1368 |
| 671 | Ga0209050_1012499 | 3300025298 | Bacteria | 3885 |
| 672 | Ga0209050_1021630 | 3300025298 | Bacteria | 2338 |
| 673 | Ga0209256_1000682 | 3300025299 | Bacteria | 45685 |
| 674 | Ga0209256_1000828 | 3300025299 | Bacteria | 39174 |
| 675 | Ga0209256_1001472 | 3300025299 | Bacteria | 24098 |
| 676 | Ga0209256_1005449 | 3300025299 | Bacteria | 7325 |
| 677 | Ga0209256_1006490 | 3300025299 | Bacteria | 6158 |
| 678 | Ga0209256_1018918 | 3300025299 | Bacteria | 2215 |
| 679 | Ga0209256_1024559 | 3300025299 | Bacteria | 1772 |
| 680 | Ga0209256_1035268 | 3300025299 | Bacteria | 1323 |
| 681 | Ga0209256_1044948 | 3300025299 | Bacteria | 1100 |
| 682 | Ga0209256_1059372 | 3300025299 | Bacteria | 896 |
| 683 | Ga0209256_1061702 | 3300025299 | Bacteria | 871 |
| 684 | Ga0207426_1000005 | 3300025302 | Bacteria | 1037188 |
| 685 | Ga0207426_1000022 | 3300025302 | Bacteria | 547377 |
| 686 | Ga0207426_1000035 | 3300025302 | Bacteria | 448327 |
| 687 | Ga0207426_1000036 | 3300025302 | Bacteria | 444920 |
| 688 | Ga0207426_1002507 | 3300025302 | Bacteria | 11560 |
| 689 | Ga0209051_1000249 | 3300025303 | Bacteria | 90988 |
| 690 | Ga0209051_1000354 | 3300025303 | Bacteria | 68119 |
| 691 | Ga0209051_1003488 | 3300025303 | Bacteria | 10288 |
| 692 | Ga0209051_1007471 | 3300025303 | Bacteria | 5965 |
| 693 | Ga0209051_1012393 | 3300025303 | Bacteria | 4127 |
| 694 | Ga0209051_1015051 | 3300025303 | Bacteria | 3578 |
| 695 | Ga0209051_1015466 | 3300025303 | Bacteria | 3507 |
| 696 | Ga0209051_1016212 | 3300025303 | Bacteria | 3386 |
| 697 | Ga0209051_1018238 | 3300025303 | Bacteria | 3110 |
| 698 | Ga0209257_1015285 | 3300025304 | Bacteria | 3211 |
| 699 | Ga0209257_1019467 | 3300025304 | Bacteria | 2555 |
| 700 | Ga0209257_1032100 | 3300025304 | Bacteria | 1670 |
| 701 | Ga0209257_1033816 | 3300025304 | Bacteria | 1602 |
| 702 | Ga0207697_10002645 | 3300025315 | Bacteria | 9173 |
| 703 | Ga0207697_10005514 | 3300025315 | Bacteria | 5869 |
| 704 | Ga0207697_10024046 | 3300025315 | Bacteria | 2495 |
| 705 | Ga0207656_10006336 | 3300025321 | Bacteria | 4244 |
| 706 | Ga0207656_10006584 | 3300025321 | Bacteria | 4188 |
| 707 | Ga0207656_10069172 | 3300025321 | Bacteria | 1566 |
| 708 | Ga0207656_10103144 | 3300025321 | Bacteria | 1310 |
| 709 | Ga0207656_10161076 | 3300025321 | Bacteria | 1068 |
| 710 | Ga0207655_1000117 | 3300025728 | Bacteria | 161655 |
| 711 | Ga0207713_1020865 | 3300025735 | Bacteria | 3157 |
| 712 | Ga0207682_10003790 | 3300025893 | Bacteria | 6491 |
| 713 | Ga0207682_10016767 | 3300025893 | Bacteria | 2859 |
| 714 | Ga0207682_10026959 | 3300025893 | Bacteria | 2286 |
| 715 | Ga0207642_10036079 | 3300025899 | Bacteria | 2118 |
| 716 | Ga0207642_10194466 | 3300025899 | Bacteria | 1116 |
| 717 | Ga0207642_10248448 | 3300025899 | Bacteria | 1008 |
| 718 | Ga0207688_10001682 | 3300025901 | Bacteria | 11710 |
| 719 | Ga0207688_10030555 | 3300025901 | Bacteria | 2971 |
| 720 | Ga0207688_10119420 | 3300025901 | Bacteria | 1537 |
| 721 | Ga0207680_10000416 | 3300025903 | Bacteria | 20261 |
| 722 | Ga0207680_10025108 | 3300025903 | Bacteria | 3283 |
| 723 | Ga0207680_10245688 | 3300025903 | Bacteria | 1235 |
| 724 | Ga0207647_10004710 | 3300025904 | Bacteria | 10101 |
| 725 | Ga0207647_10041929 | 3300025904 | Bacteria | 2874 |
| 726 | Ga0207647_10078474 | 3300025904 | Bacteria | 1983 |
| 727 | Ga0207645_10001481 | 3300025907 | Bacteria | 19198 |
| 728 | Ga0207645_10014278 | 3300025907 | Bacteria | 5319 |
| 729 | Ga0207645_10015476 | 3300025907 | Bacteria | 5065 |
| 730 | Ga0207645_10022550 | 3300025907 | Bacteria | 4095 |
| 731 | Ga0207645_10030541 | 3300025907 | Bacteria | 3472 |
| 732 | Ga0207643_10002283 | 3300025908 | Bacteria | 10438 |
| 733 | Ga0207705_10000625 | 3300025909 | Bacteria | 29536 |
| 734 | Ga0207705_10048791 | 3300025909 | Bacteria | 3047 |
| 735 | Ga0207705_10051510 | 3300025909 | Bacteria | 2963 |
| 736 | Ga0207705_10112090 | 3300025909 | Bacteria | 2016 |
| 737 | Ga0207705_10141660 | 3300025909 | Bacteria | 1796 |
| 738 | Ga0207705_10198955 | 3300025909 | Bacteria | 1518 |
| 739 | Ga0207684_10002597 | 3300025910 | Bacteria | 18082 |
| 740 | Ga0207654_10159710 | 3300025911 | Bacteria | 1455 |
| 741 | Ga0207695_10000120 | 3300025913 | Bacteria | 234247 |
| 742 | Ga0207695_10022029 | 3300025913 | Bacteria | 7250 |
| 743 | Ga0207695_10063883 | 3300025913 | Bacteria | 3793 |
| 744 | Ga0207695_10101432 | 3300025913 | Bacteria | 2872 |
| 745 | Ga0207671_10005869 | 3300025914 | Bacteria | 11152 |
| 746 | Ga0207671_10006498 | 3300025914 | Bacteria | 10400 |
| 747 | Ga0207671_10058639 | 3300025914 | Bacteria | 2854 |
| 748 | Ga0207671_10074921 | 3300025914 | Bacteria | 2530 |
| 749 | Ga0207671_10188081 | 3300025914 | Bacteria | 1609 |
| 750 | Ga0207671_10485790 | 3300025914 | Bacteria | 984 |
| 751 | Ga0207693_10045045 | 3300025915 | Bacteria | 3467 |
| 752 | Ga0207662_10001442 | 3300025918 | Bacteria | 11539 |
| 753 | Ga0207662_10029230 | 3300025918 | Bacteria | 3192 |
| 754 | Ga0207662_10034420 | 3300025918 | Bacteria | 2957 |
| 755 | Ga0207657_10032593 | 3300025919 | Bacteria | 4705 |
| 756 | Ga0207657_10068924 | 3300025919 | Bacteria | 3004 |
| 757 | Ga0207657_10076636 | 3300025919 | Bacteria | 2820 |
| 758 | Ga0207657_10091021 | 3300025919 | Bacteria | 2545 |
| 759 | Ga0207657_10179246 | 3300025919 | Bacteria | 1713 |
| 760 | Ga0207657_10405447 | 3300025919 | Bacteria | 1072 |
| 761 | Ga0207657_10727149 | 3300025919 | Bacteria | 770 |
| 762 | Ga0207649_10009516 | 3300025920 | Bacteria | 5319 |
| 763 | Ga0207649_10036887 | 3300025920 | Bacteria | 2948 |
| 764 | Ga0207652_10015677 | 3300025921 | Bacteria | 6171 |
| 765 | Ga0207681_10000826 | 3300025923 | Bacteria | 20436 |
| 766 | Ga0207681_10018269 | 3300025923 | Bacteria | 4416 |
| 767 | Ga0207681_10049567 | 3300025923 | Bacteria | 2839 |
| 768 | Ga0207681_10283321 | 3300025923 | Bacteria | 1305 |
| 769 | Ga0207681_10393913 | 3300025923 | Bacteria | 1117 |
| 770 | Ga0207694_10003375 | 3300025924 | Bacteria | 12715 |
| 771 | Ga0207694_10215673 | 3300025924 | Bacteria | 1564 |
| 772 | Ga0207694_10393672 | 3300025924 | Bacteria | 1151 |
| 773 | Ga0207650_10002771 | 3300025925 | Bacteria | 12104 |
| 774 | Ga0207650_10044510 | 3300025925 | Bacteria | 3263 |
| 775 | Ga0207650_10095034 | 3300025925 | Bacteria | 2284 |
| 776 | Ga0207650_10108359 | 3300025925 | Bacteria | 2147 |
| 777 | Ga0207650_10165870 | 3300025925 | Bacteria | 1753 |
| 778 | Ga0207650_10296131 | 3300025925 | Bacteria | 1320 |
| 779 | Ga0207659_10001869 | 3300025926 | Bacteria | 12468 |
| 780 | Ga0207659_10002398 | 3300025926 | Bacteria | 11149 |
| 781 | Ga0207659_10011351 | 3300025926 | Bacteria | 5625 |
| 782 | Ga0207659_10169198 | 3300025926 | Bacteria | 1723 |
| 783 | Ga0207687_10036867 | 3300025927 | Bacteria | 3333 |
| 784 | Ga0207687_10141822 | 3300025927 | Bacteria | 1823 |
| 785 | Ga0207687_10332870 | 3300025927 | Bacteria | 1232 |
| 786 | Ga0207687_10598211 | 3300025927 | Bacteria | 929 |
| 787 | Ga0207700_10000052 | 3300025928 | Bacteria | 76498 |
| 788 | Ga0207644_10000223 | 3300025931 | Bacteria | 39200 |
| 789 | Ga0207644_10000543 | 3300025931 | Bacteria | 24519 |
| 790 | Ga0207644_10003185 | 3300025931 | Bacteria | 10567 |
| 791 | Ga0207644_10008458 | 3300025931 | Bacteria | 6736 |
| 792 | Ga0207644_10019053 | 3300025931 | Bacteria | 4651 |
| 793 | Ga0207690_10018974 | 3300025932 | Bacteria | 4223 |
| 794 | Ga0207690_10025602 | 3300025932 | Bacteria | 3707 |
| 795 | Ga0207690_10126134 | 3300025932 | Bacteria | 1867 |
| 796 | Ga0207690_10217509 | 3300025932 | Bacteria | 1460 |
| 797 | Ga0207690_10431819 | 3300025932 | Bacteria | 1056 |
| 798 | Ga0207706_10000736 | 3300025933 | Bacteria | 34115 |
| 799 | Ga0207706_10003460 | 3300025933 | Bacteria | 15072 |
| 800 | Ga0207706_10130237 | 3300025933 | Bacteria | 2213 |
| 801 | Ga0207706_10487205 | 3300025933 | Bacteria | 1065 |
| 802 | Ga0207686_10169686 | 3300025934 | Bacteria | 1537 |
| 803 | Ga0207709_10005372 | 3300025935 | Bacteria | 7286 |
| 804 | Ga0207709_10006706 | 3300025935 | Bacteria | 6452 |
| 805 | Ga0207670_10214048 | 3300025936 | Bacteria | 1471 |
| 806 | Ga0207669_10002740 | 3300025937 | Bacteria | 7551 |
| 807 | Ga0207669_10016706 | 3300025937 | Bacteria | 3738 |
| 808 | Ga0207669_10100124 | 3300025937 | Bacteria | 1913 |
| 809 | Ga0207669_10106274 | 3300025937 | Bacteria | 1869 |
| 810 | Ga0207669_10178965 | 3300025937 | Bacteria | 1518 |
| 811 | Ga0207669_10558916 | 3300025937 | Bacteria | 924 |
| 812 | Ga0207704_10002371 | 3300025938 | Bacteria | 8463 |
| 813 | Ga0207704_10020597 | 3300025938 | Bacteria | 3493 |
| 814 | Ga0207704_10022772 | 3300025938 | Bacteria | 3363 |
| 815 | Ga0207704_10095530 | 3300025938 | Bacteria | 1965 |
| 816 | Ga0207704_10133173 | 3300025938 | Bacteria | 1725 |
| 817 | Ga0207704_10281057 | 3300025938 | Bacteria | 1265 |
| 818 | Ga0207704_10419024 | 3300025938 | Bacteria | 1061 |
| 819 | Ga0207704_10467395 | 3300025938 | Bacteria | 1010 |
| 820 | Ga0207691_10004886 | 3300025940 | Bacteria | 12955 |
| 821 | Ga0207691_10018207 | 3300025940 | Bacteria | 6653 |
| 822 | Ga0207691_10021499 | 3300025940 | Bacteria | 6092 |
| 823 | Ga0207691_10053661 | 3300025940 | Bacteria | 3679 |
| 824 | Ga0207691_10074883 | 3300025940 | Bacteria | 3053 |
| 825 | Ga0207691_10089902 | 3300025940 | Bacteria | 2753 |
| 826 | Ga0207691_10103580 | 3300025940 | Bacteria | 2537 |
| 827 | Ga0207691_10151848 | 3300025940 | Unclassified | 2036 |
| 828 | Ga0207691_10164989 | 3300025940 | Bacteria | 1941 |
| 829 | Ga0207711_10002545 | 3300025941 | Bacteria | 16235 |
| 830 | Ga0207711_10007597 | 3300025941 | Bacteria | 9068 |
| 831 | Ga0207711_10034440 | 3300025941 | Bacteria | 4289 |
| 832 | Ga0207711_10047277 | 3300025941 | Bacteria | 3678 |
| 833 | Ga0207711_10056557 | 3300025941 | Bacteria | 3371 |
| 834 | Ga0207711_10473011 | 3300025941 | Bacteria | 1167 |
| 835 | Ga0207711_10534347 | 3300025941 | Bacteria | 1094 |
| 836 | Ga0207711_10590015 | 3300025941 | Bacteria | 1037 |
| 837 | Ga0207689_10000259 | 3300025942 | Bacteria | 47474 |
| 838 | Ga0207689_10001323 | 3300025942 | Bacteria | 23878 |
| 839 | Ga0207689_10019394 | 3300025942 | Bacteria | 5732 |
| 840 | Ga0207689_10025240 | 3300025942 | Bacteria | 4981 |
| 841 | Ga0207661_10033466 | 3300025944 | Bacteria | 3989 |
| 842 | Ga0207661_10571633 | 3300025944 | Bacteria | 1036 |
| 843 | Ga0207679_10004670 | 3300025945 | Bacteria | 8534 |
| 844 | Ga0207679_10013547 | 3300025945 | Bacteria | 5344 |
| 845 | Ga0207679_10859123 | 3300025945 | Bacteria | 829 |
| 846 | Ga0207667_10029470 | 3300025949 | Bacteria | 5952 |
| 847 | Ga0207667_10035301 | 3300025949 | Bacteria | 5364 |
| 848 | Ga0207667_10035853 | 3300025949 | Bacteria | 5321 |
| 849 | Ga0207667_10055665 | 3300025949 | Bacteria | 4158 |
| 850 | Ga0207667_10634863 | 3300025949 | Bacteria | 1075 |
| 851 | Ga0207667_11206426 | 3300025949 | Bacteria | 736 |
| 852 | Ga0207651_10001900 | 3300025960 | Bacteria | 9800 |
| 853 | Ga0207651_10007058 | 3300025960 | Bacteria | 5958 |
| 854 | Ga0207651_10033406 | 3300025960 | Bacteria | 3318 |
| 855 | Ga0207651_10072585 | 3300025960 | Bacteria | 2444 |
| 856 | Ga0207651_10110633 | 3300025960 | Bacteria | 2061 |
| 857 | Ga0207651_10259272 | 3300025960 | Bacteria | 1426 |
| 858 | Ga0207712_10050088 | 3300025961 | Bacteria | 2915 |
| 859 | Ga0207712_10371102 | 3300025961 | Bacteria | 1195 |
| 860 | Ga0207712_10541641 | 3300025961 | Bacteria | 1000 |
| 861 | Ga0207712_10973330 | 3300025961 | Bacteria | 752 |
| 862 | Ga0207668_10012347 | 3300025972 | Bacteria | 5226 |
| 863 | Ga0207668_10035224 | 3300025972 | Bacteria | 3330 |
| 864 | Ga0207668_10290848 | 3300025972 | Bacteria | 1344 |
| 865 | Ga0207640_10036401 | 3300025981 | Bacteria | 3089 |
| 866 | Ga0207640_10066295 | 3300025981 | Bacteria | 2412 |
| 867 | Ga0207640_10072693 | 3300025981 | Bacteria | 2321 |
| 868 | Ga0207640_10335157 | 3300025981 | Bacteria | 1210 |
| 869 | Ga0207640_10365045 | 3300025981 | Bacteria | 1165 |
| 870 | Ga0207640_10703352 | 3300025981 | Bacteria | 867 |
| 871 | Ga0207640_10820422 | 3300025981 | Bacteria | 807 |
| 872 | Ga0207658_10002825 | 3300025986 | Bacteria | 12451 |
| 873 | Ga0207658_10005463 | 3300025986 | Bacteria | 8720 |
| 874 | Ga0207658_10023760 | 3300025986 | Bacteria | 4282 |
| 875 | Ga0207658_10036559 | 3300025986 | Bacteria | 3521 |
| 876 | Ga0207658_10052457 | 3300025986 | Bacteria | 3010 |
| 877 | Ga0207658_10086237 | 3300025986 | Bacteria | 2421 |
| 878 | Ga0207658_10148591 | 3300025986 | Bacteria | 1906 |
| 879 | Ga0207658_10201013 | 3300025986 | Bacteria | 1664 |
| 880 | Ga0207658_10364065 | 3300025986 | Bacteria | 1262 |
| 881 | Ga0207658_10473957 | 3300025986 | Bacteria | 1111 |
| 882 | Ga0207658_11007142 | 3300025986 | Bacteria | 760 |
| 883 | Ga0207677_10001436 | 3300026023 | Bacteria | 12666 |
| 884 | Ga0207677_10011722 | 3300026023 | Bacteria | 5008 |
| 885 | Ga0207677_10015290 | 3300026023 | Bacteria | 4509 |
| 886 | Ga0207677_10068294 | 3300026023 | Bacteria | 2494 |
| 887 | Ga0207677_10174490 | 3300026023 | Bacteria | 1685 |
| 888 | Ga0207677_10433647 | 3300026023 | Bacteria | 1122 |
| 889 | Ga0207677_10539610 | 3300026023 | Bacteria | 1015 |
| 890 | Ga0207703_10000408 | 3300026035 | Bacteria | 45772 |
| 891 | Ga0207703_10000504 | 3300026035 | Bacteria | 40430 |
| 892 | Ga0207703_10007335 | 3300026035 | Bacteria | 8764 |
| 893 | Ga0207703_10065549 | 3300026035 | Bacteria | 2985 |
| 894 | Ga0207703_10116560 | 3300026035 | Bacteria | 2287 |
| 895 | Ga0207703_10258828 | 3300026035 | Bacteria | 1572 |
| 896 | Ga0207703_10465906 | 3300026035 | Bacteria | 1182 |
| 897 | Ga0207639_10010731 | 3300026041 | Bacteria | 6346 |
| 898 | Ga0207639_10083505 | 3300026041 | Bacteria | 2535 |
| 899 | Ga0207639_10231071 | 3300026041 | Bacteria | 1603 |
| 900 | Ga0207678_10003576 | 3300026067 | Bacteria | 13974 |
| 901 | Ga0207678_10123964 | 3300026067 | Bacteria | 2205 |
| 902 | Ga0207678_10236582 | 3300026067 | Bacteria | 1564 |
| 903 | Ga0207708_10000558 | 3300026075 | Bacteria | 28801 |
| 904 | Ga0207708_10046044 | 3300026075 | Bacteria | 3323 |
| 905 | Ga0207708_10252510 | 3300026075 | Bacteria | 1421 |
| 906 | Ga0207702_10011425 | 3300026078 | Bacteria | 7401 |
| 907 | Ga0207702_10055620 | 3300026078 | Bacteria | 3356 |
| 908 | Ga0207702_10074159 | 3300026078 | Bacteria | 2936 |
| 909 | Ga0207702_10176078 | 3300026078 | Bacteria | 1966 |
| 910 | Ga0207702_10203762 | 3300026078 | Bacteria | 1835 |
| 911 | Ga0207702_10209102 | 3300026078 | Bacteria | 1813 |
| 912 | Ga0207702_10568939 | 3300026078 | Bacteria | 1110 |
| 913 | Ga0207702_10750935 | 3300026078 | Bacteria | 963 |
| 914 | Ga0207641_10002065 | 3300026088 | Bacteria | 19074 |
| 915 | Ga0207641_10004421 | 3300026088 | Bacteria | 12179 |
| 916 | Ga0207641_10178863 | 3300026088 | Bacteria | 1941 |
| 917 | Ga0207641_10345476 | 3300026088 | Bacteria | 1417 |
| 918 | Ga0207641_10754848 | 3300026088 | Bacteria | 960 |
| 919 | Ga0207648_10000006 | 3300026089 | Bacteria | 223855 |
| 920 | Ga0207648_10010711 | 3300026089 | Bacteria | 8665 |
| 921 | Ga0207648_10053834 | 3300026089 | Bacteria | 3516 |
| 922 | Ga0207648_10127708 | 3300026089 | Bacteria | 2237 |
| 923 | Ga0207648_10264293 | 3300026089 | Bacteria | 1536 |
| 924 | Ga0207648_10269565 | 3300026089 | Bacteria | 1521 |
| 925 | Ga0207648_10277978 | 3300026089 | Unclassified | 1497 |
| 926 | Ga0207648_10329262 | 3300026089 | Bacteria | 1374 |
| 927 | Ga0207676_10000269 | 3300026095 | Bacteria | 45280 |
| 928 | Ga0207676_10018994 | 3300026095 | Bacteria | 5007 |
| 929 | Ga0207676_10022527 | 3300026095 | Bacteria | 4633 |
| 930 | Ga0207676_10022675 | 3300026095 | Bacteria | 4619 |
| 931 | Ga0207676_10082855 | 3300026095 | Bacteria | 2610 |
| 932 | Ga0207674_10002376 | 3300026116 | Bacteria | 23789 |
| 933 | Ga0207674_10026017 | 3300026116 | Bacteria | 6227 |
| 934 | Ga0207674_10031643 | 3300026116 | Bacteria | 5555 |
| 935 | Ga0207674_10074635 | 3300026116 | Bacteria | 3402 |
| 936 | Ga0207674_10214850 | 3300026116 | Bacteria | 1872 |
| 937 | Ga0207675_100000307 | 3300026118 | Bacteria | 46857 |
| 938 | Ga0207675_100002315 | 3300026118 | Bacteria | 18913 |
| 939 | Ga0207675_100002610 | 3300026118 | Bacteria | 17839 |
| 940 | Ga0207675_100033253 | 3300026118 | Bacteria | 4805 |
| 941 | Ga0207675_100033725 | 3300026118 | Bacteria | 4770 |
| 942 | Ga0207675_100034412 | 3300026118 | Bacteria | 4724 |
| 943 | Ga0207675_100061406 | 3300026118 | Bacteria | 3508 |
| 944 | Ga0207675_100192930 | 3300026118 | Bacteria | 1954 |
| 945 | Ga0207683_10001051 | 3300026121 | Bacteria | 25171 |
| 946 | Ga0207683_10009047 | 3300026121 | Bacteria | 8487 |
| 947 | Ga0207683_10011779 | 3300026121 | Bacteria | 7463 |
| 948 | Ga0207683_10140183 | 3300026121 | Bacteria | 2178 |
| 949 | Ga0207683_10221055 | 3300026121 | Bacteria | 1726 |
| 950 | Ga0207683_10333903 | 3300026121 | Bacteria | 1389 |
| 951 | Ga0207683_10346718 | 3300026121 | Bacteria | 1362 |
| 952 | Ga0207683_10362558 | 3300026121 | Bacteria | 1331 |
| 953 | Ga0207683_10409034 | 3300026121 | Bacteria | 1249 |
| 954 | Ga0207683_10604826 | 3300026121 | Bacteria | 1015 |
| 955 | Ga0207698_10004189 | 3300026142 | Bacteria | 8776 |
| 956 | Ga0207698_10012346 | 3300026142 | Bacteria | 5586 |
| 957 | Ga0207698_10025234 | 3300026142 | Bacteria | 4184 |
| 958 | Ga0207698_10101682 | 3300026142 | Bacteria | 2384 |
| 959 | Ga0207698_10144575 | 3300026142 | Bacteria | 2054 |
| 960 | Ga0207698_10225286 | 3300026142 | Bacteria | 1698 |
| 961 | Ga0207698_10419167 | 3300026142 | Bacteria | 1284 |
| 962 | Ga0209281_1000032 | 3300027111 | Bacteria | 401727 |
| 963 | Ga0209281_1001369 | 3300027111 | Bacteria | 15026 |
| 964 | Ga0209371_1004078 | 3300027312 | Bacteria | 6583 |
| 965 | Ga0209968_1013722 | 3300027526 | Bacteria | 1273 |
| 966 | Ga0210002_1007602 | 3300027617 | Bacteria | 1645 |
| 967 | Ga0209998_10008846 | 3300027717 | Bacteria | 2085 |
| 968 | Ga0209813_10023660 | 3300027866 | Bacteria | 1748 |
| 969 | Ga0209813_10043387 | 3300027866 | Bacteria | 1378 |
| 970 | Ga0209813_10059974 | 3300027866 | Bacteria | 1212 |
| 971 | Ga0209813_10190147 | 3300027866 | Bacteria | 755 |
| 972 | Ga0209974_10000445 | 3300027876 | Bacteria | 13695 |
| 973 | Ga0207428_10626383 | 3300027907 | Bacteria | 773 |
| 974 | Ga0268266_10029943 | 3300028379 | Bacteria | 4626 |
| 975 | Ga0268266_10082233 | 3300028379 | Bacteria | 2809 |
| 976 | Ga0268266_10131420 | 3300028379 | Bacteria | 2239 |
| 977 | Ga0268266_10153701 | 3300028379 | Bacteria | 2077 |
| 978 | Ga0268266_10163214 | 3300028379 | Bacteria | 2017 |
| 979 | Ga0268266_10299975 | 3300028379 | Bacteria | 1498 |
| 980 | Ga0268266_10489607 | 3300028379 | Bacteria | 1173 |
| 981 | Ga0268266_10506409 | 3300028379 | Bacteria | 1153 |
| 982 | Ga0268266_11051058 | 3300028379 | Bacteria | 788 |
| 983 | Ga0268265_10040778 | 3300028380 | Bacteria | 3430 |
| 984 | Ga0268265_10114171 | 3300028380 | Bacteria | 2211 |
| 985 | Ga0268265_10514039 | 3300028380 | Bacteria | 1131 |
| 986 | Ga0268264_10020371 | 3300028381 | Bacteria | 5420 |
| 987 | Ga0268264_10029957 | 3300028381 | Bacteria | 4462 |
| 988 | Ga0268264_10039273 | 3300028381 | Bacteria | 3910 |
| 989 | Ga0268264_10121640 | 3300028381 | Bacteria | 2301 |
| 990 | Ga0268264_10133185 | 3300028381 | Bacteria | 2207 |
| 991 | Ga0268264_10167671 | 3300028381 | Bacteria | 1984 |
| 992 | Ga0307515_10000375 | 3300028794 | Bacteria | 109285 |
| 993 | Ga0307515_10005525 | 3300028794 | Bacteria | 25589 |
| 994 | Ga0307515_10013701 | 3300028794 | Bacteria | 15109 |
| 995 | Ga0268256_1002543 | 3300030500 | Bacteria | 9162 |
| 996 | Ga0307511_10131150 | 3300030521 | Bacteria | 1509 |
| 997 | Ga0265329_10099663 | 3300031242 | Bacteria | 924 |
| 998 | Ga0265340_10044760 | 3300031247 | Bacteria | 2165 |
| 999 | Ga0265339_10073917 | 3300031249 | Bacteria | 1812 |
| 1000 | Ga0265331_10094631 | 3300031250 | Bacteria | 1379 |
| 1001 | Ga0265316_10084030 | 3300031344 | Bacteria | 2438 |
| 1002 | Ga0307513_10002502 | 3300031456 | Bacteria | 25439 |
| 1003 | Ga0307513_10018285 | 3300031456 | Bacteria | 8379 |
| 1004 | Ga0307513_10243339 | 3300031456 | Bacteria | 1602 |
| 1005 | Ga0307513_10551724 | 3300031456 | Bacteria | 865 |
| 1006 | Ga0307509_10001328 | 3300031507 | Bacteria | 41879 |
| 1007 | Ga0307509_10033331 | 3300031507 | Bacteria | 5670 |
| 1008 | Ga0307408_100027204 | 3300031548 | Bacteria | 3939 |
| 1009 | Ga0307408_100207039 | 3300031548 | Bacteria | 1592 |
| 1010 | Ga0307408_100272653 | 3300031548 | Bacteria | 1405 |
| 1011 | Ga0307408_100404427 | 3300031548 | Bacteria | 1173 |
| 1012 | Ga0265313_10026994 | 3300031595 | Bacteria | 3013 |
| 1013 | Ga0307508_10077400 | 3300031616 | Bacteria | 2905 |
| 1014 | Ga0265314_10012378 | 3300031711 | Bacteria | 6965 |
| 1015 | Ga0265342_10070611 | 3300031712 | Bacteria | 2037 |
| 1016 | Ga0307516_10000662 | 3300031730 | Bacteria | 46543 |
| 1017 | Ga0307516_10007532 | 3300031730 | Bacteria | 12496 |
| 1018 | Ga0307405_10059257 | 3300031731 | Bacteria | 2412 |
| 1019 | Ga0307413_10001878 | 3300031824 | Bacteria | 8299 |
| 1020 | Ga0307406_10023234 | 3300031901 | Bacteria | 3686 |
| 1021 | Ga0307406_10061831 | 3300031901 | Bacteria | 2420 |
| 1022 | Ga0307406_10285536 | 3300031901 | Bacteria | 1261 |
| 1023 | Ga0307406_11007418 | 3300031901 | Bacteria | 715 |
| 1024 | Ga0307412_10001094 | 3300031911 | Bacteria | 15530 |
| 1025 | Ga0307412_10394783 | 3300031911 | Bacteria | 1124 |
| 1026 | Ga0307409_100002844 | 3300031995 | Bacteria | 9155 |
| 1027 | Ga0307409_100041713 | 3300031995 | Bacteria | 3430 |
| 1028 | Ga0307416_100001574 | 3300032002 | Bacteria | 12514 |
| 1029 | Ga0307416_100002602 | 3300032002 | Bacteria | 10424 |
| 1030 | Ga0307416_100057914 | 3300032002 | Bacteria | 3138 |
| 1031 | Ga0307416_100334684 | 3300032002 | Bacteria | 1523 |
| 1032 | Ga0307414_10091577 | 3300032004 | Bacteria | 2260 |
| 1033 | Ga0307414_10097273 | 3300032004 | Bacteria | 2205 |
| 1034 | Ga0307414_10114978 | 3300032004 | Bacteria | 2057 |
| 1035 | Ga0307414_10200850 | 3300032004 | Bacteria | 1621 |
| 1036 | Ga0307414_10218193 | 3300032004 | Bacteria | 1564 |
| 1037 | Ga0307414_10278232 | 3300032004 | Bacteria | 1405 |
| 1038 | Ga0307414_10659293 | 3300032004 | Bacteria | 944 |
| 1039 | Ga0307414_10858263 | 3300032004 | Bacteria | 830 |
| 1040 | Ga0307411_10056023 | 3300032005 | Bacteria | 2596 |
| 1041 | Ga0307411_10142911 | 3300032005 | Bacteria | 1767 |
| 1042 | Ga0307411_10460559 | 3300032005 | Bacteria | 1066 |
| 1043 | Ga0307411_10527103 | 3300032005 | Bacteria | 1004 |
| 1044 | Ga0307415_100007051 | 3300032126 | Bacteria | 6113 |
| 1045 | Ga0307510_10187942 | 3300033180 | Bacteria | 1618 |
| 1046 | Ga0373959_0006169 | 3300034820 | Bacteria | 1983 |
| 1047 | Ga0373940_0021250 | 3300035088 | Bacteria | 1657 |
| 1048 | Ga0373936_0044308 | 3300035113 | Bacteria | 1790 |
| 1049 | Ga0373941_0053875 | 3300035115 | Bacteria | 1288 |
| 1050 | Ga0373953_0065968 | 3300035117 | Bacteria | 1487 |
| 1051 | Ga0373954_0047471 | 3300035118 | Bacteria | 2010 |
| 1052 | Ga0373957_0024701 | 3300035120 | Bacteria | 2160 |
| 1053 | Ga0373943_0017569 | 3300035170 | Bacteria | 3273 |
| 1054 | Ga0373955_0084035 | 3300035172 | Bacteria | 1804 |
| 1055 | Ga0316574_0459332 | 3300035398 | Bacteria | 797 |
| 1056 | Ga0373924_0052712 | 3300035410 | Bacteria | 1689 |
| 1057 | Ga0373931_0001075 | 3300035691 | Bacteria | 11550 |
| 1058 | Ga0373931_0054830 | 3300035691 | Bacteria | 2132 |
| 1059 | Ga0373927_0059272 | 3300035695 | Bacteria | 2476 |
| 1060 | Ga0373927_0706812 | 3300035695 | Bacteria | 666 |
| 1061 | Ga0373933_0000057 | 3300035724 | Bacteria | 66100 |
| 1062 | Ga0373947_0073171 | 3300035725 | Bacteria | 2106 |
| 1063 | Ga0373937_0015648 | 3300036401 | Bacteria | 6716 |
| 1064 | Ga0373937_0174464 | 3300036401 | Bacteria | 2017 |
| 1065 | Ga0373925_0242691 | 3300037068 | Bacteria | 1443 |
| 1066 | Ga0373925_0595786 | 3300037068 | Bacteria | 910 |
| 1067 | Ga0395899_0000005 | 3300037312 | Bacteria | 772966 |
| 1068 | Ga0395899_0000729 | 3300037312 | Bacteria | 32868 |
| 1069 | Ga0395899_0084318 | 3300037312 | Bacteria | 2310 |
| 1070 | Ga0395899_0176329 | 3300037312 | Bacteria | 1503 |
| 1071 | Ga0395900_0000003 | 3300037418 | Bacteria | 587648 |
| 1072 | Ga0395900_0053623 | 3300037418 | Bacteria | 4150 |
| 1073 | Ga0395900_0106065 | 3300037418 | Bacteria | 2886 |
| 1074 | Ga0395900_0106286 | 3300037418 | Bacteria | 2883 |
| 1075 | Ga0395900_0127056 | 3300037418 | Bacteria | 2615 |
| 1076 | Ga0395900_0802608 | 3300037418 | Bacteria | 869 |
| 1077 | Ga0395898_0000003 | 3300037466 | Bacteria | 772986 |
| 1078 | Ga0395898_0000195 | 3300037466 | Bacteria | 155796 |
| 1079 | Ga0395898_0044774 | 3300037466 | Bacteria | 4353 |
| 1080 | Ga0395898_0248555 | 3300037466 | Bacteria | 1696 |
| 1081 | Ga0395898_0432294 | 3300037466 | Bacteria | 1254 |
| 1082 | Ga0395898_1053351 | 3300037466 | Bacteria | 748 |
| 1083 | Ga0395905_0015787 | 3300037471 | Bacteria | 7174 |
| 1084 | Ga0395905_0041614 | 3300037471 | Bacteria | 4311 |
| 1085 | Ga0395905_0047229 | 3300037471 | Bacteria | 4036 |
| 1086 | Ga0395905_0062649 | 3300037471 | Bacteria | 3479 |
| 1087 | Ga0395905_0077524 | 3300037471 | Bacteria | 3114 |
| 1088 | Ga0395905_0109842 | 3300037471 | Bacteria | 2589 |
| 1089 | Ga0395905_0122201 | 3300037471 | Bacteria | 2448 |
| 1090 | Ga0395905_0324699 | 3300037471 | Bacteria | 1429 |
| 1091 | Ga0436364_0698594 | 3300037853 | Bacteria | 5635 |
| 1092 | Ga0436364_1521153 | 3300037853 | Bacteria | 3271 |
| 1093 | Ga0395901_0000012 | 3300038443 | Bacteria | 381361 |
| 1094 | Ga0395901_0000038 | 3300038443 | Bacteria | 210534 |
| 1095 | Ga0395901_0001277 | 3300038443 | Bacteria | 26706 |
| 1096 | Ga0395901_0013219 | 3300038443 | Bacteria | 8381 |
| 1097 | Ga0395901_0034009 | 3300038443 | Bacteria | 5263 |
| 1098 | Ga0395901_0246976 | 3300038443 | Bacteria | 1860 |
| 1099 | Ga0395901_0588452 | 3300038443 | Bacteria | 1123 |
| 1100 | Ga0395901_0728011 | 3300038443 | Bacteria | 987 |
| 1101 | Ga0400483_246615 | 3300039062 | Bacteria | 3000 |
| 1102 | Ga0436365_1498206 | 3300039437 | Bacteria | 3774 |
| 1103 | Ga0436365_1805396 | 3300039437 | Bacteria | 1419 |
| 1104 | Ga0436363_0482532 | 3300039450 | Bacteria | 7189 |
| 1105 | Ga0436363_0541622 | 3300039450 | Bacteria | 4653 |
| 1106 | Ga0439436_0005356 | 3300041404 | Bacteria | 3936 |
| 1107 | Ga0439436_0060725 | 3300041404 | Bacteria | 1059 |
| 1108 | Ga0439438_028498 | 3300041405 | Bacteria | 1502 |
| 1109 | Ga0439438_084326 | 3300041405 | Bacteria | 778 |
| 1110 | Ga0439466_0076357 | 3300041411 | Bacteria | 1061 |
| 1111 | Ga0439465_0017127 | 3300041413 | Bacteria | 2261 |
| 1112 | Ga0439465_0033120 | 3300041413 | Bacteria | 1652 |
| 1113 | Ga0439465_0034315 | 3300041413 | Bacteria | 1624 |
| 1114 | Ga0439465_0069363 | 3300041413 | Bacteria | 1180 |
| 1115 | Ga0439465_0089500 | 3300041413 | Bacteria | 1051 |
| 1116 | Ga0451833_0022715 | 3300041491 | Bacteria | 1284 |
| 1117 | Ga0451833_0262634 | 3300041491 | Bacteria | 661 |
| 1118 | Ga0451833_1190930 | 3300041491 | Bacteria | 910 |
| 1119 | Ga0451835_1112531 | 3300041492 | Bacteria | 2614 |
| 1120 | Ga0451837_1671410 | 3300041494 | Bacteria | 1012 |
| 1121 | Ga0451845_0221428 | 3300041501 | Bacteria | 1697 |
| 1122 | Ga0451845_0821064 | 3300041501 | Bacteria | 2084 |
| 1123 | Ga0451853_1015694 | 3300041512 | Bacteria | 825 |
| 1124 | Ga0451853_1447831 | 3300041512 | Bacteria | 3923 |
| 1125 | Ga0451853_1733039 | 3300041512 | Bacteria | 1015 |
| 1126 | Ga0439432_007309 | 3300042006 | Bacteria | 3918 |
| 1127 | Ga0439449_0033819 | 3300042007 | Bacteria | 1904 |
| 1128 | Ga0439449_0070138 | 3300042007 | Bacteria | 1292 |
| 1129 | Ga0439449_0078029 | 3300042007 | Bacteria | 1221 |
| 1130 | Ga0439452_000009 | 3300042010 | Bacteria | 569493 |
| 1131 | Ga0439455_0047256 | 3300042012 | Bacteria | 1117 |
| 1132 | Ga0450906_003973 | 3300042145 | Bacteria | 3129 |
| 1133 | Ga0450909_041573 | 3300042185 | Bacteria | 708 |
| 1134 | Ga0439434_0154498 | 3300042435 | Bacteria | 761 |
| 1135 | Ga0439464_0004864 | 3300042439 | Bacteria | 3445 |
| 1136 | Ga0466969_0005411 | 3300044656 | Bacteria | 6794 |
| 1137 | Ga0466969_0023384 | 3300044656 | Bacteria | 3185 |
| 1138 | Ga0466972_0103414 | 3300044658 | Bacteria | 1347 |
| 1139 | Ga0466973_0065732 | 3300044659 | Bacteria | 3256 |
| 1140 | Ga0466965_0003828 | 3300044683 | Bacteria | 6643 |
| 1141 | Ga0466965_0004407 | 3300044683 | Bacteria | 6258 |
| 1142 | Ga0466965_0053833 | 3300044683 | Bacteria | 2000 |
| 1143 | Ga0466965_0162018 | 3300044683 | Bacteria | 1173 |
| 1144 | Ga0466966_0000035 | 3300044684 | Bacteria | 98928 |
| 1145 | Ga0466966_0000198 | 3300044684 | Bacteria | 40082 |
| 1146 | Ga0466966_0001168 | 3300044684 | Bacteria | 16883 |
| 1147 | Ga0466966_0068761 | 3300044684 | Bacteria | 2223 |
| 1148 | Ga0466966_0070976 | 3300044684 | Bacteria | 2183 |
| 1149 | Ga0466961_0000336 | 3300044693 | Bacteria | 30807 |
| 1150 | Ga0466961_0000612 | 3300044693 | Bacteria | 22494 |
| 1151 | Ga0466961_0051454 | 3300044693 | Bacteria | 2630 |
| 1152 | Ga0466961_0250504 | 3300044693 | Bacteria | 1087 |
| 1153 | Ga0466963_0004869 | 3300044694 | Bacteria | 7823 |
| 1154 | Ga0466963_0006557 | 3300044694 | Bacteria | 6894 |
| 1155 | Ga0466963_0021658 | 3300044694 | Bacteria | 4058 |
| 1156 | Ga0466963_0040541 | 3300044694 | Bacteria | 3052 |
| 1157 | Ga0466964_0067742 | 3300044706 | Bacteria | 1501 |
| 1158 | Ga0466964_0121287 | 3300044706 | Bacteria | 1179 |
| 1159 | Ga0466971_0001651 | 3300044719 | Bacteria | 9433 |
| 1160 | Ga0466971_0009252 | 3300044719 | Bacteria | 4305 |
| 1161 | Ga0466971_0075630 | 3300044719 | Bacteria | 1531 |
| 1162 | Ga0466970_0002904 | 3300044765 | Bacteria | 8301 |
| 1163 | Ga0466970_0105728 | 3300044765 | Bacteria | 1535 |
| 1164 | Ga0466957_0012504 | 3300044842 | Bacteria | 4912 |
| 1165 | Ga0466957_0038351 | 3300044842 | Bacteria | 2887 |
| 1166 | Ga0466957_0048030 | 3300044842 | Bacteria | 2594 |
| 1167 | Ga0466959_0026579 | 3300045049 | Bacteria | 4289 |
| 1168 | Ga0466959_0049086 | 3300045049 | Bacteria | 3100 |
| 1169 | Ga0466959_0083940 | 3300045049 | Bacteria | 2293 |
| 1170 | Ga0466959_0178919 | 3300045049 | Bacteria | 1484 |
| 1171 | Ga0451576_0178637 | 3300045051 | Bacteria | 2216 |
| 1172 | Ga0451576_0220891 | 3300045051 | Bacteria | 1978 |
| 1173 | Ga0451576_0349392 | 3300045051 | Bacteria | 1548 |
| 1174 | Ga0466958_0003881 | 3300045836 | Bacteria | 7823 |
| 1175 | Ga0466958_0030845 | 3300045836 | Bacteria | 3186 |
| 1176 | Ga0466958_0076274 | 3300045836 | Bacteria | 2058 |
| 1177 | Ga0466958_0100342 | 3300045836 | Bacteria | 1799 |
| 1178 | Ga0466958_0104893 | 3300045836 | Bacteria | 1761 |
| 1179 | Ga0466958_0141157 | 3300045836 | Bacteria | 1516 |
| 1180 | Ga0466967_0113105 | 3300045976 | Bacteria | 2497 |
| 1181 | Ga0466967_0139106 | 3300045976 | Bacteria | 2260 |
| 1182 | Ga0466967_0483430 | 3300045976 | Bacteria | 1213 |
| 1183 | Ga0466967_1497625 | 3300045976 | Bacteria | 672 |
| 1184 | Ga0495592_0000352 | 3300046454 | Bacteria | 37494 |
| 1185 | Ga0495603_0517187 | 3300046455 | Bacteria | 684 |
| 1186 | Ga0495638_0021565 | 3300046460 | Bacteria | 4242 |
| 1187 | Ga0495650_0073727 | 3300046471 | Bacteria | 1332 |
| 1188 | Ga0495650_0116891 | 3300046471 | Bacteria | 985 |
| 1189 | Ga0495580_0119663 | 3300046472 | Bacteria | 1829 |
| 1190 | Ga0495605_0000656 | 3300046474 | Bacteria | 26399 |
| 1191 | Ga0495605_0072931 | 3300046474 | Bacteria | 1618 |
| 1192 | Ga0495639_0034523 | 3300046475 | Bacteria | 2263 |
| 1193 | Ga0495585_0084023 | 3300046492 | Bacteria | 1722 |
| 1194 | Ga0495607_0036759 | 3300046501 | Bacteria | 2948 |
| 1195 | Ga0495583_0000313 | 3300046506 | Bacteria | 76539 |
| 1196 | Ga0495583_0036571 | 3300046506 | Bacteria | 2334 |
| 1197 | Ga0495606_0001364 | 3300046507 | Bacteria | 33033 |
| 1198 | Ga0495606_0001607 | 3300046507 | Bacteria | 29481 |
| 1199 | Ga0495606_0040174 | 3300046507 | Bacteria | 3146 |
| 1200 | Ga0495606_0168843 | 3300046507 | Bacteria | 1271 |
| 1201 | Ga0495610_0012498 | 3300046512 | Bacteria | 5105 |
| 1202 | Ga0495631_0000923 | 3300046518 | Bacteria | 18319 |
| 1203 | Ga0495631_0069673 | 3300046518 | Bacteria | 1521 |
| 1204 | Ga0495631_0070087 | 3300046518 | Bacteria | 1516 |
| 1205 | Ga0495632_0081758 | 3300046519 | Bacteria | 1540 |
| 1206 | Ga0495643_0002915 | 3300046522 | Bacteria | 12974 |
| 1207 | Ga0495643_0007905 | 3300046522 | Bacteria | 6792 |
| 1208 | Ga0495643_0165626 | 3300046522 | Bacteria | 1084 |
| 1209 | Ga0495586_0366471 | 3300046535 | Bacteria | 828 |
| 1210 | Ga0495598_0021406 | 3300046537 | Bacteria | 1720 |
| 1211 | Ga0495621_0006769 | 3300046539 | Bacteria | 3364 |
| 1212 | Ga0495621_0014656 | 3300046539 | Bacteria | 2485 |
| 1213 | Ga0495621_0186132 | 3300046539 | Bacteria | 831 |
| 1214 | Ga0495597_0022857 | 3300046542 | Bacteria | 2897 |
| 1215 | Ga0495597_0083477 | 3300046542 | Bacteria | 1364 |
| 1216 | Ga0495633_0200942 | 3300046558 | Bacteria | 915 |
| 1217 | Ga0495633_0202733 | 3300046558 | Bacteria | 910 |
| 1218 | Ga0495656_0000884 | 3300046615 | Bacteria | 9698 |
| 1219 | Ga0495668_0011868 | 3300046616 | Bacteria | 5193 |
| 1220 | Ga0495668_0476669 | 3300046616 | Bacteria | 687 |
| 1221 | Ga0495611_0018352 | 3300046648 | Bacteria | 3000 |
| 1222 | Ga0495625_0004259 | 3300046660 | Bacteria | 13628 |
| 1223 | Ga0495625_0171941 | 3300046660 | Bacteria | 1446 |
| 1224 | Ga0495625_0285144 | 3300046660 | Bacteria | 1061 |
| 1225 | Ga0495588_0029691 | 3300046674 | Bacteria | 2744 |
| 1226 | Ga0495647_0002237 | 3300046681 | Bacteria | 6066 |
| 1227 | Ga0495647_0090910 | 3300046681 | Bacteria | 1251 |
| 1228 | Ga0495658_0026757 | 3300046683 | Bacteria | 3095 |
| 1229 | Ga0495658_0043354 | 3300046683 | Bacteria | 2516 |
| 1230 | Ga0495658_0114107 | 3300046683 | Bacteria | 1627 |
| 1231 | Ga0495658_0137075 | 3300046683 | Bacteria | 1494 |
| 1232 | Ga0495669_0018434 | 3300046684 | Bacteria | 3002 |
| 1233 | Ga0495670_0179602 | 3300046691 | Bacteria | 1117 |
| 1234 | Ga0495670_0460544 | 3300046691 | Bacteria | 689 |
| 1235 | Ga0495671_0058269 | 3300046692 | Bacteria | 1911 |
| 1236 | Ga0495649_0000665 | 3300046694 | Bacteria | 28093 |
| 1237 | Ga0495589_0006421 | 3300046794 | Bacteria | 6206 |
| 1238 | Ga0495600_0115097 | 3300046809 | Bacteria | 1751 |
| 1239 | Ga0495600_0220855 | 3300046809 | Bacteria | 1212 |
| 1240 | Ga0495660_0062761 | 3300046810 | Bacteria | 1991 |
| 1241 | Ga0495660_0155778 | 3300046810 | Bacteria | 1124 |
| 1242 | Ga0495581_0435796 | 3300047315 | Bacteria | 764 |
| 1243 | Ga0495672_0049491 | 3300047320 | Bacteria | 2487 |
| 1244 | Ga0495676_0566133 | 3300047321 | Bacteria | 742 |
| 1245 | Ga0495680_0146953 | 3300047322 | Bacteria | 1721 |
| 1246 | Ga0495687_074300 | 3300047443 | Bacteria | 1352 |
| 1247 | Ga0495675_0157922 | 3300047444 | Bacteria | 1398 |
| 1248 | Ga0495681_0184670 | 3300047470 | Bacteria | 855 |
| 1249 | Ga0495684_0081239 | 3300047471 | Bacteria | 2460 |
| 1250 | Ga0495686_0006771 | 3300047472 | Bacteria | 8703 |
| 1251 | Ga0495686_0084127 | 3300047472 | Bacteria | 1939 |
| 1252 | Ga0495626_0110637 | 3300048091 | Bacteria | 1190 |
| 1253 | Ga0496100_0032367 | 3300048903 | Bacteria | 3261 |
| 1254 | Ga0496100_0069676 | 3300048903 | Bacteria | 2343 |
| 1255 | Ga0496100_0094754 | 3300048903 | Bacteria | 2045 |
| 1256 | Ga0496100_0109234 | 3300048903 | Bacteria | 1919 |
| 1257 | Ga0496100_0317195 | 3300048903 | Bacteria | 1170 |
| 1258 | Ga0496101_0005191 | 3300048904 | Bacteria | 8284 |
| 1259 | Ga0496101_0018036 | 3300048904 | Bacteria | 4793 |
| 1260 | Ga0496101_0072335 | 3300048904 | Bacteria | 2531 |
| 1261 | Ga0496102_0004684 | 3300048905 | Bacteria | 11571 |
| 1262 | Ga0496102_0029586 | 3300048905 | Bacteria | 4902 |
| 1263 | Ga0496102_0042628 | 3300048905 | Bacteria | 4113 |
| 1264 | Ga0496102_0141534 | 3300048905 | Bacteria | 2256 |
| 1265 | Ga0496102_0246661 | 3300048905 | Bacteria | 1684 |
| 1266 | Ga0496102_0287645 | 3300048905 | Bacteria | 1549 |
| 1267 | Ga0496102_0410713 | 3300048905 | Bacteria | 1272 |
| 1268 | Ga0496102_0491432 | 3300048905 | Bacteria | 1149 |
| 1269 | Ga0496103_0001141 | 3300048906 | Bacteria | 18434 |
| 1270 | Ga0496103_0138489 | 3300048906 | Bacteria | 1556 |
| 1271 | Ga0496104_0033621 | 3300048907 | Bacteria | 4779 |
| 1272 | Ga0496104_0149429 | 3300048907 | Bacteria | 2243 |
| 1273 | Ga0496104_0200149 | 3300048907 | Bacteria | 1909 |
| 1274 | Ga0496104_0259575 | 3300048907 | Bacteria | 1650 |
| 1275 | Ga0496104_0913166 | 3300048907 | Bacteria | 783 |
| 1276 | Ga0496105_0024032 | 3300048908 | Bacteria | 4950 |
| 1277 | Ga0496105_0024345 | 3300048908 | Bacteria | 4918 |
| 1278 | Ga0496105_0174019 | 3300048908 | Bacteria | 1764 |
| 1279 | Ga0496105_0482790 | 3300048908 | Bacteria | 975 |
| 1280 | Ga0496106_0000269 | 3300048909 | Bacteria | 36744 |
| 1281 | Ga0496106_0002032 | 3300048909 | Bacteria | 15215 |
| 1282 | Ga0496106_0082536 | 3300048909 | Bacteria | 2470 |
| 1283 | Ga0496107_0009689 | 3300048910 | Bacteria | 6678 |
| 1284 | Ga0496107_0238682 | 3300048910 | Bacteria | 1353 |
| 1285 | Ga0496108_0180946 | 3300048911 | Bacteria | 1826 |
| 1286 | Ga0496108_0571435 | 3300048911 | Bacteria | 986 |
| 1287 | Ga0496108_0574932 | 3300048911 | Bacteria | 982 |
| 1288 | Ga0496109_0008278 | 3300048912 | Bacteria | 8830 |
| 1289 | Ga0496109_0050006 | 3300048912 | Bacteria | 3808 |
| 1290 | Ga0496109_0092273 | 3300048912 | Bacteria | 2801 |
| 1291 | Ga0496110_0005584 | 3300048913 | Bacteria | 9874 |
| 1292 | Ga0496110_0195204 | 3300048913 | Bacteria | 1838 |
| 1293 | Ga0496110_0297235 | 3300048913 | Bacteria | 1471 |
| 1294 | Ga0496110_0311716 | 3300048913 | Bacteria | 1433 |
| 1295 | Ga0496110_0327576 | 3300048913 | Bacteria | 1395 |
| 1296 | Ga0496112_0017411 | 3300048915 | Bacteria | 6750 |
| 1297 | Ga0496112_0056538 | 3300048915 | Bacteria | 3862 |
| 1298 | Ga0496112_0812197 | 3300048915 | Bacteria | 860 |
| 1299 | Ga0496113_0116715 | 3300048916 | Bacteria | 2083 |
| 1300 | Ga0496113_0431101 | 3300048916 | Bacteria | 1059 |
| 1301 | Ga0496114_0008095 | 3300048917 | Bacteria | 8325 |
| 1302 | Ga0496114_0009654 | 3300048917 | Bacteria | 7665 |
| 1303 | Ga0496114_0127883 | 3300048917 | Bacteria | 2192 |
| 1304 | Ga0496114_0135507 | 3300048917 | Bacteria | 2129 |
| 1305 | Ga0496114_0496413 | 3300048917 | Bacteria | 1080 |
| 1306 | Ga0496114_0591408 | 3300048917 | Bacteria | 979 |
| 1307 | Ga0496115_0040075 | 3300048918 | Bacteria | 3722 |
| 1308 | Ga0496116_0000065 | 3300048919 | Bacteria | 265193 |
| 1309 | Ga0496116_0006609 | 3300048919 | Bacteria | 10491 |
| 1310 | Ga0496116_0011599 | 3300048919 | Bacteria | 7273 |
| 1311 | Ga0496116_0057009 | 3300048919 | Bacteria | 2557 |
| 1312 | Ga0496116_0079756 | 3300048919 | Bacteria | 2035 |
| 1313 | Ga0496116_0159381 | 3300048919 | Bacteria | 1240 |
| 1314 | Ga0496116_0162962 | 3300048919 | Bacteria | 1220 |
| 1315 | Ga0496117_0000866 | 3300048920 | Bacteria | 46705 |
| 1316 | Ga0496117_0002913 | 3300048920 | Bacteria | 20708 |
| 1317 | Ga0496117_0013051 | 3300048920 | Bacteria | 7274 |
| 1318 | Ga0496117_0050229 | 3300048920 | Bacteria | 2958 |
| 1319 | Ga0496117_0083586 | 3300048920 | Bacteria | 2086 |
| 1320 | Ga0496117_0121928 | 3300048920 | Bacteria | 1599 |
| 1321 | Ga0496117_0253991 | 3300048920 | Bacteria | 957 |
| 1322 | Ga0496117_0530204 | 3300048920 | Bacteria | 565 |
| 1323 | Ga0496118_0003707 | 3300048921 | Bacteria | 18924 |
| 1324 | Ga0496118_0008892 | 3300048921 | Bacteria | 10264 |
| 1325 | Ga0496118_0013019 | 3300048921 | Bacteria | 7913 |
| 1326 | Ga0496118_0199382 | 3300048921 | Bacteria | 1187 |
| 1327 | Ga0496118_0220971 | 3300048921 | Bacteria | 1102 |
| 1328 | Ga0496119_0007795 | 3300048922 | Bacteria | 9551 |
| 1329 | Ga0496119_0039398 | 3300048922 | Bacteria | 3037 |
| 1330 | Ga0496119_0055029 | 3300048922 | Bacteria | 2419 |
| 1331 | Ga0496119_0081512 | 3300048922 | Bacteria | 1863 |
| 1332 | Ga0496120_0008875 | 3300048923 | Bacteria | 7205 |
| 1333 | Ga0496120_0009699 | 3300048923 | Bacteria | 6793 |
| 1334 | Ga0496120_0034977 | 3300048923 | Bacteria | 3005 |
| 1335 | Ga0496120_0139655 | 3300048923 | Bacteria | 1231 |
| 1336 | Ga0496120_0162375 | 3300048923 | Bacteria | 1112 |
| 1337 | Ga0496120_0192844 | 3300048923 | Bacteria | 992 |
| 1338 | Ga0496121_0000174 | 3300048924 | Bacteria | 143186 |
| 1339 | Ga0496121_0003584 | 3300048924 | Bacteria | 21925 |
| 1340 | Ga0496121_0055728 | 3300048924 | Bacteria | 3290 |
| 1341 | Ga0496121_0056408 | 3300048924 | Bacteria | 3263 |
| 1342 | Ga0496121_0057718 | 3300048924 | Bacteria | 3215 |
| 1343 | Ga0496121_0097359 | 3300048924 | Bacteria | 2280 |
| 1344 | Ga0496121_0121803 | 3300048924 | Bacteria | 1969 |
| 1345 | Ga0496121_0149667 | 3300048924 | Bacteria | 1719 |
| 1346 | Ga0496121_0171636 | 3300048924 | Bacteria | 1574 |
| 1347 | Ga0496121_0179798 | 3300048924 | Bacteria | 1528 |
| 1348 | Ga0496121_0196712 | 3300048924 | Bacteria | 1440 |
| 1349 | Ga0496121_0396374 | 3300048924 | Bacteria | 905 |
| 1350 | Ga0496121_0618368 | 3300048924 | Bacteria | 665 |
| 1351 | Ga0496122_0011815 | 3300048925 | Bacteria | 8781 |
| 1352 | Ga0496122_0035663 | 3300048925 | Bacteria | 4040 |
| 1353 | Ga0496122_0066433 | 3300048925 | Bacteria | 2605 |
| 1354 | Ga0496122_0086269 | 3300048925 | Bacteria | 2161 |
| 1355 | Ga0496122_0132391 | 3300048925 | Bacteria | 1581 |
| 1356 | Ga0496122_0139655 | 3300048925 | Bacteria | 1518 |
| 1357 | Ga0496123_0028116 | 3300048926 | Bacteria | 4170 |
| 1358 | Ga0496123_0042384 | 3300048926 | Bacteria | 3141 |
| 1359 | Ga0496123_0081801 | 3300048926 | Bacteria | 1960 |
| 1360 | Ga0496123_0230474 | 3300048926 | Bacteria | 927 |
| 1361 | Ga0496124_0000200 | 3300048927 | Bacteria | 117910 |
| 1362 | Ga0496124_0001776 | 3300048927 | Bacteria | 29988 |
| 1363 | Ga0496124_0003927 | 3300048927 | Bacteria | 17758 |
| 1364 | Ga0496124_0030008 | 3300048927 | Bacteria | 4835 |
| 1365 | Ga0496124_0047267 | 3300048927 | Bacteria | 3682 |
| 1366 | Ga0496124_0069789 | 3300048927 | Bacteria | 2916 |
| 1367 | Ga0496124_0071883 | 3300048927 | Bacteria | 2866 |
| 1368 | Ga0496124_0258095 | 3300048927 | Bacteria | 1284 |
| 1369 | Ga0496124_0295942 | 3300048927 | Bacteria | 1172 |
| 1370 | Ga0496125_0000048 | 3300048928 | Bacteria | 290651 |
| 1371 | Ga0496125_0000115 | 3300048928 | Bacteria | 181994 |
| 1372 | Ga0496125_0000982 | 3300048928 | Bacteria | 44569 |
| 1373 | Ga0496125_0024616 | 3300048928 | Bacteria | 5530 |
| 1374 | Ga0496125_0067409 | 3300048928 | Bacteria | 2820 |
| 1375 | Ga0496125_0077925 | 3300048928 | Bacteria | 2551 |
| 1376 | Ga0496125_0107652 | 3300048928 | Bacteria | 2030 |
| 1377 | Ga0496125_0186218 | 3300048928 | Bacteria | 1376 |
| 1378 | Ga0496125_0187175 | 3300048928 | Bacteria | 1371 |
| 1379 | Ga0496126_0019281 | 3300048929 | Bacteria | 6720 |
| 1380 | Ga0496126_0088806 | 3300048929 | Bacteria | 2722 |
| 1381 | Ga0496126_0127413 | 3300048929 | Bacteria | 2202 |
| 1382 | Ga0496126_0479018 | 3300048929 | Bacteria | 997 |
| 1383 | Ga0496126_0877422 | 3300048929 | Bacteria | 682 |
| 1384 | Ga0501298_024284 | 3300049521 | Bacteria | 1154 |
| 1385 | Ga0501031_0056043 | 3300049568 | Bacteria | 2568 |
| 1386 | Ga0501031_0280265 | 3300049568 | Bacteria | 1081 |
| 1387 | Ga0501031_0310805 | 3300049568 | Bacteria | 1021 |
| 1388 | Ga0501031_0538050 | 3300049568 | Bacteria | 753 |
| 1389 | Ga0501032_0000023 | 3300049569 | Bacteria | 146435 |
| 1390 | Ga0501032_0035515 | 3300049569 | Bacteria | 3407 |
| 1391 | Ga0501032_0042316 | 3300049569 | Bacteria | 3090 |
| 1392 | Ga0501032_0158743 | 3300049569 | Bacteria | 1485 |
| 1393 | Ga0501032_0231499 | 3300049569 | Bacteria | 1201 |
| 1394 | Ga0501032_0284598 | 3300049569 | Bacteria | 1070 |
| 1395 | Ga0501033_0000104 | 3300049570 | Bacteria | 81029 |
| 1396 | Ga0501033_0001017 | 3300049570 | Bacteria | 25466 |
| 1397 | Ga0501033_0038718 | 3300049570 | Bacteria | 3562 |
| 1398 | Ga0501033_0039506 | 3300049570 | Bacteria | 3524 |
| 1399 | Ga0501033_0063901 | 3300049570 | Bacteria | 2709 |
| 1400 | Ga0501033_0103823 | 3300049570 | Bacteria | 2072 |
| 1401 | Ga0501033_0211047 | 3300049570 | Bacteria | 1384 |
| 1402 | Ga0501033_0289624 | 3300049570 | Bacteria | 1155 |
| 1403 | Ga0501034_0000116 | 3300049571 | Bacteria | 146442 |
| 1404 | Ga0501034_0000162 | 3300049571 | Bacteria | 125834 |
| 1405 | Ga0501034_0083017 | 3300049571 | Bacteria | 3206 |
| 1406 | Ga0501034_0097881 | 3300049571 | Bacteria | 2929 |
| 1407 | Ga0501034_0183645 | 3300049571 | Bacteria | 2055 |
| 1408 | Ga0501034_0300812 | 3300049571 | Bacteria | 1541 |
| 1409 | Ga0501034_0493449 | 3300049571 | Bacteria | 1139 |
| 1410 | Ga0501034_0902885 | 3300049571 | Bacteria | 771 |
| 1411 | Ga0501034_1247817 | 3300049571 | Bacteria | 621 |
| 1412 | Ga0501036_0000015 | 3300049572 | Bacteria | 146442 |
| 1413 | Ga0501036_0227988 | 3300049572 | Bacteria | 1564 |
| 1414 | Ga0501036_0385722 | 3300049572 | Bacteria | 1169 |
| 1415 | Ga0501036_0541326 | 3300049572 | Bacteria | 968 |
| 1416 | Ga0501037_0000023 | 3300049573 | Bacteria | 146542 |
| 1417 | Ga0501037_0000035 | 3300049573 | Bacteria | 125589 |
| 1418 | Ga0501037_0155691 | 3300049573 | Bacteria | 1631 |
| 1419 | Ga0501037_0234782 | 3300049573 | Bacteria | 1287 |
| 1420 | Ga0501038_0000025 | 3300049574 | Bacteria | 146542 |
| 1421 | Ga0501038_0023128 | 3300049574 | Bacteria | 5561 |
| 1422 | Ga0501038_0368599 | 3300049574 | Bacteria | 1116 |
| 1423 | Ga0501038_0522109 | 3300049574 | Bacteria | 906 |
| 1424 | Ga0501039_0000037 | 3300049575 | Bacteria | 122286 |
| 1425 | Ga0501039_0159654 | 3300049575 | Bacteria | 1772 |
| 1426 | Ga0501039_0207273 | 3300049575 | Bacteria | 1541 |
| 1427 | Ga0501040_0006421 | 3300049576 | Bacteria | 7635 |
| 1428 | Ga0501041_0472878 | 3300049577 | Bacteria | 796 |
| 1429 | Ga0501042_0317510 | 3300049578 | Bacteria | 1126 |
| 1430 | Ga0501043_0000031 | 3300049579 | Bacteria | 140707 |
| 1431 | Ga0501043_0000070 | 3300049579 | Bacteria | 89839 |
| 1432 | Ga0501043_0000071 | 3300049579 | Bacteria | 89105 |
| 1433 | Ga0501043_0023763 | 3300049579 | Bacteria | 4808 |
| 1434 | Ga0501043_0085371 | 3300049579 | Bacteria | 2480 |
| 1435 | Ga0501043_0326502 | 3300049579 | Bacteria | 1169 |
| 1436 | Ga0501043_0412182 | 3300049579 | Bacteria | 1020 |
| 1437 | Ga0501046_0000311 | 3300049580 | Bacteria | 48905 |
| 1438 | Ga0501046_0029834 | 3300049580 | Bacteria | 4431 |
| 1439 | Ga0501046_0144281 | 3300049580 | Bacteria | 1799 |
| 1440 | Ga0501046_0395767 | 3300049580 | Bacteria | 998 |
| 1441 | Ga0501046_0530893 | 3300049580 | Bacteria | 840 |
| 1442 | Ga0501047_0000087 | 3300049581 | Bacteria | 117516 |
| 1443 | Ga0501047_0002287 | 3300049581 | Bacteria | 18325 |
| 1444 | Ga0501047_0022828 | 3300049581 | Bacteria | 6007 |
| 1445 | Ga0501047_0078456 | 3300049581 | Bacteria | 3175 |
| 1446 | Ga0501047_0202116 | 3300049581 | Bacteria | 1848 |
| 1447 | Ga0501047_0220841 | 3300049581 | Bacteria | 1751 |
| 1448 | Ga0501047_0297357 | 3300049581 | Bacteria | 1457 |
| 1449 | Ga0501047_0311468 | 3300049581 | Bacteria | 1415 |
| 1450 | Ga0501048_0000226 | 3300049582 | Bacteria | 37156 |
| 1451 | Ga0501048_0557492 | 3300049582 | Bacteria | 822 |
| 1452 | Ga0501048_0564249 | 3300049582 | Bacteria | 817 |
| 1453 | Ga0501067_0015101 | 3300049583 | Bacteria | 4273 |
| 1454 | Ga0501068_0005004 | 3300049584 | Bacteria | 7218 |
| 1455 | Ga0501068_0328135 | 3300049584 | Bacteria | 982 |
| 1456 | Ga0501069_0000136 | 3300049585 | Bacteria | 32144 |
| 1457 | Ga0501069_0049438 | 3300049585 | Bacteria | 2337 |
| 1458 | Ga0501069_0232197 | 3300049585 | Bacteria | 1074 |
| 1459 | Ga0501070_0000202 | 3300049586 | Bacteria | 55898 |
| 1460 | Ga0501070_0000422 | 3300049586 | Bacteria | 38458 |
| 1461 | Ga0501070_0006568 | 3300049586 | Bacteria | 9898 |
| 1462 | Ga0501070_0010179 | 3300049586 | Bacteria | 7960 |
| 1463 | Ga0501070_0022526 | 3300049586 | Bacteria | 5277 |
| 1464 | Ga0501070_0060029 | 3300049586 | Bacteria | 3152 |
| 1465 | Ga0501070_0077138 | 3300049586 | Bacteria | 2758 |
| 1466 | Ga0501070_0440136 | 3300049586 | Bacteria | 1052 |
| 1467 | Ga0501071_0001465 | 3300049587 | Bacteria | 13695 |
| 1468 | Ga0501071_0067873 | 3300049587 | Bacteria | 2594 |
| 1469 | Ga0501072_0466182 | 3300049588 | Bacteria | 1000 |
| 1470 | Ga0501073_0027594 | 3300049589 | Bacteria | 4060 |
| 1471 | Ga0501073_0323530 | 3300049589 | Bacteria | 1064 |
| 1472 | Ga0501074_0000024 | 3300049590 | Bacteria | 68886 |
| 1473 | Ga0501074_0157201 | 3300049590 | Bacteria | 1624 |
| 1474 | Ga0501074_0534348 | 3300049590 | Bacteria | 830 |
| 1475 | Ga0501076_0242941 | 3300049592 | Bacteria | 1473 |
| 1476 | Ga0501077_0022616 | 3300049593 | Bacteria | 3983 |
| 1477 | Ga0501225_0065977 | 3300049705 | Bacteria | 1023 |
| 1478 | Ga0501080_0000429 | 3300049742 | Bacteria | 32423 |
| 1479 | Ga0501080_0000963 | 3300049742 | Bacteria | 23558 |
| 1480 | Ga0501080_0265394 | 3300049742 | Bacteria | 1563 |
| 1481 | Ga0501080_0503803 | 3300049742 | Bacteria | 1082 |
| 1482 | Ga0501083_0000200 | 3300049744 | Bacteria | 38409 |
| 1483 | Ga0501083_0010111 | 3300049744 | Bacteria | 6647 |
| 1484 | Ga0501083_0110838 | 3300049744 | Bacteria | 1805 |
| 1485 | Ga0501241_037925 | 3300049758 | Bacteria | 927 |
| 1486 | Ga0501265_000721 | 3300049762 | Bacteria | 3618 |
| 1487 | Ga0501280_001590 | 3300049776 | Bacteria | 4078 |
| 1488 | Ga0501281_02092 | 3300049777 | Bacteria | 1484 |
| 1489 | Ga0501035_0000036 | 3300049822 | Bacteria | 165008 |
| 1490 | Ga0501035_0000074 | 3300049822 | Bacteria | 122269 |
| 1491 | Ga0501035_0000723 | 3300049822 | Bacteria | 35738 |
| 1492 | Ga0501035_0002648 | 3300049822 | Bacteria | 17423 |
| 1493 | Ga0501035_0008594 | 3300049822 | Bacteria | 9501 |
| 1494 | Ga0501035_0032962 | 3300049822 | Bacteria | 4711 |
| 1495 | Ga0501035_0087522 | 3300049822 | Bacteria | 2745 |
| 1496 | Ga0501035_0125755 | 3300049822 | Bacteria | 2238 |
| 1497 | Ga0501035_0159957 | 3300049822 | Bacteria | 1950 |
| 1498 | Ga0501044_0000011 | 3300049823 | Bacteria | 257385 |
| 1499 | Ga0501044_0000069 | 3300049823 | Bacteria | 125974 |
| 1500 | Ga0501044_0004538 | 3300049823 | Bacteria | 15525 |
| 1501 | Ga0501044_0008293 | 3300049823 | Bacteria | 11391 |
| 1502 | Ga0501044_0034203 | 3300049823 | Bacteria | 5332 |
| 1503 | Ga0501044_0034206 | 3300049823 | Bacteria | 5332 |
| 1504 | Ga0501044_0039584 | 3300049823 | Bacteria | 4917 |
| 1505 | Ga0501044_0076189 | 3300049823 | Bacteria | 3405 |
| 1506 | Ga0501044_0079139 | 3300049823 | Bacteria | 3331 |
| 1507 | Ga0501044_0175065 | 3300049823 | Bacteria | 2115 |
| 1508 | Ga0501044_0176365 | 3300049823 | Bacteria | 2106 |
| 1509 | Ga0501044_0250617 | 3300049823 | Bacteria | 1712 |
| 1510 | Ga0501045_0101064 | 3300049824 | Bacteria | 2134 |
| 1511 | Ga0501045_0489401 | 3300049824 | Bacteria | 914 |
| 1512 | nmdc:mga03683_486071_c1 | 3300050489 | Bacteria | 597 |
| 1513 | nmdc:mga03n38_76581_c1 | 3300050490 | Bacteria | 1561 |
| 1514 | nmdc:mga03n38_8598_c1 | 3300050490 | Bacteria | 1343 |
| 1515 | nmdc:mga00v17_102948_c1 | 3300050491 | Bacteria | 1804 |
| 1516 | nmdc:mga00v17_11078_c1 | 3300050491 | Bacteria | 4947 |
| 1517 | nmdc:mga00v17_20863_c1 | 3300050491 | Bacteria | 3759 |
| 1518 | nmdc:mga00v17_594075_c1 | 3300050491 | Bacteria | 714 |
| 1519 | nmdc:mga0yw44_137179_c1 | 3300050492 | Bacteria | 1588 |
| 1520 | nmdc:mga0yw44_17647_c1 | 3300050492 | Bacteria | 3889 |
| 1521 | nmdc:mga0yw44_2420_c1 | 3300050492 | Bacteria | 7946 |
| 1522 | nmdc:mga0yw44_26588_c1 | 3300050492 | Bacteria | 3307 |
| 1523 | nmdc:mga0k408_11975_c1 | 3300050493 | Bacteria | 4732 |
| 1524 | nmdc:mga0k408_13145_c1 | 3300050493 | Bacteria | 4535 |
| 1525 | nmdc:mga0k408_13887_c1 | 3300050493 | Bacteria | 3763 |
| 1526 | nmdc:mga0k408_319783_c1 | 3300050493 | Bacteria | 926 |
| 1527 | nmdc:mga0k408_34788_c1 | 3300050493 | Bacteria | 2885 |
| 1528 | nmdc:mga06z11_1261_c1 | 3300050494 | Bacteria | 9369 |
| 1529 | nmdc:mga06z11_14948_c1 | 3300050494 | Bacteria | 3452 |
| 1530 | nmdc:mga06z11_158670_c1 | 3300050494 | Bacteria | 1291 |
| 1531 | nmdc:mga06z11_247352_c1 | 3300050494 | Bacteria | 1049 |
| 1532 | nmdc:mga06z11_35364_c1 | 3300050494 | Bacteria | 2458 |
| 1533 | nmdc:mga04h51_153595_c1 | 3300050495 | Bacteria | 881 |
| 1534 | nmdc:mga04h51_344332_c1 | 3300050495 | Bacteria | 615 |
| 1535 | nmdc:mga04h51_55610_c1 | 3300050495 | Bacteria | 1341 |
| 1536 | nmdc:mga07m45_104832_c1 | 3300050496 | Bacteria | 1626 |
| 1537 | nmdc:mga07m45_10536_c1 | 3300050496 | Bacteria | 1908 |
| 1538 | nmdc:mga07m45_16474_c2 | 3300050496 | Bacteria | 2724 |
| 1539 | nmdc:mga07m45_93500_c1 | 3300050496 | Bacteria | 1724 |
| 1540 | nmdc:mga05p37_270609_c1 | 3300050507 | Bacteria | 2030 |
| 1541 | nmdc:mga0qj67_398601_c1 | 3300050509 | Bacteria | 1110 |
| 1542 | nmdc:mga06r32_1237570_c1 | 3300050510 | Bacteria | 692 |
| 1543 | nmdc:mga06r32_989868_c1 | 3300050510 | Bacteria | 794 |
| 1544 | nmdc:mga08y16_103169_c1 | 3300050511 | Bacteria | 2969 |
| 1545 | nmdc:mga08y16_414253_c1 | 3300050511 | Bacteria | 1378 |
| 1546 | nmdc:mga0n895_464316_c1 | 3300050512 | Bacteria | 1277 |
| 1547 | nmdc:mga0n895_577473_c1 | 3300050512 | Bacteria | 1128 |
| 1548 | nmdc:mga0rr50_511315_c1 | 3300050513 | Bacteria | 1021 |
| 1549 | nmdc:mga0sz30_11929_c1 | 3300050516 | Bacteria | 3369 |
| 1550 | nmdc:mga0sz30_7432_c2 | 3300050516 | Bacteria | 3344 |
| 1551 | Ga0495601_0031506 | 3300053077 | Bacteria | 3296 |
| 1552 | Ga0500635_0000072 | 3300053080 | Bacteria | 66335 |
| 1553 | Ga0495595_0082470 | 3300053084 | Bacteria | 1534 |
| 1554 | Ga0495619_0097152 | 3300053085 | Bacteria | 2001 |
| 1555 | Ga0500578_0183781 | 3300053086 | Bacteria | 1287 |
| 1556 | Ga0500651_0241138 | 3300053093 | Bacteria | 1054 |
| 1557 | Ga0500660_139892 | 3300053100 | Bacteria | 964 |
| 1558 | Ga0500557_001166 | 3300053105 | Bacteria | 4086 |
| 1559 | Ga0500569_046751 | 3300053109 | Bacteria | 1291 |
| 1560 | Ga0500594_0006266 | 3300053118 | Bacteria | 2669 |
| 1561 | Ga0500618_000008 | 3300053125 | Bacteria | 214678 |
| 1562 | Ga0500618_003329 | 3300053125 | Bacteria | 5557 |
| 1563 | Ga0500618_011676 | 3300053125 | Bacteria | 2322 |
| 1564 | Ga0500628_038589 | 3300053129 | Bacteria | 1079 |
| 1565 | Ga0500658_0000458 | 3300053134 | Bacteria | 17401 |
| 1566 | Ga0500658_0024481 | 3300053134 | Bacteria | 2313 |
| 1567 | Ga0500658_0221890 | 3300053134 | Bacteria | 867 |
| 1568 | Ga0500568_0000019 | 3300053139 | Bacteria | 195696 |
| 1569 | Ga0500568_0000152 | 3300053139 | Bacteria | 60089 |
| 1570 | Ga0500568_0000695 | 3300053139 | Bacteria | 24132 |
| 1571 | Ga0500577_0001225 | 3300053142 | Bacteria | 6566 |
| 1572 | Ga0500604_0065295 | 3300053151 | Bacteria | 1151 |
| 1573 | Ga0500616_0005593 | 3300053153 | Bacteria | 8487 |
| 1574 | Ga0500616_0012753 | 3300053153 | Bacteria | 4906 |
| 1575 | Ga0500616_0140514 | 3300053153 | Bacteria | 1129 |
| 1576 | Ga0500620_000018 | 3300053155 | Bacteria | 33396 |
| 1577 | Ga0500622_0000185 | 3300053156 | Bacteria | 66073 |
| 1578 | Ga0500624_003879 | 3300053157 | Bacteria | 1961 |
| 1579 | Ga0500633_0019408 | 3300053160 | Bacteria | 2032 |
| 1580 | Ga0500634_0000001 | 3300053161 | Bacteria | 258285 |
| 1581 | Ga0500634_0011993 | 3300053161 | Bacteria | 4497 |
| 1582 | Ga0500636_0077761 | 3300053177 | Bacteria | 1916 |
| 1583 | Ga0500636_0204139 | 3300053177 | Bacteria | 1043 |
| 1584 | Ga0501084_0151587 | 3300054114 | Bacteria | 1954 |
| 1585 | Ga0501084_0237865 | 3300054114 | Bacteria | 1537 |
| 1586 | Ga0500661_011828 | 3300055283 | Bacteria | 1578 |
| 1587 | Ga0501082_0082917 | 3300060353 | Bacteria | 2766 |
| 1588 | Ga0501082_0732848 | 3300060353 | Bacteria | 865 |
| 1589 | Ga0501082_0852826 | 3300060353 | Bacteria | 797 |
| 1590 | Ga0466962_0004499 | 3300061719 | Bacteria | 6682 |
| 1591 | Ga0466962_0007394 | 3300061719 | Bacteria | 5269 |
| 1592 | Ga0466962_0018487 | 3300061719 | Bacteria | 3352 |
| 1593 | Ga0466962_0095510 | 3300061719 | Bacteria | 1425 |
| 1594 | Ga0466962_0129463 | 3300061719 | Bacteria | 1219 |
| 1595 | Ga0530510_0872702 | 3300061734 | Bacteria | 687 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048924 | Ga0496121_0196712 | Ga0496121_0196712_928_1419 | 159 |
| 2 | 3300048919 | Ga0496116_0057009 | Ga0496116_0057009_2041_2532 | 160 |
| 3 | 3300048920 | Ga0496117_0530204 | Ga0496117_0530204_15_506 | 160 |
| 4 | 3300050489 | nmdc:mga03683_486071_c1 | nmdc:mga03683_486071_c1_76_585 | 167 |
| 5 | 3300050495 | nmdc:mga04h51_344332_c1 | nmdc:mga04h51_344332_c1_88_597 | 167 |
| 6 | 3300041411 | Ga0439466_0076357 | Ga0439466_0076357_27_569 | 176 |
| 7 | 3300046691 | Ga0495670_0460544 | Ga0495670_0460544_14_556 | 176 |
| 8 | 3300049570 | Ga0501033_0103823 | Ga0501033_0103823_39_581 | 176 |
| 9 | 3300049571 | Ga0501034_1247817 | Ga0501034_1247817_69_611 | 176 |
| 10 | iso_pu_bacteria | 2924718760 | 2924719745 | 177 |
| 11 | 3300005334 | Ga0068869_100362236 | Ga0068869_1003622362 | 180 |
| 12 | 3300005337 | Ga0070682_100740513 | Ga0070682_1007405131 | 180 |
| 13 | 3300005354 | Ga0070675_100262046 | Ga0070675_1002620462 | 180 |
| 14 | 3300005367 | Ga0070667_100656999 | Ga0070667_1006569991 | 180 |
| 15 | 3300005459 | Ga0068867_100309068 | Ga0068867_1003090682 | 180 |
| 16 | 3300005548 | Ga0070665_101445313 | Ga0070665_1014453131 | 180 |
| 17 | 3300005616 | Ga0068852_100268784 | Ga0068852_1002687842 | 180 |
| 18 | 3300005617 | Ga0068859_101244512 | Ga0068859_1012445121 | 180 |
| 19 | 3300005844 | Ga0068862_100437467 | Ga0068862_1004374672 | 180 |
| 20 | 3300006237 | Ga0097621_100243818 | Ga0097621_1002438182 | 180 |
| 21 | 3300006358 | Ga0068871_100141240 | Ga0068871_1001412402 | 180 |
| 22 | 3300006931 | Ga0097620_101244282 | Ga0097620_1012442822 | 180 |
| 23 | 3300010375 | Ga0105239_11835747 | Ga0105239_118357472 | 180 |
| 24 | 3300013297 | Ga0157378_10175059 | Ga0157378_101750594 | 180 |
| 25 | 3300017792 | Ga0163161_10536561 | Ga0163161_105365612 | 180 |
| 26 | 3300025940 | Ga0207691_10151848 | Ga0207691_101518482 | 180 |
| 27 | 3300026089 | Ga0207648_10277978 | Ga0207648_102779782 | 180 |
| 28 | 3300028380 | Ga0268265_10514039 | Ga0268265_105140392 | 180 |
| 29 | 3300045976 | Ga0466967_1497625 | Ga0466967_1497625_32_589 | 181 |
| 30 | 3300046542 | Ga0495597_0083477 | Ga0495597_0083477_784_1341 | 181 |
| 31 | 3300013306 | Ga0163162_10696673 | Ga0163162_106966732 | 182 |
| 32 | 3300014325 | Ga0163163_10780138 | Ga0163163_107801381 | 182 |
| 33 | 3300060353 | Ga0501082_0732848 | Ga0501082_0732848_226_813 | 182 |
| 34 | 3300046683 | Ga0495658_0137075 | Ga0495658_0137075_27_602 | 186 |
| 35 | 3300049579 | Ga0501043_0326502 | Ga0501043_0326502_476_1051 | 186 |
| 36 | 3300049742 | Ga0501080_0503803 | Ga0501080_0503803_61_636 | 186 |
| 37 | 3300049823 | Ga0501044_0250617 | Ga0501044_0250617_100_675 | 186 |
| 38 | 3300050512 | nmdc:mga0n895_577473_c1 | nmdc:mga0n895_577473_c1_37_606 | 186 |
| 39 | iso_pu_bacteria | 8004703790 | 8004708508 | 186 |
| 40 | 3300005347 | Ga0070668_100429523 | Ga0070668_1004295232 | 187 |
| 41 | 3300005356 | Ga0070674_100230532 | Ga0070674_1002305322 | 187 |
| 42 | 3300005459 | Ga0068867_100898180 | Ga0068867_1008981802 | 187 |
| 43 | 3300005844 | Ga0068862_100113780 | Ga0068862_1001137802 | 187 |
| 44 | 3300005981 | Ga0081538_10016898 | Ga0081538_100168984 | 187 |
| 45 | 3300006847 | Ga0075431_101186836 | Ga0075431_1011868361 | 187 |
| 46 | 3300009147 | Ga0114129_10742727 | Ga0114129_107427271 | 187 |
| 47 | 3300025937 | Ga0207669_10100124 | Ga0207669_101001242 | 187 |
| 48 | 3300025938 | Ga0207704_10133173 | Ga0207704_101331732 | 187 |
| 49 | 3300026118 | Ga0207675_100034412 | Ga0207675_1000344122 | 187 |
| 50 | 3300045976 | Ga0466967_0113105 | Ga0466967_0113105_32_607 | 187 |
| 51 | 3300048924 | Ga0496121_0121803 | Ga0496121_0121803_1368_1946 | 187 |
| 52 | 3300048925 | Ga0496122_0132391 | Ga0496122_0132391_522_1100 | 187 |
| 53 | 3300048928 | Ga0496125_0000048 | Ga0496125_0000048_78668_79246 | 187 |
| 54 | 3300050507 | nmdc:mga05p37_270609_c1 | nmdc:mga05p37_270609_c1_896_1465 | 187 |
| 55 | 3300050510 | nmdc:mga06r32_1237570_c1 | nmdc:mga06r32_1237570_c1_102_671 | 187 |
| 56 | 3300050510 | nmdc:mga06r32_989868_c1 | nmdc:mga06r32_989868_c1_52_621 | 187 |
| 57 | 3300053142 | Ga0500577_0001225 | Ga0500577_0001225_1822_2400 | 187 |
| 58 | iso_pu_bacteria | 2643221629 | 2644169081 | 187 |
| 59 | iso_pu_bacteria | 2643221662 | 2644350493 | 187 |
| 60 | iso_pu_bacteria | 2842333319 | 2842338104 | 187 |
| 61 | iso_pu_bacteria | 2885350715 | 2885356007 | 187 |
| 62 | iso_pu_bacteria | 2888343758 | 2888346455 | 187 |
| 63 | 3300005367 | Ga0070667_101279750 | Ga0070667_1012797501 | 188 |
| 64 | 3300005455 | Ga0070663_100135555 | Ga0070663_1001355552 | 188 |
| 65 | 3300006051 | Ga0075364_10294932 | Ga0075364_102949321 | 188 |
| 66 | 3300037853 | Ga0436364_0698594 | Ga0436364_0698594_1396_2004 | 188 |
| 67 | 3300039450 | Ga0436363_0482532 | Ga0436363_0482532_3815_4423 | 188 |
| 68 | 3300048919 | Ga0496116_0011599 | Ga0496116_0011599_3520_4101 | 188 |
| 69 | 3300048928 | Ga0496125_0024616 | Ga0496125_0024616_4216_4797 | 188 |
| 70 | 3300009147 | Ga0114129_10487396 | Ga0114129_104873962 | 189 |
| 71 | 3300046681 | Ga0495647_0002237 | Ga0495647_0002237_324_908 | 189 |
| 72 | 3300006353 | Ga0075370_10216355 | Ga0075370_102163552 | 190 |
| 73 | 3300050491 | nmdc:mga00v17_102948_c1 | nmdc:mga00v17_102948_c1_714_1292 | 190 |
| 74 | 3300050493 | nmdc:mga0k408_13145_c1 | nmdc:mga0k408_13145_c1_1902_2480 | 190 |
| 75 | 3300050494 | nmdc:mga06z11_158670_c1 | nmdc:mga06z11_158670_c1_540_1118 | 190 |
| 76 | 3300050496 | nmdc:mga07m45_104832_c1 | nmdc:mga07m45_104832_c1_515_1093 | 190 |
| 77 | 3300031456 | Ga0307513_10551724 | Ga0307513_105517242 | 191 |
| 78 | 3300031548 | Ga0307408_100207039 | Ga0307408_1002070392 | 191 |
| 79 | 3300031901 | Ga0307406_11007418 | Ga0307406_110074181 | 191 |
| 80 | 3300032004 | Ga0307414_10218193 | Ga0307414_102181932 | 191 |
| 81 | 3300032004 | Ga0307414_10659293 | Ga0307414_106592932 | 191 |
| 82 | 3300032005 | Ga0307411_10142911 | Ga0307411_101429112 | 191 |
| 83 | 3300032005 | Ga0307411_10527103 | Ga0307411_105271032 | 191 |
| 84 | 3300035398 | Ga0316574_0459332 | Ga0316574_0459332_16_612 | 191 |
| 85 | 3300035695 | Ga0373927_0706812 | Ga0373927_0706812_17_598 | 191 |
| 86 | 3300041413 | Ga0439465_0033120 | Ga0439465_0033120_671_1252 | 191 |
| 87 | 3300042435 | Ga0439434_0154498 | Ga0439434_0154498_160_741 | 191 |
| 88 | 3300048911 | Ga0496108_0180946 | Ga0496108_0180946_552_1133 | 191 |
| 89 | 3300050509 | nmdc:mga0qj67_398601_c1 | nmdc:mga0qj67_398601_c1_518_1099 | 191 |
| 90 | iso_pu_bacteria | 2929199973 | 2929200422 | 192 |
| 91 | iso_pu_bacteria | 8055909800 | 8055914738 | 192 |
| 92 | iso_pu_bacteria | 2643221591 | 2643966274 | 193 |
| 93 | 3300035724 | Ga0373933_0000057 | Ga0373933_0000057_53625_54224 | 194 |
| 94 | 3300005455 | Ga0070663_100064129 | Ga0070663_1000641293 | 195 |
| 95 | 3300005614 | Ga0068856_100705153 | Ga0068856_1007051532 | 195 |
| 96 | 3300053139 | Ga0500568_0000019 | Ga0500568_0000019_150256_150855 | 195 |
| 97 | 3300053157 | Ga0500624_003879 | Ga0500624_003879_1134_1736 | 195 |
| 98 | 3300053161 | Ga0500634_0000001 | Ga0500634_0000001_80900_81502 | 195 |
| 99 | 3300053161 | Ga0500634_0011993 | Ga0500634_0011993_1051_1653 | 195 |
| 100 | iso_pu_bacteria | 2509276021 | 2509385856 | 195 |
| 101 | iso_pu_bacteria | 2509276033 | 2509448086 | 195 |
| 102 | iso_pu_bacteria | 2510065019 | 2510136842 | 195 |
| 103 | iso_pu_bacteria | 2510461076 | 2510899868 | 195 |
| 104 | iso_pu_bacteria | 2510461076 | 2510900464 | 195 |
| 105 | iso_pu_bacteria | 2510917030 | 2511196474 | 195 |
| 106 | iso_pu_bacteria | 2513237084 | 2513569749 | 195 |
| 107 | iso_pu_bacteria | 2513237085 | 2513576601 | 195 |
| 108 | iso_pu_bacteria | 2513237093 | 2513631722 | 195 |
| 109 | iso_pu_bacteria | 2513237103 | 2513713427 | 195 |
| 110 | iso_pu_bacteria | 2513237144 | 2513911663 | 195 |
| 111 | iso_pu_bacteria | 2513237159 | 2513996353 | 195 |
| 112 | iso_pu_bacteria | 2513237162 | 2514021327 | 195 |
| 113 | iso_pu_bacteria | 2515075009 | 2515115426 | 195 |
| 114 | iso_pu_bacteria | 2515154113 | 2515636152 | 195 |
| 115 | iso_pu_bacteria | 2515154114 | 2515644691 | 195 |
| 116 | iso_pu_bacteria | 2515154116 | 2515657972 | 195 |
| 117 | iso_pu_bacteria | 2515154134 | 2515742279 | 195 |
| 118 | iso_pu_bacteria | 2516653077 | 2517041557 | 195 |
| 119 | iso_pu_bacteria | 2516653085 | 2517080833 | 195 |
| 120 | iso_pu_bacteria | 2517093000 | 2517099031 | 195 |
| 121 | iso_pu_bacteria | 2517287029 | 2517410734 | 195 |
| 122 | iso_pu_bacteria | 2519899620 | 2520380666 | 195 |
| 123 | iso_pu_bacteria | 2529292951 | 2530644398 | 195 |
| 124 | iso_pu_bacteria | 2582581298 | 2585221685 | 195 |
| 125 | iso_pu_bacteria | 2585427526 | 2585524512 | 195 |
| 126 | iso_pu_bacteria | 2585427528 | 2585539095 | 195 |
| 127 | iso_pu_bacteria | 2585427529 | 2585544145 | 195 |
| 128 | iso_pu_bacteria | 2585427593 | 2585837045 | 195 |
| 129 | iso_pu_bacteria | 2599185170 | 2599414608 | 195 |
| 130 | iso_pu_bacteria | 2615840624 | 2616295091 | 195 |
| 131 | iso_pu_bacteria | 2718217882 | 2719183570 | 195 |
| 132 | iso_pu_bacteria | 2718217927 | 2719388323 | 195 |
| 133 | iso_pu_bacteria | 2718217997 | 2719667927 | 195 |
| 134 | iso_pu_bacteria | 2718218009 | 2719728011 | 195 |
| 135 | iso_pu_bacteria | 2718218199 | 2720494690 | 195 |
| 136 | iso_pu_bacteria | 2718218232 | 2720611026 | 195 |
| 137 | iso_pu_bacteria | 2718218233 | 2720616194 | 195 |
| 138 | iso_pu_bacteria | 2718218235 | 2720629275 | 195 |
| 139 | iso_pu_bacteria | 2718218269 | 2720771847 | 195 |
| 140 | iso_pu_bacteria | 2718218363 | 2721144872 | 195 |
| 141 | iso_pu_bacteria | 2718218365 | 2721155611 | 195 |
| 142 | iso_pu_bacteria | 2718218366 | 2721166959 | 195 |
| 143 | iso_pu_bacteria | 2718218423 | 2721402946 | 195 |
| 144 | iso_pu_bacteria | 2721755514 | 2722837937 | 195 |
| 145 | iso_pu_bacteria | 2721755556 | 2723029251 | 195 |
| 146 | iso_pu_bacteria | 2721755684 | 2723562884 | 195 |
| 147 | iso_pu_bacteria | 2721755685 | 2723570874 | 195 |
| 148 | iso_pu_bacteria | 2721755809 | 2724035303 | 195 |
| 149 | iso_pu_bacteria | 2721755810 | 2724042205 | 195 |
| 150 | iso_pu_bacteria | 2721755819 | 2724086667 | 195 |
| 151 | iso_pu_bacteria | 2721755822 | 2724106825 | 195 |
| 152 | iso_pu_bacteria | 2721755823 | 2724107633 | 195 |
| 153 | iso_pu_bacteria | 2724679232 | 2725946478 | 195 |
| 154 | iso_pu_bacteria | 2728369352 | 2730105565 | 195 |
| 155 | iso_pu_bacteria | 2728369365 | 2730161710 | 195 |
| 156 | iso_pu_bacteria | 2728369397 | 2730300718 | 195 |
| 157 | iso_pu_bacteria | 2738541333 | 2739033553 | 195 |
| 158 | iso_pu_bacteria | 2765235942 | 2766068721 | 195 |
| 159 | iso_pu_bacteria | 2791355256 | 2793296549 | 195 |
| 160 | iso_pu_bacteria | 2791355259 | 2793314927 | 195 |
| 161 | iso_pu_bacteria | 2791355260 | 2793321561 | 195 |
| 162 | iso_pu_bacteria | 2791355261 | 2793325939 | 195 |
| 163 | iso_pu_bacteria | 2791355262 | 2793332947 | 195 |
| 164 | iso_pu_bacteria | 2791355263 | 2793340245 | 195 |
| 165 | iso_pu_bacteria | 2791355264 | 2793346049 | 195 |
| 166 | iso_pu_bacteria | 2791355265 | 2793355261 | 195 |
| 167 | iso_pu_bacteria | 2791355266 | 2793357903 | 195 |
| 168 | iso_pu_bacteria | 2791355267 | 2793366671 | 195 |
| 169 | iso_pu_bacteria | 2802429605 | 2805927941 | 195 |
| 170 | iso_pu_bacteria | 2802429606 | 2805933787 | 195 |
| 171 | iso_pu_bacteria | 2802429633 | 2806044950 | 195 |
| 172 | iso_pu_bacteria | 2802429634 | 2806053891 | 195 |
| 173 | iso_pu_bacteria | 2802429635 | 2806060017 | 195 |
| 174 | iso_pu_bacteria | 2802429636 | 2806065929 | 195 |
| 175 | iso_pu_bacteria | 2802429637 | 2806075459 | 195 |
| 176 | iso_pu_bacteria | 2838016132 | 2838019345 | 195 |
| 177 | iso_pu_bacteria | 2838022645 | 2838024889 | 195 |
| 178 | iso_pu_bacteria | 2838035591 | 2838036969 | 195 |
| 179 | iso_pu_bacteria | 2838048938 | 2838050421 | 195 |
| 180 | iso_pu_bacteria | 2838061910 | 2838063123 | 195 |
| 181 | iso_pu_bacteria | 2838068647 | 2838071684 | 195 |
| 182 | iso_pu_bacteria | 2838661181 | 2838661992 | 195 |
| 183 | iso_pu_bacteria | 2838668709 | 2838674678 | 195 |
| 184 | iso_pu_bacteria | 2838680041 | 2838684287 | 195 |
| 185 | iso_pu_bacteria | 2838686498 | 2838692198 | 195 |
| 186 | iso_pu_bacteria | 2838694306 | 2838699778 | 195 |
| 187 | iso_pu_bacteria | 2838701080 | 2838705221 | 195 |
| 188 | iso_pu_bacteria | 2838707686 | 2838711937 | 195 |
| 189 | iso_pu_bacteria | 2838729681 | 2838734579 | 195 |
| 190 | iso_pu_bacteria | 2838742623 | 2838747761 | 195 |
| 191 | iso_pu_bacteria | 2841851746 | 2841853526 | 195 |
| 192 | iso_pu_bacteria | 2842077413 | 2842081753 | 195 |
| 193 | iso_pu_bacteria | 2842110456 | 2842114542 | 195 |
| 194 | iso_pu_bacteria | 2842118031 | 2842122330 | 195 |
| 195 | iso_pu_bacteria | 2842146304 | 2842150288 | 195 |
| 196 | iso_pu_bacteria | 2842156927 | 2842161391 | 195 |
| 197 | iso_pu_bacteria | 2842163707 | 2842167406 | 195 |
| 198 | iso_pu_bacteria | 2842180545 | 2842186344 | 195 |
| 199 | iso_pu_bacteria | 2842192696 | 2842195109 | 195 |
| 200 | iso_pu_bacteria | 2842198810 | 2842201974 | 195 |
| 201 | iso_pu_bacteria | 2842205361 | 2842210474 | 195 |
| 202 | iso_pu_bacteria | 2842217011 | 2842223587 | 195 |
| 203 | iso_pu_bacteria | 2842229732 | 2842235254 | 195 |
| 204 | iso_pu_bacteria | 2842237096 | 2842241349 | 195 |
| 205 | iso_pu_bacteria | 2842243621 | 2842246321 | 195 |
| 206 | iso_pu_bacteria | 2842250916 | 2842254974 | 195 |
| 207 | iso_pu_bacteria | 2842257432 | 2842260818 | 195 |
| 208 | iso_pu_bacteria | 2842264693 | 2842267884 | 195 |
| 209 | iso_pu_bacteria | 2842271015 | 2842276109 | 195 |
| 210 | iso_pu_bacteria | 2842278818 | 2842283928 | 195 |
| 211 | iso_pu_bacteria | 2842291075 | 2842295409 | 195 |
| 212 | iso_pu_bacteria | 2842304105 | 2842310533 | 195 |
| 213 | iso_pu_bacteria | 2842311132 | 2842311911 | 195 |
| 214 | iso_pu_bacteria | 2842317721 | 2842319293 | 195 |
| 215 | iso_pu_bacteria | 2842370503 | 2842375953 | 195 |
| 216 | iso_pu_bacteria | 2842377471 | 2842381815 | 195 |
| 217 | iso_pu_bacteria | 2842384541 | 2842388878 | 195 |
| 218 | iso_pu_bacteria | 2842395702 | 2842396773 | 195 |
| 219 | iso_pu_bacteria | 2842422224 | 2842425317 | 195 |
| 220 | iso_pu_bacteria | 2842428310 | 2842432047 | 195 |
| 221 | iso_pu_bacteria | 2842434925 | 2842438159 | 195 |
| 222 | iso_pu_bacteria | 2842441272 | 2842443855 | 195 |
| 223 | iso_pu_bacteria | 2842447887 | 2842449882 | 195 |
| 224 | iso_pu_bacteria | 2842462802 | 2842466145 | 195 |
| 225 | iso_pu_bacteria | 2842469257 | 2842472871 | 195 |
| 226 | iso_pu_bacteria | 2842489311 | 2842491740 | 195 |
| 227 | iso_pu_bacteria | 2842495871 | 2842502041 | 195 |
| 228 | iso_pu_bacteria | 2842521101 | 2842521921 | 195 |
| 229 | iso_pu_bacteria | 2844454524 | 2844461315 | 195 |
| 230 | iso_pu_bacteria | 2857516855 | 2857522339 | 195 |
| 231 | iso_pu_bacteria | 2919100787 | 2919103361 | 195 |
| 232 | iso_pu_bacteria | 2933016740 | 2933019198 | 195 |
| 233 | iso_pu_bacteria | 2933570622 | 2933577044 | 195 |
| 234 | iso_pu_bacteria | 2933586486 | 2933590602 | 195 |
| 235 | iso_pu_bacteria | 2933599457 | 2933602480 | 195 |
| 236 | iso_pu_bacteria | 2935894831 | 2935898372 | 195 |
| 237 | iso_pu_bacteria | 2935901341 | 2935906810 | 195 |
| 238 | iso_pu_bacteria | 2936367885 | 2936370538 | 195 |
| 239 | iso_pu_bacteria | 2936375103 | 2936378197 | 195 |
| 240 | iso_pu_bacteria | 2936381700 | 2936384295 | 195 |
| 241 | iso_pu_bacteria | 2996893221 | 2996896681 | 195 |
| 242 | iso_pu_bacteria | 3005445848 | 3005451526 | 195 |
| 243 | iso_pu_bacteria | 639633055 | 639651434 | 195 |
| 244 | iso_pu_bacteria | 8005282627 | 8005287958 | 195 |
| 245 | iso_pu_bacteria | 8005289223 | 8005290529 | 195 |
| 246 | iso_pu_bacteria | 8005301065 | 8005305174 | 195 |
| 247 | iso_pu_bacteria | 8005307578 | 8005313267 | 195 |
| 248 | iso_pu_bacteria | 8005376324 | 8005382207 | 195 |
| 249 | iso_pu_bacteria | 8005430974 | 8005431353 | 195 |
| 250 | iso_pu_bacteria | 8005460587 | 8005466651 | 195 |
| 251 | iso_pu_bacteria | 8005556819 | 8005562014 | 195 |
| 252 | iso_pu_bacteria | 8005563573 | 8005567246 | 195 |
| 253 | iso_pu_bacteria | 8005570704 | 8005576190 | 195 |
| 254 | iso_pu_bacteria | 8005619151 | 8005625479 | 195 |
| 255 | iso_pu_bacteria | 8005626139 | 8005630464 | 195 |
| 256 | iso_pu_bacteria | 8005688590 | 8005689196 | 195 |
| 257 | iso_pu_bacteria | 8005695170 | 8005696955 | 195 |
| 258 | iso_pu_bacteria | 8018127388 | 8018127715 | 195 |
| 259 | iso_pu_bacteria | 8018163183 | 8018165806 | 195 |
| 260 | iso_pu_bacteria | 8023680758 | 8023688413 | 195 |
| 261 | iso_pu_bacteria | 8024479707 | 8024484057 | 195 |
| 262 | iso_pu_bacteria | 8024501048 | 8024505415 | 195 |
| 263 | iso_pu_bacteria | 8056382006 | 8056383167 | 195 |
| 264 | iso_pu_bacteria | 8057874678 | 8057880741 | 195 |
| 265 | 3300005435 | Ga0070714_100049991 | Ga0070714_1000499913 | 196 |
| 266 | 3300005983 | Ga0081540_1007285 | Ga0081540_10072854 | 196 |
| 267 | 3300037466 | Ga0395898_1053351 | Ga0395898_1053351_77_697 | 196 |
| 268 | iso_pu_bacteria | 2503198000 | 2503203914 | 196 |
| 269 | iso_pu_bacteria | 2508501127 | 2509139811 | 196 |
| 270 | iso_pu_bacteria | 2509276018 | 2509369298 | 196 |
| 271 | iso_pu_bacteria | 2510065059 | 2510316813 | 196 |
| 272 | iso_pu_bacteria | 2510461069 | 2510840788 | 196 |
| 273 | iso_pu_bacteria | 2510917022 | 2511132888 | 196 |
| 274 | iso_pu_bacteria | 2510917028 | 2511184201 | 196 |
| 275 | iso_pu_bacteria | 2512875016 | 2512929288 | 196 |
| 276 | iso_pu_bacteria | 2512875024 | 2512964100 | 196 |
| 277 | iso_pu_bacteria | 2513237090 | 2513611405 | 196 |
| 278 | iso_pu_bacteria | 2513237164 | 2514034157 | 196 |
| 279 | iso_pu_bacteria | 2513237305 | 2514421329 | 196 |
| 280 | iso_pu_bacteria | 2513237351 | 2514586067 | 196 |
| 281 | iso_pu_bacteria | 2516143018 | 2516207837 | 196 |
| 282 | iso_pu_bacteria | 2524023209 | 2524457142 | 196 |
| 283 | iso_pu_bacteria | 2534681796 | 2535519968 | 196 |
| 284 | iso_pu_bacteria | 2582581283 | 2585169667 | 196 |
| 285 | iso_pu_bacteria | 2582581294 | 2585202816 | 196 |
| 286 | iso_pu_bacteria | 2582581299 | 2585228136 | 196 |
| 287 | iso_pu_bacteria | 2582581304 | 2585255837 | 196 |
| 288 | iso_pu_bacteria | 2582581306 | 2585267280 | 196 |
| 289 | iso_pu_bacteria | 2582581307 | 2585272397 | 196 |
| 290 | iso_pu_bacteria | 2582581308 | 2585278459 | 196 |
| 291 | iso_pu_bacteria | 2582581315 | 2585324697 | 196 |
| 292 | iso_pu_bacteria | 2582581316 | 2585332129 | 196 |
| 293 | iso_pu_bacteria | 2582581865 | 2585386349 | 196 |
| 294 | iso_pu_bacteria | 2582581866 | 2585393373 | 196 |
| 295 | iso_pu_bacteria | 2582581867 | 2585401183 | 196 |
| 296 | iso_pu_bacteria | 2585427527 | 2585535499 | 196 |
| 297 | iso_pu_bacteria | 2585427530 | 2585552244 | 196 |
| 298 | iso_pu_bacteria | 2585427531 | 2585561540 | 196 |
| 299 | iso_pu_bacteria | 2585427590 | 2585821668 | 196 |
| 300 | iso_pu_bacteria | 2585427594 | 2585847617 | 196 |
| 301 | iso_pu_bacteria | 2585427608 | 2585899388 | 196 |
| 302 | iso_pu_bacteria | 2585427609 | 2585906768 | 196 |
| 303 | iso_pu_bacteria | 2585427633 | 2585992471 | 196 |
| 304 | iso_pu_bacteria | 2585427634 | 2586003223 | 196 |
| 305 | iso_pu_bacteria | 2585428125 | 2587982189 | 196 |
| 306 | iso_pu_bacteria | 2588253730 | 2588514843 | 196 |
| 307 | iso_pu_bacteria | 2599185156 | 2599335920 | 196 |
| 308 | iso_pu_bacteria | 2599185236 | 2599720507 | 196 |
| 309 | iso_pu_bacteria | 2599185301 | 2599936861 | 196 |
| 310 | iso_pu_bacteria | 2599185352 | 2600197969 | 196 |
| 311 | iso_pu_bacteria | 2615840626 | 2616307977 | 196 |
| 312 | iso_pu_bacteria | 2615840698 | 2616552552 | 196 |
| 313 | iso_pu_bacteria | 2617270742 | 2617381708 | 196 |
| 314 | iso_pu_bacteria | 2643221557 | 2643806950 | 196 |
| 315 | iso_pu_bacteria | 2643221595 | 2643986296 | 196 |
| 316 | iso_pu_bacteria | 2643221599 | 2644006751 | 196 |
| 317 | iso_pu_bacteria | 2643221607 | 2644050399 | 196 |
| 318 | iso_pu_bacteria | 2643221610 | 2644068094 | 196 |
| 319 | iso_pu_bacteria | 2643221618 | 2644110445 | 196 |
| 320 | iso_pu_bacteria | 2643221623 | 2644130504 | 196 |
| 321 | iso_pu_bacteria | 2643221626 | 2644144980 | 196 |
| 322 | iso_pu_bacteria | 2643221627 | 2644152528 | 196 |
| 323 | iso_pu_bacteria | 2643221634 | 2644191661 | 196 |
| 324 | iso_pu_bacteria | 2643221636 | 2644205627 | 196 |
| 325 | iso_pu_bacteria | 2643221643 | 2644242031 | 196 |
| 326 | iso_pu_bacteria | 2643221653 | 2644299452 | 196 |
| 327 | iso_pu_bacteria | 2643221655 | 2644307197 | 196 |
| 328 | iso_pu_bacteria | 2643221659 | 2644337081 | 196 |
| 329 | iso_pu_bacteria | 2643221668 | 2644380053 | 196 |
| 330 | iso_pu_bacteria | 2643221675 | 2644419002 | 196 |
| 331 | iso_pu_bacteria | 2643221680 | 2644452383 | 196 |
| 332 | iso_pu_bacteria | 2643221686 | 2644483317 | 196 |
| 333 | iso_pu_bacteria | 2643221688 | 2644495120 | 196 |
| 334 | iso_pu_bacteria | 2643221689 | 2644499525 | 196 |
| 335 | iso_pu_bacteria | 2643221698 | 2644540595 | 196 |
| 336 | iso_pu_bacteria | 2643221712 | 2644613277 | 196 |
| 337 | iso_pu_bacteria | 2643221719 | 2644657680 | 196 |
| 338 | iso_pu_bacteria | 2643221723 | 2644674729 | 196 |
| 339 | iso_pu_bacteria | 2643221726 | 2644688225 | 196 |
| 340 | iso_pu_bacteria | 2643221736 | 2644747141 | 196 |
| 341 | iso_pu_bacteria | 2657244999 | 2657686010 | 196 |
| 342 | iso_pu_bacteria | 2667528174 | 2671112972 | 196 |
| 343 | iso_pu_bacteria | 2687453392 | 2688600616 | 196 |
| 344 | iso_pu_bacteria | 2693429783 | 2694630965 | 196 |
| 345 | iso_pu_bacteria | 2693429784 | 2694636537 | 196 |
| 346 | iso_pu_bacteria | 2721755686 | 2723575279 | 196 |
| 347 | iso_pu_bacteria | 2738541293 | 2738803959 | 196 |
| 348 | iso_pu_bacteria | 2738543024 | 2739310167 | 196 |
| 349 | iso_pu_bacteria | 2751185821 | 2753463196 | 196 |
| 350 | iso_pu_bacteria | 2756170246 | 2756672778 | 196 |
| 351 | iso_pu_bacteria | 2765235802 | 2765466788 | 196 |
| 352 | iso_pu_bacteria | 2767802442 | 2770196203 | 196 |
| 353 | iso_pu_bacteria | 2775507266 | 2778178191 | 196 |
| 354 | iso_pu_bacteria | 2791355091 | 2792621421 | 196 |
| 355 | iso_pu_bacteria | 2791355092 | 2792627891 | 196 |
| 356 | iso_pu_bacteria | 2791355094 | 2792643645 | 196 |
| 357 | iso_pu_bacteria | 2791355123 | 2792745811 | 196 |
| 358 | iso_pu_bacteria | 2802429268 | 2804755284 | 196 |
| 359 | iso_pu_bacteria | 2818991272 | 2819244028 | 196 |
| 360 | iso_pu_bacteria | 2818991448 | 2819610264 | 196 |
| 361 | iso_pu_bacteria | 2818991453 | 2819640128 | 196 |
| 362 | iso_pu_bacteria | 2821123053 | 2821128946 | 196 |
| 363 | iso_pu_bacteria | 2838029111 | 2838033815 | 196 |
| 364 | iso_pu_bacteria | 2838074704 | 2838075890 | 196 |
| 365 | iso_pu_bacteria | 2838736955 | 2838742261 | 196 |
| 366 | iso_pu_bacteria | 2840764183 | 2840765160 | 196 |
| 367 | iso_pu_bacteria | 2841734538 | 2841735475 | 196 |
| 368 | iso_pu_bacteria | 2841760612 | 2841764305 | 196 |
| 369 | iso_pu_bacteria | 2841840854 | 2841846117 | 196 |
| 370 | iso_pu_bacteria | 2842140634 | 2842145821 | 196 |
| 371 | iso_pu_bacteria | 2842298080 | 2842299304 | 196 |
| 372 | iso_pu_bacteria | 2842357229 | 2842358771 | 196 |
| 373 | iso_pu_bacteria | 2842475841 | 2842480562 | 196 |
| 374 | iso_pu_bacteria | 2842482326 | 2842484135 | 196 |
| 375 | iso_pu_bacteria | 2842502639 | 2842507157 | 196 |
| 376 | iso_pu_bacteria | 2842509118 | 2842512202 | 196 |
| 377 | iso_pu_bacteria | 2842871566 | 2842874876 | 196 |
| 378 | iso_pu_bacteria | 2842922631 | 2842926926 | 196 |
| 379 | iso_pu_bacteria | 2844002411 | 2844005235 | 196 |
| 380 | iso_pu_bacteria | 2844009547 | 2844015966 | 196 |
| 381 | iso_pu_bacteria | 2844104063 | 2844108240 | 196 |
| 382 | iso_pu_bacteria | 2844163670 | 2844167869 | 196 |
| 383 | iso_pu_bacteria | 2851182111 | 2851185582 | 196 |
| 384 | iso_pu_bacteria | 2851246043 | 2851250740 | 196 |
| 385 | iso_pu_bacteria | 2852387548 | 2852394544 | 196 |
| 386 | iso_pu_bacteria | 2854911287 | 2854916456 | 196 |
| 387 | iso_pu_bacteria | 2855872281 | 2855875565 | 196 |
| 388 | iso_pu_bacteria | 2856314179 | 2856314233 | 196 |
| 389 | iso_pu_bacteria | 2856320880 | 2856326371 | 196 |
| 390 | iso_pu_bacteria | 2856334872 | 2856339486 | 196 |
| 391 | iso_pu_bacteria | 2856342000 | 2856347857 | 196 |
| 392 | iso_pu_bacteria | 2856349417 | 2856355923 | 196 |
| 393 | iso_pu_bacteria | 2856364286 | 2856369362 | 196 |
| 394 | iso_pu_bacteria | 2857349434 | 2857351256 | 196 |
| 395 | iso_pu_bacteria | 2857367948 | 2857372264 | 196 |
| 396 | iso_pu_bacteria | 2857531043 | 2857536397 | 196 |
| 397 | iso_pu_bacteria | 2869234852 | 2869241147 | 196 |
| 398 | iso_pu_bacteria | 2869242130 | 2869248847 | 196 |
| 399 | iso_pu_bacteria | 2869249662 | 2869255669 | 196 |
| 400 | iso_pu_bacteria | 2869256925 | 2869256979 | 196 |
| 401 | iso_pu_bacteria | 2869264136 | 2869268482 | 196 |
| 402 | iso_pu_bacteria | 2869271264 | 2869273579 | 196 |
| 403 | iso_pu_bacteria | 2869278585 | 2869284005 | 196 |
| 404 | iso_pu_bacteria | 2869285874 | 2869286565 | 196 |
| 405 | iso_pu_bacteria | 2871429161 | 2871434718 | 196 |
| 406 | iso_pu_bacteria | 2871435913 | 2871442080 | 196 |
| 407 | iso_pu_bacteria | 2871451962 | 2871456854 | 196 |
| 408 | iso_pu_bacteria | 2871459585 | 2871460648 | 196 |
| 409 | iso_pu_bacteria | 2871466892 | 2871472991 | 196 |
| 410 | iso_pu_bacteria | 2871474448 | 2871476186 | 196 |
| 411 | iso_pu_bacteria | 2871481445 | 2871482351 | 196 |
| 412 | iso_pu_bacteria | 2871488783 | 2871494634 | 196 |
| 413 | iso_pu_bacteria | 2871495908 | 2871496612 | 196 |
| 414 | iso_pu_bacteria | 2874109183 | 2874111248 | 196 |
| 415 | iso_pu_bacteria | 2874116593 | 2874122885 | 196 |
| 416 | iso_pu_bacteria | 2874123672 | 2874123918 | 196 |
| 417 | iso_pu_bacteria | 2874131515 | 2874133118 | 196 |
| 418 | iso_pu_bacteria | 2874139085 | 2874144623 | 196 |
| 419 | iso_pu_bacteria | 2874146452 | 2874149923 | 196 |
| 420 | iso_pu_bacteria | 2874155637 | 2874158181 | 196 |
| 421 | iso_pu_bacteria | 2874162495 | 2874164323 | 196 |
| 422 | iso_pu_bacteria | 2874168670 | 2874173908 | 196 |
| 423 | iso_pu_bacteria | 2876363079 | 2876367156 | 196 |
| 424 | iso_pu_bacteria | 2876369609 | 2876372904 | 196 |
| 425 | iso_pu_bacteria | 2876377896 | 2876384484 | 196 |
| 426 | iso_pu_bacteria | 2876386047 | 2876391188 | 196 |
| 427 | iso_pu_bacteria | 2876392853 | 2876398339 | 196 |
| 428 | iso_pu_bacteria | 2876399893 | 2876404072 | 196 |
| 429 | iso_pu_bacteria | 2876406927 | 2876411239 | 196 |
| 430 | iso_pu_bacteria | 2876413966 | 2876416385 | 196 |
| 431 | iso_pu_bacteria | 2876420981 | 2876424022 | 196 |
| 432 | iso_pu_bacteria | 2878730984 | 2878736736 | 196 |
| 433 | iso_pu_bacteria | 2878738818 | 2878744001 | 196 |
| 434 | iso_pu_bacteria | 2878745973 | 2878751851 | 196 |
| 435 | iso_pu_bacteria | 2878753008 | 2878758784 | 196 |
| 436 | iso_pu_bacteria | 2878760144 | 2878760839 | 196 |
| 437 | iso_pu_bacteria | 2878767105 | 2878767802 | 196 |
| 438 | iso_pu_bacteria | 2878774303 | 2878779411 | 196 |
| 439 | iso_pu_bacteria | 2878781027 | 2878786472 | 196 |
| 440 | iso_pu_bacteria | 2878788777 | 2878794716 | 196 |
| 441 | iso_pu_bacteria | 2881147464 | 2881151213 | 196 |
| 442 | iso_pu_bacteria | 2881155292 | 2881161711 | 196 |
| 443 | iso_pu_bacteria | 2881161766 | 2881167428 | 196 |
| 444 | iso_pu_bacteria | 2881845957 | 2881846175 | 196 |
| 445 | iso_pu_bacteria | 2881853255 | 2881859247 | 196 |
| 446 | iso_pu_bacteria | 2881861095 | 2881862455 | 196 |
| 447 | iso_pu_bacteria | 2882632389 | 2882636173 | 196 |
| 448 | iso_pu_bacteria | 2882912400 | 2882915096 | 196 |
| 449 | iso_pu_bacteria | 2885305155 | 2885309325 | 196 |
| 450 | iso_pu_bacteria | 2885312484 | 2885312792 | 196 |
| 451 | iso_pu_bacteria | 2885312484 | 2885318662 | 196 |
| 452 | iso_pu_bacteria | 2885318864 | 2885319397 | 196 |
| 453 | iso_pu_bacteria | 2885326080 | 2885328726 | 196 |
| 454 | iso_pu_bacteria | 2885334103 | 2885338561 | 196 |
| 455 | iso_pu_bacteria | 2885342637 | 2885349851 | 196 |
| 456 | iso_pu_bacteria | 2888337043 | 2888342058 | 196 |
| 457 | iso_pu_bacteria | 2888350351 | 2888355651 | 196 |
| 458 | iso_pu_bacteria | 2889010040 | 2889010587 | 196 |
| 459 | iso_pu_bacteria | 2889016732 | 2889017711 | 196 |
| 460 | iso_pu_bacteria | 2896384573 | 2896388333 | 196 |
| 461 | iso_pu_bacteria | 2903448605 | 2903453376 | 196 |
| 462 | iso_pu_bacteria | 2903492973 | 2903503977 | 196 |
| 463 | iso_pu_bacteria | 2903492973 | 2903504797 | 196 |
| 464 | iso_pu_bacteria | 2903513507 | 2903520766 | 196 |
| 465 | iso_pu_bacteria | 2903521522 | 2903526647 | 196 |
| 466 | iso_pu_bacteria | 2903528002 | 2903530734 | 196 |
| 467 | iso_pu_bacteria | 2903540706 | 2903541410 | 196 |
| 468 | iso_pu_bacteria | 2904578770 | 2904581687 | 196 |
| 469 | iso_pu_bacteria | 2904659560 | 2904664894 | 196 |
| 470 | iso_pu_bacteria | 2906308376 | 2906314249 | 196 |
| 471 | iso_pu_bacteria | 2906321335 | 2906327415 | 196 |
| 472 | iso_pu_bacteria | 2906354277 | 2906355484 | 196 |
| 473 | iso_pu_bacteria | 2906363423 | 2906368798 | 196 |
| 474 | iso_pu_bacteria | 2906370794 | 2906373097 | 196 |
| 475 | iso_pu_bacteria | 2906378014 | 2906385045 | 196 |
| 476 | iso_pu_bacteria | 2906386501 | 2906392054 | 196 |
| 477 | iso_pu_bacteria | 2906393657 | 2906395566 | 196 |
| 478 | iso_pu_bacteria | 2906401398 | 2906403703 | 196 |
| 479 | iso_pu_bacteria | 2906408224 | 2906412257 | 196 |
| 480 | iso_pu_bacteria | 2906414383 | 2906414655 | 196 |
| 481 | iso_pu_bacteria | 2906427513 | 2906435362 | 196 |
| 482 | iso_pu_bacteria | 2913295892 | 2913296007 | 196 |
| 483 | iso_pu_bacteria | 2915986958 | 2915987881 | 196 |
| 484 | iso_pu_bacteria | 2919119836 | 2919123351 | 196 |
| 485 | iso_pu_bacteria | 2919408235 | 2919412761 | 196 |
| 486 | iso_pu_bacteria | 2920760137 | 2920764441 | 196 |
| 487 | iso_pu_bacteria | 2920822456 | 2920828035 | 196 |
| 488 | iso_pu_bacteria | 2921257292 | 2921263294 | 196 |
| 489 | iso_pu_bacteria | 2922130491 | 2922135743 | 196 |
| 490 | iso_pu_bacteria | 2922151315 | 2922152164 | 196 |
| 491 | iso_pu_bacteria | 2922172374 | 2922175458 | 196 |
| 492 | iso_pu_bacteria | 2922178524 | 2922181336 | 196 |
| 493 | iso_pu_bacteria | 2922185730 | 2922191285 | 196 |
| 494 | iso_pu_bacteria | 2924193448 | 2924198408 | 196 |
| 495 | iso_pu_bacteria | 2924207177 | 2924210339 | 196 |
| 496 | iso_pu_bacteria | 2924228884 | 2924230740 | 196 |
| 497 | iso_pu_bacteria | 2924710171 | 2924716395 | 196 |
| 498 | iso_pu_bacteria | 2924733363 | 2924738807 | 196 |
| 499 | iso_pu_bacteria | 2924741084 | 2924743895 | 196 |
| 500 | iso_pu_bacteria | 2924748358 | 2924751997 | 196 |
| 501 | iso_pu_bacteria | 2924762789 | 2924765017 | 196 |
| 502 | iso_pu_bacteria | 2924776078 | 2924781918 | 196 |
| 503 | iso_pu_bacteria | 2924784321 | 2924788986 | 196 |
| 504 | iso_pu_bacteria | 2929138655 | 2929143785 | 196 |
| 505 | iso_pu_bacteria | 2937023124 | 2937024432 | 196 |
| 506 | iso_pu_bacteria | 2937071275 | 2937074206 | 196 |
| 507 | iso_pu_bacteria | 2937813078 | 2937815641 | 196 |
| 508 | iso_pu_bacteria | 2937822353 | 2937824351 | 196 |
| 509 | iso_pu_bacteria | 2937836603 | 2937842291 | 196 |
| 510 | iso_pu_bacteria | 2937843397 | 2937848065 | 196 |
| 511 | iso_pu_bacteria | 2937848649 | 2937850324 | 196 |
| 512 | iso_pu_bacteria | 2937861824 | 2937868711 | 196 |
| 513 | iso_pu_bacteria | 2937868953 | 2937874243 | 196 |
| 514 | iso_pu_bacteria | 2937877337 | 2937884753 | 196 |
| 515 | iso_pu_bacteria | 2937972304 | 2937978026 | 196 |
| 516 | iso_pu_bacteria | 2937980651 | 2937983932 | 196 |
| 517 | iso_pu_bacteria | 2937994558 | 2937995266 | 196 |
| 518 | iso_pu_bacteria | 2938014810 | 2938017057 | 196 |
| 519 | iso_pu_bacteria | 2941499720 | 2941503026 | 196 |
| 520 | iso_pu_bacteria | 2957382221 | 2957385881 | 196 |
| 521 | iso_pu_bacteria | 2957395598 | 2957400616 | 196 |
| 522 | iso_pu_bacteria | 2957402308 | 2957406088 | 196 |
| 523 | iso_pu_bacteria | 2957415311 | 2957418415 | 196 |
| 524 | iso_pu_bacteria | 2958034702 | 2958040394 | 196 |
| 525 | iso_pu_bacteria | 2958041894 | 2958055242 | 196 |
| 526 | iso_pu_bacteria | 2958064165 | 2958068239 | 196 |
| 527 | iso_pu_bacteria | 2958071322 | 2958075527 | 196 |
| 528 | iso_pu_bacteria | 2958084443 | 2958092062 | 196 |
| 529 | iso_pu_bacteria | 2958100919 | 2958107279 | 196 |
| 530 | iso_pu_bacteria | 2958108152 | 2958114631 | 196 |
| 531 | iso_pu_bacteria | 2958122699 | 2958127823 | 196 |
| 532 | iso_pu_bacteria | 2958130278 | 2958130968 | 196 |
| 533 | iso_pu_bacteria | 2958137437 | 2958143344 | 196 |
| 534 | iso_pu_bacteria | 2958144490 | 2958144770 | 196 |
| 535 | iso_pu_bacteria | 2958158011 | 2958162394 | 196 |
| 536 | iso_pu_bacteria | 2958165035 | 2958165742 | 196 |
| 537 | iso_pu_bacteria | 2958172287 | 2958176949 | 196 |
| 538 | iso_pu_bacteria | 2958179912 | 2958184889 | 196 |
| 539 | iso_pu_bacteria | 2960584000 | 2960584573 | 196 |
| 540 | iso_pu_bacteria | 2961077736 | 2961083056 | 196 |
| 541 | iso_pu_bacteria | 2961114664 | 2961119893 | 196 |
| 542 | iso_pu_bacteria | 2961127735 | 2961132620 | 196 |
| 543 | iso_pu_bacteria | 2961136820 | 2961140458 | 196 |
| 544 | iso_pu_bacteria | 2961163497 | 2961164201 | 196 |
| 545 | iso_pu_bacteria | 2961170736 | 2961176138 | 196 |
| 546 | iso_pu_bacteria | 2961183825 | 2961190523 | 196 |
| 547 | iso_pu_bacteria | 2963644680 | 2963649949 | 196 |
| 548 | iso_pu_bacteria | 2964615318 | 2964620960 | 196 |
| 549 | iso_pu_bacteria | 2964663802 | 2964667280 | 196 |
| 550 | iso_pu_bacteria | 2964705432 | 2964707354 | 196 |
| 551 | iso_pu_bacteria | 2965018300 | 2965019190 | 196 |
| 552 | iso_pu_bacteria | 2965025482 | 2965027010 | 196 |
| 553 | iso_pu_bacteria | 2965032056 | 2965037108 | 196 |
| 554 | iso_pu_bacteria | 2965040258 | 2965045882 | 196 |
| 555 | iso_pu_bacteria | 2965047637 | 2965048870 | 196 |
| 556 | iso_pu_bacteria | 2965089291 | 2965095850 | 196 |
| 557 | iso_pu_bacteria | 2965110997 | 2965111510 | 196 |
| 558 | iso_pu_bacteria | 2965119406 | 2965126638 | 196 |
| 559 | iso_pu_bacteria | 2967755722 | 2967756064 | 196 |
| 560 | iso_pu_bacteria | 2967996073 | 2968002025 | 196 |
| 561 | iso_pu_bacteria | 2968003550 | 2968008951 | 196 |
| 562 | iso_pu_bacteria | 2968016561 | 2968021980 | 196 |
| 563 | iso_pu_bacteria | 2968083720 | 2968086740 | 196 |
| 564 | iso_pu_bacteria | 2968110612 | 2968116250 | 196 |
| 565 | iso_pu_bacteria | 2968117919 | 2968119851 | 196 |
| 566 | iso_pu_bacteria | 2968138860 | 2968141242 | 196 |
| 567 | iso_pu_bacteria | 2968171901 | 2968172601 | 196 |
| 568 | iso_pu_bacteria | 2970082768 | 2970084708 | 196 |
| 569 | iso_pu_bacteria | 2970102677 | 2970103836 | 196 |
| 570 | iso_pu_bacteria | 2970164137 | 2970166147 | 196 |
| 571 | iso_pu_bacteria | 2970469710 | 2970474570 | 196 |
| 572 | iso_pu_bacteria | 2970489779 | 2970491871 | 196 |
| 573 | iso_pu_bacteria | 2970503327 | 2970508804 | 196 |
| 574 | iso_pu_bacteria | 2970510686 | 2970514709 | 196 |
| 575 | iso_pu_bacteria | 2970524798 | 2970528009 | 196 |
| 576 | iso_pu_bacteria | 2970532167 | 2970538562 | 196 |
| 577 | iso_pu_bacteria | 2970547951 | 2970549748 | 196 |
| 578 | iso_pu_bacteria | 2970554993 | 2970555694 | 196 |
| 579 | iso_pu_bacteria | 2970593180 | 2970598617 | 196 |
| 580 | iso_pu_bacteria | 2970619444 | 2970626418 | 196 |
| 581 | iso_pu_bacteria | 2970627176 | 2970628632 | 196 |
| 582 | iso_pu_bacteria | 2977821940 | 2977827324 | 196 |
| 583 | iso_pu_bacteria | 2977828996 | 2977836594 | 196 |
| 584 | iso_pu_bacteria | 2977843712 | 2977845877 | 196 |
| 585 | iso_pu_bacteria | 2977851361 | 2977855681 | 196 |
| 586 | iso_pu_bacteria | 2977864932 | 2977867192 | 196 |
| 587 | iso_pu_bacteria | 2977872689 | 2977873275 | 196 |
| 588 | iso_pu_bacteria | 2977898635 | 2977907138 | 196 |
| 589 | iso_pu_bacteria | 2977907340 | 2977910758 | 196 |
| 590 | iso_pu_bacteria | 2977915119 | 2977919549 | 196 |
| 591 | iso_pu_bacteria | 2977922695 | 2977927987 | 196 |
| 592 | iso_pu_bacteria | 2977935797 | 2977941163 | 196 |
| 593 | iso_pu_bacteria | 2977942078 | 2977942649 | 196 |
| 594 | iso_pu_bacteria | 2977950692 | 2977952658 | 196 |
| 595 | iso_pu_bacteria | 2977957713 | 2977960404 | 196 |
| 596 | iso_pu_bacteria | 2977971508 | 2977974372 | 196 |
| 597 | iso_pu_bacteria | 2977986579 | 2977991677 | 196 |
| 598 | iso_pu_bacteria | 2979710463 | 2979717577 | 196 |
| 599 | iso_pu_bacteria | 2979742915 | 2979751574 | 196 |
| 600 | iso_pu_bacteria | 2979764755 | 2979767271 | 196 |
| 601 | iso_pu_bacteria | 2979772303 | 2979779213 | 196 |
| 602 | iso_pu_bacteria | 2979793036 | 2979797487 | 196 |
| 603 | iso_pu_bacteria | 2979808191 | 2979811548 | 196 |
| 604 | iso_pu_bacteria | 2987636660 | 2987638440 | 196 |
| 605 | iso_pu_bacteria | 2987645492 | 2987648048 | 196 |
| 606 | iso_pu_bacteria | 2987652177 | 2987654549 | 196 |
| 607 | iso_pu_bacteria | 2987659509 | 2987660207 | 196 |
| 608 | iso_pu_bacteria | 2987666974 | 2987667923 | 196 |
| 609 | iso_pu_bacteria | 2987673487 | 2987675237 | 196 |
| 610 | iso_pu_bacteria | 2989349275 | 2989351861 | 196 |
| 611 | iso_pu_bacteria | 2989776772 | 2989780564 | 196 |
| 612 | iso_pu_bacteria | 2996348954 | 2996353979 | 196 |
| 613 | iso_pu_bacteria | 2996386984 | 2996391262 | 196 |
| 614 | iso_pu_bacteria | 3000135777 | 3000141080 | 196 |
| 615 | iso_pu_bacteria | 3002141150 | 3002146108 | 196 |
| 616 | iso_pu_bacteria | 3004167301 | 3004171489 | 196 |
| 617 | iso_pu_bacteria | 3004188549 | 3004189256 | 196 |
| 618 | iso_pu_bacteria | 3004195979 | 3004200308 | 196 |
| 619 | iso_pu_bacteria | 3004203850 | 3004205317 | 196 |
| 620 | iso_pu_bacteria | 3004211236 | 3004213629 | 196 |
| 621 | iso_pu_bacteria | 3004218560 | 3004223220 | 196 |
| 622 | iso_pu_bacteria | 3004232784 | 3004239099 | 196 |
| 623 | iso_pu_bacteria | 3004239961 | 3004246458 | 196 |
| 624 | iso_pu_bacteria | 3004248173 | 3004251384 | 196 |
| 625 | iso_pu_bacteria | 3004268573 | 3004270281 | 196 |
| 626 | iso_pu_bacteria | 3004275668 | 3004280647 | 196 |
| 627 | iso_pu_bacteria | 3004289098 | 3004291654 | 196 |
| 628 | iso_pu_bacteria | 3004334049 | 3004338798 | 196 |
| 629 | iso_pu_bacteria | 3005409236 | 3005414027 | 196 |
| 630 | iso_pu_bacteria | 3005416602 | 3005421048 | 196 |
| 631 | iso_pu_bacteria | 3005452660 | 3005458120 | 196 |
| 632 | iso_pu_bacteria | 637000159 | 637079046 | 196 |
| 633 | iso_pu_bacteria | 640427133 | 640487206 | 196 |
| 634 | iso_pu_bacteria | 649633066 | 649875068 | 196 |
| 635 | iso_pu_bacteria | 651053060 | 651175083 | 196 |
| 636 | iso_pu_bacteria | 8004300914 | 8004303613 | 196 |
| 637 | iso_pu_bacteria | 8004361976 | 8004365936 | 196 |
| 638 | iso_pu_bacteria | 8004374579 | 8004380305 | 196 |
| 639 | iso_pu_bacteria | 8004387939 | 8004393739 | 196 |
| 640 | iso_pu_bacteria | 8004633249 | 8004639422 | 196 |
| 641 | iso_pu_bacteria | 8004640170 | 8004640939 | 196 |
| 642 | iso_pu_bacteria | 8004695233 | 8004696791 | 196 |
| 643 | iso_pu_bacteria | 8004714634 | 8004720507 | 196 |
| 644 | iso_pu_bacteria | 8004727605 | 8004733788 | 196 |
| 645 | iso_pu_bacteria | 8005246636 | 8005250284 | 196 |
| 646 | iso_pu_bacteria | 8005258706 | 8005263958 | 196 |
| 647 | iso_pu_bacteria | 8005314921 | 8005319217 | 196 |
| 648 | iso_pu_bacteria | 8005484373 | 8005489450 | 196 |
| 649 | iso_pu_bacteria | 8005542996 | 8005547693 | 196 |
| 650 | iso_pu_bacteria | 8005645114 | 8005648038 | 196 |
| 651 | iso_pu_bacteria | 8046767195 | 8046774622 | 196 |
| 652 | iso_pu_bacteria | 8054558443 | 8054561604 | 196 |
| 653 | iso_pu_bacteria | 8055617313 | 8055620118 | 196 |
| 654 | iso_pu_bacteria | 8057529695 | 8057533632 | 196 |
| 655 | iso_pu_bacteria | 8057575449 | 8057577721 | 196 |
| 656 | 3300006177 | Ga0075362_10134956 | Ga0075362_101349562 | 197 |
| 657 | 3300048913 | Ga0496110_0297235 | Ga0496110_0297235_663_1268 | 197 |
| 658 | 3300048924 | Ga0496121_0179798 | Ga0496121_0179798_378_983 | 197 |
| 659 | 3300048927 | Ga0496124_0295942 | Ga0496124_0295942_464_1066 | 197 |
| 660 | 3300048928 | Ga0496125_0000115 | Ga0496125_0000115_168049_168654 | 197 |
| 661 | iso_pu_bacteria | 2643221564 | 2643839631 | 197 |
| 662 | iso_pu_bacteria | 2643221580 | 2643909926 | 197 |
| 663 | iso_pu_bacteria | 2643221674 | 2644412485 | 197 |
| 664 | iso_pu_bacteria | 2838042994 | 2838046515 | 197 |
| 665 | iso_pu_bacteria | 2841864319 | 2841869656 | 197 |
| 666 | iso_pu_bacteria | 2842285085 | 2842289811 | 197 |
| 667 | iso_pu_bacteria | 2842341865 | 2842343897 | 197 |
| 668 | iso_pu_bacteria | 2842363717 | 2842368274 | 197 |
| 669 | iso_pu_bacteria | 2842402390 | 2842407048 | 197 |
| 670 | iso_pu_bacteria | 2842409023 | 2842413941 | 197 |
| 671 | iso_pu_bacteria | 2842415677 | 2842420582 | 197 |
| 672 | iso_pu_bacteria | 2996310559 | 2996315595 | 197 |
| 673 | iso_pu_bacteria | 3003930520 | 3003931536 | 197 |
| 674 | iso_pu_bacteria | 8005275841 | 8005277039 | 197 |
| 675 | iso_pu_bacteria | 8005382845 | 8005388560 | 197 |
| 676 | iso_pu_bacteria | 8005395548 | 8005399347 | 197 |
| 677 | iso_pu_bacteria | 8018176218 | 8018182855 | 197 |
| 678 | iso_pu_bacteria | 8056375014 | 8056375283 | 197 |
| 679 | 3300042007 | Ga0439449_0033819 | Ga0439449_0033819_11_637 | 198 |
| 680 | 3300053134 | Ga0500658_0000458 | Ga0500658_0000458_11435_12043 | 198 |
| 681 | iso_pu_bacteria | 2643221551 | 2643776189 | 198 |
| 682 | iso_pu_bacteria | 2643221555 | 2643794636 | 198 |
| 683 | 3300002739 | JGI25158J39367_1000347 | JGI25158J39367_10003474 | 199 |
| 684 | 3300002741 | JGI25157J39369_1000841 | JGI25157J39369_10008417 | 199 |
| 685 | 3300002773 | JGI25152J39213_1005724 | JGI25152J39213_10057242 | 199 |
| 686 | 3300002773 | JGI25152J39213_1005868 | JGI25152J39213_10058682 | 199 |
| 687 | 3300002773 | JGI25152J39213_1008747 | JGI25152J39213_10087473 | 199 |
| 688 | 3300002774 | JGI25150J39212_1010813 | JGI25150J39212_10108132 | 199 |
| 689 | 3300002774 | JGI25150J39212_1016900 | JGI25150J39212_10169002 | 199 |
| 690 | 3300002987 | JGI25159J45721_1000259 | JGI25159J45721_100025925 | 199 |
| 691 | 3300003187 | JGI25151J46595_10000274 | JGI25151J46595_1000027448 | 199 |
| 692 | 3300003187 | JGI25151J46595_10018172 | JGI25151J46595_100181722 | 199 |
| 693 | 3300003215 | JGI25153J46596_10012993 | JGI25153J46596_100129932 | 199 |
| 694 | 3300003215 | JGI25153J46596_10013350 | JGI25153J46596_100133502 | 199 |
| 695 | 3300003323 | rootH1_10104478 | rootH1_101044782 | 199 |
| 696 | 3300003354 | JGI25160J50197_1001878 | JGI25160J50197_10018781 | 199 |
| 697 | 3300003354 | JGI25160J50197_1006181 | JGI25160J50197_10061813 | 199 |
| 698 | 3300003374 | JGI25161J50226_1000025 | JGI25161J50226_100002571 | 199 |
| 699 | 3300003771 | Ga0055526_1001208 | Ga0055526_10012087 | 199 |
| 700 | 3300003771 | Ga0055526_1006973 | Ga0055526_10069732 | 199 |
| 701 | 3300003775 | Ga0055524_1019755 | Ga0055524_10197552 | 199 |
| 702 | 3300003790 | Ga0055528_1001036 | Ga0055528_100103618 | 199 |
| 703 | 3300003790 | Ga0055528_1001440 | Ga0055528_100144012 | 199 |
| 704 | 3300003790 | Ga0055528_1026575 | Ga0055528_10265752 | 199 |
| 705 | 3300003790 | Ga0055528_1036732 | Ga0055528_10367322 | 199 |
| 706 | 3300003790 | Ga0055528_1047861 | Ga0055528_10478612 | 199 |
| 707 | 3300003792 | Ga0055540_1000050 | Ga0055540_100005035 | 199 |
| 708 | 3300003792 | Ga0055540_1019446 | Ga0055540_10194461 | 199 |
| 709 | 3300004625 | Ga0055543_1000021 | Ga0055543_1000021124 | 199 |
| 710 | 3300004625 | Ga0055543_1002242 | Ga0055543_10022422 | 199 |
| 711 | 3300005262 | Ga0065165_1024912 | Ga0065165_10249124 | 199 |
| 712 | 3300005262 | Ga0065165_1062300 | Ga0065165_10623001 | 199 |
| 713 | 3300005338 | Ga0068868_100107875 | Ga0068868_1001078751 | 199 |
| 714 | 3300005355 | Ga0070671_100025227 | Ga0070671_1000252275 | 199 |
| 715 | 3300005367 | Ga0070667_100199143 | Ga0070667_1001991432 | 199 |
| 716 | 3300005841 | Ga0068863_100598522 | Ga0068863_1005985222 | 199 |
| 717 | 3300006038 | Ga0075365_10008006 | Ga0075365_100080065 | 199 |
| 718 | 3300006048 | Ga0075363_100175649 | Ga0075363_1001756492 | 199 |
| 719 | 3300006177 | Ga0075362_10013397 | Ga0075362_100133975 | 199 |
| 720 | 3300006178 | Ga0075367_10022064 | Ga0075367_100220645 | 199 |
| 721 | 3300006186 | Ga0075369_10158560 | Ga0075369_101585601 | 199 |
| 722 | 3300006195 | Ga0075366_10050942 | Ga0075366_100509421 | 199 |
| 723 | 3300006237 | Ga0097621_100275350 | Ga0097621_1002753502 | 199 |
| 724 | 3300006353 | Ga0075370_10004269 | Ga0075370_100042693 | 199 |
| 725 | 3300009093 | Ga0105240_10079788 | Ga0105240_100797883 | 199 |
| 726 | 3300009765 | Ga0123341_1000025 | Ga0123341_100002512 | 199 |
| 727 | 3300009766 | Ga0123342_1015842 | Ga0123342_10158422 | 199 |
| 728 | 3300013297 | Ga0157378_10003823 | Ga0157378_100038233 | 199 |
| 729 | 3300025208 | Ga0209436_100044 | Ga0209436_10004425 | 199 |
| 730 | 3300025245 | Ga0207425_1000563 | Ga0207425_10005636 | 199 |
| 731 | 3300025250 | Ga0209026_1000025 | Ga0209026_100002529 | 199 |
| 732 | 3300025256 | Ga0209759_1000197 | Ga0209759_10001974 | 199 |
| 733 | 3300025258 | Ga0209129_1001297 | Ga0209129_10012979 | 199 |
| 734 | 3300025258 | Ga0209129_1004815 | Ga0209129_10048153 | 199 |
| 735 | 3300025258 | Ga0209129_1006772 | Ga0209129_10067722 | 199 |
| 736 | 3300025258 | Ga0209129_1006906 | Ga0209129_10069062 | 199 |
| 737 | 3300025273 | Ga0209673_1000023 | Ga0209673_1000023133 | 199 |
| 738 | 3300025273 | Ga0209673_1000212 | Ga0209673_100021273 | 199 |
| 739 | 3300025273 | Ga0209673_1000738 | Ga0209673_100073838 | 199 |
| 740 | 3300025273 | Ga0209673_1001452 | Ga0209673_100145225 | 199 |
| 741 | 3300025273 | Ga0209673_1080594 | Ga0209673_10805942 | 199 |
| 742 | 3300025284 | Ga0209130_1000001 | Ga0209130_1000001145 | 199 |
| 743 | 3300025291 | Ga0209675_1043675 | Ga0209675_10436751 | 199 |
| 744 | 3300025294 | Ga0209025_1000300 | Ga0209025_100030072 | 199 |
| 745 | 3300025294 | Ga0209025_1002603 | Ga0209025_10026032 | 199 |
| 746 | 3300025294 | Ga0209025_1004543 | Ga0209025_10045433 | 199 |
| 747 | 3300025295 | Ga0209564_1000112 | Ga0209564_1000112150 | 199 |
| 748 | 3300025295 | Ga0209564_1001278 | Ga0209564_10012788 | 199 |
| 749 | 3300025295 | Ga0209564_1001823 | Ga0209564_10018238 | 199 |
| 750 | 3300025295 | Ga0209564_1011616 | Ga0209564_10116162 | 199 |
| 751 | 3300025297 | Ga0209758_1000053 | Ga0209758_1000053260 | 199 |
| 752 | 3300025297 | Ga0209758_1001669 | Ga0209758_10016696 | 199 |
| 753 | 3300025297 | Ga0209758_1001814 | Ga0209758_10018146 | 199 |
| 754 | 3300025297 | Ga0209758_1006808 | Ga0209758_10068082 | 199 |
| 755 | 3300025297 | Ga0209758_1011938 | Ga0209758_10119385 | 199 |
| 756 | 3300025297 | Ga0209758_1054398 | Ga0209758_10543982 | 199 |
| 757 | 3300025298 | Ga0209050_1021630 | Ga0209050_10216302 | 199 |
| 758 | 3300025299 | Ga0209256_1000682 | Ga0209256_100068230 | 199 |
| 759 | 3300025299 | Ga0209256_1005449 | Ga0209256_10054495 | 199 |
| 760 | 3300025299 | Ga0209256_1018918 | Ga0209256_10189182 | 199 |
| 761 | 3300025299 | Ga0209256_1035268 | Ga0209256_10352682 | 199 |
| 762 | 3300025302 | Ga0207426_1000005 | Ga0207426_1000005750 | 199 |
| 763 | 3300025302 | Ga0207426_1000035 | Ga0207426_1000035349 | 199 |
| 764 | 3300025303 | Ga0209051_1000249 | Ga0209051_100024952 | 199 |
| 765 | 3300025303 | Ga0209051_1003488 | Ga0209051_10034886 | 199 |
| 766 | 3300025303 | Ga0209051_1015466 | Ga0209051_10154664 | 199 |
| 767 | 3300025303 | Ga0209051_1018238 | Ga0209051_10182382 | 199 |
| 768 | 3300025304 | Ga0209257_1015285 | Ga0209257_10152852 | 199 |
| 769 | 3300025304 | Ga0209257_1033816 | Ga0209257_10338162 | 199 |
| 770 | 3300025913 | Ga0207695_10063883 | Ga0207695_100638834 | 199 |
| 771 | 3300025931 | Ga0207644_10019053 | Ga0207644_100190532 | 199 |
| 772 | 3300025986 | Ga0207658_10148591 | Ga0207658_101485912 | 199 |
| 773 | 3300026023 | Ga0207677_10433647 | Ga0207677_104336472 | 199 |
| 774 | 3300026075 | Ga0207708_10252510 | Ga0207708_102525101 | 199 |
| 775 | 3300026088 | Ga0207641_10345476 | Ga0207641_103454763 | 199 |
| 776 | 3300027866 | Ga0209813_10043387 | Ga0209813_100433872 | 199 |
| 777 | 3300028379 | Ga0268266_11051058 | Ga0268266_110510581 | 199 |
| 778 | 3300028794 | Ga0307515_10005525 | Ga0307515_1000552515 | 199 |
| 779 | 3300031456 | Ga0307513_10018285 | Ga0307513_100182856 | 199 |
| 780 | 3300031901 | Ga0307406_10285536 | Ga0307406_102855362 | 199 |
| 781 | 3300041404 | Ga0439436_0060725 | Ga0439436_0060725_385_996 | 199 |
| 782 | 3300041413 | Ga0439465_0017127 | Ga0439465_0017127_227_838 | 199 |
| 783 | 3300041413 | Ga0439465_0089500 | Ga0439465_0089500_103_714 | 199 |
| 784 | 3300041491 | Ga0451833_0022715 | Ga0451833_0022715_414_1025 | 199 |
| 785 | 3300041491 | Ga0451833_0262634 | Ga0451833_0262634_38_649 | 199 |
| 786 | 3300041492 | Ga0451835_1112531 | Ga0451835_1112531_463_1074 | 199 |
| 787 | 3300041494 | Ga0451837_1671410 | Ga0451837_1671410_16_627 | 199 |
| 788 | 3300041501 | Ga0451845_0221428 | Ga0451845_0221428_669_1280 | 199 |
| 789 | 3300041501 | Ga0451845_0821064 | Ga0451845_0821064_183_794 | 199 |
| 790 | 3300041512 | Ga0451853_1015694 | Ga0451853_1015694_111_722 | 199 |
| 791 | 3300042007 | Ga0439449_0070138 | Ga0439449_0070138_648_1259 | 199 |
| 792 | 3300046474 | Ga0495605_0000656 | Ga0495605_0000656_13706_14317 | 199 |
| 793 | 3300046474 | Ga0495605_0072931 | Ga0495605_0072931_454_1065 | 199 |
| 794 | 3300046501 | Ga0495607_0036759 | Ga0495607_0036759_1150_1761 | 199 |
| 795 | 3300046506 | Ga0495583_0036571 | Ga0495583_0036571_972_1583 | 199 |
| 796 | 3300046507 | Ga0495606_0168843 | Ga0495606_0168843_50_661 | 199 |
| 797 | 3300046512 | Ga0495610_0012498 | Ga0495610_0012498_82_693 | 199 |
| 798 | 3300046518 | Ga0495631_0000923 | Ga0495631_0000923_302_913 | 199 |
| 799 | 3300046518 | Ga0495631_0069673 | Ga0495631_0069673_808_1419 | 199 |
| 800 | 3300046519 | Ga0495632_0081758 | Ga0495632_0081758_883_1494 | 199 |
| 801 | 3300046522 | Ga0495643_0002915 | Ga0495643_0002915_2743_3354 | 199 |
| 802 | 3300046522 | Ga0495643_0007905 | Ga0495643_0007905_1951_2562 | 199 |
| 803 | 3300046522 | Ga0495643_0165626 | Ga0495643_0165626_460_1071 | 199 |
| 804 | 3300046542 | Ga0495597_0022857 | Ga0495597_0022857_164_775 | 199 |
| 805 | 3300046558 | Ga0495633_0200942 | Ga0495633_0200942_225_836 | 199 |
| 806 | 3300046616 | Ga0495668_0011868 | Ga0495668_0011868_284_895 | 199 |
| 807 | 3300046648 | Ga0495611_0018352 | Ga0495611_0018352_208_819 | 199 |
| 808 | 3300046660 | Ga0495625_0004259 | Ga0495625_0004259_7731_8342 | 199 |
| 809 | 3300046810 | Ga0495660_0062761 | Ga0495660_0062761_16_627 | 199 |
| 810 | 3300046810 | Ga0495660_0155778 | Ga0495660_0155778_354_965 | 199 |
| 811 | 3300047320 | Ga0495672_0049491 | Ga0495672_0049491_1434_2045 | 199 |
| 812 | 3300048091 | Ga0495626_0110637 | Ga0495626_0110637_414_1025 | 199 |
| 813 | 3300048905 | Ga0496102_0491432 | Ga0496102_0491432_258_869 | 199 |
| 814 | 3300048909 | Ga0496106_0000269 | Ga0496106_0000269_1360_1971 | 199 |
| 815 | 3300048920 | Ga0496117_0013051 | Ga0496117_0013051_27_638 | 199 |
| 816 | 3300048921 | Ga0496118_0013019 | Ga0496118_0013019_343_954 | 199 |
| 817 | 3300048924 | Ga0496121_0055728 | Ga0496121_0055728_1992_2603 | 199 |
| 818 | 3300048926 | Ga0496123_0230474 | Ga0496123_0230474_190_801 | 199 |
| 819 | 3300048927 | Ga0496124_0069789 | Ga0496124_0069789_630_1241 | 199 |
| 820 | 3300048928 | Ga0496125_0186218 | Ga0496125_0186218_52_663 | 199 |
| 821 | 3300049568 | Ga0501031_0280265 | Ga0501031_0280265_85_696 | 199 |
| 822 | 3300049569 | Ga0501032_0000023 | Ga0501032_0000023_82309_82917 | 199 |
| 823 | 3300049569 | Ga0501032_0231499 | Ga0501032_0231499_341_952 | 199 |
| 824 | 3300049569 | Ga0501032_0284598 | Ga0501032_0284598_198_809 | 199 |
| 825 | 3300049570 | Ga0501033_0000104 | Ga0501033_0000104_18589_19197 | 199 |
| 826 | 3300049571 | Ga0501034_0000116 | Ga0501034_0000116_63526_64134 | 199 |
| 827 | 3300049572 | Ga0501036_0000015 | Ga0501036_0000015_63526_64134 | 199 |
| 828 | 3300049572 | Ga0501036_0385722 | Ga0501036_0385722_238_849 | 199 |
| 829 | 3300049573 | Ga0501037_0000023 | Ga0501037_0000023_63626_64234 | 199 |
| 830 | 3300049573 | Ga0501037_0234782 | Ga0501037_0234782_245_856 | 199 |
| 831 | 3300049574 | Ga0501038_0000025 | Ga0501038_0000025_63626_64234 | 199 |
| 832 | 3300049574 | Ga0501038_0368599 | Ga0501038_0368599_382_993 | 199 |
| 833 | 3300049575 | Ga0501039_0000037 | Ga0501039_0000037_63526_64134 | 199 |
| 834 | 3300049576 | Ga0501040_0006421 | Ga0501040_0006421_2146_2754 | 199 |
| 835 | 3300049579 | Ga0501043_0000070 | Ga0501043_0000070_6962_7570 | 199 |
| 836 | 3300049579 | Ga0501043_0412182 | Ga0501043_0412182_279_890 | 199 |
| 837 | 3300049581 | Ga0501047_0002287 | Ga0501047_0002287_2143_2751 | 199 |
| 838 | 3300049581 | Ga0501047_0202116 | Ga0501047_0202116_960_1571 | 199 |
| 839 | 3300049581 | Ga0501047_0311468 | Ga0501047_0311468_542_1153 | 199 |
| 840 | 3300049583 | Ga0501067_0015101 | Ga0501067_0015101_2640_3251 | 199 |
| 841 | 3300049586 | Ga0501070_0022526 | Ga0501070_0022526_3125_3733 | 199 |
| 842 | 3300049589 | Ga0501073_0323530 | Ga0501073_0323530_103_714 | 199 |
| 843 | 3300049590 | Ga0501074_0157201 | Ga0501074_0157201_168_776 | 199 |
| 844 | 3300049592 | Ga0501076_0242941 | Ga0501076_0242941_392_1003 | 199 |
| 845 | 3300049593 | Ga0501077_0022616 | Ga0501077_0022616_2941_3552 | 199 |
| 846 | 3300049744 | Ga0501083_0010111 | Ga0501083_0010111_2951_3562 | 199 |
| 847 | 3300049822 | Ga0501035_0000074 | Ga0501035_0000074_63507_64115 | 199 |
| 848 | 3300049822 | Ga0501035_0159957 | Ga0501035_0159957_193_804 | 199 |
| 849 | 3300049823 | Ga0501044_0000069 | Ga0501044_0000069_61841_62449 | 199 |
| 850 | 3300050494 | nmdc:mga06z11_35364_c1 | nmdc:mga06z11_35364_c1_1733_2344 | 199 |
| 851 | 3300050496 | nmdc:mga07m45_10536_c1 | nmdc:mga07m45_10536_c1_736_1347 | 199 |
| 852 | 3300053086 | Ga0500578_0183781 | Ga0500578_0183781_463_1074 | 199 |
| 853 | 3300053105 | Ga0500557_001166 | Ga0500557_001166_3270_3881 | 199 |
| 854 | 3300053109 | Ga0500569_046751 | Ga0500569_046751_163_774 | 199 |
| 855 | 3300053118 | Ga0500594_0006266 | Ga0500594_0006266_258_869 | 199 |
| 856 | 3300053129 | Ga0500628_038589 | Ga0500628_038589_102_713 | 199 |
| 857 | 3300053134 | Ga0500658_0024481 | Ga0500658_0024481_1300_1911 | 199 |
| 858 | 3300053139 | Ga0500568_0000152 | Ga0500568_0000152_15_626 | 199 |
| 859 | 3300053139 | Ga0500568_0000695 | Ga0500568_0000695_8578_9189 | 199 |
| 860 | 3300053151 | Ga0500604_0065295 | Ga0500604_0065295_113_724 | 199 |
| 861 | 3300053153 | Ga0500616_0005593 | Ga0500616_0005593_5441_6052 | 199 |
| 862 | 3300053153 | Ga0500616_0012753 | Ga0500616_0012753_3833_4444 | 199 |
| 863 | 3300053156 | Ga0500622_0000185 | Ga0500622_0000185_52840_53451 | 199 |
| 864 | 3300053160 | Ga0500633_0019408 | Ga0500633_0019408_1328_1939 | 199 |
| 865 | 3300054114 | Ga0501084_0151587 | Ga0501084_0151587_1003_1614 | 199 |
| 866 | 3300054114 | Ga0501084_0237865 | Ga0501084_0237865_481_1092 | 199 |
| 867 | iso_pu_bacteria | 2599185299 | 2599928601 | 199 |
| 868 | iso_pu_bacteria | 2648501693 | 2650898176 | 199 |
| 869 | iso_pu_bacteria | 2684622997 | 2686355180 | 199 |
| 870 | iso_pu_bacteria | 2808606414 | 2809127465 | 199 |
| 871 | iso_pu_bacteria | 2840878972 | 2840883342 | 199 |
| 872 | iso_pu_bacteria | 2847797336 | 2847798093 | 199 |
| 873 | iso_pu_bacteria | 2869169390 | 2869170286 | 199 |
| 874 | iso_pu_bacteria | 2884086401 | 2884088663 | 199 |
| 875 | iso_pu_bacteria | 2984494565 | 2984495084 | 199 |
| 876 | iso_pu_bacteria | 2990261002 | 2990263165 | 199 |
| 877 | iso_pu_bacteria | 8004592986 | 8004596638 | 199 |
| 878 | 3300001979 | JGI24740J21852_10002540 | JGI24740J21852_1000254010 | 200 |
| 879 | 3300001989 | JGI24739J22299_10039807 | JGI24739J22299_100398072 | 200 |
| 880 | 3300001989 | JGI24739J22299_10068872 | JGI24739J22299_100688721 | 200 |
| 881 | 3300002067 | JGI24735J21928_10036100 | JGI24735J21928_100361002 | 200 |
| 882 | 3300002705 | JGI25156J39149_1000523 | JGI25156J39149_10005239 | 200 |
| 883 | 3300002737 | JGI25162J39368_1000656 | JGI25162J39368_10006567 | 200 |
| 884 | 3300002737 | JGI25162J39368_1000744 | JGI25162J39368_100074415 | 200 |
| 885 | 3300002738 | JGI25154J39366_1000435 | JGI25154J39366_10004359 | 200 |
| 886 | 3300002739 | JGI25158J39367_1007582 | JGI25158J39367_10075822 | 200 |
| 887 | 3300002741 | JGI25157J39369_1000562 | JGI25157J39369_10005629 | 200 |
| 888 | 3300002773 | JGI25152J39213_1000009 | JGI25152J39213_1000009119 | 200 |
| 889 | 3300002773 | JGI25152J39213_1003290 | JGI25152J39213_10032905 | 200 |
| 890 | 3300002774 | JGI25150J39212_1000016 | JGI25150J39212_100001616 | 200 |
| 891 | 3300002987 | JGI25159J45721_1000083 | JGI25159J45721_100008340 | 200 |
| 892 | 3300002987 | JGI25159J45721_1000466 | JGI25159J45721_100046611 | 200 |
| 893 | 3300002987 | JGI25159J45721_1000902 | JGI25159J45721_100090213 | 200 |
| 894 | 3300002987 | JGI25159J45721_1008601 | JGI25159J45721_10086012 | 200 |
| 895 | 3300003187 | JGI25151J46595_10000073 | JGI25151J46595_10000073118 | 200 |
| 896 | 3300003214 | JGI25165J46597_1000015 | JGI25165J46597_1000015301 | 200 |
| 897 | 3300003214 | JGI25165J46597_1000018 | JGI25165J46597_1000018250 | 200 |
| 898 | 3300003214 | JGI25165J46597_1000407 | JGI25165J46597_100040737 | 200 |
| 899 | 3300003214 | JGI25165J46597_1003522 | JGI25165J46597_10035224 | 200 |
| 900 | 3300003215 | JGI25153J46596_10008048 | JGI25153J46596_100080485 | 200 |
| 901 | 3300003322 | rootL2_10132451 | rootL2_101324512 | 200 |
| 902 | 3300003323 | rootH1_10031251 | rootH1_100312512 | 200 |
| 903 | 3300003323 | rootH1_10033851 | rootH1_100338513 | 200 |
| 904 | 3300003354 | JGI25160J50197_1000005 | JGI25160J50197_100000546 | 200 |
| 905 | 3300003354 | JGI25160J50197_1000014 | JGI25160J50197_1000014191 | 200 |
| 906 | 3300003374 | JGI25161J50226_1000022 | JGI25161J50226_100002291 | 200 |
| 907 | 3300003374 | JGI25161J50226_1001121 | JGI25161J50226_10011215 | 200 |
| 908 | 3300003578 | Ga0006562J51391_1035319 | Ga0006562J51391_10353192 | 200 |
| 909 | 3300003762 | Ga0055542_1000227 | Ga0055542_100022750 | 200 |
| 910 | 3300003763 | Ga0055529_1006674 | Ga0055529_10066742 | 200 |
| 911 | 3300003771 | Ga0055526_1002592 | Ga0055526_100259211 | 200 |
| 912 | 3300003771 | Ga0055526_1010076 | Ga0055526_10100765 | 200 |
| 913 | 3300003775 | Ga0055524_1000581 | Ga0055524_10005816 | 200 |
| 914 | 3300003775 | Ga0055524_1007283 | Ga0055524_10072834 | 200 |
| 915 | 3300003775 | Ga0055524_1022464 | Ga0055524_10224643 | 200 |
| 916 | 3300003775 | Ga0055524_1044601 | Ga0055524_10446012 | 200 |
| 917 | 3300003781 | Ga0055536_1008001 | Ga0055536_10080015 | 200 |
| 918 | 3300003790 | Ga0055528_1000917 | Ga0055528_100091711 | 200 |
| 919 | 3300003790 | Ga0055528_1004532 | Ga0055528_10045325 | 200 |
| 920 | 3300003791 | Ga0055530_10019390 | Ga0055530_100193903 | 200 |
| 921 | 3300003792 | Ga0055540_1008862 | Ga0055540_10088622 | 200 |
| 922 | 3300003792 | Ga0055540_1015678 | Ga0055540_10156783 | 200 |
| 923 | 3300003792 | Ga0055540_1028599 | Ga0055540_10285992 | 200 |
| 924 | 3300003794 | Ga0055531_10004249 | Ga0055531_100042492 | 200 |
| 925 | 3300004625 | Ga0055543_1000005 | Ga0055543_100000542 | 200 |
| 926 | 3300004625 | Ga0055543_1000324 | Ga0055543_100032426 | 200 |
| 927 | 3300005262 | Ga0065165_1000002 | Ga0065165_1000002344 | 200 |
| 928 | 3300005262 | Ga0065165_1000463 | Ga0065165_100046323 | 200 |
| 929 | 3300005262 | Ga0065165_1005453 | Ga0065165_10054532 | 200 |
| 930 | 3300005289 | Ga0065704_10025103 | Ga0065704_100251032 | 200 |
| 931 | 3300005339 | Ga0070660_100065214 | Ga0070660_1000652141 | 200 |
| 932 | 3300005339 | Ga0070660_101030725 | Ga0070660_1010307251 | 200 |
| 933 | 3300005367 | Ga0070667_100081022 | Ga0070667_1000810222 | 200 |
| 934 | 3300005367 | Ga0070667_100746268 | Ga0070667_1007462682 | 200 |
| 935 | 3300005455 | Ga0070663_100074899 | Ga0070663_1000748994 | 200 |
| 936 | 3300005459 | Ga0068867_100195236 | Ga0068867_1001952362 | 200 |
| 937 | 3300005539 | Ga0068853_100023496 | Ga0068853_1000234964 | 200 |
| 938 | 3300005539 | Ga0068853_100173117 | Ga0068853_1001731173 | 200 |
| 939 | 3300005539 | Ga0068853_100251426 | Ga0068853_1002514262 | 200 |
| 940 | 3300005548 | Ga0070665_100037012 | Ga0070665_1000370122 | 200 |
| 941 | 3300005548 | Ga0070665_100044042 | Ga0070665_1000440422 | 200 |
| 942 | 3300005548 | Ga0070665_100069048 | Ga0070665_1000690482 | 200 |
| 943 | 3300005548 | Ga0070665_100496181 | Ga0070665_1004961812 | 200 |
| 944 | 3300005563 | Ga0068855_100285588 | Ga0068855_1002855882 | 200 |
| 945 | 3300005563 | Ga0068855_100369898 | Ga0068855_1003698982 | 200 |
| 946 | 3300005563 | Ga0068855_100868113 | Ga0068855_1008681131 | 200 |
| 947 | 3300005563 | Ga0068855_101114054 | Ga0068855_1011140541 | 200 |
| 948 | 3300005577 | Ga0068857_100059870 | Ga0068857_1000598702 | 200 |
| 949 | 3300005578 | Ga0068854_100288668 | Ga0068854_1002886682 | 200 |
| 950 | 3300005578 | Ga0068854_100986173 | Ga0068854_1009861731 | 200 |
| 951 | 3300005614 | Ga0068856_100057963 | Ga0068856_1000579633 | 200 |
| 952 | 3300005614 | Ga0068856_100228578 | Ga0068856_1002285782 | 200 |
| 953 | 3300005614 | Ga0068856_100228829 | Ga0068856_1002288292 | 200 |
| 954 | 3300005616 | Ga0068852_100070158 | Ga0068852_1000701582 | 200 |
| 955 | 3300005834 | Ga0068851_10373325 | Ga0068851_103733252 | 200 |
| 956 | 3300005834 | Ga0068851_10430400 | Ga0068851_104304001 | 200 |
| 957 | 3300005983 | Ga0081540_1010250 | Ga0081540_10102506 | 200 |
| 958 | 3300006038 | Ga0075365_10002167 | Ga0075365_1000216711 | 200 |
| 959 | 3300006038 | Ga0075365_10007595 | Ga0075365_100075953 | 200 |
| 960 | 3300006038 | Ga0075365_10012364 | Ga0075365_100123646 | 200 |
| 961 | 3300006038 | Ga0075365_10130762 | Ga0075365_101307622 | 200 |
| 962 | 3300006038 | Ga0075365_10423392 | Ga0075365_104233921 | 200 |
| 963 | 3300006038 | Ga0075365_10798963 | Ga0075365_107989631 | 200 |
| 964 | 3300006042 | Ga0075368_10267597 | Ga0075368_102675972 | 200 |
| 965 | 3300006048 | Ga0075363_100038848 | Ga0075363_1000388482 | 200 |
| 966 | 3300006048 | Ga0075363_100059224 | Ga0075363_1000592243 | 200 |
| 967 | 3300006048 | Ga0075363_100096793 | Ga0075363_1000967931 | 200 |
| 968 | 3300006048 | Ga0075363_100116507 | Ga0075363_1001165072 | 200 |
| 969 | 3300006048 | Ga0075363_100125359 | Ga0075363_1001253592 | 200 |
| 970 | 3300006051 | Ga0075364_10001924 | Ga0075364_100019247 | 200 |
| 971 | 3300006051 | Ga0075364_10225773 | Ga0075364_102257732 | 200 |
| 972 | 3300006051 | Ga0075364_10413934 | Ga0075364_104139342 | 200 |
| 973 | 3300006177 | Ga0075362_10296222 | Ga0075362_102962222 | 200 |
| 974 | 3300006178 | Ga0075367_10001150 | Ga0075367_100011506 | 200 |
| 975 | 3300006178 | Ga0075367_10008246 | Ga0075367_100082466 | 200 |
| 976 | 3300006178 | Ga0075367_10018335 | Ga0075367_100183352 | 200 |
| 977 | 3300006178 | Ga0075367_10097012 | Ga0075367_100970122 | 200 |
| 978 | 3300006178 | Ga0075367_10144934 | Ga0075367_101449341 | 200 |
| 979 | 3300006178 | Ga0075367_10242020 | Ga0075367_102420202 | 200 |
| 980 | 3300006186 | Ga0075369_10003976 | Ga0075369_100039762 | 200 |
| 981 | 3300006186 | Ga0075369_10045840 | Ga0075369_100458403 | 200 |
| 982 | 3300006186 | Ga0075369_10054368 | Ga0075369_100543683 | 200 |
| 983 | 3300006186 | Ga0075369_10100652 | Ga0075369_101006522 | 200 |
| 984 | 3300006353 | Ga0075370_10075341 | Ga0075370_100753414 | 200 |
| 985 | 3300006353 | Ga0075370_10106219 | Ga0075370_101062192 | 200 |
| 986 | 3300006946 | Ga0079104_1000014 | Ga0079104_100001431 | 200 |
| 987 | 3300006946 | Ga0079104_1000183 | Ga0079104_100018382 | 200 |
| 988 | 3300009093 | Ga0105240_10000012 | Ga0105240_1000001234 | 200 |
| 989 | 3300009093 | Ga0105240_10242127 | Ga0105240_102421272 | 200 |
| 990 | 3300009093 | Ga0105240_10678091 | Ga0105240_106780912 | 200 |
| 991 | 3300009093 | Ga0105240_10793738 | Ga0105240_107937381 | 200 |
| 992 | 3300009148 | Ga0105243_10023977 | Ga0105243_100239777 | 200 |
| 993 | 3300009174 | Ga0105241_10269253 | Ga0105241_102692532 | 200 |
| 994 | 3300009177 | Ga0105248_10755010 | Ga0105248_107550102 | 200 |
| 995 | 3300009545 | Ga0105237_10000165 | Ga0105237_1000016545 | 200 |
| 996 | 3300009551 | Ga0105238_10007244 | Ga0105238_1000724411 | 200 |
| 997 | 3300009551 | Ga0105238_10197142 | Ga0105238_101971422 | 200 |
| 998 | 3300009553 | Ga0105249_11055565 | Ga0105249_110555652 | 200 |
| 999 | 3300009763 | Ga0123340_1055299 | Ga0123340_10552992 | 200 |
| 1000 | 3300010375 | Ga0105239_10000471 | Ga0105239_1000047128 | 200 |
| 1001 | 3300010375 | Ga0105239_10045062 | Ga0105239_100450627 | 200 |
| 1002 | 3300010375 | Ga0105239_10074454 | Ga0105239_100744543 | 200 |
| 1003 | 3300010375 | Ga0105239_10078448 | Ga0105239_100784482 | 200 |
| 1004 | 3300010375 | Ga0105239_10265712 | Ga0105239_102657122 | 200 |
| 1005 | 3300010375 | Ga0105239_10311827 | Ga0105239_103118272 | 200 |
| 1006 | 3300010375 | Ga0105239_11028585 | Ga0105239_110285852 | 200 |
| 1007 | 3300011119 | Ga0105246_10691753 | Ga0105246_106917532 | 200 |
| 1008 | 3300013104 | Ga0157370_10003232 | Ga0157370_100032324 | 200 |
| 1009 | 3300013105 | Ga0157369_10127996 | Ga0157369_101279962 | 200 |
| 1010 | 3300013249 | Ga0171463_1013 | Ga0171463_101366 | 200 |
| 1011 | 3300013296 | Ga0157374_10292302 | Ga0157374_102923022 | 200 |
| 1012 | 3300013306 | Ga0163162_10140642 | Ga0163162_101406422 | 200 |
| 1013 | 3300014325 | Ga0163163_10746476 | Ga0163163_107464762 | 200 |
| 1014 | 3300014497 | Ga0182008_10055693 | Ga0182008_100556932 | 200 |
| 1015 | 3300015261 | Ga0182006_1059859 | Ga0182006_10598592 | 200 |
| 1016 | 3300015262 | Ga0182007_10000763 | Ga0182007_100007635 | 200 |
| 1017 | 3300015265 | Ga0182005_1005468 | Ga0182005_10054683 | 200 |
| 1018 | 3300015690 | Ga0183363_1409 | Ga0183363_14092 | 200 |
| 1019 | 3300021320 | Ga0214544_1000130 | Ga0214544_100013046 | 200 |
| 1020 | 3300021321 | Ga0214542_1000014 | Ga0214542_100001457 | 200 |
| 1021 | 3300021327 | Ga0214543_1000146 | Ga0214543_100014657 | 200 |
| 1022 | 3300025206 | Ga0209435_100025 | Ga0209435_100025176 | 200 |
| 1023 | 3300025208 | Ga0209436_100162 | Ga0209436_10016216 | 200 |
| 1024 | 3300025208 | Ga0209436_107779 | Ga0209436_1077792 | 200 |
| 1025 | 3300025233 | Ga0209437_100022 | Ga0209437_100022311 | 200 |
| 1026 | 3300025233 | Ga0209437_100040 | Ga0209437_100040348 | 200 |
| 1027 | 3300025245 | Ga0207425_1000054 | Ga0207425_100005417 | 200 |
| 1028 | 3300025246 | Ga0209646_1000083 | Ga0209646_1000083176 | 200 |
| 1029 | 3300025250 | Ga0209026_1000078 | Ga0209026_1000078176 | 200 |
| 1030 | 3300025253 | Ga0209677_100515 | Ga0209677_1005157 | 200 |
| 1031 | 3300025253 | Ga0209677_108945 | Ga0209677_1089453 | 200 |
| 1032 | 3300025254 | Ga0209148_1000057 | Ga0209148_100005753 | 200 |
| 1033 | 3300025256 | Ga0209759_1000060 | Ga0209759_1000060176 | 200 |
| 1034 | 3300025258 | Ga0209129_1000016 | Ga0209129_1000016267 | 200 |
| 1035 | 3300025258 | Ga0209129_1000108 | Ga0209129_100010817 | 200 |
| 1036 | 3300025258 | Ga0209129_1007558 | Ga0209129_10075585 | 200 |
| 1037 | 3300025258 | Ga0209129_1038819 | Ga0209129_10388192 | 200 |
| 1038 | 3300025261 | Ga0209233_1000010 | Ga0209233_1000010398 | 200 |
| 1039 | 3300025261 | Ga0209233_1000031 | Ga0209233_1000031311 | 200 |
| 1040 | 3300025261 | Ga0209233_1000051 | Ga0209233_1000051349 | 200 |
| 1041 | 3300025261 | Ga0209233_1000346 | Ga0209233_10003467 | 200 |
| 1042 | 3300025261 | Ga0209233_1006948 | Ga0209233_10069485 | 200 |
| 1043 | 3300025263 | Ga0209565_1058203 | Ga0209565_10582031 | 200 |
| 1044 | 3300025272 | Ga0209455_1000224 | Ga0209455_10002249 | 200 |
| 1045 | 3300025272 | Ga0209455_1015739 | Ga0209455_10157392 | 200 |
| 1046 | 3300025273 | Ga0209673_1000005 | Ga0209673_1000005329 | 200 |
| 1047 | 3300025273 | Ga0209673_1029612 | Ga0209673_10296122 | 200 |
| 1048 | 3300025273 | Ga0209673_1053764 | Ga0209673_10537642 | 200 |
| 1049 | 3300025284 | Ga0209130_1000010 | Ga0209130_1000010340 | 200 |
| 1050 | 3300025284 | Ga0209130_1000013 | Ga0209130_1000013339 | 200 |
| 1051 | 3300025284 | Ga0209130_1019868 | Ga0209130_10198682 | 200 |
| 1052 | 3300025292 | Ga0209676_1005657 | Ga0209676_10056576 | 200 |
| 1053 | 3300025294 | Ga0209025_1000189 | Ga0209025_100018917 | 200 |
| 1054 | 3300025294 | Ga0209025_1002184 | Ga0209025_100218413 | 200 |
| 1055 | 3300025294 | Ga0209025_1056157 | Ga0209025_10561572 | 200 |
| 1056 | 3300025294 | Ga0209025_1067969 | Ga0209025_10679692 | 200 |
| 1057 | 3300025295 | Ga0209564_1000025 | Ga0209564_10000255 | 200 |
| 1058 | 3300025295 | Ga0209564_1007604 | Ga0209564_10076045 | 200 |
| 1059 | 3300025295 | Ga0209564_1026842 | Ga0209564_10268421 | 200 |
| 1060 | 3300025295 | Ga0209564_1029039 | Ga0209564_10290392 | 200 |
| 1061 | 3300025297 | Ga0209758_1000162 | Ga0209758_1000162137 | 200 |
| 1062 | 3300025297 | Ga0209758_1001361 | Ga0209758_100136123 | 200 |
| 1063 | 3300025297 | Ga0209758_1016362 | Ga0209758_10163622 | 200 |
| 1064 | 3300025297 | Ga0209758_1031255 | Ga0209758_10312552 | 200 |
| 1065 | 3300025298 | Ga0209050_1012499 | Ga0209050_10124993 | 200 |
| 1066 | 3300025299 | Ga0209256_1000828 | Ga0209256_100082835 | 200 |
| 1067 | 3300025299 | Ga0209256_1001472 | Ga0209256_10014728 | 200 |
| 1068 | 3300025299 | Ga0209256_1006490 | Ga0209256_10064902 | 200 |
| 1069 | 3300025299 | Ga0209256_1024559 | Ga0209256_10245592 | 200 |
| 1070 | 3300025299 | Ga0209256_1044948 | Ga0209256_10449482 | 200 |
| 1071 | 3300025299 | Ga0209256_1059372 | Ga0209256_10593721 | 200 |
| 1072 | 3300025299 | Ga0209256_1061702 | Ga0209256_10617021 | 200 |
| 1073 | 3300025302 | Ga0207426_1000022 | Ga0207426_100002242 | 200 |
| 1074 | 3300025302 | Ga0207426_1000036 | Ga0207426_1000036340 | 200 |
| 1075 | 3300025302 | Ga0207426_1002507 | Ga0207426_10025073 | 200 |
| 1076 | 3300025303 | Ga0209051_1012393 | Ga0209051_10123934 | 200 |
| 1077 | 3300025303 | Ga0209051_1015051 | Ga0209051_10150512 | 200 |
| 1078 | 3300025304 | Ga0209257_1019467 | Ga0209257_10194672 | 200 |
| 1079 | 3300025321 | Ga0207656_10103144 | Ga0207656_101031442 | 200 |
| 1080 | 3300025904 | Ga0207647_10004710 | Ga0207647_100047109 | 200 |
| 1081 | 3300025904 | Ga0207647_10041929 | Ga0207647_100419293 | 200 |
| 1082 | 3300025904 | Ga0207647_10078474 | Ga0207647_100784743 | 200 |
| 1083 | 3300025909 | Ga0207705_10048791 | Ga0207705_100487913 | 200 |
| 1084 | 3300025909 | Ga0207705_10198955 | Ga0207705_101989551 | 200 |
| 1085 | 3300025911 | Ga0207654_10159710 | Ga0207654_101597102 | 200 |
| 1086 | 3300025913 | Ga0207695_10000120 | Ga0207695_10000120180 | 200 |
| 1087 | 3300025914 | Ga0207671_10005869 | Ga0207671_100058692 | 200 |
| 1088 | 3300025914 | Ga0207671_10006498 | Ga0207671_100064986 | 200 |
| 1089 | 3300025914 | Ga0207671_10188081 | Ga0207671_101880812 | 200 |
| 1090 | 3300025914 | Ga0207671_10485790 | Ga0207671_104857902 | 200 |
| 1091 | 3300025919 | Ga0207657_10068924 | Ga0207657_100689242 | 200 |
| 1092 | 3300025919 | Ga0207657_10727149 | Ga0207657_107271491 | 200 |
| 1093 | 3300025924 | Ga0207694_10003375 | Ga0207694_1000337511 | 200 |
| 1094 | 3300025941 | Ga0207711_10590015 | Ga0207711_105900152 | 200 |
| 1095 | 3300025949 | Ga0207667_10035853 | Ga0207667_100358532 | 200 |
| 1096 | 3300025949 | Ga0207667_11206426 | Ga0207667_112064261 | 200 |
| 1097 | 3300025961 | Ga0207712_10973330 | Ga0207712_109733302 | 200 |
| 1098 | 3300025981 | Ga0207640_10066295 | Ga0207640_100662953 | 200 |
| 1099 | 3300025981 | Ga0207640_10335157 | Ga0207640_103351572 | 200 |
| 1100 | 3300025981 | Ga0207640_10703352 | Ga0207640_107033522 | 200 |
| 1101 | 3300025986 | Ga0207658_10052457 | Ga0207658_100524572 | 200 |
| 1102 | 3300026041 | Ga0207639_10010731 | Ga0207639_100107313 | 200 |
| 1103 | 3300026067 | Ga0207678_10123964 | Ga0207678_101239642 | 200 |
| 1104 | 3300026078 | Ga0207702_10176078 | Ga0207702_101760782 | 200 |
| 1105 | 3300026078 | Ga0207702_10203762 | Ga0207702_102037622 | 200 |
| 1106 | 3300026078 | Ga0207702_10568939 | Ga0207702_105689391 | 200 |
| 1107 | 3300026089 | Ga0207648_10053834 | Ga0207648_100538342 | 200 |
| 1108 | 3300026116 | Ga0207674_10074635 | Ga0207674_100746354 | 200 |
| 1109 | 3300026142 | Ga0207698_10225286 | Ga0207698_102252862 | 200 |
| 1110 | 3300027111 | Ga0209281_1000032 | Ga0209281_100003233 | 200 |
| 1111 | 3300027111 | Ga0209281_1001369 | Ga0209281_100136915 | 200 |
| 1112 | 3300027312 | Ga0209371_1004078 | Ga0209371_10040786 | 200 |
| 1113 | 3300027866 | Ga0209813_10059974 | Ga0209813_100599742 | 200 |
| 1114 | 3300027866 | Ga0209813_10190147 | Ga0209813_101901471 | 200 |
| 1115 | 3300028379 | Ga0268266_10131420 | Ga0268266_101314203 | 200 |
| 1116 | 3300028379 | Ga0268266_10163214 | Ga0268266_101632142 | 200 |
| 1117 | 3300028379 | Ga0268266_10489607 | Ga0268266_104896072 | 200 |
| 1118 | 3300028794 | Ga0307515_10000375 | Ga0307515_10000375103 | 200 |
| 1119 | 3300028794 | Ga0307515_10013701 | Ga0307515_100137018 | 200 |
| 1120 | 3300030500 | Ga0268256_1002543 | Ga0268256_10025439 | 200 |
| 1121 | 3300031242 | Ga0265329_10099663 | Ga0265329_100996632 | 200 |
| 1122 | 3300031247 | Ga0265340_10044760 | Ga0265340_100447602 | 200 |
| 1123 | 3300031249 | Ga0265339_10073917 | Ga0265339_100739172 | 200 |
| 1124 | 3300031250 | Ga0265331_10094631 | Ga0265331_100946312 | 200 |
| 1125 | 3300031344 | Ga0265316_10084030 | Ga0265316_100840303 | 200 |
| 1126 | 3300031456 | Ga0307513_10002502 | Ga0307513_1000250213 | 200 |
| 1127 | 3300031456 | Ga0307513_10243339 | Ga0307513_102433392 | 200 |
| 1128 | 3300031548 | Ga0307408_100027204 | Ga0307408_1000272047 | 200 |
| 1129 | 3300031548 | Ga0307408_100404427 | Ga0307408_1004044272 | 200 |
| 1130 | 3300031595 | Ga0265313_10026994 | Ga0265313_100269943 | 200 |
| 1131 | 3300031711 | Ga0265314_10012378 | Ga0265314_100123788 | 200 |
| 1132 | 3300031712 | Ga0265342_10070611 | Ga0265342_100706113 | 200 |
| 1133 | 3300031901 | Ga0307406_10061831 | Ga0307406_100618312 | 200 |
| 1134 | 3300031911 | Ga0307412_10001094 | Ga0307412_1000109417 | 200 |
| 1135 | 3300032004 | Ga0307414_10114978 | Ga0307414_101149782 | 200 |
| 1136 | 3300032004 | Ga0307414_10200850 | Ga0307414_102008502 | 200 |
| 1137 | 3300037418 | Ga0395900_0053623 | Ga0395900_0053623_3282_3896 | 200 |
| 1138 | 3300037418 | Ga0395900_0106065 | Ga0395900_0106065_1017_1631 | 200 |
| 1139 | 3300037418 | Ga0395900_0802608 | Ga0395900_0802608_245_859 | 200 |
| 1140 | 3300037466 | Ga0395898_0248555 | Ga0395898_0248555_634_1248 | 200 |
| 1141 | 3300037471 | Ga0395905_0015787 | Ga0395905_0015787_3275_3889 | 200 |
| 1142 | 3300037471 | Ga0395905_0047229 | Ga0395905_0047229_898_1512 | 200 |
| 1143 | 3300037471 | Ga0395905_0077524 | Ga0395905_0077524_2356_2970 | 200 |
| 1144 | 3300037471 | Ga0395905_0122201 | Ga0395905_0122201_886_1500 | 200 |
| 1145 | 3300038443 | Ga0395901_0013219 | Ga0395901_0013219_2218_2832 | 200 |
| 1146 | 3300038443 | Ga0395901_0034009 | Ga0395901_0034009_2081_2695 | 200 |
| 1147 | 3300038443 | Ga0395901_0246976 | Ga0395901_0246976_579_1193 | 200 |
| 1148 | 3300038443 | Ga0395901_0728011 | Ga0395901_0728011_60_674 | 200 |
| 1149 | 3300041404 | Ga0439436_0005356 | Ga0439436_0005356_1941_2555 | 200 |
| 1150 | 3300041405 | Ga0439438_028498 | Ga0439438_028498_840_1454 | 200 |
| 1151 | 3300041405 | Ga0439438_084326 | Ga0439438_084326_38_652 | 200 |
| 1152 | 3300041413 | Ga0439465_0034315 | Ga0439465_0034315_929_1543 | 200 |
| 1153 | 3300041413 | Ga0439465_0069363 | Ga0439465_0069363_534_1148 | 200 |
| 1154 | 3300041512 | Ga0451853_1733039 | Ga0451853_1733039_151_765 | 200 |
| 1155 | 3300042007 | Ga0439449_0078029 | Ga0439449_0078029_276_890 | 200 |
| 1156 | 3300042145 | Ga0450906_003973 | Ga0450906_003973_179_793 | 200 |
| 1157 | 3300042185 | Ga0450909_041573 | Ga0450909_041573_16_630 | 200 |
| 1158 | 3300044683 | Ga0466965_0162018 | Ga0466965_0162018_477_1094 | 200 |
| 1159 | 3300044684 | Ga0466966_0070976 | Ga0466966_0070976_1341_1955 | 200 |
| 1160 | 3300044694 | Ga0466963_0040541 | Ga0466963_0040541_1914_2528 | 200 |
| 1161 | 3300044706 | Ga0466964_0121287 | Ga0466964_0121287_410_1024 | 200 |
| 1162 | 3300045836 | Ga0466958_0100342 | Ga0466958_0100342_1106_1720 | 200 |
| 1163 | 3300046455 | Ga0495603_0517187 | Ga0495603_0517187_32_652 | 200 |
| 1164 | 3300046460 | Ga0495638_0021565 | Ga0495638_0021565_637_1251 | 200 |
| 1165 | 3300046492 | Ga0495585_0084023 | Ga0495585_0084023_26_643 | 200 |
| 1166 | 3300046507 | Ga0495606_0001364 | Ga0495606_0001364_26343_26957 | 200 |
| 1167 | 3300046518 | Ga0495631_0070087 | Ga0495631_0070087_313_930 | 200 |
| 1168 | 3300046558 | Ga0495633_0202733 | Ga0495633_0202733_43_657 | 200 |
| 1169 | 3300046616 | Ga0495668_0476669 | Ga0495668_0476669_35_649 | 200 |
| 1170 | 3300046660 | Ga0495625_0171941 | Ga0495625_0171941_11_625 | 200 |
| 1171 | 3300046660 | Ga0495625_0285144 | Ga0495625_0285144_138_752 | 200 |
| 1172 | 3300046674 | Ga0495588_0029691 | Ga0495588_0029691_12_626 | 200 |
| 1173 | 3300046691 | Ga0495670_0179602 | Ga0495670_0179602_321_935 | 200 |
| 1174 | 3300047443 | Ga0495687_074300 | Ga0495687_074300_628_1242 | 200 |
| 1175 | 3300047470 | Ga0495681_0184670 | Ga0495681_0184670_29_643 | 200 |
| 1176 | 3300047472 | Ga0495686_0084127 | Ga0495686_0084127_1045_1659 | 200 |
| 1177 | 3300048903 | Ga0496100_0069676 | Ga0496100_0069676_862_1476 | 200 |
| 1178 | 3300048903 | Ga0496100_0094754 | Ga0496100_0094754_658_1272 | 200 |
| 1179 | 3300048904 | Ga0496101_0018036 | Ga0496101_0018036_342_956 | 200 |
| 1180 | 3300048904 | Ga0496101_0072335 | Ga0496101_0072335_427_1041 | 200 |
| 1181 | 3300048905 | Ga0496102_0004684 | Ga0496102_0004684_8213_8827 | 200 |
| 1182 | 3300048905 | Ga0496102_0042628 | Ga0496102_0042628_2498_3112 | 200 |
| 1183 | 3300048905 | Ga0496102_0287645 | Ga0496102_0287645_103_717 | 200 |
| 1184 | 3300048906 | Ga0496103_0001141 | Ga0496103_0001141_1814_2428 | 200 |
| 1185 | 3300048906 | Ga0496103_0138489 | Ga0496103_0138489_903_1517 | 200 |
| 1186 | 3300048907 | Ga0496104_0913166 | Ga0496104_0913166_109_723 | 200 |
| 1187 | 3300048908 | Ga0496105_0024345 | Ga0496105_0024345_1559_2173 | 200 |
| 1188 | 3300048908 | Ga0496105_0482790 | Ga0496105_0482790_41_655 | 200 |
| 1189 | 3300048911 | Ga0496108_0571435 | Ga0496108_0571435_37_651 | 200 |
| 1190 | 3300048913 | Ga0496110_0311716 | Ga0496110_0311716_228_842 | 200 |
| 1191 | 3300048915 | Ga0496112_0017411 | Ga0496112_0017411_588_1202 | 200 |
| 1192 | 3300048915 | Ga0496112_0056538 | Ga0496112_0056538_2813_3427 | 200 |
| 1193 | 3300048916 | Ga0496113_0116715 | Ga0496113_0116715_114_728 | 200 |
| 1194 | 3300048916 | Ga0496113_0431101 | Ga0496113_0431101_361_975 | 200 |
| 1195 | 3300048917 | Ga0496114_0496413 | Ga0496114_0496413_11_625 | 200 |
| 1196 | 3300048919 | Ga0496116_0006609 | Ga0496116_0006609_9463_10077 | 200 |
| 1197 | 3300048919 | Ga0496116_0079756 | Ga0496116_0079756_57_671 | 200 |
| 1198 | 3300048919 | Ga0496116_0159381 | Ga0496116_0159381_487_1101 | 200 |
| 1199 | 3300048919 | Ga0496116_0162962 | Ga0496116_0162962_188_802 | 200 |
| 1200 | 3300048920 | Ga0496117_0002913 | Ga0496117_0002913_16953_17567 | 200 |
| 1201 | 3300048920 | Ga0496117_0050229 | Ga0496117_0050229_128_742 | 200 |
| 1202 | 3300048920 | Ga0496117_0083586 | Ga0496117_0083586_1176_1790 | 200 |
| 1203 | 3300048920 | Ga0496117_0121928 | Ga0496117_0121928_97_711 | 200 |
| 1204 | 3300048920 | Ga0496117_0253991 | Ga0496117_0253991_162_776 | 200 |
| 1205 | 3300048921 | Ga0496118_0003707 | Ga0496118_0003707_16953_17567 | 200 |
| 1206 | 3300048921 | Ga0496118_0008892 | Ga0496118_0008892_7710_8324 | 200 |
| 1207 | 3300048921 | Ga0496118_0199382 | Ga0496118_0199382_30_644 | 200 |
| 1208 | 3300048922 | Ga0496119_0007795 | Ga0496119_0007795_2659_3273 | 200 |
| 1209 | 3300048922 | Ga0496119_0039398 | Ga0496119_0039398_1649_2263 | 200 |
| 1210 | 3300048922 | Ga0496119_0055029 | Ga0496119_0055029_1618_2232 | 200 |
| 1211 | 3300048922 | Ga0496119_0081512 | Ga0496119_0081512_214_828 | 200 |
| 1212 | 3300048923 | Ga0496120_0008875 | Ga0496120_0008875_2070_2684 | 200 |
| 1213 | 3300048923 | Ga0496120_0009699 | Ga0496120_0009699_3748_4362 | 200 |
| 1214 | 3300048923 | Ga0496120_0034977 | Ga0496120_0034977_715_1329 | 200 |
| 1215 | 3300048923 | Ga0496120_0139655 | Ga0496120_0139655_396_1010 | 200 |
| 1216 | 3300048923 | Ga0496120_0162375 | Ga0496120_0162375_21_635 | 200 |
| 1217 | 3300048923 | Ga0496120_0192844 | Ga0496120_0192844_135_749 | 200 |
| 1218 | 3300048924 | Ga0496121_0000174 | Ga0496121_0000174_112116_112730 | 200 |
| 1219 | 3300048924 | Ga0496121_0003584 | Ga0496121_0003584_3688_4302 | 200 |
| 1220 | 3300048924 | Ga0496121_0056408 | Ga0496121_0056408_294_908 | 200 |
| 1221 | 3300048924 | Ga0496121_0057718 | Ga0496121_0057718_1811_2425 | 200 |
| 1222 | 3300048924 | Ga0496121_0097359 | Ga0496121_0097359_260_874 | 200 |
| 1223 | 3300048924 | Ga0496121_0149667 | Ga0496121_0149667_457_1071 | 200 |
| 1224 | 3300048924 | Ga0496121_0171636 | Ga0496121_0171636_744_1358 | 200 |
| 1225 | 3300048924 | Ga0496121_0396374 | Ga0496121_0396374_170_784 | 200 |
| 1226 | 3300048924 | Ga0496121_0618368 | Ga0496121_0618368_10_624 | 200 |
| 1227 | 3300048925 | Ga0496122_0011815 | Ga0496122_0011815_7276_7890 | 200 |
| 1228 | 3300048925 | Ga0496122_0035663 | Ga0496122_0035663_944_1558 | 200 |
| 1229 | 3300048925 | Ga0496122_0066433 | Ga0496122_0066433_1538_2152 | 200 |
| 1230 | 3300048925 | Ga0496122_0086269 | Ga0496122_0086269_254_868 | 200 |
| 1231 | 3300048925 | Ga0496122_0139655 | Ga0496122_0139655_397_1011 | 200 |
| 1232 | 3300048926 | Ga0496123_0028116 | Ga0496123_0028116_3320_3934 | 200 |
| 1233 | 3300048926 | Ga0496123_0042384 | Ga0496123_0042384_775_1389 | 200 |
| 1234 | 3300048926 | Ga0496123_0081801 | Ga0496123_0081801_769_1383 | 200 |
| 1235 | 3300048927 | Ga0496124_0000200 | Ga0496124_0000200_38900_39514 | 200 |
| 1236 | 3300048927 | Ga0496124_0001776 | Ga0496124_0001776_27522_28136 | 200 |
| 1237 | 3300048927 | Ga0496124_0003927 | Ga0496124_0003927_10725_11339 | 200 |
| 1238 | 3300048927 | Ga0496124_0030008 | Ga0496124_0030008_105_719 | 200 |
| 1239 | 3300048927 | Ga0496124_0047267 | Ga0496124_0047267_1818_2432 | 200 |
| 1240 | 3300048927 | Ga0496124_0071883 | Ga0496124_0071883_2107_2721 | 200 |
| 1241 | 3300048927 | Ga0496124_0258095 | Ga0496124_0258095_44_658 | 200 |
| 1242 | 3300048928 | Ga0496125_0000982 | Ga0496125_0000982_8620_9234 | 200 |
| 1243 | 3300048928 | Ga0496125_0067409 | Ga0496125_0067409_231_845 | 200 |
| 1244 | 3300048928 | Ga0496125_0077925 | Ga0496125_0077925_1622_2236 | 200 |
| 1245 | 3300048928 | Ga0496125_0107652 | Ga0496125_0107652_480_1094 | 200 |
| 1246 | 3300048928 | Ga0496125_0187175 | Ga0496125_0187175_41_655 | 200 |
| 1247 | 3300048929 | Ga0496126_0019281 | Ga0496126_0019281_882_1496 | 200 |
| 1248 | 3300048929 | Ga0496126_0088806 | Ga0496126_0088806_198_812 | 200 |
| 1249 | 3300048929 | Ga0496126_0127413 | Ga0496126_0127413_761_1378 | 200 |
| 1250 | 3300048929 | Ga0496126_0479018 | Ga0496126_0479018_214_828 | 200 |
| 1251 | 3300048929 | Ga0496126_0877422 | Ga0496126_0877422_13_627 | 200 |
| 1252 | 3300049568 | Ga0501031_0056043 | Ga0501031_0056043_1772_2386 | 200 |
| 1253 | 3300049568 | Ga0501031_0310805 | Ga0501031_0310805_62_676 | 200 |
| 1254 | 3300049568 | Ga0501031_0538050 | Ga0501031_0538050_79_693 | 200 |
| 1255 | 3300049569 | Ga0501032_0035515 | Ga0501032_0035515_2538_3152 | 200 |
| 1256 | 3300049569 | Ga0501032_0042316 | Ga0501032_0042316_2143_2757 | 200 |
| 1257 | 3300049569 | Ga0501032_0158743 | Ga0501032_0158743_273_887 | 200 |
| 1258 | 3300049570 | Ga0501033_0001017 | Ga0501033_0001017_409_1023 | 200 |
| 1259 | 3300049570 | Ga0501033_0038718 | Ga0501033_0038718_725_1339 | 200 |
| 1260 | 3300049570 | Ga0501033_0039506 | Ga0501033_0039506_2697_3311 | 200 |
| 1261 | 3300049570 | Ga0501033_0063901 | Ga0501033_0063901_1735_2349 | 200 |
| 1262 | 3300049570 | Ga0501033_0289624 | Ga0501033_0289624_411_1025 | 200 |
| 1263 | 3300049571 | Ga0501034_0083017 | Ga0501034_0083017_2037_2651 | 200 |
| 1264 | 3300049571 | Ga0501034_0097881 | Ga0501034_0097881_1242_1856 | 200 |
| 1265 | 3300049571 | Ga0501034_0183645 | Ga0501034_0183645_97_711 | 200 |
| 1266 | 3300049571 | Ga0501034_0300812 | Ga0501034_0300812_729_1343 | 200 |
| 1267 | 3300049571 | Ga0501034_0493449 | Ga0501034_0493449_35_649 | 200 |
| 1268 | 3300049571 | Ga0501034_0902885 | Ga0501034_0902885_92_706 | 200 |
| 1269 | 3300049572 | Ga0501036_0227988 | Ga0501036_0227988_405_1019 | 200 |
| 1270 | 3300049572 | Ga0501036_0541326 | Ga0501036_0541326_48_662 | 200 |
| 1271 | 3300049573 | Ga0501037_0000035 | Ga0501037_0000035_10192_10806 | 200 |
| 1272 | 3300049574 | Ga0501038_0023128 | Ga0501038_0023128_2695_3309 | 200 |
| 1273 | 3300049575 | Ga0501039_0159654 | Ga0501039_0159654_409_1023 | 200 |
| 1274 | 3300049579 | Ga0501043_0000031 | Ga0501043_0000031_105252_105866 | 200 |
| 1275 | 3300049579 | Ga0501043_0023763 | Ga0501043_0023763_2849_3463 | 200 |
| 1276 | 3300049579 | Ga0501043_0085371 | Ga0501043_0085371_1063_1677 | 200 |
| 1277 | 3300049580 | Ga0501046_0144281 | Ga0501046_0144281_1140_1754 | 200 |
| 1278 | 3300049580 | Ga0501046_0395767 | Ga0501046_0395767_55_669 | 200 |
| 1279 | 3300049580 | Ga0501046_0530893 | Ga0501046_0530893_39_653 | 200 |
| 1280 | 3300049581 | Ga0501047_0022828 | Ga0501047_0022828_1247_1861 | 200 |
| 1281 | 3300049581 | Ga0501047_0078456 | Ga0501047_0078456_2113_2727 | 200 |
| 1282 | 3300049581 | Ga0501047_0220841 | Ga0501047_0220841_132_746 | 200 |
| 1283 | 3300049581 | Ga0501047_0297357 | Ga0501047_0297357_641_1255 | 200 |
| 1284 | 3300049582 | Ga0501048_0557492 | Ga0501048_0557492_98_712 | 200 |
| 1285 | 3300049582 | Ga0501048_0564249 | Ga0501048_0564249_53_667 | 200 |
| 1286 | 3300049584 | Ga0501068_0005004 | Ga0501068_0005004_621_1235 | 200 |
| 1287 | 3300049584 | Ga0501068_0328135 | Ga0501068_0328135_17_631 | 200 |
| 1288 | 3300049585 | Ga0501069_0000136 | Ga0501069_0000136_10196_10810 | 200 |
| 1289 | 3300049585 | Ga0501069_0049438 | Ga0501069_0049438_1360_1974 | 200 |
| 1290 | 3300049585 | Ga0501069_0232197 | Ga0501069_0232197_155_769 | 200 |
| 1291 | 3300049586 | Ga0501070_0000202 | Ga0501070_0000202_48146_48760 | 200 |
| 1292 | 3300049586 | Ga0501070_0000422 | Ga0501070_0000422_27065_27679 | 200 |
| 1293 | 3300049586 | Ga0501070_0006568 | Ga0501070_0006568_4169_4783 | 200 |
| 1294 | 3300049586 | Ga0501070_0010179 | Ga0501070_0010179_2138_2752 | 200 |
| 1295 | 3300049586 | Ga0501070_0077138 | Ga0501070_0077138_770_1384 | 200 |
| 1296 | 3300049586 | Ga0501070_0440136 | Ga0501070_0440136_167_781 | 200 |
| 1297 | 3300049587 | Ga0501071_0001465 | Ga0501071_0001465_51_665 | 200 |
| 1298 | 3300049587 | Ga0501071_0067873 | Ga0501071_0067873_417_1031 | 200 |
| 1299 | 3300049589 | Ga0501073_0027594 | Ga0501073_0027594_1330_1944 | 200 |
| 1300 | 3300049590 | Ga0501074_0000024 | Ga0501074_0000024_58319_58933 | 200 |
| 1301 | 3300049590 | Ga0501074_0534348 | Ga0501074_0534348_171_785 | 200 |
| 1302 | 3300049742 | Ga0501080_0000429 | Ga0501080_0000429_12364_12978 | 200 |
| 1303 | 3300049742 | Ga0501080_0000963 | Ga0501080_0000963_22757_23371 | 200 |
| 1304 | 3300049742 | Ga0501080_0265394 | Ga0501080_0265394_123_737 | 200 |
| 1305 | 3300049744 | Ga0501083_0000200 | Ga0501083_0000200_28964_29578 | 200 |
| 1306 | 3300049744 | Ga0501083_0110838 | Ga0501083_0110838_719_1333 | 200 |
| 1307 | 3300049758 | Ga0501241_037925 | Ga0501241_037925_35_652 | 200 |
| 1308 | 3300049776 | Ga0501280_001590 | Ga0501280_001590_3029_3643 | 200 |
| 1309 | 3300049822 | Ga0501035_0000036 | Ga0501035_0000036_49611_50225 | 200 |
| 1310 | 3300049822 | Ga0501035_0000723 | Ga0501035_0000723_28324_28938 | 200 |
| 1311 | 3300049822 | Ga0501035_0008594 | Ga0501035_0008594_8120_8734 | 200 |
| 1312 | 3300049822 | Ga0501035_0032962 | Ga0501035_0032962_121_735 | 200 |
| 1313 | 3300049822 | Ga0501035_0087522 | Ga0501035_0087522_158_772 | 200 |
| 1314 | 3300049822 | Ga0501035_0125755 | Ga0501035_0125755_1513_2127 | 200 |
| 1315 | 3300049823 | Ga0501044_0000011 | Ga0501044_0000011_158325_158939 | 200 |
| 1316 | 3300049823 | Ga0501044_0004538 | Ga0501044_0004538_4608_5222 | 200 |
| 1317 | 3300049823 | Ga0501044_0008293 | Ga0501044_0008293_895_1509 | 200 |
| 1318 | 3300049823 | Ga0501044_0034203 | Ga0501044_0034203_1590_2204 | 200 |
| 1319 | 3300049823 | Ga0501044_0039584 | Ga0501044_0039584_1964_2578 | 200 |
| 1320 | 3300049823 | Ga0501044_0076189 | Ga0501044_0076189_2779_3393 | 200 |
| 1321 | 3300049823 | Ga0501044_0079139 | Ga0501044_0079139_2613_3227 | 200 |
| 1322 | 3300049823 | Ga0501044_0175065 | Ga0501044_0175065_1398_2012 | 200 |
| 1323 | 3300049824 | Ga0501045_0489401 | Ga0501045_0489401_166_780 | 200 |
| 1324 | 3300050490 | nmdc:mga03n38_76581_c1 | nmdc:mga03n38_76581_c1_737_1351 | 200 |
| 1325 | 3300050490 | nmdc:mga03n38_8598_c1 | nmdc:mga03n38_8598_c1_694_1308 | 200 |
| 1326 | 3300050491 | nmdc:mga00v17_11078_c1 | nmdc:mga00v17_11078_c1_2620_3234 | 200 |
| 1327 | 3300050491 | nmdc:mga00v17_20863_c1 | nmdc:mga00v17_20863_c1_2389_3003 | 200 |
| 1328 | 3300050491 | nmdc:mga00v17_594075_c1 | nmdc:mga00v17_594075_c1_13_627 | 200 |
| 1329 | 3300050492 | nmdc:mga0yw44_137179_c1 | nmdc:mga0yw44_137179_c1_344_958 | 200 |
| 1330 | 3300050492 | nmdc:mga0yw44_17647_c1 | nmdc:mga0yw44_17647_c1_2645_3259 | 200 |
| 1331 | 3300050492 | nmdc:mga0yw44_2420_c1 | nmdc:mga0yw44_2420_c1_6105_6719 | 200 |
| 1332 | 3300050493 | nmdc:mga0k408_319783_c1 | nmdc:mga0k408_319783_c1_112_726 | 200 |
| 1333 | 3300050494 | nmdc:mga06z11_1261_c1 | nmdc:mga06z11_1261_c1_5029_5643 | 200 |
| 1334 | 3300050494 | nmdc:mga06z11_14948_c1 | nmdc:mga06z11_14948_c1_1906_2520 | 200 |
| 1335 | 3300050495 | nmdc:mga04h51_153595_c1 | nmdc:mga04h51_153595_c1_64_678 | 200 |
| 1336 | 3300050496 | nmdc:mga07m45_93500_c1 | nmdc:mga07m45_93500_c1_367_981 | 200 |
| 1337 | 3300050516 | nmdc:mga0sz30_11929_c1 | nmdc:mga0sz30_11929_c1_1945_2559 | 200 |
| 1338 | 3300050516 | nmdc:mga0sz30_7432_c2 | nmdc:mga0sz30_7432_c2_899_1513 | 200 |
| 1339 | 3300053100 | Ga0500660_139892 | Ga0500660_139892_133_744 | 200 |
| 1340 | 3300053125 | Ga0500618_000008 | Ga0500618_000008_51618_52232 | 200 |
| 1341 | 3300053125 | Ga0500618_003329 | Ga0500618_003329_1534_2148 | 200 |
| 1342 | 3300053125 | Ga0500618_011676 | Ga0500618_011676_723_1337 | 200 |
| 1343 | 3300053134 | Ga0500658_0221890 | Ga0500658_0221890_73_687 | 200 |
| 1344 | 3300053153 | Ga0500616_0140514 | Ga0500616_0140514_224_838 | 200 |
| 1345 | 3300053155 | Ga0500620_000018 | Ga0500620_000018_22091_22705 | 200 |
| 1346 | 3300053177 | Ga0500636_0077761 | Ga0500636_0077761_28_642 | 200 |
| 1347 | 3300060353 | Ga0501082_0082917 | Ga0501082_0082917_1341_1955 | 200 |
| 1348 | 3300061719 | Ga0466962_0095510 | Ga0466962_0095510_704_1318 | 200 |
| 1349 | iso_pu_bacteria | 2958092219 | 2958098894 | 200 |
| 1350 | iso_pu_bacteria | 3000376612 | 3000379187 | 200 |
| 1351 | 3300003316 | rootH1_10086971 | rootH1_100869712 | 201 |
| 1352 | 3300005338 | Ga0068868_100223636 | Ga0068868_1002236362 | 201 |
| 1353 | 3300005367 | Ga0070667_100893702 | Ga0070667_1008937021 | 201 |
| 1354 | 3300005617 | Ga0068859_100423381 | Ga0068859_1004233812 | 201 |
| 1355 | 3300005842 | Ga0068858_100461556 | Ga0068858_1004615562 | 201 |
| 1356 | 3300005843 | Ga0068860_100337341 | Ga0068860_1003373412 | 201 |
| 1357 | 3300006163 | Ga0070715_10044099 | Ga0070715_100440991 | 201 |
| 1358 | 3300006237 | Ga0097621_100286717 | Ga0097621_1002867172 | 201 |
| 1359 | 3300006353 | Ga0075370_10028022 | Ga0075370_100280222 | 201 |
| 1360 | 3300006931 | Ga0097620_100423359 | Ga0097620_1004233592 | 201 |
| 1361 | 3300009098 | Ga0105245_10167846 | Ga0105245_101678462 | 201 |
| 1362 | 3300009545 | Ga0105237_10058994 | Ga0105237_100589942 | 201 |
| 1363 | 3300013306 | Ga0163162_10291720 | Ga0163162_102917202 | 201 |
| 1364 | 3300014325 | Ga0163163_10423430 | Ga0163163_104234302 | 201 |
| 1365 | 3300014968 | Ga0157379_10062000 | Ga0157379_100620003 | 201 |
| 1366 | 3300025927 | Ga0207687_10332870 | Ga0207687_103328702 | 201 |
| 1367 | 3300025927 | Ga0207687_10598211 | Ga0207687_105982112 | 201 |
| 1368 | 3300025986 | Ga0207658_10036559 | Ga0207658_100365592 | 201 |
| 1369 | 3300025986 | Ga0207658_10086237 | Ga0207658_100862372 | 201 |
| 1370 | 3300026035 | Ga0207703_10465906 | Ga0207703_104659062 | 201 |
| 1371 | 3300031507 | Ga0307509_10001328 | Ga0307509_1000132825 | 201 |
| 1372 | 3300031507 | Ga0307509_10033331 | Ga0307509_100333315 | 201 |
| 1373 | 3300031616 | Ga0307508_10077400 | Ga0307508_100774002 | 201 |
| 1374 | 3300031730 | Ga0307516_10000662 | Ga0307516_1000066237 | 201 |
| 1375 | 3300032004 | Ga0307414_10097273 | Ga0307414_100972733 | 201 |
| 1376 | 3300032004 | Ga0307414_10278232 | Ga0307414_102782322 | 201 |
| 1377 | 3300032004 | Ga0307414_10858263 | Ga0307414_108582632 | 201 |
| 1378 | 3300035691 | Ga0373931_0054830 | Ga0373931_0054830_88_723 | 201 |
| 1379 | 3300044656 | Ga0466969_0023384 | Ga0466969_0023384_1656_2306 | 201 |
| 1380 | 3300044659 | Ga0466973_0065732 | Ga0466973_0065732_2258_2908 | 201 |
| 1381 | 3300044683 | Ga0466965_0003828 | Ga0466965_0003828_3298_3948 | 201 |
| 1382 | 3300044693 | Ga0466961_0051454 | Ga0466961_0051454_1933_2583 | 201 |
| 1383 | 3300044694 | Ga0466963_0004869 | Ga0466963_0004869_4319_4969 | 201 |
| 1384 | 3300044719 | Ga0466971_0001651 | Ga0466971_0001651_6851_7501 | 201 |
| 1385 | 3300044765 | Ga0466970_0105728 | Ga0466970_0105728_348_998 | 201 |
| 1386 | 3300044842 | Ga0466957_0012504 | Ga0466957_0012504_3894_4544 | 201 |
| 1387 | 3300045836 | Ga0466958_0030845 | Ga0466958_0030845_885_1535 | 201 |
| 1388 | 3300046454 | Ga0495592_0000352 | Ga0495592_0000352_22237_22872 | 201 |
| 1389 | 3300046471 | Ga0495650_0116891 | Ga0495650_0116891_141_776 | 201 |
| 1390 | 3300046472 | Ga0495580_0119663 | Ga0495580_0119663_861_1496 | 201 |
| 1391 | 3300046681 | Ga0495647_0090910 | Ga0495647_0090910_335_970 | 201 |
| 1392 | 3300046683 | Ga0495658_0114107 | Ga0495658_0114107_688_1323 | 201 |
| 1393 | 3300048907 | Ga0496104_0200149 | Ga0496104_0200149_618_1253 | 201 |
| 1394 | 3300048908 | Ga0496105_0024032 | Ga0496105_0024032_3632_4267 | 201 |
| 1395 | 3300048917 | Ga0496114_0127883 | Ga0496114_0127883_340_975 | 201 |
| 1396 | 3300048917 | Ga0496114_0135507 | Ga0496114_0135507_247_882 | 201 |
| 1397 | 3300049571 | Ga0501034_0000162 | Ga0501034_0000162_27852_28472 | 201 |
| 1398 | 3300050496 | nmdc:mga07m45_16474_c2 | nmdc:mga07m45_16474_c2_324_965 | 201 |
| 1399 | 3300053084 | Ga0495595_0082470 | Ga0495595_0082470_425_1060 | 201 |
| 1400 | 3300053093 | Ga0500651_0241138 | Ga0500651_0241138_258_893 | 201 |
| 1401 | 3300053177 | Ga0500636_0204139 | Ga0500636_0204139_295_930 | 201 |
| 1402 | 3300061719 | Ga0466962_0018487 | Ga0466962_0018487_759_1409 | 201 |
| 1403 | iso_pu_bacteria | 2773857925 | 2774870879 | 201 |
| 1404 | iso_pu_bacteria | 643348564 | 643599819 | 201 |
| 1405 | 3300005468 | Ga0070707_100035738 | Ga0070707_1000357385 | 202 |
| 1406 | 3300006042 | Ga0075368_10004699 | Ga0075368_100046996 | 202 |
| 1407 | 3300006048 | Ga0075363_100264881 | Ga0075363_1002648812 | 202 |
| 1408 | 3300006178 | Ga0075367_10059289 | Ga0075367_100592891 | 202 |
| 1409 | 3300006195 | Ga0075366_10092785 | Ga0075366_100927852 | 202 |
| 1410 | 3300006353 | Ga0075370_10064346 | Ga0075370_100643461 | 202 |
| 1411 | 3300009036 | Ga0105244_10000403 | Ga0105244_100004037 | 202 |
| 1412 | 3300025910 | Ga0207684_10002597 | Ga0207684_1000259717 | 202 |
| 1413 | 3300027866 | Ga0209813_10023660 | Ga0209813_100236602 | 202 |
| 1414 | 3300037312 | Ga0395899_0000729 | Ga0395899_0000729_20914_21540 | 202 |
| 1415 | 3300037471 | Ga0395905_0062649 | Ga0395905_0062649_1053_1682 | 202 |
| 1416 | 3300037471 | Ga0395905_0109842 | Ga0395905_0109842_1129_1755 | 202 |
| 1417 | 3300037471 | Ga0395905_0324699 | Ga0395905_0324699_473_1099 | 202 |
| 1418 | 3300044658 | Ga0466972_0103414 | Ga0466972_0103414_518_1144 | 202 |
| 1419 | 3300045049 | Ga0466959_0178919 | Ga0466959_0178919_13_639 | 202 |
| 1420 | 3300047315 | Ga0495581_0435796 | Ga0495581_0435796_34_663 | 202 |
| 1421 | 3300049570 | Ga0501033_0211047 | Ga0501033_0211047_402_1025 | 202 |
| 1422 | 3300049573 | Ga0501037_0155691 | Ga0501037_0155691_28_651 | 202 |
| 1423 | 3300049580 | Ga0501046_0029834 | Ga0501046_0029834_2171_2794 | 202 |
| 1424 | 3300049586 | Ga0501070_0060029 | Ga0501070_0060029_1597_2220 | 202 |
| 1425 | 3300049822 | Ga0501035_0002648 | Ga0501035_0002648_15213_15836 | 202 |
| 1426 | 3300049823 | Ga0501044_0176365 | Ga0501044_0176365_997_1620 | 202 |
| 1427 | 3300050493 | nmdc:mga0k408_13887_c1 | nmdc:mga0k408_13887_c1_1247_1891 | 202 |
| 1428 | 3300050494 | nmdc:mga06z11_247352_c1 | nmdc:mga06z11_247352_c1_372_1016 | 202 |
| 1429 | 3300050495 | nmdc:mga04h51_55610_c1 | nmdc:mga04h51_55610_c1_260_904 | 202 |
| 1430 | 3300061719 | Ga0466962_0129463 | Ga0466962_0129463_163_789 | 202 |
| 1431 | iso_pu_bacteria | 2895511927 | 2895516956 | 202 |
| 1432 | iso_pu_bacteria | 3003665799 | 3003672614 | 202 |
| 1433 | 3300001989 | JGI24739J22299_10000109 | JGI24739J22299_1000010918 | 203 |
| 1434 | 3300002705 | JGI25156J39149_1000137 | JGI25156J39149_100013727 | 203 |
| 1435 | 3300002738 | JGI25154J39366_1000106 | JGI25154J39366_100010646 | 203 |
| 1436 | 3300002741 | JGI25157J39369_1000154 | JGI25157J39369_100015424 | 203 |
| 1437 | 3300002772 | JGI25164J39214_1004996 | JGI25164J39214_10049962 | 203 |
| 1438 | 3300003316 | rootH1_10022690 | rootH1_100226904 | 203 |
| 1439 | 3300003320 | rootH2_10074857 | rootH2_100748572 | 203 |
| 1440 | 3300003322 | rootL2_10313242 | rootL2_103132421 | 203 |
| 1441 | 3300003323 | rootH1_10019588 | rootH1_100195884 | 203 |
| 1442 | 3300003323 | rootH1_10030464 | rootH1_100304643 | 203 |
| 1443 | 3300003752 | Ga0055539_1000160 | Ga0055539_100016044 | 203 |
| 1444 | 3300003752 | Ga0055539_1001756 | Ga0055539_10017561 | 203 |
| 1445 | 3300003756 | Ga0055533_1000162 | Ga0055533_100016244 | 203 |
| 1446 | 3300003759 | Ga0055525_1000742 | Ga0055525_10007422 | 203 |
| 1447 | 3300003761 | Ga0055535_1000403 | Ga0055535_10004036 | 203 |
| 1448 | 3300003763 | Ga0055529_1000195 | Ga0055529_10001956 | 203 |
| 1449 | 3300005327 | Ga0070658_10004550 | Ga0070658_100045508 | 203 |
| 1450 | 3300005330 | Ga0070690_100020918 | Ga0070690_1000209184 | 203 |
| 1451 | 3300005339 | Ga0070660_100264068 | Ga0070660_1002640681 | 203 |
| 1452 | 3300005353 | Ga0070669_100641494 | Ga0070669_1006414941 | 203 |
| 1453 | 3300005364 | Ga0070673_100031638 | Ga0070673_1000316384 | 203 |
| 1454 | 3300005364 | Ga0070673_100369495 | Ga0070673_1003694952 | 203 |
| 1455 | 3300005366 | Ga0070659_100076553 | Ga0070659_1000765532 | 203 |
| 1456 | 3300005456 | Ga0070678_100404392 | Ga0070678_1004043922 | 203 |
| 1457 | 3300005459 | Ga0068867_100233785 | Ga0068867_1002337852 | 203 |
| 1458 | 3300005467 | Ga0070706_100205588 | Ga0070706_1002055882 | 203 |
| 1459 | 3300005543 | Ga0070672_100080696 | Ga0070672_1000806962 | 203 |
| 1460 | 3300005543 | Ga0070672_100939630 | Ga0070672_1009396301 | 203 |
| 1461 | 3300005548 | Ga0070665_100008247 | Ga0070665_1000082473 | 203 |
| 1462 | 3300005563 | Ga0068855_100215864 | Ga0068855_1002158643 | 203 |
| 1463 | 3300005563 | Ga0068855_100868107 | Ga0068855_1008681072 | 203 |
| 1464 | 3300005577 | Ga0068857_100000535 | Ga0068857_10000053522 | 203 |
| 1465 | 3300005614 | Ga0068856_100022922 | Ga0068856_1000229225 | 203 |
| 1466 | 3300005614 | Ga0068856_100791147 | Ga0068856_1007911471 | 203 |
| 1467 | 3300005616 | Ga0068852_100056329 | Ga0068852_1000563294 | 203 |
| 1468 | 3300006195 | Ga0075366_10000527 | Ga0075366_1000052711 | 203 |
| 1469 | 3300006195 | Ga0075366_10072032 | Ga0075366_100720322 | 203 |
| 1470 | 3300009011 | Ga0105251_10000198 | Ga0105251_1000019855 | 203 |
| 1471 | 3300009036 | Ga0105244_10000037 | Ga0105244_10000037116 | 203 |
| 1472 | 3300009036 | Ga0105244_10002423 | Ga0105244_100024236 | 203 |
| 1473 | 3300009093 | Ga0105240_10009833 | Ga0105240_100098337 | 203 |
| 1474 | 3300009093 | Ga0105240_10141815 | Ga0105240_101418153 | 203 |
| 1475 | 3300009098 | Ga0105245_10160344 | Ga0105245_101603442 | 203 |
| 1476 | 3300009148 | Ga0105243_10002671 | Ga0105243_100026716 | 203 |
| 1477 | 3300009177 | Ga0105248_10174488 | Ga0105248_101744883 | 203 |
| 1478 | 3300009545 | Ga0105237_10126562 | Ga0105237_101265623 | 203 |
| 1479 | 3300013102 | Ga0157371_10005423 | Ga0157371_100054233 | 203 |
| 1480 | 3300013104 | Ga0157370_10000343 | Ga0157370_1000034315 | 203 |
| 1481 | 3300013104 | Ga0157370_10000348 | Ga0157370_100003487 | 203 |
| 1482 | 3300013105 | Ga0157369_10000288 | Ga0157369_1000028845 | 203 |
| 1483 | 3300013296 | Ga0157374_10019897 | Ga0157374_100198973 | 203 |
| 1484 | 3300013306 | Ga0163162_10242733 | Ga0163162_102427333 | 203 |
| 1485 | 3300013308 | Ga0157375_10430766 | Ga0157375_104307662 | 203 |
| 1486 | 3300014745 | Ga0157377_10000013 | Ga0157377_10000013111 | 203 |
| 1487 | 3300015261 | Ga0182006_1039762 | Ga0182006_10397622 | 203 |
| 1488 | 3300017792 | Ga0163161_10082554 | Ga0163161_100825543 | 203 |
| 1489 | 3300025226 | Ga0209674_100003 | Ga0209674_10000311 | 203 |
| 1490 | 3300025228 | Ga0209672_113575 | Ga0209672_1135752 | 203 |
| 1491 | 3300025230 | Ga0209563_100192 | Ga0209563_10019211 | 203 |
| 1492 | 3300025231 | Ga0207427_100663 | Ga0207427_10066316 | 203 |
| 1493 | 3300025242 | Ga0209258_100291 | Ga0209258_1002917 | 203 |
| 1494 | 3300025246 | Ga0209646_1000127 | Ga0209646_1000127110 | 203 |
| 1495 | 3300025250 | Ga0209026_1000004 | Ga0209026_1000004852 | 203 |
| 1496 | 3300025250 | Ga0209026_1012212 | Ga0209026_10122122 | 203 |
| 1497 | 3300025253 | Ga0209677_100085 | Ga0209677_10008581 | 203 |
| 1498 | 3300025253 | Ga0209677_100107 | Ga0209677_10010711 | 203 |
| 1499 | 3300025256 | Ga0209759_1000129 | Ga0209759_100012924 | 203 |
| 1500 | 3300025256 | Ga0209759_1003974 | Ga0209759_10039742 | 203 |
| 1501 | 3300025256 | Ga0209759_1010790 | Ga0209759_10107903 | 203 |
| 1502 | 3300025272 | Ga0209455_1000208 | Ga0209455_100020867 | 203 |
| 1503 | 3300025303 | Ga0209051_1000354 | Ga0209051_100035444 | 203 |
| 1504 | 3300025303 | Ga0209051_1007471 | Ga0209051_10074713 | 203 |
| 1505 | 3300025303 | Ga0209051_1016212 | Ga0209051_10162122 | 203 |
| 1506 | 3300025304 | Ga0209257_1032100 | Ga0209257_10321002 | 203 |
| 1507 | 3300025728 | Ga0207655_1000117 | Ga0207655_1000117115 | 203 |
| 1508 | 3300025735 | Ga0207713_1020865 | Ga0207713_10208653 | 203 |
| 1509 | 3300025909 | Ga0207705_10000625 | Ga0207705_1000062519 | 203 |
| 1510 | 3300025909 | Ga0207705_10141660 | Ga0207705_101416602 | 203 |
| 1511 | 3300025913 | Ga0207695_10022029 | Ga0207695_100220293 | 203 |
| 1512 | 3300025913 | Ga0207695_10101432 | Ga0207695_101014322 | 203 |
| 1513 | 3300025914 | Ga0207671_10074921 | Ga0207671_100749213 | 203 |
| 1514 | 3300025919 | Ga0207657_10405447 | Ga0207657_104054472 | 203 |
| 1515 | 3300025923 | Ga0207681_10049567 | Ga0207681_100495672 | 203 |
| 1516 | 3300025932 | Ga0207690_10431819 | Ga0207690_104318192 | 203 |
| 1517 | 3300025935 | Ga0207709_10005372 | Ga0207709_100053726 | 203 |
| 1518 | 3300025949 | Ga0207667_10029470 | Ga0207667_100294705 | 203 |
| 1519 | 3300025949 | Ga0207667_10634863 | Ga0207667_106348632 | 203 |
| 1520 | 3300025960 | Ga0207651_10033406 | Ga0207651_100334064 | 203 |
| 1521 | 3300026078 | Ga0207702_10055620 | Ga0207702_100556202 | 203 |
| 1522 | 3300026078 | Ga0207702_10750935 | Ga0207702_107509351 | 203 |
| 1523 | 3300026089 | Ga0207648_10000006 | Ga0207648_10000006140 | 203 |
| 1524 | 3300026089 | Ga0207648_10264293 | Ga0207648_102642932 | 203 |
| 1525 | 3300026118 | Ga0207675_100033725 | Ga0207675_1000337253 | 203 |
| 1526 | 3300026121 | Ga0207683_10140183 | Ga0207683_101401831 | 203 |
| 1527 | 3300026121 | Ga0207683_10221055 | Ga0207683_102210552 | 203 |
| 1528 | 3300026121 | Ga0207683_10362558 | Ga0207683_103625582 | 203 |
| 1529 | 3300028379 | Ga0268266_10029943 | Ga0268266_100299435 | 203 |
| 1530 | 3300028379 | Ga0268266_10506409 | Ga0268266_105064092 | 203 |
| 1531 | 3300028381 | Ga0268264_10167671 | Ga0268264_101676711 | 203 |
| 1532 | 3300030521 | Ga0307511_10131150 | Ga0307511_101311502 | 203 |
| 1533 | 3300031911 | Ga0307412_10394783 | Ga0307412_103947832 | 203 |
| 1534 | 3300032002 | Ga0307416_100057914 | Ga0307416_1000579143 | 203 |
| 1535 | 3300032002 | Ga0307416_100334684 | Ga0307416_1003346842 | 203 |
| 1536 | 3300032005 | Ga0307411_10460559 | Ga0307411_104605592 | 203 |
| 1537 | 3300034820 | Ga0373959_0006169 | Ga0373959_0006169_227_847 | 203 |
| 1538 | 3300035695 | Ga0373927_0059272 | Ga0373927_0059272_1570_2190 | 203 |
| 1539 | 3300037312 | Ga0395899_0000005 | Ga0395899_0000005_666187_666855 | 203 |
| 1540 | 3300037312 | Ga0395899_0084318 | Ga0395899_0084318_23_697 | 203 |
| 1541 | 3300037312 | Ga0395899_0176329 | Ga0395899_0176329_652_1272 | 203 |
| 1542 | 3300037418 | Ga0395900_0000003 | Ga0395900_0000003_106112_106780 | 203 |
| 1543 | 3300037418 | Ga0395900_0106286 | Ga0395900_0106286_801_1475 | 203 |
| 1544 | 3300037418 | Ga0395900_0127056 | Ga0395900_0127056_816_1490 | 203 |
| 1545 | 3300037466 | Ga0395898_0000003 | Ga0395898_0000003_666207_666875 | 203 |
| 1546 | 3300037466 | Ga0395898_0000195 | Ga0395898_0000195_119775_120449 | 203 |
| 1547 | 3300037466 | Ga0395898_0044774 | Ga0395898_0044774_3067_3741 | 203 |
| 1548 | 3300037466 | Ga0395898_0432294 | Ga0395898_0432294_201_821 | 203 |
| 1549 | 3300037471 | Ga0395905_0041614 | Ga0395905_0041614_663_1283 | 203 |
| 1550 | 3300038443 | Ga0395901_0000012 | Ga0395901_0000012_150715_151389 | 203 |
| 1551 | 3300038443 | Ga0395901_0000038 | Ga0395901_0000038_20091_20756 | 203 |
| 1552 | 3300038443 | Ga0395901_0001277 | Ga0395901_0001277_18875_19495 | 203 |
| 1553 | 3300038443 | Ga0395901_0588452 | Ga0395901_0588452_448_1068 | 203 |
| 1554 | 3300039062 | Ga0400483_246615 | Ga0400483_246615_1399_2019 | 203 |
| 1555 | 3300039437 | Ga0436365_1805396 | Ga0436365_1805396_734_1360 | 203 |
| 1556 | 3300042006 | Ga0439432_007309 | Ga0439432_007309_594_1214 | 203 |
| 1557 | 3300042010 | Ga0439452_000009 | Ga0439452_000009_315477_316097 | 203 |
| 1558 | 3300044656 | Ga0466969_0005411 | Ga0466969_0005411_5332_6000 | 203 |
| 1559 | 3300044683 | Ga0466965_0004407 | Ga0466965_0004407_459_1079 | 203 |
| 1560 | 3300044683 | Ga0466965_0053833 | Ga0466965_0053833_1011_1679 | 203 |
| 1561 | 3300044684 | Ga0466966_0000035 | Ga0466966_0000035_2853_3521 | 203 |
| 1562 | 3300044684 | Ga0466966_0000198 | Ga0466966_0000198_23878_24498 | 203 |
| 1563 | 3300044684 | Ga0466966_0001168 | Ga0466966_0001168_13276_13971 | 203 |
| 1564 | 3300044684 | Ga0466966_0068761 | Ga0466966_0068761_722_1351 | 203 |
| 1565 | 3300044693 | Ga0466961_0000336 | Ga0466961_0000336_27530_28198 | 203 |
| 1566 | 3300044693 | Ga0466961_0000612 | Ga0466961_0000612_9356_9985 | 203 |
| 1567 | 3300044693 | Ga0466961_0250504 | Ga0466961_0250504_57_725 | 203 |
| 1568 | 3300044694 | Ga0466963_0006557 | Ga0466963_0006557_3758_4426 | 203 |
| 1569 | 3300044694 | Ga0466963_0021658 | Ga0466963_0021658_1720_2415 | 203 |
| 1570 | 3300044706 | Ga0466964_0067742 | Ga0466964_0067742_131_799 | 203 |
| 1571 | 3300044719 | Ga0466971_0009252 | Ga0466971_0009252_1800_2468 | 203 |
| 1572 | 3300044719 | Ga0466971_0075630 | Ga0466971_0075630_276_971 | 203 |
| 1573 | 3300044765 | Ga0466970_0002904 | Ga0466970_0002904_5550_6218 | 203 |
| 1574 | 3300044842 | Ga0466957_0038351 | Ga0466957_0038351_974_1669 | 203 |
| 1575 | 3300044842 | Ga0466957_0048030 | Ga0466957_0048030_679_1347 | 203 |
| 1576 | 3300045049 | Ga0466959_0026579 | Ga0466959_0026579_1437_2105 | 203 |
| 1577 | 3300045049 | Ga0466959_0049086 | Ga0466959_0049086_2383_3051 | 203 |
| 1578 | 3300045049 | Ga0466959_0083940 | Ga0466959_0083940_1583_2203 | 203 |
| 1579 | 3300045836 | Ga0466958_0003881 | Ga0466958_0003881_738_1406 | 203 |
| 1580 | 3300045836 | Ga0466958_0076274 | Ga0466958_0076274_1356_2024 | 203 |
| 1581 | 3300045836 | Ga0466958_0104893 | Ga0466958_0104893_647_1342 | 203 |
| 1582 | 3300045836 | Ga0466958_0141157 | Ga0466958_0141157_754_1374 | 203 |
| 1583 | 3300045976 | Ga0466967_0139106 | Ga0466967_0139106_1425_2045 | 203 |
| 1584 | 3300046471 | Ga0495650_0073727 | Ga0495650_0073727_209_829 | 203 |
| 1585 | 3300046475 | Ga0495639_0034523 | Ga0495639_0034523_1170_1790 | 203 |
| 1586 | 3300046506 | Ga0495583_0000313 | Ga0495583_0000313_42803_43423 | 203 |
| 1587 | 3300046507 | Ga0495606_0001607 | Ga0495606_0001607_2492_3112 | 203 |
| 1588 | 3300046539 | Ga0495621_0014656 | Ga0495621_0014656_272_892 | 203 |
| 1589 | 3300046615 | Ga0495656_0000884 | Ga0495656_0000884_1821_2441 | 203 |
| 1590 | 3300046684 | Ga0495669_0018434 | Ga0495669_0018434_1620_2240 | 203 |
| 1591 | 3300046692 | Ga0495671_0058269 | Ga0495671_0058269_810_1430 | 203 |
| 1592 | 3300046694 | Ga0495649_0000665 | Ga0495649_0000665_5376_5996 | 203 |
| 1593 | 3300046794 | Ga0495589_0006421 | Ga0495589_0006421_714_1334 | 203 |
| 1594 | 3300048912 | Ga0496109_0092273 | Ga0496109_0092273_762_1382 | 203 |
| 1595 | 3300048913 | Ga0496110_0195204 | Ga0496110_0195204_598_1224 | 203 |
| 1596 | 3300048919 | Ga0496116_0000065 | Ga0496116_0000065_56111_56731 | 203 |
| 1597 | 3300048920 | Ga0496117_0000866 | Ga0496117_0000866_45949_46569 | 203 |
| 1598 | 3300048921 | Ga0496118_0220971 | Ga0496118_0220971_291_911 | 203 |
| 1599 | 3300049521 | Ga0501298_024284 | Ga0501298_024284_271_891 | 203 |
| 1600 | 3300049579 | Ga0501043_0000071 | Ga0501043_0000071_25575_26198 | 203 |
| 1601 | 3300049580 | Ga0501046_0000311 | Ga0501046_0000311_25573_26196 | 203 |
| 1602 | 3300049581 | Ga0501047_0000087 | Ga0501047_0000087_91140_91763 | 203 |
| 1603 | 3300049582 | Ga0501048_0000226 | Ga0501048_0000226_26897_27520 | 203 |
| 1604 | 3300049705 | Ga0501225_0065977 | Ga0501225_0065977_97_717 | 203 |
| 1605 | 3300049762 | Ga0501265_000721 | Ga0501265_000721_2929_3549 | 203 |
| 1606 | 3300049777 | Ga0501281_02092 | Ga0501281_02092_68_688 | 203 |
| 1607 | 3300049824 | Ga0501045_0101064 | Ga0501045_0101064_564_1187 | 203 |
| 1608 | 3300050493 | nmdc:mga0k408_11975_c1 | nmdc:mga0k408_11975_c1_2402_3022 | 203 |
| 1609 | 3300050493 | nmdc:mga0k408_34788_c1 | nmdc:mga0k408_34788_c1_1266_1886 | 203 |
| 1610 | 3300053080 | Ga0500635_0000072 | Ga0500635_0000072_46280_46900 | 203 |
| 1611 | 3300055283 | Ga0500661_011828 | Ga0500661_011828_126_746 | 203 |
| 1612 | 3300061719 | Ga0466962_0004499 | Ga0466962_0004499_3998_4693 | 203 |
| 1613 | 3300061719 | Ga0466962_0007394 | Ga0466962_0007394_521_1141 | 203 |
| 1614 | 3300003323 | rootH1_10097074 | rootH1_100970742 | 204 |
| 1615 | 3300005293 | Ga0065715_10169762 | Ga0065715_101697621 | 204 |
| 1616 | 3300005328 | Ga0070676_10009234 | Ga0070676_100092342 | 204 |
| 1617 | 3300005328 | Ga0070676_10016418 | Ga0070676_100164182 | 204 |
| 1618 | 3300005329 | Ga0070683_100152822 | Ga0070683_1001528222 | 204 |
| 1619 | 3300005330 | Ga0070690_100012120 | Ga0070690_1000121202 | 204 |
| 1620 | 3300005331 | Ga0070670_100242043 | Ga0070670_1002420432 | 204 |
| 1621 | 3300005333 | Ga0070677_10010314 | Ga0070677_100103142 | 204 |
| 1622 | 3300005334 | Ga0068869_100000109 | Ga0068869_10000010912 | 204 |
| 1623 | 3300005334 | Ga0068869_100025418 | Ga0068869_1000254183 | 204 |
| 1624 | 3300005335 | Ga0070666_10010714 | Ga0070666_100107142 | 204 |
| 1625 | 3300005338 | Ga0068868_100000895 | Ga0068868_10000089512 | 204 |
| 1626 | 3300005338 | Ga0068868_100000928 | Ga0068868_1000009288 | 204 |
| 1627 | 3300005340 | Ga0070689_100265862 | Ga0070689_1002658622 | 204 |
| 1628 | 3300005347 | Ga0070668_100154246 | Ga0070668_1001542461 | 204 |
| 1629 | 3300005353 | Ga0070669_100010114 | Ga0070669_1000101147 | 204 |
| 1630 | 3300005353 | Ga0070669_100027346 | Ga0070669_1000273462 | 204 |
| 1631 | 3300005354 | Ga0070675_100000621 | Ga0070675_10000062110 | 204 |
| 1632 | 3300005354 | Ga0070675_100000772 | Ga0070675_10000077211 | 204 |
| 1633 | 3300005355 | Ga0070671_100353375 | Ga0070671_1003533752 | 204 |
| 1634 | 3300005364 | Ga0070673_100005018 | Ga0070673_1000050182 | 204 |
| 1635 | 3300005366 | Ga0070659_100011653 | Ga0070659_1000116533 | 204 |
| 1636 | 3300005367 | Ga0070667_100005806 | Ga0070667_1000058068 | 204 |
| 1637 | 3300005455 | Ga0070663_100003719 | Ga0070663_1000037193 | 204 |
| 1638 | 3300005457 | Ga0070662_100001965 | Ga0070662_1000019659 | 204 |
| 1639 | 3300005457 | Ga0070662_100397392 | Ga0070662_1003973921 | 204 |
| 1640 | 3300005459 | Ga0068867_100243698 | Ga0068867_1002436982 | 204 |
| 1641 | 3300005539 | Ga0068853_100110330 | Ga0068853_1001103302 | 204 |
| 1642 | 3300005543 | Ga0070672_100041547 | Ga0070672_1000415472 | 204 |
| 1643 | 3300005547 | Ga0070693_100037016 | Ga0070693_1000370162 | 204 |
| 1644 | 3300005548 | Ga0070665_100133333 | Ga0070665_1001333333 | 204 |
| 1645 | 3300005577 | Ga0068857_100050833 | Ga0068857_1000508332 | 204 |
| 1646 | 3300005578 | Ga0068854_100107770 | Ga0068854_1001077702 | 204 |
| 1647 | 3300005614 | Ga0068856_100152331 | Ga0068856_1001523312 | 204 |
| 1648 | 3300005615 | Ga0070702_100229285 | Ga0070702_1002292852 | 204 |
| 1649 | 3300005616 | Ga0068852_100014330 | Ga0068852_1000143303 | 204 |
| 1650 | 3300005616 | Ga0068852_100180005 | Ga0068852_1001800052 | 204 |
| 1651 | 3300005617 | Ga0068859_100008484 | Ga0068859_1000084843 | 204 |
| 1652 | 3300005618 | Ga0068864_100000270 | Ga0068864_10000027011 | 204 |
| 1653 | 3300005719 | Ga0068861_100000126 | Ga0068861_10000012612 | 204 |
| 1654 | 3300005719 | Ga0068861_100020024 | Ga0068861_1000200242 | 204 |
| 1655 | 3300005834 | Ga0068851_10163325 | Ga0068851_101633252 | 204 |
| 1656 | 3300005841 | Ga0068863_100000679 | Ga0068863_1000006799 | 204 |
| 1657 | 3300005841 | Ga0068863_100463579 | Ga0068863_1004635792 | 204 |
| 1658 | 3300005842 | Ga0068858_100000225 | Ga0068858_10000022511 | 204 |
| 1659 | 3300005842 | Ga0068858_100134936 | Ga0068858_1001349363 | 204 |
| 1660 | 3300005844 | Ga0068862_100082999 | Ga0068862_1000829992 | 204 |
| 1661 | 3300006237 | Ga0097621_100007479 | Ga0097621_1000074797 | 204 |
| 1662 | 3300006237 | Ga0097621_100018660 | Ga0097621_1000186605 | 204 |
| 1663 | 3300006358 | Ga0068871_100078234 | Ga0068871_1000782343 | 204 |
| 1664 | 3300006881 | Ga0068865_100178424 | Ga0068865_1001784242 | 204 |
| 1665 | 3300006931 | Ga0097620_100008484 | Ga0097620_1000084843 | 204 |
| 1666 | 3300009093 | Ga0105240_10126850 | Ga0105240_101268501 | 204 |
| 1667 | 3300009094 | Ga0111539_10518546 | Ga0111539_105185462 | 204 |
| 1668 | 3300009098 | Ga0105245_10532893 | Ga0105245_105328932 | 204 |
| 1669 | 3300009148 | Ga0105243_10066230 | Ga0105243_100662301 | 204 |
| 1670 | 3300009176 | Ga0105242_10302608 | Ga0105242_103026082 | 204 |
| 1671 | 3300009177 | Ga0105248_10009628 | Ga0105248_100096284 | 204 |
| 1672 | 3300009177 | Ga0105248_10021381 | Ga0105248_100213813 | 204 |
| 1673 | 3300009177 | Ga0105248_10228802 | Ga0105248_102288022 | 204 |
| 1674 | 3300009545 | Ga0105237_10359684 | Ga0105237_103596842 | 204 |
| 1675 | 3300009551 | Ga0105238_10112274 | Ga0105238_101122742 | 204 |
| 1676 | 3300009553 | Ga0105249_10032185 | Ga0105249_100321853 | 204 |
| 1677 | 3300009553 | Ga0105249_10515878 | Ga0105249_105158782 | 204 |
| 1678 | 3300010375 | Ga0105239_10727320 | Ga0105239_107273202 | 204 |
| 1679 | 3300013297 | Ga0157378_11393369 | Ga0157378_113933691 | 204 |
| 1680 | 3300013306 | Ga0163162_10018986 | Ga0163162_100189865 | 204 |
| 1681 | 3300013306 | Ga0163162_10021486 | Ga0163162_100214864 | 204 |
| 1682 | 3300013306 | Ga0163162_10205453 | Ga0163162_102054533 | 204 |
| 1683 | 3300013307 | Ga0157372_10231102 | Ga0157372_102311022 | 204 |
| 1684 | 3300013308 | Ga0157375_10097833 | Ga0157375_100978332 | 204 |
| 1685 | 3300013308 | Ga0157375_10285270 | Ga0157375_102852702 | 204 |
| 1686 | 3300014326 | Ga0157380_10038632 | Ga0157380_100386323 | 204 |
| 1687 | 3300014326 | Ga0157380_10790695 | Ga0157380_107906952 | 204 |
| 1688 | 3300014745 | Ga0157377_10001137 | Ga0157377_100011379 | 204 |
| 1689 | 3300014968 | Ga0157379_10002398 | Ga0157379_1000239812 | 204 |
| 1690 | 3300014968 | Ga0157379_10011386 | Ga0157379_100113868 | 204 |
| 1691 | 3300014969 | Ga0157376_10076384 | Ga0157376_100763843 | 204 |
| 1692 | 3300014969 | Ga0157376_10240412 | Ga0157376_102404122 | 204 |
| 1693 | 3300017792 | Ga0163161_10048831 | Ga0163161_100488314 | 204 |
| 1694 | 3300017792 | Ga0163161_10077140 | Ga0163161_100771403 | 204 |
| 1695 | 3300017792 | Ga0163161_10159485 | Ga0163161_101594852 | 204 |
| 1696 | 3300025271 | Ga0207666_1007136 | Ga0207666_10071362 | 204 |
| 1697 | 3300025315 | Ga0207697_10024046 | Ga0207697_100240463 | 204 |
| 1698 | 3300025321 | Ga0207656_10161076 | Ga0207656_101610762 | 204 |
| 1699 | 3300025893 | Ga0207682_10016767 | Ga0207682_100167672 | 204 |
| 1700 | 3300025901 | Ga0207688_10030555 | Ga0207688_100305552 | 204 |
| 1701 | 3300025903 | Ga0207680_10000416 | Ga0207680_1000041613 | 204 |
| 1702 | 3300025907 | Ga0207645_10022550 | Ga0207645_100225502 | 204 |
| 1703 | 3300025907 | Ga0207645_10030541 | Ga0207645_100305412 | 204 |
| 1704 | 3300025919 | Ga0207657_10076636 | Ga0207657_100766362 | 204 |
| 1705 | 3300025923 | Ga0207681_10018269 | Ga0207681_100182692 | 204 |
| 1706 | 3300025923 | Ga0207681_10393913 | Ga0207681_103939132 | 204 |
| 1707 | 3300025924 | Ga0207694_10215673 | Ga0207694_102156732 | 204 |
| 1708 | 3300025925 | Ga0207650_10108359 | Ga0207650_101083593 | 204 |
| 1709 | 3300025926 | Ga0207659_10001869 | Ga0207659_1000186910 | 204 |
| 1710 | 3300025926 | Ga0207659_10002398 | Ga0207659_100023988 | 204 |
| 1711 | 3300025927 | Ga0207687_10036867 | Ga0207687_100368672 | 204 |
| 1712 | 3300025931 | Ga0207644_10000543 | Ga0207644_1000054319 | 204 |
| 1713 | 3300025932 | Ga0207690_10025602 | Ga0207690_100256022 | 204 |
| 1714 | 3300025933 | Ga0207706_10000736 | Ga0207706_1000073623 | 204 |
| 1715 | 3300025933 | Ga0207706_10130237 | Ga0207706_101302372 | 204 |
| 1716 | 3300025936 | Ga0207670_10214048 | Ga0207670_102140482 | 204 |
| 1717 | 3300025937 | Ga0207669_10106274 | Ga0207669_101062742 | 204 |
| 1718 | 3300025938 | Ga0207704_10020597 | Ga0207704_100205974 | 204 |
| 1719 | 3300025940 | Ga0207691_10103580 | Ga0207691_101035802 | 204 |
| 1720 | 3300025941 | Ga0207711_10002545 | Ga0207711_100025457 | 204 |
| 1721 | 3300025941 | Ga0207711_10034440 | Ga0207711_100344402 | 204 |
| 1722 | 3300025942 | Ga0207689_10000259 | Ga0207689_1000025935 | 204 |
| 1723 | 3300025942 | Ga0207689_10025240 | Ga0207689_100252403 | 204 |
| 1724 | 3300025960 | Ga0207651_10001900 | Ga0207651_100019005 | 204 |
| 1725 | 3300025961 | Ga0207712_10050088 | Ga0207712_100500883 | 204 |
| 1726 | 3300025961 | Ga0207712_10541641 | Ga0207712_105416412 | 204 |
| 1727 | 3300025972 | Ga0207668_10035224 | Ga0207668_100352242 | 204 |
| 1728 | 3300025981 | Ga0207640_10072693 | Ga0207640_100726932 | 204 |
| 1729 | 3300025986 | Ga0207658_10005463 | Ga0207658_100054636 | 204 |
| 1730 | 3300026023 | Ga0207677_10001436 | Ga0207677_1000143612 | 204 |
| 1731 | 3300026023 | Ga0207677_10011722 | Ga0207677_100117223 | 204 |
| 1732 | 3300026035 | Ga0207703_10000408 | Ga0207703_1000040835 | 204 |
| 1733 | 3300026035 | Ga0207703_10116560 | Ga0207703_101165602 | 204 |
| 1734 | 3300026041 | Ga0207639_10083505 | Ga0207639_100835053 | 204 |
| 1735 | 3300026067 | Ga0207678_10236582 | Ga0207678_102365822 | 204 |
| 1736 | 3300026078 | Ga0207702_10074159 | Ga0207702_100741592 | 204 |
| 1737 | 3300026088 | Ga0207641_10002065 | Ga0207641_1000206511 | 204 |
| 1738 | 3300026088 | Ga0207641_10754848 | Ga0207641_107548482 | 204 |
| 1739 | 3300026089 | Ga0207648_10269565 | Ga0207648_102695652 | 204 |
| 1740 | 3300026095 | Ga0207676_10000269 | Ga0207676_1000026935 | 204 |
| 1741 | 3300026095 | Ga0207676_10082855 | Ga0207676_100828552 | 204 |
| 1742 | 3300026116 | Ga0207674_10026017 | Ga0207674_100260172 | 204 |
| 1743 | 3300026118 | Ga0207675_100000307 | Ga0207675_10000030712 | 204 |
| 1744 | 3300026118 | Ga0207675_100033253 | Ga0207675_1000332535 | 204 |
| 1745 | 3300026118 | Ga0207675_100192930 | Ga0207675_1001929302 | 204 |
| 1746 | 3300026121 | Ga0207683_10001051 | Ga0207683_1000105114 | 204 |
| 1747 | 3300026142 | Ga0207698_10004189 | Ga0207698_100041898 | 204 |
| 1748 | 3300026142 | Ga0207698_10012346 | Ga0207698_100123465 | 204 |
| 1749 | 3300027907 | Ga0207428_10626383 | Ga0207428_106263831 | 204 |
| 1750 | 3300028379 | Ga0268266_10082233 | Ga0268266_100822332 | 204 |
| 1751 | 3300028381 | Ga0268264_10029957 | Ga0268264_100299575 | 204 |
| 1752 | 3300033180 | Ga0307510_10187942 | Ga0307510_101879423 | 204 |
| 1753 | 3300035088 | Ga0373940_0021250 | Ga0373940_0021250_676_1311 | 204 |
| 1754 | 3300035115 | Ga0373941_0053875 | Ga0373941_0053875_631_1266 | 204 |
| 1755 | 3300035691 | Ga0373931_0001075 | Ga0373931_0001075_7871_8506 | 204 |
| 1756 | 3300045051 | Ga0451576_0220891 | Ga0451576_0220891_1169_1804 | 204 |
| 1757 | 3300045976 | Ga0466967_0483430 | Ga0466967_0483430_356_979 | 204 |
| 1758 | 3300047321 | Ga0495676_0566133 | Ga0495676_0566133_17_652 | 204 |
| 1759 | 3300047472 | Ga0495686_0006771 | Ga0495686_0006771_2960_3586 | 204 |
| 1760 | 3300048903 | Ga0496100_0109234 | Ga0496100_0109234_1129_1764 | 204 |
| 1761 | 3300048904 | Ga0496101_0005191 | Ga0496101_0005191_5704_6339 | 204 |
| 1762 | 3300048905 | Ga0496102_0029586 | Ga0496102_0029586_456_1091 | 204 |
| 1763 | 3300048907 | Ga0496104_0149429 | Ga0496104_0149429_1243_1905 | 204 |
| 1764 | 3300048908 | Ga0496105_0174019 | Ga0496105_0174019_111_746 | 204 |
| 1765 | 3300048909 | Ga0496106_0002032 | Ga0496106_0002032_2345_2980 | 204 |
| 1766 | 3300048910 | Ga0496107_0009689 | Ga0496107_0009689_915_1550 | 204 |
| 1767 | 3300048910 | Ga0496107_0238682 | Ga0496107_0238682_579_1241 | 204 |
| 1768 | 3300048912 | Ga0496109_0050006 | Ga0496109_0050006_1684_2346 | 204 |
| 1769 | 3300048913 | Ga0496110_0005584 | Ga0496110_0005584_7534_8169 | 204 |
| 1770 | 3300048917 | Ga0496114_0009654 | Ga0496114_0009654_1237_1872 | 204 |
| 1771 | 3300048917 | Ga0496114_0591408 | Ga0496114_0591408_157_819 | 204 |
| 1772 | 3300048918 | Ga0496115_0040075 | Ga0496115_0040075_183_818 | 204 |
| 1773 | 3300050512 | nmdc:mga0n895_464316_c1 | nmdc:mga0n895_464316_c1_446_1081 | 204 |
| 1774 | 3300002244 | JGI24742J22300_10027710 | JGI24742J22300_100277102 | 205 |
| 1775 | 3300005328 | Ga0070676_10001260 | Ga0070676_100012602 | 205 |
| 1776 | 3300005329 | Ga0070683_100093396 | Ga0070683_1000933963 | 205 |
| 1777 | 3300005330 | Ga0070690_100034503 | Ga0070690_1000345031 | 205 |
| 1778 | 3300005331 | Ga0070670_100048774 | Ga0070670_1000487742 | 205 |
| 1779 | 3300005333 | Ga0070677_10063874 | Ga0070677_100638742 | 205 |
| 1780 | 3300005333 | Ga0070677_10119082 | Ga0070677_101190822 | 205 |
| 1781 | 3300005335 | Ga0070666_10022337 | Ga0070666_100223374 | 205 |
| 1782 | 3300005335 | Ga0070666_10032542 | Ga0070666_100325422 | 205 |
| 1783 | 3300005338 | Ga0068868_100030201 | Ga0068868_1000302014 | 205 |
| 1784 | 3300005339 | Ga0070660_100019782 | Ga0070660_1000197826 | 205 |
| 1785 | 3300005340 | Ga0070689_100003058 | Ga0070689_1000030584 | 205 |
| 1786 | 3300005344 | Ga0070661_100029542 | Ga0070661_1000295423 | 205 |
| 1787 | 3300005344 | Ga0070661_100242801 | Ga0070661_1002428012 | 205 |
| 1788 | 3300005345 | Ga0070692_10013623 | Ga0070692_100136232 | 205 |
| 1789 | 3300005347 | Ga0070668_100768920 | Ga0070668_1007689201 | 205 |
| 1790 | 3300005353 | Ga0070669_100035026 | Ga0070669_1000350264 | 205 |
| 1791 | 3300005355 | Ga0070671_100077908 | Ga0070671_1000779082 | 205 |
| 1792 | 3300005355 | Ga0070671_100125094 | Ga0070671_1001250943 | 205 |
| 1793 | 3300005356 | Ga0070674_100043954 | Ga0070674_1000439542 | 205 |
| 1794 | 3300005364 | Ga0070673_100026947 | Ga0070673_1000269475 | 205 |
| 1795 | 3300005364 | Ga0070673_100096508 | Ga0070673_1000965083 | 205 |
| 1796 | 3300005366 | Ga0070659_100016119 | Ga0070659_1000161192 | 205 |
| 1797 | 3300005366 | Ga0070659_100223148 | Ga0070659_1002231482 | 205 |
| 1798 | 3300005366 | Ga0070659_100391073 | Ga0070659_1003910732 | 205 |
| 1799 | 3300005367 | Ga0070667_100042070 | Ga0070667_1000420703 | 205 |
| 1800 | 3300005367 | Ga0070667_100100603 | Ga0070667_1001006032 | 205 |
| 1801 | 3300005367 | Ga0070667_100373681 | Ga0070667_1003736812 | 205 |
| 1802 | 3300005367 | Ga0070667_100533014 | Ga0070667_1005330142 | 205 |
| 1803 | 3300005367 | Ga0070667_100989641 | Ga0070667_1009896411 | 205 |
| 1804 | 3300005436 | Ga0070713_100000018 | Ga0070713_10000001879 | 205 |
| 1805 | 3300005437 | Ga0070710_10399514 | Ga0070710_103995142 | 205 |
| 1806 | 3300005437 | Ga0070710_10404875 | Ga0070710_104048752 | 205 |
| 1807 | 3300005438 | Ga0070701_10118482 | Ga0070701_101184822 | 205 |
| 1808 | 3300005441 | Ga0070700_100015826 | Ga0070700_1000158262 | 205 |
| 1809 | 3300005456 | Ga0070678_100000941 | Ga0070678_10000094112 | 205 |
| 1810 | 3300005456 | Ga0070678_100611614 | Ga0070678_1006116141 | 205 |
| 1811 | 3300005456 | Ga0070678_100808854 | Ga0070678_1008088541 | 205 |
| 1812 | 3300005457 | Ga0070662_100074655 | Ga0070662_1000746552 | 205 |
| 1813 | 3300005459 | Ga0068867_100904289 | Ga0068867_1009042891 | 205 |
| 1814 | 3300005535 | Ga0070684_100019501 | Ga0070684_1000195013 | 205 |
| 1815 | 3300005539 | Ga0068853_100202750 | Ga0068853_1002027502 | 205 |
| 1816 | 3300005539 | Ga0068853_100580305 | Ga0068853_1005803051 | 205 |
| 1817 | 3300005543 | Ga0070672_100058354 | Ga0070672_1000583543 | 205 |
| 1818 | 3300005543 | Ga0070672_100383316 | Ga0070672_1003833162 | 205 |
| 1819 | 3300005547 | Ga0070693_100320706 | Ga0070693_1003207061 | 205 |
| 1820 | 3300005548 | Ga0070665_100058043 | Ga0070665_1000580432 | 205 |
| 1821 | 3300005563 | Ga0068855_100066535 | Ga0068855_1000665353 | 205 |
| 1822 | 3300005564 | Ga0070664_100939451 | Ga0070664_1009394512 | 205 |
| 1823 | 3300005577 | Ga0068857_100025285 | Ga0068857_1000252855 | 205 |
| 1824 | 3300005578 | Ga0068854_100072584 | Ga0068854_1000725842 | 205 |
| 1825 | 3300005578 | Ga0068854_100132320 | Ga0068854_1001323202 | 205 |
| 1826 | 3300005578 | Ga0068854_100349997 | Ga0068854_1003499972 | 205 |
| 1827 | 3300005614 | Ga0068856_100104259 | Ga0068856_1001042592 | 205 |
| 1828 | 3300005614 | Ga0068856_100347043 | Ga0068856_1003470432 | 205 |
| 1829 | 3300005615 | Ga0070702_100007631 | Ga0070702_1000076315 | 205 |
| 1830 | 3300005616 | Ga0068852_100100432 | Ga0068852_1001004322 | 205 |
| 1831 | 3300005617 | Ga0068859_100020441 | Ga0068859_1000204411 | 205 |
| 1832 | 3300005617 | Ga0068859_100251951 | Ga0068859_1002519513 | 205 |
| 1833 | 3300005618 | Ga0068864_100003834 | Ga0068864_1000038344 | 205 |
| 1834 | 3300005718 | Ga0068866_10027919 | Ga0068866_100279192 | 205 |
| 1835 | 3300005834 | Ga0068851_10020460 | Ga0068851_100204602 | 205 |
| 1836 | 3300005840 | Ga0068870_10013617 | Ga0068870_100136174 | 205 |
| 1837 | 3300005842 | Ga0068858_100042529 | Ga0068858_1000425295 | 205 |
| 1838 | 3300005842 | Ga0068858_100052225 | Ga0068858_1000522252 | 205 |
| 1839 | 3300005842 | Ga0068858_100886630 | Ga0068858_1008866301 | 205 |
| 1840 | 3300006028 | Ga0070717_10422491 | Ga0070717_104224912 | 205 |
| 1841 | 3300006038 | Ga0075365_10010319 | Ga0075365_100103193 | 205 |
| 1842 | 3300006358 | Ga0068871_100132455 | Ga0068871_1001324552 | 205 |
| 1843 | 3300006358 | Ga0068871_100312150 | Ga0068871_1003121502 | 205 |
| 1844 | 3300006852 | Ga0075433_10289896 | Ga0075433_102898962 | 205 |
| 1845 | 3300006881 | Ga0068865_100076924 | Ga0068865_1000769243 | 205 |
| 1846 | 3300006931 | Ga0097620_100020438 | Ga0097620_1000204381 | 205 |
| 1847 | 3300006931 | Ga0097620_100251960 | Ga0097620_1002519603 | 205 |
| 1848 | 3300009094 | Ga0111539_10022792 | Ga0111539_100227929 | 205 |
| 1849 | 3300009147 | Ga0114129_11199656 | Ga0114129_111996562 | 205 |
| 1850 | 3300009176 | Ga0105242_10036739 | Ga0105242_100367394 | 205 |
| 1851 | 3300009177 | Ga0105248_10006493 | Ga0105248_100064936 | 205 |
| 1852 | 3300009545 | Ga0105237_10651532 | Ga0105237_106515322 | 205 |
| 1853 | 3300009553 | Ga0105249_10822595 | Ga0105249_108225952 | 205 |
| 1854 | 3300009553 | Ga0105249_10827093 | Ga0105249_108270932 | 205 |
| 1855 | 3300010375 | Ga0105239_10062791 | Ga0105239_100627912 | 205 |
| 1856 | 3300013105 | Ga0157369_10210299 | Ga0157369_102102992 | 205 |
| 1857 | 3300013105 | Ga0157369_10227997 | Ga0157369_102279972 | 205 |
| 1858 | 3300013296 | Ga0157374_10177479 | Ga0157374_101774792 | 205 |
| 1859 | 3300013297 | Ga0157378_10299170 | Ga0157378_102991702 | 205 |
| 1860 | 3300013297 | Ga0157378_10308128 | Ga0157378_103081281 | 205 |
| 1861 | 3300013297 | Ga0157378_10951050 | Ga0157378_109510502 | 205 |
| 1862 | 3300013306 | Ga0163162_10066999 | Ga0163162_100669991 | 205 |
| 1863 | 3300013306 | Ga0163162_10678728 | Ga0163162_106787282 | 205 |
| 1864 | 3300013307 | Ga0157372_10033146 | Ga0157372_100331462 | 205 |
| 1865 | 3300013308 | Ga0157375_10291660 | Ga0157375_102916601 | 205 |
| 1866 | 3300014325 | Ga0163163_10616047 | Ga0163163_106160471 | 205 |
| 1867 | 3300014326 | Ga0157380_10821704 | Ga0157380_108217042 | 205 |
| 1868 | 3300014326 | Ga0157380_11256544 | Ga0157380_112565441 | 205 |
| 1869 | 3300014745 | Ga0157377_10037573 | Ga0157377_100375734 | 205 |
| 1870 | 3300014968 | Ga0157379_10014287 | Ga0157379_100142876 | 205 |
| 1871 | 3300014968 | Ga0157379_10038589 | Ga0157379_100385895 | 205 |
| 1872 | 3300014969 | Ga0157376_10084787 | Ga0157376_100847874 | 205 |
| 1873 | 3300017792 | Ga0163161_10091622 | Ga0163161_100916222 | 205 |
| 1874 | 3300017792 | Ga0163161_10535122 | Ga0163161_105351222 | 205 |
| 1875 | 3300025290 | Ga0207673_1000918 | Ga0207673_10009184 | 205 |
| 1876 | 3300025315 | Ga0207697_10002645 | Ga0207697_100026457 | 205 |
| 1877 | 3300025321 | Ga0207656_10006336 | Ga0207656_100063362 | 205 |
| 1878 | 3300025321 | Ga0207656_10069172 | Ga0207656_100691722 | 205 |
| 1879 | 3300025893 | Ga0207682_10003790 | Ga0207682_100037902 | 205 |
| 1880 | 3300025899 | Ga0207642_10248448 | Ga0207642_102484482 | 205 |
| 1881 | 3300025901 | Ga0207688_10001682 | Ga0207688_100016827 | 205 |
| 1882 | 3300025903 | Ga0207680_10025108 | Ga0207680_100251084 | 205 |
| 1883 | 3300025907 | Ga0207645_10001481 | Ga0207645_100014817 | 205 |
| 1884 | 3300025908 | Ga0207643_10002283 | Ga0207643_100022837 | 205 |
| 1885 | 3300025909 | Ga0207705_10051510 | Ga0207705_100515104 | 205 |
| 1886 | 3300025914 | Ga0207671_10058639 | Ga0207671_100586394 | 205 |
| 1887 | 3300025915 | Ga0207693_10045045 | Ga0207693_100450454 | 205 |
| 1888 | 3300025918 | Ga0207662_10001442 | Ga0207662_100014425 | 205 |
| 1889 | 3300025919 | Ga0207657_10032593 | Ga0207657_100325934 | 205 |
| 1890 | 3300025920 | Ga0207649_10036887 | Ga0207649_100368872 | 205 |
| 1891 | 3300025923 | Ga0207681_10283321 | Ga0207681_102833212 | 205 |
| 1892 | 3300025925 | Ga0207650_10002771 | Ga0207650_100027718 | 205 |
| 1893 | 3300025925 | Ga0207650_10044510 | Ga0207650_100445102 | 205 |
| 1894 | 3300025926 | Ga0207659_10011351 | Ga0207659_100113516 | 205 |
| 1895 | 3300025928 | Ga0207700_10000052 | Ga0207700_1000005256 | 205 |
| 1896 | 3300025931 | Ga0207644_10003185 | Ga0207644_100031855 | 205 |
| 1897 | 3300025932 | Ga0207690_10018974 | Ga0207690_100189743 | 205 |
| 1898 | 3300025932 | Ga0207690_10126134 | Ga0207690_101261342 | 205 |
| 1899 | 3300025933 | Ga0207706_10003460 | Ga0207706_100034607 | 205 |
| 1900 | 3300025937 | Ga0207669_10002740 | Ga0207669_100027403 | 205 |
| 1901 | 3300025937 | Ga0207669_10016706 | Ga0207669_100167064 | 205 |
| 1902 | 3300025938 | Ga0207704_10281057 | Ga0207704_102810572 | 205 |
| 1903 | 3300025940 | Ga0207691_10004886 | Ga0207691_100048864 | 205 |
| 1904 | 3300025940 | Ga0207691_10018207 | Ga0207691_100182077 | 205 |
| 1905 | 3300025940 | Ga0207691_10074883 | Ga0207691_100748833 | 205 |
| 1906 | 3300025941 | Ga0207711_10007597 | Ga0207711_100075972 | 205 |
| 1907 | 3300025941 | Ga0207711_10047277 | Ga0207711_100472772 | 205 |
| 1908 | 3300025942 | Ga0207689_10019394 | Ga0207689_100193944 | 205 |
| 1909 | 3300025944 | Ga0207661_10571633 | Ga0207661_105716332 | 205 |
| 1910 | 3300025945 | Ga0207679_10013547 | Ga0207679_100135473 | 205 |
| 1911 | 3300025945 | Ga0207679_10859123 | Ga0207679_108591231 | 205 |
| 1912 | 3300025949 | Ga0207667_10055665 | Ga0207667_100556653 | 205 |
| 1913 | 3300025960 | Ga0207651_10072585 | Ga0207651_100725853 | 205 |
| 1914 | 3300025960 | Ga0207651_10110633 | Ga0207651_101106332 | 205 |
| 1915 | 3300025961 | Ga0207712_10371102 | Ga0207712_103711022 | 205 |
| 1916 | 3300025972 | Ga0207668_10290848 | Ga0207668_102908482 | 205 |
| 1917 | 3300025981 | Ga0207640_10036401 | Ga0207640_100364012 | 205 |
| 1918 | 3300025981 | Ga0207640_10820422 | Ga0207640_108204222 | 205 |
| 1919 | 3300025986 | Ga0207658_10023760 | Ga0207658_100237603 | 205 |
| 1920 | 3300025986 | Ga0207658_10201013 | Ga0207658_102010132 | 205 |
| 1921 | 3300025986 | Ga0207658_10473957 | Ga0207658_104739572 | 205 |
| 1922 | 3300026023 | Ga0207677_10174490 | Ga0207677_101744903 | 205 |
| 1923 | 3300026023 | Ga0207677_10539610 | Ga0207677_105396101 | 205 |
| 1924 | 3300026035 | Ga0207703_10065549 | Ga0207703_100655492 | 205 |
| 1925 | 3300026035 | Ga0207703_10258828 | Ga0207703_102588282 | 205 |
| 1926 | 3300026067 | Ga0207678_10003576 | Ga0207678_1000357614 | 205 |
| 1927 | 3300026075 | Ga0207708_10000558 | Ga0207708_1000055819 | 205 |
| 1928 | 3300026089 | Ga0207648_10010711 | Ga0207648_100107118 | 205 |
| 1929 | 3300026095 | Ga0207676_10022527 | Ga0207676_100225274 | 205 |
| 1930 | 3300026116 | Ga0207674_10002376 | Ga0207674_100023768 | 205 |
| 1931 | 3300026116 | Ga0207674_10214850 | Ga0207674_102148502 | 205 |
| 1932 | 3300026118 | Ga0207675_100002315 | Ga0207675_1000023156 | 205 |
| 1933 | 3300026118 | Ga0207675_100061406 | Ga0207675_1000614062 | 205 |
| 1934 | 3300026121 | Ga0207683_10009047 | Ga0207683_100090473 | 205 |
| 1935 | 3300026121 | Ga0207683_10011779 | Ga0207683_100117796 | 205 |
| 1936 | 3300026121 | Ga0207683_10409034 | Ga0207683_104090342 | 205 |
| 1937 | 3300026121 | Ga0207683_10604826 | Ga0207683_106048262 | 205 |
| 1938 | 3300026142 | Ga0207698_10025234 | Ga0207698_100252344 | 205 |
| 1939 | 3300026142 | Ga0207698_10101682 | Ga0207698_101016823 | 205 |
| 1940 | 3300027526 | Ga0209968_1013722 | Ga0209968_10137222 | 205 |
| 1941 | 3300027617 | Ga0210002_1007602 | Ga0210002_10076023 | 205 |
| 1942 | 3300027717 | Ga0209998_10008846 | Ga0209998_100088462 | 205 |
| 1943 | 3300027876 | Ga0209974_10000445 | Ga0209974_1000044510 | 205 |
| 1944 | 3300028379 | Ga0268266_10299975 | Ga0268266_102999752 | 205 |
| 1945 | 3300028380 | Ga0268265_10114171 | Ga0268265_101141713 | 205 |
| 1946 | 3300028381 | Ga0268264_10121640 | Ga0268264_101216402 | 205 |
| 1947 | 3300031548 | Ga0307408_100272653 | Ga0307408_1002726532 | 205 |
| 1948 | 3300031730 | Ga0307516_10007532 | Ga0307516_100075323 | 205 |
| 1949 | 3300031824 | Ga0307413_10001878 | Ga0307413_100018782 | 205 |
| 1950 | 3300031901 | Ga0307406_10023234 | Ga0307406_100232343 | 205 |
| 1951 | 3300031995 | Ga0307409_100002844 | Ga0307409_1000028442 | 205 |
| 1952 | 3300032002 | Ga0307416_100002602 | Ga0307416_1000026022 | 205 |
| 1953 | 3300032004 | Ga0307414_10091577 | Ga0307414_100915773 | 205 |
| 1954 | 3300032005 | Ga0307411_10056023 | Ga0307411_100560233 | 205 |
| 1955 | 3300035113 | Ga0373936_0044308 | Ga0373936_0044308_743_1399 | 205 |
| 1956 | 3300036401 | Ga0373937_0015648 | Ga0373937_0015648_5685_6323 | 205 |
| 1957 | 3300037068 | Ga0373925_0242691 | Ga0373925_0242691_439_1077 | 205 |
| 1958 | 3300037068 | Ga0373925_0595786 | Ga0373925_0595786_24_662 | 205 |
| 1959 | 3300037853 | Ga0436364_1521153 | Ga0436364_1521153_660_1295 | 205 |
| 1960 | 3300039437 | Ga0436365_1498206 | Ga0436365_1498206_14_649 | 205 |
| 1961 | 3300041491 | Ga0451833_1190930 | Ga0451833_1190930_80_721 | 205 |
| 1962 | 3300041512 | Ga0451853_1447831 | Ga0451853_1447831_803_1441 | 205 |
| 1963 | 3300042012 | Ga0439455_0047256 | Ga0439455_0047256_192_881 | 205 |
| 1964 | 3300042439 | Ga0439464_0004864 | Ga0439464_0004864_834_1523 | 205 |
| 1965 | 3300045051 | Ga0451576_0178637 | Ga0451576_0178637_790_1425 | 205 |
| 1966 | 3300046537 | Ga0495598_0021406 | Ga0495598_0021406_955_1593 | 205 |
| 1967 | 3300046539 | Ga0495621_0006769 | Ga0495621_0006769_78_716 | 205 |
| 1968 | 3300048903 | Ga0496100_0032367 | Ga0496100_0032367_1038_1676 | 205 |
| 1969 | 3300048903 | Ga0496100_0317195 | Ga0496100_0317195_128_754 | 205 |
| 1970 | 3300048905 | Ga0496102_0141534 | Ga0496102_0141534_405_1043 | 205 |
| 1971 | 3300048905 | Ga0496102_0246661 | Ga0496102_0246661_36_674 | 205 |
| 1972 | 3300048905 | Ga0496102_0410713 | Ga0496102_0410713_535_1161 | 205 |
| 1973 | 3300048907 | Ga0496104_0033621 | Ga0496104_0033621_1158_1796 | 205 |
| 1974 | 3300048907 | Ga0496104_0259575 | Ga0496104_0259575_602_1228 | 205 |
| 1975 | 3300048909 | Ga0496106_0082536 | Ga0496106_0082536_593_1231 | 205 |
| 1976 | 3300048912 | Ga0496109_0008278 | Ga0496109_0008278_4287_4925 | 205 |
| 1977 | 3300048915 | Ga0496112_0812197 | Ga0496112_0812197_175_813 | 205 |
| 1978 | 3300048917 | Ga0496114_0008095 | Ga0496114_0008095_1802_2440 | 205 |
| 1979 | 3300049574 | Ga0501038_0522109 | Ga0501038_0522109_169_795 | 205 |
| 1980 | 3300049575 | Ga0501039_0207273 | Ga0501039_0207273_125_751 | 205 |
| 1981 | 3300049577 | Ga0501041_0472878 | Ga0501041_0472878_86_712 | 205 |
| 1982 | 3300049578 | Ga0501042_0317510 | Ga0501042_0317510_239_865 | 205 |
| 1983 | 3300049588 | Ga0501072_0466182 | Ga0501072_0466182_171_797 | 205 |
| 1984 | 3300049823 | Ga0501044_0034206 | Ga0501044_0034206_4527_5153 | 205 |
| 1985 | 3300050492 | nmdc:mga0yw44_26588_c1 | nmdc:mga0yw44_26588_c1_745_1377 | 205 |
| 1986 | 3300050511 | nmdc:mga08y16_103169_c1 | nmdc:mga08y16_103169_c1_1921_2559 | 205 |
| 1987 | 3300050513 | nmdc:mga0rr50_511315_c1 | nmdc:mga0rr50_511315_c1_76_714 | 205 |
| 1988 | 3300060353 | Ga0501082_0852826 | Ga0501082_0852826_49_675 | 205 |
| 1989 | 3300061734 | Ga0530510_0872702 | Ga0530510_0872702_38_664 | 205 |
| 1990 | 2010549000 | RicEn_FSXC70212_g1 | RicEn_530520 | 206 |
| 1991 | 3300005328 | Ga0070676_10011240 | Ga0070676_100112406 | 206 |
| 1992 | 3300005329 | Ga0070683_100025144 | Ga0070683_1000251443 | 206 |
| 1993 | 3300005330 | Ga0070690_100249148 | Ga0070690_1002491482 | 206 |
| 1994 | 3300005331 | Ga0070670_100789880 | Ga0070670_1007898802 | 206 |
| 1995 | 3300005334 | Ga0068869_100033584 | Ga0068869_1000335843 | 206 |
| 1996 | 3300005335 | Ga0070666_10051656 | Ga0070666_100516562 | 206 |
| 1997 | 3300005338 | Ga0068868_100022186 | Ga0068868_1000221862 | 206 |
| 1998 | 3300005338 | Ga0068868_100105992 | Ga0068868_1001059922 | 206 |
| 1999 | 3300005339 | Ga0070660_100230342 | Ga0070660_1002303422 | 206 |
| 2000 | 3300005340 | Ga0070689_100064787 | Ga0070689_1000647872 | 206 |
| 2001 | 3300005343 | Ga0070687_100012451 | Ga0070687_1000124513 | 206 |
| 2002 | 3300005343 | Ga0070687_100123626 | Ga0070687_1001236262 | 206 |
| 2003 | 3300005344 | Ga0070661_100014534 | Ga0070661_1000145343 | 206 |
| 2004 | 3300005344 | Ga0070661_100387720 | Ga0070661_1003877201 | 206 |
| 2005 | 3300005347 | Ga0070668_100037799 | Ga0070668_1000377992 | 206 |
| 2006 | 3300005353 | Ga0070669_100003867 | Ga0070669_1000038673 | 206 |
| 2007 | 3300005354 | Ga0070675_100019977 | Ga0070675_1000199773 | 206 |
| 2008 | 3300005354 | Ga0070675_100202813 | Ga0070675_1002028132 | 206 |
| 2009 | 3300005355 | Ga0070671_100136348 | Ga0070671_1001363482 | 206 |
| 2010 | 3300005356 | Ga0070674_100009649 | Ga0070674_1000096493 | 206 |
| 2011 | 3300005364 | Ga0070673_100034172 | Ga0070673_1000341722 | 206 |
| 2012 | 3300005366 | Ga0070659_100014156 | Ga0070659_1000141565 | 206 |
| 2013 | 3300005367 | Ga0070667_100007096 | Ga0070667_1000070969 | 206 |
| 2014 | 3300005367 | Ga0070667_100025581 | Ga0070667_1000255815 | 206 |
| 2015 | 3300005438 | Ga0070701_10139266 | Ga0070701_101392662 | 206 |
| 2016 | 3300005441 | Ga0070700_100206386 | Ga0070700_1002063862 | 206 |
| 2017 | 3300005456 | Ga0070678_100295503 | Ga0070678_1002955032 | 206 |
| 2018 | 3300005456 | Ga0070678_100489479 | Ga0070678_1004894792 | 206 |
| 2019 | 3300005457 | Ga0070662_100462487 | Ga0070662_1004624872 | 206 |
| 2020 | 3300005458 | Ga0070681_10056763 | Ga0070681_100567633 | 206 |
| 2021 | 3300005459 | Ga0068867_100005611 | Ga0068867_1000056118 | 206 |
| 2022 | 3300005530 | Ga0070679_100003825 | Ga0070679_10000382513 | 206 |
| 2023 | 3300005535 | Ga0070684_100041554 | Ga0070684_1000415543 | 206 |
| 2024 | 3300005535 | Ga0070684_100057631 | Ga0070684_1000576311 | 206 |
| 2025 | 3300005539 | Ga0068853_100017836 | Ga0068853_1000178363 | 206 |
| 2026 | 3300005543 | Ga0070672_100002181 | Ga0070672_1000021819 | 206 |
| 2027 | 3300005543 | Ga0070672_100021542 | Ga0070672_1000215423 | 206 |
| 2028 | 3300005543 | Ga0070672_100422823 | Ga0070672_1004228232 | 206 |
| 2029 | 3300005547 | Ga0070693_100424186 | Ga0070693_1004241861 | 206 |
| 2030 | 3300005548 | Ga0070665_100181467 | Ga0070665_1001814672 | 206 |
| 2031 | 3300005563 | Ga0068855_100138616 | Ga0068855_1001386162 | 206 |
| 2032 | 3300005564 | Ga0070664_100011493 | Ga0070664_1000114935 | 206 |
| 2033 | 3300005564 | Ga0070664_100089333 | Ga0070664_1000893332 | 206 |
| 2034 | 3300005564 | Ga0070664_100104005 | Ga0070664_1001040053 | 206 |
| 2035 | 3300005577 | Ga0068857_100077462 | Ga0068857_1000774622 | 206 |
| 2036 | 3300005578 | Ga0068854_100106117 | Ga0068854_1001061172 | 206 |
| 2037 | 3300005614 | Ga0068856_100076585 | Ga0068856_1000765853 | 206 |
| 2038 | 3300005614 | Ga0068856_100255630 | Ga0068856_1002556302 | 206 |
| 2039 | 3300005616 | Ga0068852_100013214 | Ga0068852_1000132148 | 206 |
| 2040 | 3300005616 | Ga0068852_100015034 | Ga0068852_1000150345 | 206 |
| 2041 | 3300005616 | Ga0068852_100084266 | Ga0068852_1000842662 | 206 |
| 2042 | 3300005616 | Ga0068852_100815977 | Ga0068852_1008159772 | 206 |
| 2043 | 3300005617 | Ga0068859_100027077 | Ga0068859_1000270774 | 206 |
| 2044 | 3300005617 | Ga0068859_100109338 | Ga0068859_1001093383 | 206 |
| 2045 | 3300005618 | Ga0068864_100011737 | Ga0068864_1000117375 | 206 |
| 2046 | 3300005618 | Ga0068864_100025267 | Ga0068864_1000252672 | 206 |
| 2047 | 3300005618 | Ga0068864_100225337 | Ga0068864_1002253372 | 206 |
| 2048 | 3300005618 | Ga0068864_100420409 | Ga0068864_1004204092 | 206 |
| 2049 | 3300005719 | Ga0068861_100024484 | Ga0068861_1000244842 | 206 |
| 2050 | 3300005834 | Ga0068851_10155557 | Ga0068851_101555572 | 206 |
| 2051 | 3300005841 | Ga0068863_100034797 | Ga0068863_1000347973 | 206 |
| 2052 | 3300005841 | Ga0068863_100259269 | Ga0068863_1002592692 | 206 |
| 2053 | 3300005841 | Ga0068863_100397503 | Ga0068863_1003975032 | 206 |
| 2054 | 3300005841 | Ga0068863_100666250 | Ga0068863_1006662501 | 206 |
| 2055 | 3300005842 | Ga0068858_100003892 | Ga0068858_10000389210 | 206 |
| 2056 | 3300005842 | Ga0068858_100095010 | Ga0068858_1000950102 | 206 |
| 2057 | 3300005843 | Ga0068860_100006887 | Ga0068860_1000068873 | 206 |
| 2058 | 3300005843 | Ga0068860_100015755 | Ga0068860_1000157553 | 206 |
| 2059 | 3300005843 | Ga0068860_100524543 | Ga0068860_1005245432 | 206 |
| 2060 | 3300005844 | Ga0068862_100018535 | Ga0068862_1000185352 | 206 |
| 2061 | 3300006058 | Ga0075432_10186595 | Ga0075432_101865951 | 206 |
| 2062 | 3300006237 | Ga0097621_100162654 | Ga0097621_1001626542 | 206 |
| 2063 | 3300006237 | Ga0097621_100454211 | Ga0097621_1004542111 | 206 |
| 2064 | 3300006881 | Ga0068865_100424004 | Ga0068865_1004240042 | 206 |
| 2065 | 3300006931 | Ga0097620_100027078 | Ga0097620_1000270782 | 206 |
| 2066 | 3300006931 | Ga0097620_100109345 | Ga0097620_1001093453 | 206 |
| 2067 | 3300009176 | Ga0105242_10031513 | Ga0105242_100315133 | 206 |
| 2068 | 3300009177 | Ga0105248_10208018 | Ga0105248_102080182 | 206 |
| 2069 | 3300009551 | Ga0105238_10007894 | Ga0105238_100078947 | 206 |
| 2070 | 3300009553 | Ga0105249_10038924 | Ga0105249_100389242 | 206 |
| 2071 | 3300013100 | Ga0157373_10011513 | Ga0157373_100115133 | 206 |
| 2072 | 3300013102 | Ga0157371_10051970 | Ga0157371_100519702 | 206 |
| 2073 | 3300013297 | Ga0157378_10061027 | Ga0157378_100610274 | 206 |
| 2074 | 3300013297 | Ga0157378_10212366 | Ga0157378_102123662 | 206 |
| 2075 | 3300013306 | Ga0163162_10010080 | Ga0163162_100100802 | 206 |
| 2076 | 3300013308 | Ga0157375_10559788 | Ga0157375_105597882 | 206 |
| 2077 | 3300013308 | Ga0157375_11024923 | Ga0157375_110249232 | 206 |
| 2078 | 3300014326 | Ga0157380_10021253 | Ga0157380_100212532 | 206 |
| 2079 | 3300014326 | Ga0157380_10053461 | Ga0157380_100534612 | 206 |
| 2080 | 3300014326 | Ga0157380_10517566 | Ga0157380_105175662 | 206 |
| 2081 | 3300014745 | Ga0157377_10355129 | Ga0157377_103551292 | 206 |
| 2082 | 3300014968 | Ga0157379_10005033 | Ga0157379_100050339 | 206 |
| 2083 | 3300014968 | Ga0157379_10043827 | Ga0157379_100438273 | 206 |
| 2084 | 3300014969 | Ga0157376_10034022 | Ga0157376_100340222 | 206 |
| 2085 | 3300017792 | Ga0163161_10107034 | Ga0163161_101070342 | 206 |
| 2086 | 3300025315 | Ga0207697_10005514 | Ga0207697_100055142 | 206 |
| 2087 | 3300025321 | Ga0207656_10006584 | Ga0207656_100065842 | 206 |
| 2088 | 3300025893 | Ga0207682_10026959 | Ga0207682_100269592 | 206 |
| 2089 | 3300025899 | Ga0207642_10036079 | Ga0207642_100360793 | 206 |
| 2090 | 3300025899 | Ga0207642_10194466 | Ga0207642_101944662 | 206 |
| 2091 | 3300025901 | Ga0207688_10119420 | Ga0207688_101194202 | 206 |
| 2092 | 3300025903 | Ga0207680_10245688 | Ga0207680_102456882 | 206 |
| 2093 | 3300025907 | Ga0207645_10014278 | Ga0207645_100142786 | 206 |
| 2094 | 3300025907 | Ga0207645_10015476 | Ga0207645_100154763 | 206 |
| 2095 | 3300025909 | Ga0207705_10112090 | Ga0207705_101120902 | 206 |
| 2096 | 3300025918 | Ga0207662_10029230 | Ga0207662_100292302 | 206 |
| 2097 | 3300025918 | Ga0207662_10034420 | Ga0207662_100344202 | 206 |
| 2098 | 3300025919 | Ga0207657_10091021 | Ga0207657_100910212 | 206 |
| 2099 | 3300025919 | Ga0207657_10179246 | Ga0207657_101792462 | 206 |
| 2100 | 3300025920 | Ga0207649_10009516 | Ga0207649_100095163 | 206 |
| 2101 | 3300025921 | Ga0207652_10015677 | Ga0207652_100156773 | 206 |
| 2102 | 3300025923 | Ga0207681_10000826 | Ga0207681_100008269 | 206 |
| 2103 | 3300025924 | Ga0207694_10393672 | Ga0207694_103936722 | 206 |
| 2104 | 3300025925 | Ga0207650_10095034 | Ga0207650_100950342 | 206 |
| 2105 | 3300025925 | Ga0207650_10165870 | Ga0207650_101658702 | 206 |
| 2106 | 3300025925 | Ga0207650_10296131 | Ga0207650_102961312 | 206 |
| 2107 | 3300025926 | Ga0207659_10169198 | Ga0207659_101691982 | 206 |
| 2108 | 3300025927 | Ga0207687_10141822 | Ga0207687_101418222 | 206 |
| 2109 | 3300025931 | Ga0207644_10000223 | Ga0207644_1000022323 | 206 |
| 2110 | 3300025931 | Ga0207644_10008458 | Ga0207644_100084583 | 206 |
| 2111 | 3300025932 | Ga0207690_10217509 | Ga0207690_102175092 | 206 |
| 2112 | 3300025933 | Ga0207706_10487205 | Ga0207706_104872051 | 206 |
| 2113 | 3300025934 | Ga0207686_10169686 | Ga0207686_101696862 | 206 |
| 2114 | 3300025935 | Ga0207709_10006706 | Ga0207709_100067065 | 206 |
| 2115 | 3300025937 | Ga0207669_10178965 | Ga0207669_101789652 | 206 |
| 2116 | 3300025937 | Ga0207669_10558916 | Ga0207669_105589162 | 206 |
| 2117 | 3300025938 | Ga0207704_10002371 | Ga0207704_100023718 | 206 |
| 2118 | 3300025938 | Ga0207704_10022772 | Ga0207704_100227723 | 206 |
| 2119 | 3300025938 | Ga0207704_10095530 | Ga0207704_100955302 | 206 |
| 2120 | 3300025938 | Ga0207704_10419024 | Ga0207704_104190242 | 206 |
| 2121 | 3300025938 | Ga0207704_10467395 | Ga0207704_104673952 | 206 |
| 2122 | 3300025940 | Ga0207691_10021499 | Ga0207691_100214992 | 206 |
| 2123 | 3300025940 | Ga0207691_10053661 | Ga0207691_100536612 | 206 |
| 2124 | 3300025940 | Ga0207691_10089902 | Ga0207691_100899022 | 206 |
| 2125 | 3300025940 | Ga0207691_10164989 | Ga0207691_101649893 | 206 |
| 2126 | 3300025941 | Ga0207711_10056557 | Ga0207711_100565572 | 206 |
| 2127 | 3300025941 | Ga0207711_10473011 | Ga0207711_104730112 | 206 |
| 2128 | 3300025941 | Ga0207711_10534347 | Ga0207711_105343472 | 206 |
| 2129 | 3300025942 | Ga0207689_10001323 | Ga0207689_100013235 | 206 |
| 2130 | 3300025944 | Ga0207661_10033466 | Ga0207661_100334664 | 206 |
| 2131 | 3300025945 | Ga0207679_10004670 | Ga0207679_100046705 | 206 |
| 2132 | 3300025949 | Ga0207667_10035301 | Ga0207667_100353015 | 206 |
| 2133 | 3300025960 | Ga0207651_10007058 | Ga0207651_100070585 | 206 |
| 2134 | 3300025960 | Ga0207651_10259272 | Ga0207651_102592722 | 206 |
| 2135 | 3300025972 | Ga0207668_10012347 | Ga0207668_100123473 | 206 |
| 2136 | 3300025981 | Ga0207640_10365045 | Ga0207640_103650451 | 206 |
| 2137 | 3300025986 | Ga0207658_10002825 | Ga0207658_100028252 | 206 |
| 2138 | 3300025986 | Ga0207658_10364065 | Ga0207658_103640652 | 206 |
| 2139 | 3300025986 | Ga0207658_11007142 | Ga0207658_110071421 | 206 |
| 2140 | 3300026023 | Ga0207677_10015290 | Ga0207677_100152901 | 206 |
| 2141 | 3300026023 | Ga0207677_10068294 | Ga0207677_100682943 | 206 |
| 2142 | 3300026035 | Ga0207703_10000504 | Ga0207703_1000050430 | 206 |
| 2143 | 3300026035 | Ga0207703_10007335 | Ga0207703_100073356 | 206 |
| 2144 | 3300026041 | Ga0207639_10231071 | Ga0207639_102310712 | 206 |
| 2145 | 3300026075 | Ga0207708_10046044 | Ga0207708_100460442 | 206 |
| 2146 | 3300026078 | Ga0207702_10011425 | Ga0207702_100114255 | 206 |
| 2147 | 3300026078 | Ga0207702_10209102 | Ga0207702_102091022 | 206 |
| 2148 | 3300026088 | Ga0207641_10004421 | Ga0207641_1000442111 | 206 |
| 2149 | 3300026088 | Ga0207641_10178863 | Ga0207641_101788632 | 206 |
| 2150 | 3300026089 | Ga0207648_10127708 | Ga0207648_101277083 | 206 |
| 2151 | 3300026089 | Ga0207648_10329262 | Ga0207648_103292622 | 206 |
| 2152 | 3300026095 | Ga0207676_10018994 | Ga0207676_100189944 | 206 |
| 2153 | 3300026095 | Ga0207676_10022675 | Ga0207676_100226755 | 206 |
| 2154 | 3300026116 | Ga0207674_10031643 | Ga0207674_100316434 | 206 |
| 2155 | 3300026118 | Ga0207675_100002610 | Ga0207675_10000261013 | 206 |
| 2156 | 3300026121 | Ga0207683_10333903 | Ga0207683_103339031 | 206 |
| 2157 | 3300026121 | Ga0207683_10346718 | Ga0207683_103467182 | 206 |
| 2158 | 3300026142 | Ga0207698_10144575 | Ga0207698_101445752 | 206 |
| 2159 | 3300026142 | Ga0207698_10419167 | Ga0207698_104191672 | 206 |
| 2160 | 3300028379 | Ga0268266_10153701 | Ga0268266_101537012 | 206 |
| 2161 | 3300028380 | Ga0268265_10040778 | Ga0268265_100407783 | 206 |
| 2162 | 3300028381 | Ga0268264_10020371 | Ga0268264_100203713 | 206 |
| 2163 | 3300028381 | Ga0268264_10039273 | Ga0268264_100392734 | 206 |
| 2164 | 3300028381 | Ga0268264_10133185 | Ga0268264_101331851 | 206 |
| 2165 | 3300031731 | Ga0307405_10059257 | Ga0307405_100592572 | 206 |
| 2166 | 3300031995 | Ga0307409_100041713 | Ga0307409_1000417133 | 206 |
| 2167 | 3300032002 | Ga0307416_100001574 | Ga0307416_1000015744 | 206 |
| 2168 | 3300032126 | Ga0307415_100007051 | Ga0307415_1000070512 | 206 |
| 2169 | 3300035117 | Ga0373953_0065968 | Ga0373953_0065968_631_1323 | 206 |
| 2170 | 3300035118 | Ga0373954_0047471 | Ga0373954_0047471_631_1323 | 206 |
| 2171 | 3300035120 | Ga0373957_0024701 | Ga0373957_0024701_1038_1730 | 206 |
| 2172 | 3300035170 | Ga0373943_0017569 | Ga0373943_0017569_1808_2500 | 206 |
| 2173 | 3300035172 | Ga0373955_0084035 | Ga0373955_0084035_269_961 | 206 |
| 2174 | 3300035410 | Ga0373924_0052712 | Ga0373924_0052712_134_826 | 206 |
| 2175 | 3300035725 | Ga0373947_0073171 | Ga0373947_0073171_116_808 | 206 |
| 2176 | 3300036401 | Ga0373937_0174464 | Ga0373937_0174464_731_1441 | 206 |
| 2177 | 3300039450 | Ga0436363_0541622 | Ga0436363_0541622_2961_3653 | 206 |
| 2178 | 3300045051 | Ga0451576_0349392 | Ga0451576_0349392_287_976 | 206 |
| 2179 | 3300046507 | Ga0495606_0040174 | Ga0495606_0040174_2097_2744 | 206 |
| 2180 | 3300046535 | Ga0495586_0366471 | Ga0495586_0366471_14_706 | 206 |
| 2181 | 3300046539 | Ga0495621_0186132 | Ga0495621_0186132_44_736 | 206 |
| 2182 | 3300046683 | Ga0495658_0026757 | Ga0495658_0026757_1129_1821 | 206 |
| 2183 | 3300046683 | Ga0495658_0043354 | Ga0495658_0043354_854_1546 | 206 |
| 2184 | 3300046809 | Ga0495600_0115097 | Ga0495600_0115097_481_1173 | 206 |
| 2185 | 3300046809 | Ga0495600_0220855 | Ga0495600_0220855_317_1009 | 206 |
| 2186 | 3300047322 | Ga0495680_0146953 | Ga0495680_0146953_66_758 | 206 |
| 2187 | 3300047444 | Ga0495675_0157922 | Ga0495675_0157922_208_900 | 206 |
| 2188 | 3300047471 | Ga0495684_0081239 | Ga0495684_0081239_951_1643 | 206 |
| 2189 | 3300048911 | Ga0496108_0574932 | Ga0496108_0574932_241_933 | 206 |
| 2190 | 3300048913 | Ga0496110_0327576 | Ga0496110_0327576_458_1150 | 206 |
| 2191 | 3300050511 | nmdc:mga08y16_414253_c1 | nmdc:mga08y16_414253_c1_444_1133 | 206 |
| 2192 | 3300053077 | Ga0495601_0031506 | Ga0495601_0031506_2016_2708 | 206 |
| 2193 | 3300053085 | Ga0495619_0097152 | Ga0495619_0097152_997_1689 | 206 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1eo9-assembly1.cif.gz_A | crystal structure of acinetobacter sp. adp1 protocatechuate 3,4-dioxygenase at ph < 7.0 | 0.9386 | 8 | 206 |
| 2bux-assembly1.cif.gz_A | crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r133h | 0.9369 | 8 | 206 |
| 2bum-assembly1.cif.gz_A | crystal structure of wild-type protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 | 0.9366 | 8 | 206 |
| 1eo9-assembly1.cif.gz_A | crystal structure of acinetobacter sp. adp1 protocatechuate 3,4-dioxygenase at ph < 7.0 | 0.9205 | 8 | 206 |
| 2bux-assembly1.cif.gz_A | crystal structure of protocatechuate 3,4-dioxygenase from acinetobacter sp. adp1 mutant r133h | 0.9188 | 8 | 206 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ykkA00 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.8909 | 5 | 206 | 2.60.130.10 |
| 1ykkA00 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.8823 | 5 | 206 | 2.60.130.10 |
| 4iltA00 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.7497 | 34 | 197 | 2.60.130.10 |
| 2boyB00 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.7492 | 41 | 194 | 2.60.130.10 |
| 1eo2B00 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.7439 | 1 | 205 | 2.60.130.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A526QD84-F1-model_v4 | Protocatechuate 3,4-dioxygenase subunit alpha | 0.9826 | 115 | 206 |
GO:0005506
GO:0016702 |
| AF-A0A358H0J6-F1-model_v4 | deleted | 0.982 | 39 | 206 |
|
| AF-A0A529XP50-F1-model_v4 | deleted | 0.9811 | 103 | 206 |
|
| AF-A0A240C2B3-F1-model_v4 | Protocatechuate 3,4-dioxygenase alpha chain (EC 1.13.11.3) | 0.9794 | 93 | 206 |
GO:0005506
GO:0009056 GO:0018578 |
| AF-A0A378B320-F1-model_v4 | Protocatechuate 3,4-dioxygenase subunit alpha (EC 1.13.11.3) | 0.9767 | 129 | 206 |
GO:0005506
GO:0018578 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar