metagRoot

F496541

General Info

Members	Datasets	Scaffolds	Average Seq Length
2196	1338	4392	198

Family's Representative Sequence

Representative Sequence	3300038443\|Ga0395901_1021864\|Ga0395901_1021864_63_758
Length	231
Sequence	LRLGTAKSGDPMKMIRIGAALASPLKRGQGVRIMASQEIEALSQALARLPGLGPRSARRAVLHLMKKRETALQPLLAALKQVADKLSTCSVCGNVDTSDPXXXXSDPRRDEKMLCVVEEVADLWALDRSRLFPGRYHVLGGRLSALEGVRPEDLSIDKLVSRVSKGGIDEVVLAMNATLEGQTTAHYLAEQLEKFPIRLSQLAHGLPVGGELDYLDEGTLAQALRARRPIS

Samples

	Sample ID	Description	Type	Environment
1	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
2	3300001976	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7	Metagenome	Rhizosphere
3	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
4	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
5	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
6	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
7	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
8	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
9	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
10	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
11	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
12	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
13	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
14	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
15	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
16	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
17	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
18	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
19	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
20	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
21	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
22	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
23	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
24	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
25	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
26	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
27	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
28	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
29	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
30	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
31	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
32	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
33	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
34	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
35	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
36	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
37	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
38	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
39	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
40	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
41	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
42	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
43	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
44	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
45	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
46	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
47	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
48	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
49	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
50	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
51	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
52	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
53	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
54	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
55	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
56	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
57	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
58	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
59	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
60	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
61	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
62	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
63	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
64	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
65	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
66	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
67	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
68	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
69	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
70	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
71	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
72	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
73	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
74	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
75	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
76	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
77	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
78	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
79	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
80	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
81	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
82	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
83	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
84	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
85	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
86	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
87	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
88	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
89	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
90	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
91	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
92	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
93	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
94	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
95	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
96	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
97	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
98	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
99	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
100	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
101	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
102	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
103	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
104	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
105	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
106	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
107	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
108	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
109	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
110	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
111	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
112	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
113	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
114	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
115	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
116	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
117	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
118	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
119	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
120	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
121	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
122	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
123	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
124	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
125	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
126	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
127	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
128	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
129	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
130	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
131	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
132	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
133	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
134	3300009765	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule	Metagenome	Nodule
135	3300009766	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule	Metagenome	Nodule
136	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
137	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
138	3300012490	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610	Metagenome	Rhizosphere
139	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
140	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
141	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
142	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
143	3300013249	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06	Metagenome	Rhizosphere
144	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
145	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
146	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
147	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
148	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
149	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
150	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
151	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
152	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
153	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
154	3300015684	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02	Metagenome	Unclassified
155	3300015690	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05	Metagenome	Rhizosphere
156	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
157	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
158	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
159	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
160	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
161	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
162	3300022739	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules	Metagenome	Nodule
163	3300022740	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules	Metagenome	Nodule
164	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
165	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
166	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
167	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
168	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
169	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
170	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
171	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
172	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
173	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
174	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
175	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
176	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
177	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
178	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
179	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
180	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
181	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
182	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
183	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
184	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
185	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
186	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
187	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
188	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
189	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
190	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
244	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
246	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
247	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
249	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
253	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
254	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
255	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
256	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
257	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
258	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
259	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
260	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
261	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
262	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
263	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
264	3300031967	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules	Metagenome	Nodule
265	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
266	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
267	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
268	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
269	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
270	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
271	3300033430	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules	Metagenome	Nodule
272	3300033464	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules	Metagenome	Nodule
273	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
274	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
275	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
276	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
277	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
278	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
279	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
280	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
281	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
282	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
283	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
284	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
285	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
286	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
287	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
288	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
289	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
290	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
291	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
292	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
293	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
294	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
295	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
296	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
297	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
298	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
299	3300041506	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT	Metatranscriptome	Unclassified
300	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
301	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
302	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
303	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
304	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
305	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
306	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
307	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
308	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
309	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
310	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
311	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
312	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
313	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
314	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
315	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
316	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
317	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
318	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
319	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
320	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
321	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
322	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
323	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
324	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
325	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
326	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
327	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
328	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
329	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
330	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
331	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
332	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
333	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
334	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
335	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
336	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
337	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
338	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
339	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
340	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
341	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
342	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
343	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
344	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
345	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
346	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
347	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
348	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
349	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
350	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
351	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
352	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
353	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
354	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
355	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
356	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
357	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
358	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
359	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
360	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
361	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
362	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
363	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
364	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
365	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
366	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
367	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
368	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
369	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
370	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
371	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
372	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
373	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
374	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
375	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
376	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
377	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
378	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
379	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
380	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
381	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
382	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
383	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
384	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
385	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
386	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
387	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
388	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
389	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
390	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
391	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
392	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
393	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
394	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
395	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
396	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
397	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
398	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
399	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
400	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
401	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
402	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
403	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
404	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
405	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
406	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
407	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
408	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
409	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
410	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
411	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
412	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
413	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
414	3300049765	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought	Metagenome	Rhizosphere
415	3300049770	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control	Metagenome	Rhizosphere
416	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
417	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
418	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
419	3300049850	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control	Metagenome	Rhizosphere
420	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
421	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
422	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
423	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
424	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
425	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
426	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
427	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
428	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
429	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
430	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
431	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
432	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
433	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
434	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
435	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
436	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
437	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
438	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
439	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
440	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
441	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
442	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
443	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
444	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
445	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
446	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
447	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
448	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
449	3300053126	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere	Metagenome	Endosphere
450	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
451	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
452	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
453	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
454	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
455	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
456	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
457	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
458	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
459	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
460	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
461	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
462	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
463	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
464	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
465	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
466	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
467	2503198000	Mesorhizobium opportunistum WSM2075	Isolate	Nodule
468	2508501122	Ensifer yinggardensis WSM1721	Isolate	Nodule
469	2508501127	Mesorhizobium sp. WSM2561	Isolate	Nodule
470	2509276019	Ensifer aridi TW10	Isolate	Nodule
471	2509276021	Rhizobium leguminosarum bv. trifolii WSM597	Isolate	Nodule
472	2509276033	Rhizobium leguminosarum bv. trifolii WSM2012	Isolate	Nodule
473	2510065019	Rhizobium leguminosarum bv. trifolii WSM1689	Isolate	Nodule
474	2510065057	Sinorhizobium meliloti WSM1022	Isolate	Nodule
475	2510065059	Mesorhizobium ciceri WSM4083	Isolate	Nodule
476	2510461069	Rhizobium sp. PDO1-076	Isolate	Rhizosphere
477	2510461076	Rhizobium leguminosarum bv. trifolii TA1	Isolate	Nodule
478	2510917022	Rhizobium sp. AP16	Isolate	Rhizosphere
479	2510917030	Rhizobium sp. CF142	Isolate	Rhizosphere
480	2511231027	Phyllobacterium sp. YR531	Isolate	Rhizosphere
481	2511231052	Sinorhizobium meliloti AK58	Isolate	Nodule
482	2512047086	Sinorhizobium arboris LMG 14919	Isolate	Nodule
483	2512875016	Mesorhizobium japonicum R7A	Isolate	Nodule
484	2512875024
485	2512875026	Sinorhizobium medicae WSM1115	Isolate	Nodule
486	2513237084	Rhizobium leguminosarum bv. viciae UPM1131	Isolate	Nodule
487	2513237085	Rhizobium leguminosarum bv. viciae UPM1137	Isolate	Nodule
488	2513237086	Sinorhizobium meliloti MVII-I	Isolate	Nodule
489	2513237089	Sinorhizobium medicae DI28	Isolate	Nodule
490	2513237091	Sinorhizobium meliloti RRI128	Isolate	Nodule
491	2513237092	Bradyrhizobium sp. WSM1743	Isolate	Nodule
492	2513237093	Rhizobium leguminosarum bv. phaseoli FA23	Isolate	Nodule
493	2513237094	Bradyrhizobium sp. WSM3983	Isolate	Nodule
494	2513237095	Bradyrhizobium diazoefficiens USDA 122	Isolate	Nodule
495	2513237103	Rhizobium leguminosarum bv. viciae VF39	Isolate	Nodule
496	2513237104	Bradyrhizobium sp. EC3.3	Isolate	Nodule
497	2513237139	Bradyrhizobium ottawaense USDA 4	Isolate	Nodule
498	2513237140	Sinorhizobium meliloti GVPV12	Isolate	Nodule
499	2513237143	Sinorhizobium meliloti Mlalz-1	Isolate	Nodule
500	2513237144	Rhizobium sullae WSM1592	Isolate	Nodule
501	2513237146	Rhizobium mongolense USDA 1844 (Illumina)	Isolate	Nodule
502	2513237156	Sinorhizobium medicae WSM1369	Isolate	Nodule
503	2513237159	Rhizobium giardinii bv. giardinii H152	Isolate	Nodule
504	2513237160	Sinorhizobium medicae WSM244	Isolate	Nodule
505	2513237161	Bradyrhizobium sp. WSM2793	Isolate	Nodule
506	2513237162	Rhizobium ruizarguesonis GB30	Isolate	Nodule
507	2513237164	Mesorhizobium loti CJ3sym	Isolate	Nodule
508	2513237351	Mesorhizobium alhagi CCNWXJ12-2	Isolate	Nodule
509	2515075009	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
510	2515154107	Sinorhizobium meliloti 4H41	Isolate	Nodule
511	2515154113	Rhizobium ruizarguesonis Vc2	Isolate	Nodule
512	2515154114	Rhizobium ruizarguesonis Vh3	Isolate	Nodule
513	2515154116	Rhizobium ruizarguesonis Ps8	Isolate	Nodule
514	2515154134	Rhizobium gallicum bv. gallicum R602sp	Isolate	Nodule
515	2516143018	Ensifer sp. BR816	Isolate	Nodule
516	2516653046	Sinorhizobium meliloti BO21CC	Isolate	Nodule
517	2516653077	Rhizobium acaciae WSM1481	Isolate	Nodule
518	2516653085	Rhizobium leguminosarum bv. phaseoli 4292	Isolate	Nodule
519	2517093000	Rhizobium leguminosarum bv. trifolii SRDI943	Isolate	Nodule
520	2517093001	Bradyrhizobium japonicum USDA 124	Isolate	Nodule
521	2517287029	Rhizobium leguminosarum bv. trifolii SRDI565	Isolate	Nodule
522	2517487022	Sinorhizobium medicae WSM4191	Isolate	Nodule
523	2519899620	Rhizobium sp. Pop5	Isolate	Nodule
524	2524023205	Bradyrhizobium sp. Cp5.3	Isolate	Nodule
525	2524023207	Ensifer sp. USDA 6670	Isolate	Nodule
526	2524023209	Rhizobium leucaenae USDA 9039	Isolate	Nodule
527	2524023228	Bradyrhizobium sp. Th.b2	Isolate	Nodule
528	2528768022	Bradyrhizobium japonicum USDA 123	Isolate	Nodule
529	2529292951	Rhizobium sp. CCGE 510	Isolate	Nodule
530	2537561587	Agrobacterium tumefaciens Cherry 2E-2-2	Isolate	Rhizosphere
531	2551306084	Sinorhizobium meliloti 5A14	Isolate	Nodule
532	2551306085	Sinorhizobium meliloti AE608H	Isolate	Nodule
533	2551306086	Sinorhizobium meliloti AK11	Isolate	Nodule
534	2551306087	Sinorhizobium meliloti A0643DD	Isolate	Nodule
535	2551306089	Sinorhizobium meliloti 1A42	Isolate	Nodule
536	2551306090	Sinorhizobium meliloti A0641M	Isolate	Nodule
537	2551306091	Sinorhizobium meliloti C0431A	Isolate	Nodule
538	2551306092	Sinorhizobium meliloti AK75	Isolate	Nodule
539	2551306093	Sinorhizobium meliloti C0438LL	Isolate	Nodule
540	2554235003	Agrobacterium tumefaciens WRT31	Isolate	Rhizosphere
541	2558860100	Sinorhizobium sp. PC2	Isolate	Nodule
542	2558860242	Agrobacterium fabacearum P4	Isolate	Rhizosphere
543	2582581283	Rhizobium sp. OK665	Isolate	Rhizosphere
544	2582581298	Rhizobium alamii YR540	Isolate	Rhizosphere
545	2582581299	Rhizobium leguminosarum OV483	Isolate	Rhizosphere
546	2582581304	Rhizobium sp. YR519	Isolate	Rhizosphere
547	2582581306	Rhizobium sp. YR295	Isolate	Rhizosphere
548	2582581307	Rhizobium sp. YR060	Isolate	Rhizosphere
549	2582581308	Rhizobium sp. OK494	Isolate	Rhizosphere
550	2582581315	Agrobacterium rhizogenes YR147	Isolate	Rhizosphere
551	2582581316	Agrobacterium rhizogenes OK036	Isolate	Rhizosphere
552	2582581865	Rhizobium sp. CF258	Isolate	Rhizosphere
553	2582581866	Rhizobium sp. CF097	Isolate	Rhizosphere
554	2585427526	Rhizobium leguminosarum OV152	Isolate	Rhizosphere
555	2585427527	Rhizobium lusitanum YR374	Isolate	Rhizosphere
556	2585427528	Rhizobium leguminosarum CF307	Isolate	Rhizosphere
557	2585427529	Rhizobium alamii YR584	Isolate	Rhizosphere
558	2585427530	Rhizobium tropici YR635	Isolate	Rhizosphere
559	2585427531	Agrobacterium rhizogenes YR530	Isolate	Rhizosphere
560	2585427593	Rhizobium tropici CF286	Isolate	Rhizosphere
561	2585427594	Rhizobium sp. YR528	Isolate	Rhizosphere
562	2585427608	Agrobacterium rhizogenes OV677	Isolate	Rhizosphere
563	2585427609	Agrobacterium rhizogenes CF263	Isolate	Rhizosphere
564	2585428125	Agrobacterium rhizogenes CF262	Isolate	Rhizosphere
565	2588253730	Mesorhizobium huakuii 7653R	Isolate	Rhizosphere
566	2599185170	Rhizobium mongolense USDA 1844 (PacBio)	Isolate	Nodule
567	2599185210	Rhizobium sp. NFACC06-2	Isolate	Rhizoplane
568	2599185236	Rhizobium sp. NFR07	Isolate	Rhizoplane
569	2599185352	Sinorhizobium sp. NFACC03	Isolate	Rhizoplane
570	2600255279	Rhizobium sp. NFIX01	Isolate	Rhizoplane
571	2600255308	Rhizobium sp. NFIX02	Isolate	Rhizoplane
572	2602042107	Bradyrhizobium sp. NFR13	Isolate	Rhizoplane
573	2615840624	Rhizobium aethiopicum HBR26	Isolate	Nodule
574	2615840626	Rhizobium lusitanum P1-7	Isolate	Nodule
575	2615840698	Rhizobium multihospitium HAMBI 2975	Isolate	Nodule
576	2617270735	Bradyrhizobium shewense ERR11	Isolate	Nodule
577	2617270741	Bradyrhizobium yuanmingense CCBAU 10071	Isolate	Nodule
578	2617270742	Rhizobium miluonense HAMBI 2971	Isolate	Nodule
579	2643221551	Mesorhizobium sp. Root1471	Isolate	Unclassified
580	2643221555	Mesorhizobium sp. Root554	Isolate	Unclassified
581	2643221557	Ensifer sp. Root558	Isolate	Unclassified
582	2643221558	Rhizobium sp. Root149	Isolate	Unclassified
583	2643221564	Mesorhizobium sp. Root157	Isolate	Unclassified
584	2643221568	Rhizobium sp. Root564	Isolate	Unclassified
585	2643221582	Rhizobium sp. Root651	Isolate	Unclassified
586	2643221595	Mesorhizobium sp. Root695	Isolate	Unclassified
587	2643221607	Rhizobium sp. Root73	Isolate	Unclassified
588	2643221610	Ensifer sp. Root74	Isolate	Unclassified
589	2643221618	Ensifer sp. Root231	Isolate	Unclassified
590	2643221623	Aminobacter sp. DSM 101952 Root100	Isolate	Unclassified
591	2643221626	Ensifer sp. Root31	Isolate	Unclassified
592	2643221627	Mesorhizobium sp. Root102	Isolate	Unclassified
593	2643221634	Rhizobium sp. Root1203	Isolate	Unclassified
594	2643221636	Rhizobium sp. Root1204	Isolate	Unclassified
595	2643221637	Rhizobium sp. Root1212	Isolate	Unclassified
596	2643221643	Rhizobium sp. Root1220	Isolate	Unclassified
597	2643221653	Rhizobium sp. Root1240	Isolate	Unclassified
598	2643221655	Ensifer sp. Root1252	Isolate	Unclassified
599	2643221659	Ensifer sp. Root127	Isolate	Unclassified
600	2643221668	Ensifer sp. Root423	Isolate	Unclassified
601	2643221675	Ensifer sp. Root1298	Isolate	Unclassified
602	2643221680	Ensifer sp. Root1312	Isolate	Unclassified
603	2643221686	Rhizobium sp. Root1334	Isolate	Unclassified
604	2643221688	Rhizobium sp. Root482	Isolate	Unclassified
605	2643221689	Rhizobium sp. Root483D2	Isolate	Unclassified
606	2643221693	Rhizobium sp. Root491	Isolate	Unclassified
607	2643221698	Ensifer sp. Root142	Isolate	Unclassified
608	2643221712	Ensifer sp. Root258	Isolate	Unclassified
609	2643221718	Rhizobium sp. Root268	Isolate	Unclassified
610	2643221719	Rhizobium sp. Root274	Isolate	Unclassified
611	2643221723	Ensifer sp. Root278	Isolate	Unclassified
612	2643221726	Ensifer sp. Root954	Isolate	Unclassified
613	2657244999	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
614	2667528174	Rhizobium sp. NFR17	Isolate	Rhizoplane
615	2687453392	Mesorhizobium ciceri biserrulae WSM1284	Isolate	Unclassified
616	2690316117	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
617	2718217882	Rhizobium sp. N741	Isolate	Nodule
618	2718217927	Rhizobium sp. N324	Isolate	Nodule
619	2718217997	Rhizobium phaseoli sv. phaseoli R723	Isolate	Nodule
620	2718218009	Rhizobium sp. N561	Isolate	Nodule
621	2718218199	Rhizobium phaseoli sv. phaseoli N261	Isolate	Nodule
622	2718218232	Rhizobium phaseoli sv. phaseoli N161	Isolate	Nodule
623	2718218233	Rhizobium phaseoli sv. phaseoli R744	Isolate	Nodule
624	2718218235	Rhizobium phaseoli sv. phaseoli R620	Isolate	Nodule
625	2718218269	Rhizobium phaseoli sv. phaseoli N671	Isolate	Nodule
626	2718218363	Rhizobium sp. N113	Isolate	Nodule
627	2718218365	Rhizobium sp. N731	Isolate	Nodule
628	2718218366	Rhizobium sp. N621	Isolate	Nodule
629	2718218423	Rhizobium sp. N941	Isolate	Nodule
630	2721755514	Rhizobium sp. N6212	Isolate	Nodule
631	2721755556	Rhizobium phaseoli sv. phaseoli N931	Isolate	Nodule
632	2721755684	Rhizobium phaseoli sv. phaseoli N841	Isolate	Nodule
633	2721755685	Rhizobium phaseoli sv. phaseoli R611	Isolate	Nodule
634	2721755809	Rhizobium sp. N541	Isolate	Nodule
635	2721755810	Rhizobium sp. N871	Isolate	Nodule
636	2721755819	Rhizobium phaseoli sv. phaseoli N771	Isolate	Nodule
637	2721755822	Rhizobium phaseoli sv. phaseoli R650	Isolate	Nodule
638	2721755823	Rhizobium phaseoli sv. phaseoli R630	Isolate	Nodule
639	2724679232	Rhizobium leguminosarum Vaf12	Isolate	Unclassified
640	2728369352	Rhizobium phaseoli sv. phaseoli N831	Isolate	Nodule
641	2728369365	Rhizobium sp. N1341	Isolate	Nodule
642	2728369397	Rhizobium sp. N1314	Isolate	Nodule
643	2738541293	Rhizobium sp. GV031	Isolate	Unclassified
644	2738541317	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
645	2738541333	Rhizobium sophoriradicis CCBAU 03470	Isolate	Unclassified
646	2738543024	Aminobacter sp. AP02	Isolate	Unclassified
647	2744054633	Bradyrhizobium neotropicale BR 10247	Isolate	Unclassified
648	2751185821	Ensifer shofinae CCBAU 251167	Isolate	Unclassified
649	2756170246	Mesorhizobium loti DSM 2626	Isolate	Nodule
650	2757320392	Phyllobacterium leguminum ORS 1419	Isolate	Nodule
651	2758568016	[Ochrobactrum] quorumnocens A44	Isolate	Rhizosphere
652	2765235802	Phyllobacterium bourgognense 31-25a	Isolate	Rhizoplane
653	2765235942	Rhizobium sp. WYCCWR10014	Isolate	Nodule
654	2767802442	Phyllobacterium brassicacearum 29-15	Isolate	Rhizoplane
655	2775506902	Phyllobacterium zundukense Tri-48	Isolate	Unclassified
656	2775506904	Phyllobacterium zundukense Tri-38	Isolate	Unclassified
657	2775507049	Rhizobium sp. ACO-34A	Isolate	Unclassified
658	2775507266	Rhizobium tropici PRF 81	Isolate	Nodule
659	2791355082	Ensifer alkalisoli YIC4027	Isolate	Nodule
660	2791355091	Sinorhizobium sp. FG01	Isolate	Nodule
661	2791355092	Sinorhizobium sp. NG07B	Isolate	Nodule
662	2791355094	Sinorhizobium sp. BJ1	Isolate	Nodule
663	2791355123	Mesorhizobium sophorae ICMP 19535	Isolate	Unclassified
664	2791355253	Rhizobium rhizosphaerae RD15	Isolate	Rhizosphere
665	2791355256	Rhizobium sp. M10	Isolate	Nodule
666	2791355259	Rhizobium hidalgonense FH14	Isolate	Nodule
667	2791355260	Rhizobium sp. L9	Isolate	Nodule
668	2791355261	Rhizobium sp. J15	Isolate	Nodule
669	2791355262	Rhizobium sp. M1	Isolate	Nodule
670	2791355263	Rhizobium chutanense C5	Isolate	Nodule
671	2791355264	Rhizobium sp. S9	Isolate	Nodule
672	2791355265	Rhizobium sp. H4	Isolate	Nodule
673	2791355266	Rhizobium sp. L43	Isolate	Nodule
674	2791355267	Rhizobium sp. L18	Isolate	Nodule
675	2802428858	Sinorhizobium medicae M14-1	Isolate	Nodule
676	2802428859	Sinorhizobium medicae SF3.41	Isolate	Nodule
677	2802428860	Sinorhizobium medicae M19-1	Isolate	Nodule
678	2802428861	Sinorhizobium medicae USDA1037	Isolate	Nodule
679	2802428862	Sinorhizobium medicae M7-4	Isolate	Nodule
680	2802428863	Sinorhizobium medicae M26-2	Isolate	Nodule
681	2802429268	Sinorhizobium sojae CCBAU 05684	Isolate	Unclassified
682	2802429603	Bradyrhizobium ottawaense L2	Isolate	Nodule
683	2802429605	Rhizobium sophoriradicis L101	Isolate	Nodule
684	2802429606	Rhizobium sophoriradicis JJW1	Isolate	Nodule
685	2802429633	Rhizobium anhuiense J3	Isolate	Nodule
686	2802429634	Rhizobium anhuiense S10	Isolate	Nodule
687	2802429635	Rhizobium anhuiense Y27	Isolate	Nodule
688	2802429636	Rhizobium anhuiense JX3	Isolate	Nodule
689	2802429637	Rhizobium anhuiense C15	Isolate	Nodule
690	2808606387	Rhizobium sp. SJZ105	Isolate	Rhizosphere
691	2816332527	Bradyrhizobium diazoefficiens Y21	Isolate	Nodule
692	2818991272	Rhizobium sp. SLBN-4	Isolate	Unclassified
693	2818991439	Agrobacterium tumefaciens 1187	Isolate	Unclassified
694	2818991448	Rhizobium miluonense 1234	Isolate	Unclassified
695	2818991453	Rhizobium lusitanum 1158	Isolate	Unclassified
696	2821123053	Rhizobium cellulosilyticum 1193	Isolate	Unclassified
697	2824600985	Bradyrhizobium sp.HAMBI 2135	Isolate	Unclassified
698	2824609381	Bradyrhizobium sp. HAMBI 2134	Isolate	Unclassified
699	2824617872	Bradyrhizobium sp. HAMBI 2133	Isolate	Unclassified
700	2824626560	Bradyrhizobium sp. HAMBI 2149	Isolate	Unclassified
701	2824635225	Bradyrhizobium sp. HAMBI 2136	Isolate	Unclassified
702	2824644064	Bradyrhizobium sp. HAMBI 2137	Isolate	Unclassified
703	2824653114	Bradyrhizobium sp. HAMBI 2142	Isolate	Unclassified
704	2824661429	Bradyrhizobium sp. HAMBI 2115	Isolate	Unclassified
705	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
706	2824679649	Bradyrhizobium sp.HAMBI 2116	Isolate	Unclassified
707	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
708	2824696289	Bradyrhizobium sp. HAMBI 2127	Isolate	Unclassified
709	2824704595	Bradyrhizobium sp. HAMBI 2150	Isolate	Unclassified
710	2824714736	Bradyrhizobium sp. HAMBI 2151	Isolate	Unclassified
711	2824723954	Bradyrhizobium sp. HAMBI 2152	Isolate	Unclassified
712	2824732956	Bradyrhizobium sp. HAMBI 2153	Isolate	Unclassified
713	2824746037	Bradyrhizobium sp. HAMBI 2299	Isolate	Unclassified
714	2824753945	Bradyrhizobium sp. HAMBI 2128	Isolate	Unclassified
715	2824763712	Bradyrhizobium sp. HAMBI 2129	Isolate	Unclassified
716	2824773399	Bradyrhizobium sp. HAMBI 2130	Isolate	Unclassified
717	2837651117	Pseudohoeflea suaedae YC6898	Isolate	Unclassified
718	2838016132	Rhizobium phaseoli SEMIA 4071	Isolate	Nodule
719	2838022645	Rhizobium aethiopicum SEMIA 4074	Isolate	Nodule
720	2838035591	Rhizobium mongolense SEMIA 4087	Isolate	Nodule
721	2838042994	Rhizobium esperanzae SEMIA 4089	Isolate	Nodule
722	2838048938	Rhizobium pisi 27/80	Isolate	Nodule
723	2838061910	Rhizobium phaseoli L15	Isolate	Nodule
724	2838068647	Rhizobium esperanzae VC28	Isolate	Nodule
725	2838074704	Sinorhizobium terangae SEMIA 6460	Isolate	Unclassified
726	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
727	2838661181	Rhizobium mongolense SEMIA 402	Isolate	Nodule
728	2838668709	Rhizobium sophoriradicis SEMIA 403	Isolate	Nodule
729	2838675328	Agrobacterium radiobacter SEMIA 410	Isolate	Nodule
730	2838680041	Rhizobium leguminosarum SEMIA 415	Isolate	Nodule
731	2838686498	Rhizobium leguminosarum SEMIA 416	Isolate	Nodule
732	2838694306	Rhizobium leguminosarum SEMIA 421	Isolate	Nodule
733	2838701080	Rhizobium aethiopicum SEMIA 428	Isolate	Nodule
734	2838707686	Rhizobium leguminosarum SEMIA 430	Isolate	Nodule
735	2838714209	Agrobacterium radiobacter SEMIA 435	Isolate	Nodule
736	2838719591	Agrobacterium radiobacter SEMIA 436	Isolate	Nodule
737	2838724970	Agrobacterium radiobacter SEMIA 437	Isolate	Nodule
738	2838729681	Rhizobium leguminosarum SEMIA 445	Isolate	Nodule
739	2838736955	Rhizobium cellulosilyticum SEMIA 448	Isolate	Nodule
740	2838742623	Rhizobium leguminosarum SEMIA 449	Isolate	Nodule
741	2840764183	Phyllobacterium sophorae CCBAU 03422	Isolate	Unclassified
742	2841734538	Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1	Isolate	Nodule
743	2841840854	Rhizobium cellulosilyticum SEMIA 444	Isolate	Nodule
744	2841846520	Agrobacterium radiobacter SEMIA 440	Isolate	Nodule
745	2841851746	Rhizobium leguminosarum SEMIA 498	Isolate	Nodule
746	2841859092	Agrobacterium radiobacter SEMIA 4026	Isolate	Nodule
747	2841864319	Rhizobium leguminosarum SEMIA 4052	Isolate	Nodule
748	2841941048	Bradyrhizobium sp. SBR1B	Isolate	Nodule
749	2841949485	Bradyrhizobium sp. ERR14	Isolate	Nodule
750	2841957949	Bradyrhizobium sp. CIR1	Isolate	Nodule
751	2841966195	Bradyrhizobium sp. CIR18	Isolate	Nodule
752	2841974524	Bradyrhizobium sp. CIR48	Isolate	Nodule
753	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
754	2842038055	Bradyrhizobium centrosematis SEMIA 424	Isolate	Nodule
755	2842045827	Bradyrhizobium centrosematis SEMIA 431	Isolate	Nodule
756	2842077413	Rhizobium leguminosarum SEMIA 422	Isolate	Nodule
757	2842110456	Rhizobium esperanzae SEMIA 414	Isolate	Nodule
758	2842118031	Rhizobium esperanzae SEMIA 420	Isolate	Nodule
759	2842124991	Agrobacterium radiobacter SEMIA 434	Isolate	Nodule
760	2842130223	Agrobacterium radiobacter SEMIA 441	Isolate	Nodule
761	2842140634	Rhizobium cellulosilyticum SEMIA 452	Isolate	Nodule
762	2842146304	Rhizobium sophoriradicis SEMIA 454	Isolate	Nodule
763	2842152218	Agrobacterium radiobacter SEMIA 457	Isolate	Nodule
764	2842156927	Rhizobium leguminosarum SEMIA 459	Isolate	Nodule
765	2842163707	Rhizobium leguminosarum SEMIA 460	Isolate	Nodule
766	2842170452	Agrobacterium radiobacter SEMIA 461	Isolate	Nodule
767	2842175837	Agrobacterium radiobacter SEMIA 462	Isolate	Nodule
768	2842180545	Rhizobium leguminosarum SEMIA 463	Isolate	Nodule
769	2842187318	Agrobacterium radiobacter SEMIA 464	Isolate	Nodule
770	2842192696	Rhizobium esperanzae SEMIA 468	Isolate	Nodule
771	2842198810	Rhizobium aethiopicum SEMIA 470	Isolate	Nodule
772	2842205361	Rhizobium etli SEMIA 471	Isolate	Nodule
773	2842211629	Agrobacterium radiobacter SEMIA 472	Isolate	Nodule
774	2842217011	Rhizobium leguminosarum SEMIA 475	Isolate	Nodule
775	2842224351	Agrobacterium radiobacter SEMIA 480	Isolate	Nodule
776	2842229732	Rhizobium leguminosarum SEMIA 481	Isolate	Nodule
777	2842237096	Rhizobium leguminosarum SEMIA 482	Isolate	Nodule
778	2842243621	Rhizobium leguminosarum SEMIA 483	Isolate	Nodule
779	2842250916	Rhizobium etli SEMIA 484	Isolate	Nodule
780	2842257432	Rhizobium leguminosarum SEMIA 485	Isolate	Nodule
781	2842264693	Rhizobium phaseoli SEMIA 487	Isolate	Nodule
782	2842271015	Rhizobium leguminosarum SEMIA 488	Isolate	Nodule
783	2842278818	Rhizobium etli SEMIA 489	Isolate	Nodule
784	2842285085	Rhizobium lentis SEMIA 490	Isolate	Nodule
785	2842291075	Rhizobium leguminosarum SEMIA 491	Isolate	Nodule
786	2842298080	Rhizobium leucaenae SEMIA 492	Isolate	Nodule
787	2842304105	Rhizobium leguminosarum SEMIA 499	Isolate	Nodule
788	2842311132	Rhizobium phaseoli SEMIA 4002	Isolate	Nodule
789	2842317721	Rhizobium etli SEMIA 4004	Isolate	Nodule
790	2842341865	Rhizobium leguminosarum SEMIA 4011	Isolate	Nodule
791	2842357229	Rhizobium leucaenae SEMIA 4015	Isolate	Nodule
792	2842363717	Rhizobium leguminosarum SEMIA 4016	Isolate	Nodule
793	2842370503	Rhizobium leguminosarum SEMIA 4022	Isolate	Nodule
794	2842377471	Rhizobium leguminosarum SEMIA 4024	Isolate	Nodule
795	2842384541	Rhizobium leguminosarum SEMIA 4025	Isolate	Nodule
796	2842395702	Rhizobium ecuadorense SEMIA 4029	Isolate	Nodule
797	2842402390	Rhizobium lentis SEMIA 4033	Isolate	Nodule
798	2842409023	Rhizobium lentis SEMIA 4034	Isolate	Nodule
799	2842415677	Rhizobium lentis SEMIA 4036	Isolate	Nodule
800	2842422224	Rhizobium esperanzae SEMIA 4042	Isolate	Nodule
801	2842428310	Rhizobium phaseoli SEMIA 4050	Isolate	Nodule
802	2842434925	Rhizobium esperanzae SEMIA 4051	Isolate	Nodule
803	2842441272	Rhizobium esperanzae SEMIA 4053	Isolate	Nodule
804	2842447887	Rhizobium esperanzae SEMIA 4055	Isolate	Nodule
805	2842462802	Rhizobium phaseoli SEMIA 4057	Isolate	Nodule
806	2842469257	Rhizobium phaseoli SEMIA 4058	Isolate	Nodule
807	2842482326	Rhizobium lusitanum SEMIA 4060	Isolate	Nodule
808	2842489311	Rhizobium sophoriradicis SEMIA 4061	Isolate	Nodule
809	2842495871	Rhizobium etli SEMIA 4062	Isolate	Nodule
810	2842509118	Rhizobium paranaense SEMIA 4064	Isolate	Nodule
811	2842515876	Agrobacterium radiobacter SEMIA 4072	Isolate	Nodule
812	2842521101	Rhizobium giardinii SEMIA 4084	Isolate	Nodule
813	2842871566	Phyllobacterium sp. R-73111	Isolate	Unclassified
814	2844002411	Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1	Isolate	Nodule
815	2844009547	Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1	Isolate	Nodule
816	2844163670	Ensifer sp. 1H6	Isolate	Unclassified
817	2844315083	Bradyrhizobium guangzhouense CCBAU 51670	Isolate	Unclassified
818	2844454524	Rhizobium leguminosarum bv. viciae BIHB 1217	Isolate	Nodule
819	2847417321	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
820	2847670302	Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1	Isolate	Nodule
821	2847930680	Bradyrhizobium zhanjiangense CCBAU 51778	Isolate	Unclassified
822	2847939898	Bradyrhizobium ottawaense OO99	Isolate	Unclassified
823	2848992105	Sinorhizobium fredii CCBAU 25509	Isolate	Unclassified
824	2849076700	Bradyrhizobium symbiodeficiens 85S1MB	Isolate	Nodule
825	2850079185	Ensifer aridi JNVU TP6	Isolate	Unclassified
826	2852387548	Rhizobium jaguaris CCGE525	Isolate	Unclassified
827	2854916844	Neorhizobium huautlense DSM 21817	Isolate	Unclassified
828	2855825444	Sinorhizobium meliloti CXM1-105	Isolate	Nodule
829	2855839649	Sinorhizobium meliloti AK555	Isolate	Unclassified
830	2855872281	Sinorhizobium fredii PCH1	Isolate	Nodule
831	2856314179	Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1	Isolate	Nodule
832	2856328259	Mesorhizobium sp. Primo-B	Isolate	Nodule
833	2856334872	Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1	Isolate	Nodule
834	2856342000	Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1	Isolate	Nodule
835	2857367948	Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1	Isolate	Nodule
836	2857509624	Bradyrhizobium sp. R-73088	Isolate	Unclassified
837	2857516855	Rhizobium sp. R-72456	Isolate	Unclassified
838	2857524615	Tardiphaga sp. R-73074	Isolate	Unclassified
839	2857531043	Neorhizobium sp. R-72160	Isolate	Unclassified
840	2858800743	Sinorhizobium meliloti AK170	Isolate	Unclassified
841	2869169390	Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1	Isolate	Nodule
842	2869234852	Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1	Isolate	Nodule
843	2869242130	Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1	Isolate	Nodule
844	2869249662	Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1	Isolate	Nodule
845	2869256925	Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0	Isolate	Nodule
846	2869264136	Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1	Isolate	Nodule
847	2869271264	Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1	Isolate	Nodule
848	2871435913	Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0	Isolate	Nodule
849	2871444079	Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1	Isolate	Nodule
850	2871451962	Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1	Isolate	Nodule
851	2871459585	Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1	Isolate	Nodule
852	2871466892	Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1	Isolate	Nodule
853	2871474448	Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1	Isolate	Nodule
854	2871481445	Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1	Isolate	Nodule
855	2871495908	Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1	Isolate	Nodule
856	2874109183	Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1	Isolate	Nodule
857	2874116593	Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1	Isolate	Nodule
858	2874131515	Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1	Isolate	Nodule
859	2874162495	Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1	Isolate	Nodule
860	2874612657	Bradyrhizobium forestalis INPA54B	Isolate	Nodule
861	2874620515	Bradyrhizobium nanningense CCBAU 53390	Isolate	Unclassified
862	2874628541	Bradyrhizobium betae Opo-243	Isolate	Unclassified
863	2876363079	Mesorhizobium loti R7ANS::ICEMlSym2042	Isolate	Nodule
864	2876369609	Mesorhizobium sp. USDA-HM6	Isolate	Unclassified
865	2876386047	Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1	Isolate	Nodule
866	2876392853	Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1	Isolate	Nodule
867	2876399893	Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1	Isolate	Nodule
868	2876406927	Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1	Isolate	Nodule
869	2876420981	Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1	Isolate	Nodule
870	2876761206	Bradyrhizobium centrolobii BR 10245	Isolate	Nodule
871	2878035449	Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1	Isolate	Nodule
872	2878730984	Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1	Isolate	Nodule
873	2878760144	Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1	Isolate	Nodule
874	2878767105	Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1	Isolate	Nodule
875	2878774303	Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1	Isolate	Nodule
876	2878781027	Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1	Isolate	Nodule
877	2879083081	Bradyrhizobium zhanjiangense CCBAU 51787	Isolate	Unclassified
878	2879099564	Bradyrhizobium japonicum UBMA197	Isolate	Nodule
879	2881147464	Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1	Isolate	Nodule
880	2881161766	Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1	Isolate	Nodule
881	2881364244	Bradyrhizobium sp. RP6	Isolate	Unclassified
882	2881665667	Bradyrhizobium vignae LMG 28791	Isolate	Unclassified
883	2885305155	Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1	Isolate	Nodule
884	2885312484	Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2	Isolate	Nodule
885	2885326080	Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1	Isolate	Nodule
886	2885334103	Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1	Isolate	Nodule
887	2885366525	Bradyrhizobium sp. LVM 105	Isolate	Unclassified
888	2885409591	Bradyrhizobium sp. NAS80.1	Isolate	Unclassified
889	2888350351	Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1	Isolate	Nodule
890	2888378607	Bradyrhizobium sp. LCT2	Isolate	Unclassified
891	2888388044	Bradyrhizobium cosmicum 58S1	Isolate	Unclassified
892	2888419890	Bradyrhizobium sp. 1(2017) 63S1MB	Isolate	Unclassified
893	2889010040	Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1	Isolate	Nodule
894	2889016732	Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1	Isolate	Nodule
895	2889790730	Chelativorans xinjiangense lm93	Isolate	Rhizosphere
896	2889914905	Chelativorans alearense UJN715	Isolate	Rhizosphere
897	2891373044	Shinella sp. AETb1-6	Isolate	Rhizosphere
898	2893066018	Tardiphaga sp. P9-11	Isolate	Unclassified
899	2894652903	Phyllobacterium sp. SYP-B3895	Isolate	Rhizosphere
900	2896384573	Ensifer sp. MPMI2T	Isolate	Unclassified
901	2899792073	Agrobacterium deltaense CNPSo 3391	Isolate	Nodule
902	2899803654	Agrobacterium sp. a22-2	Isolate	Unclassified
903	2899845264	Agrobacterium fabacearum CNPSo 675	Isolate	Unclassified
904	2903448605	Mesorhizobium japonicum Opo-235	Isolate	Nodule
905	2903513507	Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2	Isolate	Nodule
906	2903521522	Mesorhizobium loti R7ANS::ICEMlSym2014	Isolate	Nodule
907	2903528002	Mesorhizobium loti R7ANS::ICEMlSym2037	Isolate	Nodule
908	2903540706	Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1	Isolate	Nodule
909	2903727486	Bradyrhizobium guangzhouense CCBAU 53424	Isolate	Unclassified
910	2904578770	Phyllobacterium sp. 586	Isolate	Unclassified
911	2904659560	Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1	Isolate	Nodule
912	2904666416	Bradyrhizobium nanningense CCBAU 51757	Isolate	Unclassified
913	2904711408	Bradyrhizobium sp. USDA 3456	Isolate	Unclassified
914	2906354277	Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1	Isolate	Nodule
915	2906363423	Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1	Isolate	Nodule
916	2906370794	Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1	Isolate	Nodule
917	2906378014	Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1	Isolate	Nodule
918	2906386501	Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1	Isolate	Nodule
919	2906393657	Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1	Isolate	Nodule
920	2906401398	Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1	Isolate	Nodule
921	2906408224	Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1	Isolate	Nodule
922	2906414383	Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1	Isolate	Nodule
923	2906602504	Bradyrhizobium guangzhouense CCBAU 53426	Isolate	Unclassified
924	2906626472	Bradyrhizobium hipponense aSej3	Isolate	Unclassified
925	2906643746	Bradyrhizobium genosp. SA-3 Rp7b	Isolate	Unclassified
926	2908775508	Bradyrhizobium sp. SUTN9-2	Isolate	Unclassified
927	2913295892	Sinorhizobium kostiensis DSM 13372	Isolate	Nodule
928	2913308742	Rhizobium halophytocola DSM 21600	Isolate	Unclassified
929	2915980308	Sinorhizobium medicae USDA1149	Isolate	Nodule
930	2915986958	Sinorhizobium meliloti USDA1659	Isolate	Nodule
931	2915993759	Sinorhizobium meliloti USDA1336	Isolate	Nodule
932	2916000859	Sinorhizobium meliloti USDA1562	Isolate	Nodule
933	2916007675	Sinorhizobium meliloti USDA1289	Isolate	Nodule
934	2916014648	Sinorhizobium meliloti USDA1583	Isolate	Nodule
935	2916021584	Sinorhizobium meliloti USDA1550	Isolate	Nodule
936	2916028427	Sinorhizobium meliloti USDA1613	Isolate	Nodule
937	2916035215	Sinorhizobium meliloti 3011	Isolate	Nodule
938	2916041962	Sinorhizobium meliloti USDA1795	Isolate	Nodule
939	2916048683	Sinorhizobium meliloti USDA1796	Isolate	Nodule
940	2916055098	Sinorhizobium meliloti USDA1770	Isolate	Nodule
941	2916061851	Sinorhizobium medicae USDA1638	Isolate	Nodule
942	2916076590	Sinorhizobium meliloti USDA1661	Isolate	Nodule
943	2919073203	Tardiphaga robiniae 1155	Isolate	Unclassified
944	2919100787	Rhizobium sp. 1399	Isolate	Rhizosphere
945	2919114240	Agrobacterium tumefaciens 1457	Isolate	Rhizosphere
946	2919119836	Phyllobacterium sp. 1468	Isolate	Rhizosphere
947	2919166419	Agrobacterium cavarae 2074	Isolate	Unclassified
948	2919408235	Rhizobium miluonense 3199	Isolate	Unclassified
949	2919450847	Ancylobacter sp. 3268	Isolate	Rhizosphere
950	2920760137	Ensifer psoraleae CCBAU 65732	Isolate	Unclassified
951	2920822456	Ensifer sesbaniae CCBAU 65729	Isolate	Unclassified
952	2921201388	Sinorhizobium meliloti USDA1692	Isolate	Nodule
953	2921208531	Sinorhizobium meliloti USDA1660	Isolate	Nodule
954	2921237296	Sinorhizobium meliloti USDA1508	Isolate	Nodule
955	2921244191	Sinorhizobium meliloti 2119	Isolate	Nodule
956	2921250672	Sinorhizobium medicae USDA1169	Isolate	Nodule
957	2921257292	Sinorhizobium meliloti USDA1320	Isolate	Nodule
958	2921263974	Sinorhizobium meliloti USDA1107	Isolate	Nodule
959	2921282425	Sinorhizobium meliloti USDA1203	Isolate	Nodule
960	2921289301	Sinorhizobium meliloti USDA1730	Isolate	Nodule
961	2921296804	Sinorhizobium meliloti USDA1200	Isolate	Nodule
962	2922130491	Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1	Isolate	Nodule
963	2922151315	Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1	Isolate	Nodule
964	2922158528	Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1	Isolate	Nodule
965	2922172374	Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1	Isolate	Nodule
966	2922178524	Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1	Isolate	Nodule
967	2922185730	Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1	Isolate	Nodule
968	2922368715
969	2922393267	Bradyrhizobium sp. WBAH10	Isolate	Nodule
970	2924144063	Sinorhizobium meliloti USDA1022	Isolate	Nodule
971	2924150972	Sinorhizobium meliloti USDA1700	Isolate	Nodule
972	2924158325	Sinorhizobium meliloti USDA1146	Isolate	Nodule
973	2924165586	Sinorhizobium meliloti USDA1264	Isolate	Nodule
974	2924172951	Sinorhizobium meliloti USDA1626	Isolate	Nodule
975	2924179722	Sinorhizobium meliloti USDA1280	Isolate	Nodule
976	2924186466	Sinorhizobium meliloti USDA1389	Isolate	Nodule
977	2924193448	Sinorhizobium meliloti USDA1158	Isolate	Nodule
978	2924200457	Sinorhizobium meliloti USDA1007	Isolate	Nodule
979	2924207177	Sinorhizobium meliloti USDA1589	Isolate	Nodule
980	2924214083	Sinorhizobium meliloti USDA1702	Isolate	Nodule
981	2924221636	Sinorhizobium meliloti USDA1416	Isolate	Nodule
982	2924228884	Sinorhizobium meliloti USDA1581	Isolate	Nodule
983	2924710171	Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2	Isolate	Nodule
984	2924726620	Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1	Isolate	Nodule
985	2924733363	Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1	Isolate	Nodule
986	2924741084	Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2	Isolate	Nodule
987	2924748358	Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2	Isolate	Nodule
988	2924754689	Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1	Isolate	Nodule
989	2926754445	Agrobacterium radiobacter SLBN-94	Isolate	Rhizosphere
990	2926760298	Agrobacterium tumefaciens SLBN-170	Isolate	Rhizosphere
991	2928521798	Phyllobacterium ifriqiyense 1451	Isolate	Rhizosphere
992	2929138655	Agrobacterium sp. R-72433 Hybrid assembly	Isolate	Unclassified
993	2929615660	Bradyrhizobium japonicum TXVA	Isolate	Nodule
994	2929624759	Bradyrhizobium japonicum TXEA	Isolate	Nodule
995	2932784394	Bradyrhizobium sp. S3.2.12	Isolate	Nodule
996	2932794094	Bradyrhizobium sp. S3.2.6	Isolate	Nodule
997	2932801729	Bradyrhizobium sp. S3.3.6	Isolate	Nodule
998	2932809354	Bradyrhizobium sp. S3.5.5	Isolate	Nodule
999	2932818245	Bradyrhizobium sp. S3.9.1	Isolate	Nodule
1000	2932828146	Bradyrhizobium sp. S3.9.2	Isolate	Nodule
1001	2933006813	Rhizobium sp. SEMIA 439	Isolate	Unclassified
1002	2933011516	Rhizobium sp. SEMIA 4032	Isolate	Unclassified
1003	2933016740	Rhizobium sp. SEMIA 4085	Isolate	Nodule
1004	2933570622	Rhizobium leguminosarum SEMIA 409	Isolate	Nodule
1005	2933577622	Bradyrhizobium japonicum SEMIA 417	Isolate	Nodule
1006	2933586486	Rhizobium leguminosarum SEMIA 4039	Isolate	Nodule
1007	2933594066	Agrobacterium fabrum 35/80	Isolate	Nodule
1008	2933599457	Rhizobium phaseoli M3	Isolate	Nodule
1009	2935616580	Bradyrhizobium sp. RT7a	Isolate	Nodule
1010	2935638405	Bradyrhizobium sp. JR19.8	Isolate	Nodule
1011	2935665750	Bradyrhizobium sp. JR7.2	Isolate	Nodule
1012	2935675223	Bradyrhizobium sp. LA2.1	Isolate	Nodule
1013	2935684952	Bradyrhizobium sp. LA3.X	Isolate	Nodule
1014	2935694250	Bradyrhizobium sp. LA6.1	Isolate	Nodule
1015	2935703347	Bradyrhizobium sp. LA6.10	Isolate	Nodule
1016	2935713505	Bradyrhizobium sp. LA6.12	Isolate	Nodule
1017	2935722832	Bradyrhizobium sp. LA6.3	Isolate	Nodule
1018	2935732158	Bradyrhizobium sp. LA6.4	Isolate	Nodule
1019	2935741537	Bradyrhizobium sp. LA6.7	Isolate	Nodule
1020	2935750917	Bradyrhizobium sp. LA6.8	Isolate	Nodule
1021	2935760218	Bradyrhizobium sp. LA7.1	Isolate	Nodule
1022	2935801545	Bradyrhizobium sp. RT10b	Isolate	Nodule
1023	2935810662	Bradyrhizobium sp. RT3a	Isolate	Nodule
1024	2935827899	Bradyrhizobium sp. RT4a	Isolate	Nodule
1025	2935837841	Bradyrhizobium sp. RT4b	Isolate	Nodule
1026	2935855204	Bradyrhizobium sp. RT7b	Isolate	Nodule
1027	2935864058	Bradyrhizobium sp. RT9a	Isolate	Nodule
1028	2935873716	Bradyrhizobium sp. RT9b	Isolate	Nodule
1029	2935883170	Bradyrhizobium sp. S3.12.5	Isolate	Nodule
1030	2935894831	Rhizobium leguminosarum SEMIA 419	Isolate	Nodule
1031	2935901341	Rhizobium leguminosarum SEMIA 4082	Isolate	Nodule
1032	2935959822	Bradyrhizobium sp. F1.4.3	Isolate	Nodule
1033	2935992306	Bradyrhizobium sp. I1.7.5	Isolate	Nodule
1034	2936002035	Bradyrhizobium sp. I1.8.5	Isolate	Nodule
1035	2936037263	Bradyrhizobium sp. JR18.2	Isolate	Nodule
1036	2936367885	Rhizobium changzhiense WYCCWR 11290	Isolate	Nodule
1037	2936375103	Rhizobium changzhiense WYCCWR 11317	Isolate	Nodule
1038	2936381700	Rhizobium chutanense C16	Isolate	Unclassified
1039	2936996657	Sinorhizobium meliloti USDA1025	Isolate	Nodule
1040	2937002841	Sinorhizobium meliloti USDA1006	Isolate	Nodule
1041	2937009748	Sinorhizobium meliloti USDA1162	Isolate	Nodule
1042	2937016420	Sinorhizobium meliloti USDA1027	Isolate	Nodule
1043	2937023124	Sinorhizobium meliloti USDA1335	Isolate	Nodule
1044	2937029754	Sinorhizobium medicae USDA1624	Isolate	Nodule
1045	2937036028	Sinorhizobium medicae USDA1608	Isolate	Nodule
1046	2937042894	Sinorhizobium meliloti USDA1687	Isolate	Nodule
1047	2937049772	Sinorhizobium meliloti USDA1691	Isolate	Nodule
1048	2937056579	Sinorhizobium meliloti USDA1357	Isolate	Nodule
1049	2937063883	Sinorhizobium meliloti USDA1808	Isolate	Nodule
1050	2937071275	Sinorhizobium meliloti USDA1623	Isolate	Nodule
1051	2937078374	Sinorhizobium medicae USDA1004	Isolate	Nodule
1052	2937084907	Sinorhizobium medicae USDA1664	Isolate	Nodule
1053	2937091812	Sinorhizobium meliloti USDA1221	Isolate	Nodule
1054	2937098957	Sinorhizobium meliloti USDA1519	Isolate	Nodule
1055	2937106411	Sinorhizobium meliloti USDA1214	Isolate	Nodule
1056	2937113482	Sinorhizobium meliloti USDA1180	Isolate	Nodule
1057	2937119839	Sinorhizobium meliloti USDA1790	Isolate	Nodule
1058	2937126314	Sinorhizobium meliloti USDA1612	Isolate	Nodule
1059	2937836603	Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1	Isolate	Nodule
1060	2937848649	Mesorhizobium sp. WSM4310	Isolate	Unclassified
1061	2937861824	Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1	Isolate	Nodule
1062	2937868953	Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1	Isolate	Nodule
1063	2937980651	Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1	Isolate	Nodule
1064	2937994558	Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1	Isolate	Nodule
1065	2940556831	Bradyrhizobium sp. LA8.1	Isolate	Nodule
1066	2941499720	Ensifer sp. 4252	Isolate	Rhizosphere
1067	2941531003	Bradyrhizobium sp. LB11.1	Isolate	Nodule
1068	2941538514	Bradyrhizobium sp. RT11b	Isolate	Nodule
1069	2954011201	Phyllobacterium ifrigiyense W4I11	Isolate	Rhizosphere
1070	2957375807	Sinorhizobium medicae USDA1632	Isolate	Nodule
1071	2957382221	Sinorhizobium meliloti USDA1919	Isolate	Nodule
1072	2957388812	Sinorhizobium meliloti USDA1195	Isolate	Nodule
1073	2957395598	Sinorhizobium meliloti USDA1237	Isolate	Nodule
1074	2957402308	Sinorhizobium meliloti USDA1794	Isolate	Nodule
1075	2957408893	Sinorhizobium meliloti USDA1163	Isolate	Nodule
1076	2957415311	Sinorhizobium meliloti USDA1724	Isolate	Nodule
1077	2957422303	Sinorhizobium meliloti USDA1497	Isolate	Nodule
1078	2957430029	Sinorhizobium meliloti USDA1590	Isolate	Nodule
1079	2957437181	Sinorhizobium medicae USDA1694	Isolate	Nodule
1080	2957443900	Sinorhizobium meliloti USDA1734	Isolate	Nodule
1081	2957450854	Sinorhizobium meliloti USDA1655	Isolate	Nodule
1082	2957457609	Sinorhizobium meliloti USDA1751	Isolate	Nodule
1083	2957464669	Sinorhizobium meliloti USDA1520	Isolate	Nodule
1084	2957471148	Sinorhizobium meliloti USDA1204	Isolate	Nodule
1085	2957478035	Sinorhizobium meliloti USDA1171	Isolate	Nodule
1086	2957484790	Sinorhizobium meliloti USDA1464	Isolate	Nodule
1087	2957491536	Sinorhizobium meliloti USDA1804	Isolate	Nodule
1088	2957498199	Sinorhizobium meliloti USDA1561	Isolate	Nodule
1089	2957505466	Sinorhizobium meliloti USDA1696	Isolate	Nodule
1090	2958071322	Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1	Isolate	Nodule
1091	2958100919	Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1	Isolate	Nodule
1092	2958108152	Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1	Isolate	Nodule
1093	2958122699	Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1	Isolate	Nodule
1094	2958137437	Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1	Isolate	Nodule
1095	2958158011	Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1	Isolate	Nodule
1096	2958165035	Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1	Isolate	Nodule
1097	2958172287	Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1	Isolate	Nodule
1098	2960584000	Sinorhizobium meliloti USDA1530	Isolate	Nodule
1099	2960591022	Sinorhizobium medicae USDA1066	Isolate	Nodule
1100	2960597568	Sinorhizobium meliloti 3085	Isolate	Nodule
1101	2960603979	Sinorhizobium meliloti USDA1580	Isolate	Nodule
1102	2960610863	Sinorhizobium meliloti USDA1792	Isolate	Nodule
1103	2960617483	Sinorhizobium meliloti USDA1719	Isolate	Nodule
1104	2960624210	Sinorhizobium meliloti USDA1415	Isolate	Nodule
1105	2960631154	Sinorhizobium medicae USDA1629	Isolate	Nodule
1106	2960637947	Sinorhizobium meliloti USDA1202	Isolate	Nodule
1107	2960645483	Sinorhizobium meliloti USDA1703	Isolate	Nodule
1108	2960652885	Sinorhizobium meliloti USDA1199	Isolate	Nodule
1109	2960660292	Sinorhizobium meliloti USDA1883	Isolate	Nodule
1110	2960667422	Sinorhizobium meliloti USDA1170	Isolate	Nodule
1111	2960674078	Sinorhizobium meliloti USDA1666	Isolate	Nodule
1112	2960680706	Sinorhizobium medicae USDA1150	Isolate	Nodule
1113	2960687367	Sinorhizobium meliloti USDA1462	Isolate	Nodule
1114	2960693952	Sinorhizobium medicae USDA1630	Isolate	Nodule
1115	2961114664	Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1	Isolate	Nodule
1116	2961136820	Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1	Isolate	Nodule
1117	2961163497	Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1	Isolate	Nodule
1118	2961183825	Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1	Isolate	Nodule
1119	2963644680	Mesorhizobium japonicum R7A	Isolate	Nodule
1120	2964607997	Sinorhizobium meliloti USDA1212	Isolate	Nodule
1121	2964615318	Sinorhizobium meliloti USDA1248	Isolate	Nodule
1122	2964621998	Sinorhizobium meliloti USDA1235	Isolate	Nodule
1123	2964628898	Sinorhizobium meliloti USDA1191	Isolate	Nodule
1124	2964636051	Sinorhizobium meliloti USDA1594	Isolate	Nodule
1125	2964643177	Sinorhizobium meliloti USDA1760	Isolate	Nodule
1126	2964649959	Sinorhizobium meliloti USDA1591	Isolate	Nodule
1127	2964656573	Sinorhizobium meliloti USDA1308	Isolate	Nodule
1128	2964663802	Sinorhizobium meliloti USDA1688	Isolate	Nodule
1129	2964670856	Sinorhizobium meliloti USDA1211	Isolate	Nodule
1130	2964678106	Sinorhizobium meliloti USDA1210	Isolate	Nodule
1131	2964685014	Sinorhizobium meliloti USDA1232	Isolate	Nodule
1132	2964691889	Sinorhizobium meliloti USDA1379	Isolate	Nodule
1133	2964698721	Sinorhizobium meliloti USDA1656	Isolate	Nodule
1134	2964705432	Sinorhizobium meliloti USDA1614	Isolate	Nodule
1135	2964712639	Sinorhizobium meliloti USDA1616	Isolate	Nodule
1136	2964719344	Sinorhizobium meliloti USDA1456	Isolate	Nodule
1137	2965018300	Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1	Isolate	Nodule
1138	2965025482	Mesorhizobium sp. Primo-A	Isolate	Nodule
1139	2965032056	Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1	Isolate	Nodule
1140	2965040258	Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1	Isolate	Nodule
1141	2965047637	Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1	Isolate	Nodule
1142	2965089291	Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1	Isolate	Nodule
1143	2965102966	Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1	Isolate	Nodule
1144	2965110997	Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1	Isolate	Nodule
1145	2965119406	Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1	Isolate	Nodule
1146	2967664464	Sinorhizobium meliloti USDA1208	Isolate	Nodule
1147	2967671571	Sinorhizobium meliloti USDA1496	Isolate	Nodule
1148	2967678726	Sinorhizobium meliloti USDA1467	Isolate	Nodule
1149	2967686174	Sinorhizobium medicae USDA1641	Isolate	Nodule
1150	2967693043	Sinorhizobium meliloti USDA1183	Isolate	Nodule
1151	2967699805	Sinorhizobium meliloti USDA1695	Isolate	Nodule
1152	2967706974	Sinorhizobium meliloti USDA1206	Isolate	Nodule
1153	2967714385	Sinorhizobium meliloti USDA1023	Isolate	Nodule
1154	2967721400	Sinorhizobium meliloti USDA1742	Isolate	Nodule
1155	2967728569	Sinorhizobium medicae USDA1607	Isolate	Nodule
1156	2967735183	Sinorhizobium meliloti USDA1710	Isolate	Nodule
1157	2967742019	Sinorhizobium meliloti USDA1676	Isolate	Nodule
1158	2967748971	Sinorhizobium meliloti USDA1024A	Isolate	Nodule
1159	2967755722	Sinorhizobium meliloti USDA1302	Isolate	Nodule
1160	2967762386	Sinorhizobium meliloti USDA1397	Isolate	Nodule
1161	2967769361	Sinorhizobium meliloti USDA1005	Isolate	Nodule
1162	2967775926	Sinorhizobium meliloti USDA1678	Isolate	Nodule
1163	2968083720	Mesorhizobium erdmanii Opo-242	Isolate	Unclassified
1164	2968110612	Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1	Isolate	Nodule
1165	2968138860	Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1	Isolate	Nodule
1166	2968171901	Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1	Isolate	Nodule
1167	2970019648	Sinorhizobium meliloti USDA1603	Isolate	Nodule
1168	2970026789	Sinorhizobium medicae USDA1611	Isolate	Nodule
1169	2970033650	Sinorhizobium meliloti USDA1565	Isolate	Nodule
1170	2970040964	Sinorhizobium meliloti USDA1501	Isolate	Nodule
1171	2970047711	Sinorhizobium meliloti USDA1793	Isolate	Nodule
1172	2970054988	Sinorhizobium meliloti USDA1031	Isolate	Nodule
1173	2970061556	Sinorhizobium meliloti USDA1810	Isolate	Nodule
1174	2970068827	Sinorhizobium meliloti USDA1227	Isolate	Nodule
1175	2970076120	Sinorhizobium meliloti USDA1706	Isolate	Nodule
1176	2970082768	Sinorhizobium meliloti USDA1803	Isolate	Nodule
1177	2970088815	Sinorhizobium meliloti USDA1819	Isolate	Nodule
1178	2970095765	Sinorhizobium meliloti USDA1225	Isolate	Nodule
1179	2970102677	Sinorhizobium meliloti USDA1325	Isolate	Nodule
1180	2970109326	Sinorhizobium meliloti USDA1186	Isolate	Nodule
1181	2970116247	Sinorhizobium meliloti USDA1566	Isolate	Nodule
1182	2970122695	Sinorhizobium medicae 3082	Isolate	Nodule
1183	2970129317	Sinorhizobium meliloti USDA1008	Isolate	Nodule
1184	2970136068	Sinorhizobium meliloti USDA1699	Isolate	Nodule
1185	2970143518	Sinorhizobium medicae USDA1652	Isolate	Nodule
1186	2970149975	Sinorhizobium meliloti USDA1215	Isolate	Nodule
1187	2970156795	Sinorhizobium meliloti USDA1491	Isolate	Nodule
1188	2970164137	Sinorhizobium meliloti USDA1018	Isolate	Nodule
1189	2970170962	Sinorhizobium meliloti USDA1571	Isolate	Nodule
1190	2970177841	Sinorhizobium meliloti USDA1533	Isolate	Nodule
1191	2970184632	Sinorhizobium meliloti USDA1593	Isolate	Nodule
1192	2970191845	Sinorhizobium meliloti USDA1187	Isolate	Nodule
1193	2970489779	Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1	Isolate	Nodule
1194	2970510686	Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0	Isolate	Nodule
1195	2970524798	Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1	Isolate	Nodule
1196	2970532167	Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1	Isolate	Nodule
1197	2970540015	Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1	Isolate	Nodule
1198	2970547951	Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1	Isolate	Nodule
1199	2970554993	Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1	Isolate	Nodule
1200	2970619444	Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1	Isolate	Nodule
1201	2970627176	Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1	Isolate	Nodule
1202	2977516862	Sinorhizobium meliloti USDA1791	Isolate	Nodule
1203	2977523885	Sinorhizobium meliloti USDA1777	Isolate	Nodule
1204	2977530762	Sinorhizobium medicae USDA1606	Isolate	Nodule
1205	2977537788	Sinorhizobium meliloti USDA1184	Isolate	Nodule
1206	2977544691	Sinorhizobium medicae USDA1631	Isolate	Nodule
1207	2977551784	Sinorhizobium meliloti USDA1035	Isolate	Nodule
1208	2977558990	Sinorhizobium meliloti USDA1222	Isolate	Nodule
1209	2977565890	Sinorhizobium meliloti USDA1617	Isolate	Nodule
1210	2977572785	Sinorhizobium meliloti USDA1767	Isolate	Nodule
1211	2977579622	Sinorhizobium meliloti USDA1161	Isolate	Nodule
1212	2977851361	Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1	Isolate	Nodule
1213	2977872689	Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1	Isolate	Nodule
1214	2977898635	Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1	Isolate	Nodule
1215	2977907340	Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1	Isolate	Nodule
1216	2977915119	Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1	Isolate	Nodule
1217	2977922695	Mesorhizobium sp. WSM4305	Isolate	Unclassified
1218	2977935797	Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1	Isolate	Nodule
1219	2977950692	Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1	Isolate	Nodule
1220	2977957713	Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1	Isolate	Nodule
1221	2977971508	Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1	Isolate	Nodule
1222	2977986579	Mesorhizobium intechi BD68	Isolate	Unclassified
1223	2978969890	Agrobacterium sp. SORGH_AS 787	Isolate	Unclassified
1224	2979089926	Agrobacterium sp. SORGH_AS 745	Isolate	Unclassified
1225	2979095461	Agrobacterium tumefaciens SORGH_AS 749	Isolate	Unclassified
1226	2979100975	Agrobacterium pusense SORGH_AS 755	Isolate	Unclassified
1227	2979710463	Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1	Isolate	Nodule
1228	2979742915	Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1	Isolate	Nodule
1229	2979764755	Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1	Isolate	Nodule
1230	2979772303	Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1	Isolate	Nodule
1231	2979793036	Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1	Isolate	Nodule
1232	2984509177	Agrobacterium pusense SORGH_AS260	Isolate	Aerial Root
1233	2984537506	Agrobacterium sp. SORGH_AS440	Isolate	Aerial Root
1234	2984587000	Agrobacterium larrymoorei SORGH_AS974	Isolate	Aerial Root
1235	2984601300	Rhizobium pusense SORGH_AS1083	Isolate	Aerial Root
1236	2987645492	Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1	Isolate	Nodule
1237	2987652177	Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1	Isolate	Nodule
1238	2987659509	Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1	Isolate	Nodule
1239	2987673487	Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1	Isolate	Nodule
1240	2989349275	Shinella kummerowiae CCBAU 25048	Isolate	Unclassified
1241	2989771324	Rhizobium rhizolycopersici DBTS2	Isolate	Rhizosphere
1242	2989776772	Rhizobium glycinendophyticum CL12	Isolate	Unclassified
1243	2996310559	Mesorhizobium zhangyense CGMCC 1.15528	Isolate	Unclassified
1244	2996336353	Mesorhizobium sp. YM1C-6-2	Isolate	Unclassified
1245	2996341866	Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1	Isolate	Nodule
1246	2996386984	Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0	Isolate	Nodule
1247	2996893221	Rhizobium sp. R635	Isolate	Nodule
1248	3000135777	Unclassified bacterium M00.F.Ca.ET.205.01.1.1	Isolate	Unclassified
1249	3002141150	Phyllobacterium sp. 628	Isolate	Unclassified
1250	3003930520	Sinorhizobium sp. BG8	Isolate	Unclassified
1251	3004167301	Mesorhizobium loti 582	Isolate	Unclassified
1252	3004188549	Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1	Isolate	Nodule
1253	3004195979	Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1	Isolate	Nodule
1254	3004211236	Mesorhizobium sp. WSM4307	Isolate	Unclassified
1255	3004218560	Mesorhizobium sp. WSM4315	Isolate	Unclassified
1256	3004232784	Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1	Isolate	Nodule
1257	3004239961	Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1	Isolate	Nodule
1258	3004248173	Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1	Isolate	Nodule
1259	3004268573	Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1	Isolate	Nodule
1260	3004334049	Mesorhizobium huakuii 583	Isolate	Unclassified
1261	3005409236	Rhizobium sp. P32RR-XVIII	Isolate	Rhizosphere
1262	3005416602	Rhizobium sp. P40RR-XXII	Isolate	Rhizosphere
1263	3005445848	Rhizobium sp. WYJ-E13	Isolate	Unclassified
1264	3005483717	Bradyrhizobium agreste CNPSo 4010	Isolate	Unclassified
1265	3005506211	Bradyrhizobium diazoefficiens SZCCT0449	Isolate	Unclassified
1266	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
1267	3005594810	Bradyrhizobium sp. CCBAU 53340	Isolate	Nodule
1268	3005710791	Bradyrhizobium genosp. B BDV5040	Isolate	Unclassified
1269	3005718088	Bradyrhizobium sp. CCBAU 53338	Isolate	Nodule
1270	637000159	Mesorhizobium japonicum MAFF 303099	Isolate	Unclassified
1271	639633055	Rhizobium leguminosarum bv. viciae 3841	Isolate	Unclassified
1272	643692032	Sinorhizobium fredii NGR234	Isolate	Nodule
1273	648276728	Sinorhizobium meliloti BL225C	Isolate	Nodule
1274	649633066	Mesorhizobium ciceri bv. biserrulae WSM1271	Isolate	Nodule
1275	650716007	Agrobacterium fabacearum H13-3	Isolate	Rhizosphere
1276	8001845381	Ancylobacter sonchi VKM B-3145	Isolate	Unclassified
1277	8003570095	Agrobacterium rhizogenes GBBC3284	Isolate	Unclassified
1278	8003992118	Sinorhizobium meliloti RRI128	Isolate	Nodule
1279	8003999396	Sinorhizobium medicae WSM1115	Isolate	Nodule
1280	8004300914	Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1	Isolate	Nodule
1281	8004312739	Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0	Isolate	Nodule
1282	8004361976	Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1	Isolate	Nodule
1283	8004395343	Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1	Isolate	Nodule
1284	8004633249	Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1	Isolate	Nodule
1285	8004727605	Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1	Isolate	Nodule
1286	8005246636	Rhizobium wuzhouense W44	Isolate	Rhizosphere
1287	8005275841	Rhizobium sp. N4311	Isolate	Nodule
1288	8005282627	Rhizobium phaseoli NC1	Isolate	Nodule
1289	8005289223	Rhizobium bangladeshense 1002	Isolate	Nodule
1290	8005301065	Rhizobium bangladeshense 1017	Isolate	Nodule
1291	8005307578	Rhizobium leguminosarum bv. phaseoli LCS0306	Isolate	Unclassified
1292	8005314921	Rhizobium sp. P28RR-XV	Isolate	Rhizosphere
1293	8005376324	Rhizobium changzhiense WYCCWR 11279	Isolate	Nodule
1294	8005382845	Rhizobium sp. R634	Isolate	Nodule
1295	8005395548	Rhizobium sp. R339	Isolate	Nodule
1296	8005430974	Rhizobium phaseoli Y20	Isolate	Nodule
1297	8005460587	Rhizobium leguminosarum bv. viciae 248	Isolate	Nodule
1298	8005484373	Rhizobium tropici SARCC-755	Isolate	Nodule
1299	8005497431	Rhizobium phaseoli CCGM8	Isolate	Unclassified
1300	8005556819	Rhizobium sp. WYCCWR 11128	Isolate	Nodule
1301	8005563573	Rhizobium sp. WYCCWR 11152	Isolate	Nodule
1302	8005570704	Rhizobium anhuiense bv. trifolii WYCCWR10015	Isolate	Nodule
1303	8005619151	Rhizobium phaseoli CCGM2	Isolate	Unclassified
1304	8005626139	Rhizobium phaseoli Y18	Isolate	Nodule
1305	8005645114	Rhizobium tropici IGFRI Rhizo-19	Isolate	Rhizosphere
1306	8005658619	Rhizobium terrae CC-HIH110	Isolate	Unclassified
1307	8005668836	Rhizobium phaseoli CCGM9	Isolate	Unclassified
1308	8005682033	Rhizobium dioscoreae S-93	Isolate	Unclassified
1309	8005688590	Rhizobium bangladeshense 1024	Isolate	Nodule
1310	8005695170	Rhizobium sp. RMa-01	Isolate	Unclassified
1311	8006926726	Bradyrhizobium guangdongense SM32	Isolate	Unclassified
1312	8016511872	Bradyrhizobium sp. S3.14.4	Isolate	Nodule
1313	8016583857	Bradyrhizobium sp. LM2.7	Isolate	Nodule
1314	8017057580	Bradyrhizobium sp. S3.7.6	Isolate	Nodule
1315	8018127388	Rhizobium aegyptiacum 950	Isolate	Nodule
1316	8018150411	Rhizobium straminoryzae SM12	Isolate	Rhizosphere
1317	8018163183	Rhizobium sp. WYCCWR 11146	Isolate	Nodule
1318	8018176218	Rhizobium sp. N122	Isolate	Nodule
1319	8019586578	Bradyrhizobium sp. i1.4.4	Isolate	Nodule
1320	8019608314	Bradyrhizobium sp. i1.3.1	Isolate	Nodule
1321	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
1322	8023680758	Rhizobium leguminosarum SARCC-132	Isolate	Nodule
1323	8024479707	Rhizobium leguminosarum Tri-43	Isolate	Nodule
1324	8024486573	Rhizobium tubonense CCBAU 85046	Isolate	Nodule
1325	8024501048	Rhizobium sp. H4	Isolate	Nodule
1326	8046767195	Rhizobium calliandrae CCGE524	Isolate	Unclassified
1327	8049293176	Ensifer alkalisoli YIC4027	Isolate	Nodule
1328	8054460903	Agrobacterium vaccinii B7.6	Isolate	Unclassified
1329	8054558443	Rhizobium alarense TRM95111	Isolate	Nodule
1330	8055431914	Allorhizobium sonneratiae BGMRC 0089	Isolate	Unclassified
1331	8055617313	Mesorhizobium onobrychidis OM4	Isolate	Nodule
1332	8055742211	Bradyrhizobium japonicum 5038	Isolate	Nodule
1333	8056375014	Rhizobium redzepovicii 18T	Isolate	Nodule
1334	8056382006	Rhizobium croatiense 13T	Isolate	Nodule
1335	8056875544	Rhizobium halophilum TRM95001	Isolate	Rhizosphere
1336	8056967851	Bradyrhizobium zhengyangense WYCCWR 12678	Isolate	Nodule
1337	8057575449	Rhizobium mayense CCGE526	Isolate	Nodule
1338	8057874678	Rhizobium acaciae 1AS12	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	60.23
Metatranscriptomes	0.09
Isolates	39.68

Biome Distribution

Category	Percentage (%)
Aerial Root	0.18
Bulb	0
Endosphere	11.43
Nodule	30.1
Rhizoplane	3.51
Rhizosphere	41.07
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0395901_1021864	3300038443	Bacteria	801
2	JGI24752J21851_1001390	3300001976	Bacteria	3267
3	JGI24740J21852_10030451	3300001979	Bacteria	1755
4	JGI24739J22299_10006127	3300001989	Bacteria	4542
5	JGI24739J22299_10023529	3300001989	Bacteria	2177
6	JGI24737J22298_10002277	3300001990	Bacteria	6826
7	JGI24737J22298_10006099	3300001990	Bacteria	4130
8	JGI24737J22298_10045694	3300001990	Bacteria	1337
9	JGI24743J22301_10023704	3300001991	Bacteria	1182
10	JGI24735J21928_10007014	3300002067	Bacteria	3683
11	JGI24735J21928_10060394	3300002067	Bacteria	1089
12	JGI24735J21928_10071112	3300002067	Bacteria	997
13	JGI24748J21848_1000044	3300002074	Bacteria	59119
14	JGI24738J21930_10004739	3300002075	Bacteria	3313
15	JGI24034J26672_10000020	3300002239	Bacteria	122643
16	JGI24742J22300_10000620	3300002244	Bacteria	5334
17	JGI25155J39150_1000069	3300002704	Bacteria	64645
18	JGI25156J39149_1000095	3300002705	Bacteria	64645
19	JGI25162J39368_1002190	3300002737	Bacteria	8063
20	JGI25154J39366_1000560	3300002738	Bacteria	18262
21	JGI25158J39367_1000029	3300002739	Bacteria	33536
22	JGI25157J39369_1000216	3300002741	Bacteria	47231
23	JGI25152J39213_1003369	3300002773	Bacteria	5485
24	JGI25152J39213_1003399	3300002773	Bacteria	5452
25	JGI25152J39213_1004307	3300002773	Bacteria	4530
26	JGI25152J39213_1006750	3300002773	Bacteria	3058
27	JGI25152J39213_1009332	3300002773	Bacteria	2339
28	JGI25150J39212_1000232	3300002774	Bacteria	30243
29	JGI25150J39212_1022674	3300002774	Bacteria	941
30	JGI25159J45721_1000192	3300002987	Bacteria	28420
31	JGI25159J45721_1000479	3300002987	Bacteria	18398
32	JGI25159J45721_1000621	3300002987	Bacteria	15796
33	JGI25151J46595_10000439	3300003187	Bacteria	41010
34	JGI25151J46595_10001371	3300003187	Bacteria	16854
35	JGI25151J46595_10003061	3300003187	Bacteria	9452
36	JGI25165J46597_1001961	3300003214	Bacteria	8063
37	JGI25165J46597_1001999	3300003214	Bacteria	7828
38	JGI25165J46597_1008125	3300003214	Bacteria	1674
39	JGI25153J46596_10007562	3300003215	Bacteria	5320
40	JGI25153J46596_10011190	3300003215	Bacteria	3985
41	JGI25153J46596_10013163	3300003215	Bacteria	3516
42	JGI25153J46596_10015668	3300003215	Bacteria	3075
43	JGI25153J46596_10018074	3300003215	Bacteria	2752
44	JGI25160J50197_1000003	3300003354	Bacteria	482719
45	JGI25160J50197_1000287	3300003354	Bacteria	36528
46	JGI25160J50197_1001532	3300003354	Bacteria	11456
47	JGI25160J50197_1011524	3300003354	Bacteria	3129
48	JGI25161J50226_1000176	3300003374	Bacteria	42677
49	JGI25161J50226_1000523	3300003374	Bacteria	16594
50	JGI25161J50226_1002174	3300003374	Bacteria	5224
51	JGI25161J50226_1004992	3300003374	Bacteria	2673
52	Ga0006562J51391_1115539	3300003578	Bacteria	1241
53	Ga0055526_1003881	3300003771	Bacteria	9270
54	Ga0055526_1003970	3300003771	Bacteria	9116
55	Ga0055526_1005084	3300003771	Bacteria	7678
56	Ga0055526_1005149	3300003771	Bacteria	7617
57	Ga0055526_1005215	3300003771	Bacteria	7547
58	Ga0055526_1019122	3300003771	Bacteria	2511
59	Ga0055537_1001041	3300003773	Bacteria	12442
60	Ga0055524_1001632	3300003775	Bacteria	12512
61	Ga0055524_1010414	3300003775	Bacteria	3704
62	Ga0055524_1012005	3300003775	Bacteria	3349
63	Ga0055524_1020751	3300003775	Bacteria	2202
64	Ga0055524_1034537	3300003775	Bacteria	1396
65	Ga0055536_1008181	3300003781	Bacteria	4545
66	Ga0055536_1008884	3300003781	Bacteria	4245
67	Ga0055536_1010749	3300003781	Bacteria	3588
68	Ga0055528_1003156	3300003790	Bacteria	8441
69	Ga0055528_1003713	3300003790	Bacteria	7554
70	Ga0055528_1005850	3300003790	Bacteria	5648
71	Ga0055528_1007342	3300003790	Bacteria	4888
72	Ga0055528_1013747	3300003790	Bacteria	3047
73	Ga0055540_1003870	3300003792	Bacteria	7029
74	Ga0055540_1016096	3300003792	Bacteria	2144
75	Ga0055531_10040672	3300003794	Bacteria	1358
76	Ga0058692_1002554	3300003856	Bacteria	6028
77	Ga0058692_1006913	3300003856	Bacteria	3061
78	Ga0055543_1000069	3300004625	Bacteria	94040
79	Ga0055543_1000114	3300004625	Bacteria	69144
80	Ga0055543_1000187	3300004625	Bacteria	50429
81	Ga0055543_1000247	3300004625	Bacteria	41352
82	Ga0065165_1000047	3300005262	Bacteria	197811
83	Ga0065165_1000511	3300005262	Bacteria	59722
84	Ga0065165_1015496	3300005262	Bacteria	2903
85	Ga0065165_1038045	3300005262	Bacteria	1453
86	Ga0065165_1062844	3300005262	Bacteria	1011
87	Ga0065707_10081865	3300005295	Bacteria	32547
88	Ga0070658_10000409	3300005327	Bacteria	37237
89	Ga0070658_10013265	3300005327	Bacteria	6611
90	Ga0070658_10026510	3300005327	Bacteria	4650
91	Ga0070658_10287900	3300005327	Bacteria	1400
92	Ga0070683_100000644	3300005329	Bacteria	25133
93	Ga0070690_100049725	3300005330	Bacteria	2673
94	Ga0070670_100006682	3300005331	Bacteria	9778
95	Ga0070670_100016813	3300005331	Bacteria	6278
96	Ga0070670_100067225	3300005331	Bacteria	3076
97	Ga0070670_101319407	3300005331	Bacteria	661
98	Ga0070677_10088305	3300005333	Bacteria	1343
99	Ga0068869_100021828	3300005334	Bacteria	4406
100	Ga0068869_100138345	3300005334	Bacteria	1878
101	Ga0070666_10001050	3300005335	Bacteria	16895
102	Ga0070666_10002373	3300005335	Bacteria	11380
103	Ga0070666_10642496	3300005335	Bacteria	776
104	Ga0070680_100004572	3300005336	Bacteria	10403
105	Ga0070680_100009894	3300005336	Bacteria	7340
106	Ga0070660_100000055	3300005339	Bacteria	67100
107	Ga0070660_100016630	3300005339	Bacteria	5344
108	Ga0070660_100034146	3300005339	Bacteria	3841
109	Ga0070660_100136974	3300005339	Bacteria	1962
110	Ga0070691_10209227	3300005341	Bacteria	1028
111	Ga0070691_10546220	3300005341	Bacteria	676
112	Ga0070661_100000340	3300005344	Bacteria	37237
113	Ga0070661_100013551	3300005344	Bacteria	5724
114	Ga0070661_100152831	3300005344	Bacteria	1746
115	Ga0070661_100305165	3300005344	Bacteria	1240
116	Ga0070692_10001570	3300005345	Bacteria	8386
117	Ga0070692_10013728	3300005345	Bacteria	3784
118	Ga0070668_100125420	3300005347	Bacteria	2056
119	Ga0070668_100603126	3300005347	Bacteria	961
120	Ga0070669_100017639	3300005353	Bacteria	5092
121	Ga0070669_100080824	3300005353	Bacteria	2420
122	Ga0070669_100081351	3300005353	Bacteria	2412
123	Ga0070669_100112579	3300005353	Bacteria	2067
124	Ga0070669_100223456	3300005353	Bacteria	1490
125	Ga0070675_100442176	3300005354	Bacteria	1165
126	Ga0070671_100031788	3300005355	Bacteria	4363
127	Ga0070671_100050065	3300005355	Bacteria	3475
128	Ga0070671_100112218	3300005355	Bacteria	2290
129	Ga0070671_100170118	3300005355	Bacteria	1843
130	Ga0070674_100065353	3300005356	Bacteria	2553
131	Ga0070674_100633863	3300005356	Bacteria	907
132	Ga0070673_100015703	3300005364	Bacteria	5328
133	Ga0070673_100071965	3300005364	Bacteria	2779
134	Ga0070673_100171550	3300005364	Bacteria	1852
135	Ga0070673_100603259	3300005364	Bacteria	1001
136	Ga0070659_100000139	3300005366	Bacteria	55743
137	Ga0070659_100011162	3300005366	Bacteria	6636
138	Ga0070659_100012287	3300005366	Bacteria	6349
139	Ga0070659_100503646	3300005366	Bacteria	1032
140	Ga0070659_100541874	3300005366	Bacteria	995
141	Ga0070667_100005245	3300005367	Bacteria	10835
142	Ga0070667_100023846	3300005367	Bacteria	5080
143	Ga0070667_100157513	3300005367	Bacteria	1998
144	Ga0070667_100178909	3300005367	Bacteria	1875
145	Ga0070667_100320248	3300005367	Bacteria	1399
146	Ga0070667_100339932	3300005367	Bacteria	1357
147	Ga0070703_10001725	3300005406	Bacteria	6486
148	Ga0070701_10015566	3300005438	Bacteria	3516
149	Ga0070705_100003836	3300005440	Bacteria	7349
150	Ga0070700_100010792	3300005441	Bacteria	5049
151	Ga0070694_100000725	3300005444	Bacteria	18394
152	Ga0070708_100156154	3300005445	Bacteria	2124
153	Ga0070663_100044978	3300005455	Bacteria	3117
154	Ga0070663_100260991	3300005455	Bacteria	1374
155	Ga0070663_100390871	3300005455	Bacteria	1135
156	Ga0070662_100000024	3300005457	Bacteria	91042
157	Ga0070662_100001433	3300005457	Bacteria	14710
158	Ga0070662_100015527	3300005457	Bacteria	5103
159	Ga0070662_100022218	3300005457	Bacteria	4339
160	Ga0070662_100022652	3300005457	Bacteria	4302
161	Ga0070662_100104788	3300005457	Bacteria	2146
162	Ga0070681_10024817	3300005458	Bacteria	6031
163	Ga0068867_100012473	3300005459	Bacteria	6015
164	Ga0070706_100069679	3300005467	Bacteria	3253
165	Ga0070699_100000188	3300005518	Bacteria	60070
166	Ga0070679_100060223	3300005530	Bacteria	3783
167	Ga0070684_100100316	3300005535	Bacteria	2585
168	Ga0070684_100353189	3300005535	Bacteria	1352
169	Ga0070697_100476289	3300005536	Bacteria	1090
170	Ga0068853_100000342	3300005539	Bacteria	32471
171	Ga0068853_100002373	3300005539	Bacteria	14072
172	Ga0068853_100013841	3300005539	Bacteria	6594
173	Ga0068853_100164151	3300005539	Bacteria	2006
174	Ga0068853_100223366	3300005539	Bacteria	1721
175	Ga0068853_100237579	3300005539	Bacteria	1669
176	Ga0068853_100376264	3300005539	Bacteria	1325
177	Ga0070672_100132185	3300005543	Bacteria	2052
178	Ga0070686_100168806	3300005544	Bacteria	1546
179	Ga0070695_100000657	3300005545	Bacteria	18437
180	Ga0070696_100007361	3300005546	Bacteria	7350
181	Ga0070696_100386486	3300005546	Bacteria	1092
182	Ga0070665_100000937	3300005548	Bacteria	37328
183	Ga0070665_100159460	3300005548	Bacteria	2258
184	Ga0070665_100245297	3300005548	Bacteria	1792
185	Ga0070665_100306322	3300005548	Bacteria	1592
186	Ga0070665_100419424	3300005548	Bacteria	1347
187	Ga0070665_100423525	3300005548	Bacteria	1340
188	Ga0070665_100532976	3300005548	Bacteria	1186
189	Ga0070665_100737797	3300005548	Bacteria	998
190	Ga0070704_100001753	3300005549	Bacteria	11864
191	Ga0070704_100302493	3300005549	Bacteria	1333
192	Ga0068855_100021596	3300005563	Bacteria	7721
193	Ga0068855_100190786	3300005563	Bacteria	2312
194	Ga0068855_100495888	3300005563	Bacteria	1328
195	Ga0068855_100823789	3300005563	Bacteria	985
196	Ga0070664_100000082	3300005564	Bacteria	60083
197	Ga0070664_100004455	3300005564	Bacteria	11251
198	Ga0070664_100326470	3300005564	Bacteria	1391
199	Ga0070664_100985737	3300005564	Bacteria	792
200	Ga0068857_100004407	3300005577	Bacteria	11899
201	Ga0068857_100015287	3300005577	Bacteria	6700
202	Ga0068857_100131484	3300005577	Bacteria	2257
203	Ga0068854_100061948	3300005578	Bacteria	2710
204	Ga0068854_100163575	3300005578	Bacteria	1726
205	Ga0068854_100408998	3300005578	Bacteria	1124
206	Ga0068856_100000085	3300005614	Bacteria	87665
207	Ga0068856_100015293	3300005614	Bacteria	7415
208	Ga0068856_100082663	3300005614	Bacteria	3187
209	Ga0068856_100111687	3300005614	Bacteria	2730
210	Ga0068856_100140701	3300005614	Bacteria	2420
211	Ga0070702_100122429	3300005615	Bacteria	1630
212	Ga0068852_100007528	3300005616	Bacteria	7950
213	Ga0068852_100207630	3300005616	Bacteria	1856
214	Ga0068859_100000068	3300005617	Bacteria	96701
215	Ga0068859_100014603	3300005617	Bacteria	7888
216	Ga0068859_100021782	3300005617	Bacteria	6428
217	Ga0068859_100043104	3300005617	Bacteria	4534
218	Ga0068864_100000339	3300005618	Bacteria	41252
219	Ga0068864_100007897	3300005618	Bacteria	8767
220	Ga0068864_100029139	3300005618	Bacteria	4671
221	Ga0068864_100041811	3300005618	Bacteria	3920
222	Ga0068864_100068189	3300005618	Bacteria	3090
223	Ga0068861_100365092	3300005719	Bacteria	1271
224	Ga0068861_100704500	3300005719	Bacteria	938
225	Ga0068851_10004531	3300005834	Bacteria	6267
226	Ga0068851_10017285	3300005834	Bacteria	3463
227	Ga0068851_10034334	3300005834	Bacteria	2531
228	Ga0068851_10067695	3300005834	Bacteria	1842
229	Ga0068851_10505859	3300005834	Bacteria	725
230	Ga0068870_10261182	3300005840	Bacteria	1078
231	Ga0068870_10279070	3300005840	Bacteria	1047
232	Ga0068863_100000535	3300005841	Bacteria	38753
233	Ga0068863_100009175	3300005841	Bacteria	9650
234	Ga0068863_100040654	3300005841	Bacteria	4421
235	Ga0068863_100067181	3300005841	Bacteria	3391
236	Ga0068863_100320759	3300005841	Bacteria	1505
237	Ga0068858_100069802	3300005842	Bacteria	3257
238	Ga0068860_100015416	3300005843	Bacteria	7466
239	Ga0068860_100052325	3300005843	Bacteria	3884
240	Ga0068862_100007255	3300005844	Bacteria	9201
241	Ga0068862_100008073	3300005844	Bacteria	8713
242	Ga0068862_100205887	3300005844	Bacteria	1776
243	Ga0068862_100483681	3300005844	Bacteria	1172
244	Ga0081455_10000545	3300005937	Bacteria	48941
245	Ga0081455_10074535	3300005937	Bacteria	2803
246	Ga0081455_10109732	3300005937	Bacteria	2195
247	Ga0081539_10070068	3300005985	Bacteria	1884
248	Ga0075365_10002469	3300006038	Bacteria	9082
249	Ga0075365_10003608	3300006038	Bacteria	8011
250	Ga0075365_10032760	3300006038	Bacteria	3344
251	Ga0075368_10000791	3300006042	Bacteria	9712
252	Ga0075368_10001299	3300006042	Bacteria	7919
253	Ga0075368_10005248	3300006042	Bacteria	4449
254	Ga0075368_10025919	3300006042	Bacteria	2252
255	Ga0075368_10031036	3300006042	Bacteria	2071
256	Ga0075368_10048083	3300006042	Bacteria	1690
257	Ga0075368_10140048	3300006042	Bacteria	1008
258	Ga0075363_100021865	3300006048	Bacteria	3228
259	Ga0075363_100024186	3300006048	Bacteria	3085
260	Ga0075363_100030337	3300006048	Bacteria	2798
261	Ga0075363_100054278	3300006048	Bacteria	2143
262	Ga0075363_100056239	3300006048	Bacteria	2109
263	Ga0075364_10003077	3300006051	Bacteria	9425
264	Ga0075364_10017668	3300006051	Bacteria	4460
265	Ga0075364_10139176	3300006051	Bacteria	1632
266	Ga0075362_10010129	3300006177	Bacteria	3671
267	Ga0075367_10004018	3300006178	Bacteria	7113
268	Ga0075367_10007480	3300006178	Bacteria	5595
269	Ga0075367_10020318	3300006178	Bacteria	3696
270	Ga0075367_10321591	3300006178	Bacteria	975
271	Ga0075369_10056310	3300006186	Bacteria	1709
272	Ga0075369_10289131	3300006186	Bacteria	764
273	Ga0075366_10000883	3300006195	Bacteria	14482
274	Ga0097621_100010319	3300006237	Bacteria	6827
275	Ga0097621_100066229	3300006237	Bacteria	2975
276	Ga0075370_10018662	3300006353	Bacteria	3764
277	Ga0075370_10034556	3300006353	Bacteria	2834
278	Ga0075370_10206516	3300006353	Bacteria	1159
279	Ga0075370_10225078	3300006353	Bacteria	1109
280	Ga0075370_10283212	3300006353	Bacteria	985
281	Ga0075370_10358183	3300006353	Bacteria	872
282	Ga0068871_100039095	3300006358	Bacteria	3794
283	Ga0075428_100917773	3300006844	Bacteria	929
284	Ga0075430_100069684	3300006846	Bacteria	2950
285	Ga0075430_100078448	3300006846	Bacteria	2768
286	Ga0075430_100619620	3300006846	Bacteria	893
287	Ga0075431_100003896	3300006847	Bacteria	14523
288	Ga0075431_100004223	3300006847	Bacteria	14073
289	Ga0075431_100042858	3300006847	Bacteria	4668
290	Ga0075431_100049916	3300006847	Bacteria	4314
291	Ga0075431_100236910	3300006847	Bacteria	1858
292	Ga0075431_100269453	3300006847	Bacteria	1726
293	Ga0075433_10031492	3300006852	Bacteria	4535
294	Ga0075433_11032696	3300006852	Bacteria	716
295	Ga0075434_100081577	3300006871	Bacteria	3232
296	Ga0075434_100194051	3300006871	Bacteria	2051
297	Ga0075434_100255331	3300006871	Bacteria	1772
298	Ga0075434_100335797	3300006871	Bacteria	1532
299	Ga0075429_100026019	3300006880	Bacteria	5078
300	Ga0068865_100362021	3300006881	Bacteria	1178
301	Ga0097620_100000068	3300006931	Bacteria	96701
302	Ga0097620_100014604	3300006931	Bacteria	7888
303	Ga0097620_100021781	3300006931	Bacteria	6428
304	Ga0097620_100043105	3300006931	Bacteria	4534
305	Ga0099824_1005597	3300006942	Bacteria	17628
306	Ga0079104_1000125	3300006946	Bacteria	110104
307	Ga0079104_1000777	3300006946	Bacteria	27197
308	Ga0079104_1018873	3300006946	Bacteria	1942
309	Ga0099826_10015705	3300006948	Bacteria	5721
310	Ga0099826_10020216	3300006948	Bacteria	4998
311	Ga0075435_100467799	3300007076	Bacteria	1088
312	Ga0105250_10005874	3300009092	Bacteria	5439
313	Ga0105250_10098485	3300009092	Bacteria	1192
314	Ga0105240_10000310	3300009093	Bacteria	93883
315	Ga0105240_10045075	3300009093	Bacteria	5597
316	Ga0105240_10216325	3300009093	Bacteria	2235
317	Ga0105240_10479266	3300009093	Bacteria	1387
318	Ga0105240_10829396	3300009093	Bacteria	1000
319	Ga0111539_10020472	3300009094	Bacteria	8146
320	Ga0105245_10005749	3300009098	Bacteria	10885
321	Ga0105245_10923469	3300009098	Bacteria	915
322	Ga0105247_10019921	3300009101	Bacteria	4029
323	Ga0105247_10070905	3300009101	Bacteria	2178
324	Ga0114129_10159134	3300009147	Bacteria	3087
325	Ga0114129_10221355	3300009147	Bacteria	2553
326	Ga0114129_10233827	3300009147	Bacteria	2474
327	Ga0114129_10297959	3300009147	Bacteria	2150
328	Ga0114129_10805595	3300009147	Bacteria	1198
329	Ga0105243_10003568	3300009148	Bacteria	12561
330	Ga0105243_10241288	3300009148	Bacteria	1608
331	Ga0105243_10674710	3300009148	Bacteria	1004
332	Ga0105241_10242644	3300009174	Bacteria	1524
333	Ga0105241_10338070	3300009174	Bacteria	1304
334	Ga0105241_10449044	3300009174	Bacteria	1140
335	Ga0105241_10633525	3300009174	Bacteria	969
336	Ga0105241_10657845	3300009174	Bacteria	952
337	Ga0105241_11203511	3300009174	Bacteria	718
338	Ga0105242_10016587	3300009176	Bacteria	5728
339	Ga0105248_10000059	3300009177	Bacteria	137176
340	Ga0105248_10000071	3300009177	Bacteria	118281
341	Ga0105248_10016891	3300009177	Bacteria	8035
342	Ga0105248_10125939	3300009177	Bacteria	2890
343	Ga0105248_10442637	3300009177	Bacteria	1464
344	Ga0105248_10652117	3300009177	Bacteria	1188
345	Ga0105237_10000459	3300009545	Bacteria	57762
346	Ga0105237_10002190	3300009545	Bacteria	24450
347	Ga0105237_10027740	3300009545	Bacteria	5773
348	Ga0105237_10517685	3300009545	Bacteria	1199
349	Ga0105238_10002270	3300009551	Bacteria	19365
350	Ga0105238_10009673	3300009551	Bacteria	9649
351	Ga0105238_10039938	3300009551	Bacteria	4756
352	Ga0105238_10396975	3300009551	Bacteria	1372
353	Ga0105238_10639347	3300009551	Bacteria	1073
354	Ga0105238_11193250	3300009551	Bacteria	785
355	Ga0105249_10000064	3300009553	Bacteria	151646
356	Ga0105249_10004443	3300009553	Bacteria	12140
357	Ga0105249_10676556	3300009553	Bacteria	1091
358	Ga0123341_1000017	3300009765	Bacteria	82963
359	Ga0123342_1029556	3300009766	Bacteria	2837
360	Ga0105239_10006653	3300010375	Bacteria	13371
361	Ga0105239_10012124	3300010375	Bacteria	9611
362	Ga0105239_10056820	3300010375	Bacteria	4292
363	Ga0105239_10218974	3300010375	Bacteria	2135
364	Ga0105239_10338430	3300010375	Bacteria	1698
365	Ga0105239_10370956	3300010375	Bacteria	1617
366	Ga0105239_10409896	3300010375	Bacteria	1534
367	Ga0105239_10504550	3300010375	Bacteria	1375
368	Ga0105239_10538971	3300010375	Bacteria	1329
369	Ga0105239_10565985	3300010375	Bacteria	1295
370	Ga0105239_10801957	3300010375	Bacteria	1079
371	Ga0105246_10008225	3300011119	Bacteria	6408
372	Ga0105246_10018438	3300011119	Bacteria	4448
373	Ga0157322_1000372	3300012490	Bacteria	1588
374	Ga0157373_10007416	3300013100	Bacteria	8156
375	Ga0157373_10036131	3300013100	Bacteria	3547
376	Ga0157373_10038404	3300013100	Bacteria	3432
377	Ga0157373_10093807	3300013100	Bacteria	2114
378	Ga0157373_10477277	3300013100	Bacteria	899
379	Ga0157371_10000004	3300013102	Bacteria	512593
380	Ga0157371_10006091	3300013102	Bacteria	10029
381	Ga0157371_10008339	3300013102	Bacteria	8268
382	Ga0157371_10037322	3300013102	Bacteria	3478
383	Ga0157371_10875522	3300013102	Bacteria	680
384	Ga0157370_10001506	3300013104	Bacteria	28774
385	Ga0157370_10010062	3300013104	Bacteria	10000
386	Ga0157370_10039889	3300013104	Bacteria	4535
387	Ga0157370_10153906	3300013104	Bacteria	2139
388	Ga0157369_10034621	3300013105	Bacteria	5540
389	Ga0157369_10049778	3300013105	Bacteria	4540
390	Ga0157369_10148721	3300013105	Bacteria	2476
391	Ga0171463_1001	3300013249	Bacteria	1406070
392	Ga0157374_10035946	3300013296	Bacteria	4535
393	Ga0157378_10023762	3300013297	Bacteria	5392
394	Ga0157378_10078681	3300013297	Bacteria	2975
395	Ga0163162_10077001	3300013306	Bacteria	3398
396	Ga0163162_10244138	3300013306	Bacteria	1927
397	Ga0163162_10965851	3300013306	Bacteria	962
398	Ga0157372_10181542	3300013307	Bacteria	2436
399	Ga0157372_10973294	3300013307	Bacteria	983
400	Ga0157372_11329973	3300013307	Bacteria	829
401	Ga0157375_10073535	3300013308	Bacteria	3437
402	Ga0157375_10705360	3300013308	Bacteria	1162
403	Ga0157375_11329578	3300013308	Bacteria	845
404	Ga0163163_10000763	3300014325	Bacteria	27341
405	Ga0163163_10000995	3300014325	Bacteria	23981
406	Ga0163163_10020373	3300014325	Bacteria	6244
407	Ga0163163_10083912	3300014325	Bacteria	3192
408	Ga0163163_10493253	3300014325	Bacteria	1286
409	Ga0163163_10517943	3300014325	Bacteria	1255
410	Ga0163163_10579196	3300014325	Bacteria	1185
411	Ga0157380_10000086	3300014326	Bacteria	51604
412	Ga0157380_10000723	3300014326	Bacteria	20585
413	Ga0157380_10028805	3300014326	Bacteria	4239
414	Ga0157380_10591695	3300014326	Bacteria	1096
415	Ga0182008_10020916	3300014497	Bacteria	3366
416	Ga0182008_10025465	3300014497	Bacteria	3004
417	Ga0157379_10002697	3300014968	Bacteria	14964
418	Ga0157379_10012611	3300014968	Bacteria	7382
419	Ga0157379_10050744	3300014968	Bacteria	3704
420	Ga0157379_10062874	3300014968	Bacteria	3319
421	Ga0157379_10285667	3300014968	Bacteria	1502
422	Ga0157379_11349690	3300014968	Bacteria	690
423	Ga0182007_10001994	3300015262	Bacteria	10528
424	Ga0183365_10115	3300015684	Bacteria	1996
425	Ga0183363_1187	3300015690	Bacteria	13377
426	Ga0214544_1000434	3300021320	Bacteria	75507
427	Ga0214542_1000146	3300021321	Bacteria	103035
428	Ga0214542_1025313	3300021321	Bacteria	3121
429	Ga0214543_1000049	3300021327	Bacteria	149506
430	Ga0214543_1000054	3300021327	Bacteria	140288
431	Ga0213873_10000008	3300021358	Bacteria	263363
432	Ga0213874_10014768	3300021377	Bacteria	2048
433	Ga0213876_10000005	3300021384	Bacteria	727326
434	Ga0228711_1000006	3300022739	Bacteria	202437
435	Ga0228710_1000004	3300022740	Bacteria	250560
436	Ga0209435_100049	3300025206	Bacteria	92067
437	Ga0209760_103481	3300025207	Bacteria	1395
438	Ga0209436_100107	3300025208	Bacteria	41305
439	Ga0209436_101564	3300025208	Bacteria	7745
440	Ga0209563_104898	3300025230	Bacteria	2497
441	Ga0209437_100376	3300025233	Bacteria	45400
442	Ga0209437_100981	3300025233	Bacteria	10063
443	Ga0207425_1000052	3300025245	Bacteria	162123
444	Ga0207425_1007278	3300025245	Bacteria	2940
445	Ga0207425_1015373	3300025245	Bacteria	1719
446	Ga0207425_1019367	3300025245	Bacteria	1466
447	Ga0207425_1025537	3300025245	Bacteria	1218
448	Ga0209646_1000159	3300025246	Bacteria	92067
449	Ga0209646_1031776	3300025246	Bacteria	705
450	Ga0209026_1000013	3300025250	Bacteria	415633
451	Ga0209026_1000183	3300025250	Bacteria	92067
452	Ga0209677_100684	3300025253	Bacteria	17367
453	Ga0209148_1000032	3300025254	Bacteria	557660
454	Ga0209148_1012400	3300025254	Bacteria	1560
455	Ga0209759_1000058	3300025256	Bacteria	203580
456	Ga0209759_1000206	3300025256	Bacteria	92067
457	Ga0209129_1000512	3300025258	Bacteria	27712
458	Ga0209129_1000652	3300025258	Bacteria	23241
459	Ga0209129_1000779	3300025258	Bacteria	20145
460	Ga0209129_1001160	3300025258	Bacteria	15200
461	Ga0209129_1002177	3300025258	Bacteria	9873
462	Ga0209129_1008991	3300025258	Bacteria	2696
463	Ga0209233_1000034	3300025261	Bacteria	578898
464	Ga0209233_1000368	3300025261	Bacteria	40743
465	Ga0209233_1000423	3300025261	Bacteria	31308
466	Ga0209233_1000458	3300025261	Bacteria	26629
467	Ga0209233_1005874	3300025261	Bacteria	4026
468	Ga0209233_1023863	3300025261	Bacteria	1540
469	Ga0209565_1000099	3300025263	Bacteria	131080
470	Ga0209455_1000098	3300025272	Bacteria	213890
471	Ga0209673_1000024	3300025273	Bacteria	409632
472	Ga0209673_1000358	3300025273	Bacteria	82232
473	Ga0209673_1000526	3300025273	Bacteria	62641
474	Ga0209673_1005762	3300025273	Bacteria	6165
475	Ga0209673_1006556	3300025273	Bacteria	5581
476	Ga0209673_1011840	3300025273	Bacteria	3562
477	Ga0209673_1017558	3300025273	Bacteria	2635
478	Ga0209130_1000002	3300025284	Bacteria	722648
479	Ga0209130_1000005	3300025284	Bacteria	599620
480	Ga0209130_1000377	3300025284	Bacteria	50153
481	Ga0209130_1022883	3300025284	Bacteria	1387
482	Ga0209676_1000187	3300025292	Bacteria	141338
483	Ga0209676_1008136	3300025292	Bacteria	4747
484	Ga0209025_1000037	3300025294	Bacteria	383429
485	Ga0209025_1000144	3300025294	Bacteria	181446
486	Ga0209025_1000274	3300025294	Bacteria	119322
487	Ga0209025_1000553	3300025294	Bacteria	69760
488	Ga0209025_1001763	3300025294	Bacteria	25860
489	Ga0209025_1001809	3300025294	Bacteria	25289
490	Ga0209025_1014907	3300025294	Bacteria	4736
491	Ga0209025_1017884	3300025294	Bacteria	4061
492	Ga0209025_1028305	3300025294	Bacteria	2751
493	Ga0209564_1000113	3300025295	Bacteria	211564
494	Ga0209564_1001082	3300025295	Bacteria	32571
495	Ga0209564_1003178	3300025295	Bacteria	11543
496	Ga0209564_1003326	3300025295	Bacteria	11170
497	Ga0209564_1003465	3300025295	Bacteria	10757
498	Ga0209564_1004032	3300025295	Bacteria	9283
499	Ga0209564_1004773	3300025295	Bacteria	8092
500	Ga0209758_1000519	3300025297	Bacteria	61859
501	Ga0209758_1000744	3300025297	Bacteria	47380
502	Ga0209758_1003444	3300025297	Bacteria	14386
503	Ga0209758_1003617	3300025297	Bacteria	13829
504	Ga0209758_1003869	3300025297	Bacteria	13112
505	Ga0209758_1006551	3300025297	Bacteria	8296
506	Ga0209758_1010846	3300025297	Bacteria	5381
507	Ga0209758_1019765	3300025297	Bacteria	3228
508	Ga0209050_1010553	3300025298	Bacteria	4532
509	Ga0209050_1012338	3300025298	Bacteria	3929
510	Ga0209050_1022296	3300025298	Bacteria	2272
511	Ga0209256_1000595	3300025299	Bacteria	50352
512	Ga0209256_1000779	3300025299	Bacteria	41192
513	Ga0209256_1001173	3300025299	Bacteria	29524
514	Ga0209256_1001742	3300025299	Bacteria	20785
515	Ga0209256_1003431	3300025299	Bacteria	11131
516	Ga0209256_1006686	3300025299	Bacteria	5991
517	Ga0207426_1000013	3300025302	Bacteria	721897
518	Ga0207426_1000015	3300025302	Bacteria	599316
519	Ga0207426_1000142	3300025302	Bacteria	194023
520	Ga0207426_1000330	3300025302	Bacteria	89992
521	Ga0207426_1016841	3300025302	Bacteria	2611
522	Ga0209051_1000170	3300025303	Bacteria	119026
523	Ga0209051_1003992	3300025303	Bacteria	9367
524	Ga0209051_1041857	3300025303	Bacteria	1625
525	Ga0209051_1072126	3300025303	Bacteria	1034
526	Ga0209257_1003747	3300025304	Bacteria	12587
527	Ga0209257_1004397	3300025304	Bacteria	10948
528	Ga0207697_10015942	3300025315	Bacteria	3099
529	Ga0207656_10011471	3300025321	Bacteria	3349
530	Ga0207656_10064926	3300025321	Bacteria	1610
531	Ga0207653_10001613	3300025885	Bacteria	7261
532	Ga0207710_10154789	3300025900	Bacteria	1114
533	Ga0207688_10270608	3300025901	Bacteria	1033
534	Ga0207680_10001402	3300025903	Bacteria	11401
535	Ga0207680_10001928	3300025903	Bacteria	9728
536	Ga0207647_10007819	3300025904	Bacteria	7697
537	Ga0207647_10015676	3300025904	Bacteria	5190
538	Ga0207647_10017963	3300025904	Bacteria	4795
539	Ga0207647_10036486	3300025904	Bacteria	3123
540	Ga0207647_10313909	3300025904	Bacteria	891
541	Ga0207645_10477341	3300025907	Bacteria	843
542	Ga0207705_10000062	3300025909	Bacteria	149432
543	Ga0207705_10009913	3300025909	Bacteria	6936
544	Ga0207705_10035585	3300025909	Bacteria	3562
545	Ga0207654_10000874	3300025911	Bacteria	16703
546	Ga0207654_10103025	3300025911	Bacteria	1762
547	Ga0207654_10170111	3300025911	Bacteria	1414
548	Ga0207707_10049317	3300025912	Bacteria	3668
549	Ga0207707_10635272	3300025912	Bacteria	901
550	Ga0207695_10000403	3300025913	Bacteria	96385
551	Ga0207695_10078433	3300025913	Bacteria	3351
552	Ga0207695_10299401	3300025913	Bacteria	1500
553	Ga0207695_10468702	3300025913	Bacteria	1142
554	Ga0207671_10000277	3300025914	Bacteria	76473
555	Ga0207671_10014940	3300025914	Bacteria	6104
556	Ga0207671_10040568	3300025914	Bacteria	3446
557	Ga0207660_10008981	3300025917	Bacteria	6468
558	Ga0207660_10217892	3300025917	Bacteria	1497
559	Ga0207657_10000015	3300025919	Bacteria	175776
560	Ga0207657_10002661	3300025919	Bacteria	19282
561	Ga0207657_10015543	3300025919	Bacteria	7372
562	Ga0207657_10036956	3300025919	Bacteria	4367
563	Ga0207657_10174156	3300025919	Bacteria	1742
564	Ga0207649_10000264	3300025920	Bacteria	41423
565	Ga0207649_10089675	3300025920	Bacteria	2010
566	Ga0207649_10291322	3300025920	Bacteria	1190
567	Ga0207649_10435508	3300025920	Bacteria	987
568	Ga0207652_10048966	3300025921	Bacteria	3615
569	Ga0207652_10874395	3300025921	Bacteria	795
570	Ga0207646_10353556	3300025922	Bacteria	1328
571	Ga0207681_10074068	3300025923	Bacteria	2384
572	Ga0207681_10086320	3300025923	Bacteria	2229
573	Ga0207681_10182161	3300025923	Bacteria	1601
574	Ga0207681_10280828	3300025923	Bacteria	1311
575	Ga0207694_10000306	3300025924	Bacteria	46009
576	Ga0207694_10021174	3300025924	Bacteria	4924
577	Ga0207694_10142708	3300025924	Bacteria	1926
578	Ga0207694_10215765	3300025924	Bacteria	1564
579	Ga0207694_10490150	3300025924	Bacteria	1028
580	Ga0207650_10007746	3300025925	Bacteria	7321
581	Ga0207650_10014713	3300025925	Bacteria	5437
582	Ga0207687_10126221	3300025927	Bacteria	1921
583	Ga0207687_10146986	3300025927	Bacteria	1794
584	Ga0207644_10000274	3300025931	Bacteria	34175
585	Ga0207644_10025358	3300025931	Bacteria	4078
586	Ga0207644_10109491	3300025931	Bacteria	2087
587	Ga0207644_10114325	3300025931	Bacteria	2045
588	Ga0207644_10137528	3300025931	Bacteria	1877
589	Ga0207644_10265209	3300025931	Bacteria	1374
590	Ga0207690_10000032	3300025932	Bacteria	152479
591	Ga0207690_10181782	3300025932	Bacteria	1584
592	Ga0207690_10239786	3300025932	Bacteria	1396
593	Ga0207690_10403487	3300025932	Bacteria	1090
594	Ga0207706_10000032	3300025933	Bacteria	142723
595	Ga0207706_10000143	3300025933	Bacteria	77680
596	Ga0207706_10013628	3300025933	Bacteria	7383
597	Ga0207706_10025353	3300025933	Bacteria	5313
598	Ga0207706_10110034	3300025933	Bacteria	2424
599	Ga0207686_10167263	3300025934	Bacteria	1547
600	Ga0207709_10074535	3300025935	Bacteria	2166
601	Ga0207670_10167942	3300025936	Bacteria	1643
602	Ga0207669_10004579	3300025937	Bacteria	6099
603	Ga0207691_10003446	3300025940	Bacteria	15387
604	Ga0207691_10066693	3300025940	Bacteria	3256
605	Ga0207691_10280006	3300025940	Bacteria	1435
606	Ga0207711_10000046	3300025941	Bacteria	153238
607	Ga0207711_10000476	3300025941	Bacteria	41373
608	Ga0207711_10194323	3300025941	Bacteria	1850
609	Ga0207711_10472544	3300025941	Bacteria	1168
610	Ga0207689_10372285	3300025942	Bacteria	1189
611	Ga0207661_10007272	3300025944	Bacteria	7877
612	Ga0207679_10001577	3300025945	Bacteria	14256
613	Ga0207679_10076796	3300025945	Bacteria	2539
614	Ga0207679_10265120	3300025945	Bacteria	1467
615	Ga0207667_10028393	3300025949	Bacteria	6078
616	Ga0207667_10038209	3300025949	Bacteria	5128
617	Ga0207667_10326844	3300025949	Bacteria	1566
618	Ga0207667_10545678	3300025949	Bacteria	1173
619	Ga0207667_10674262	3300025949	Bacteria	1038
620	Ga0207651_10013384	3300025960	Bacteria	4693
621	Ga0207651_10042757	3300025960	Bacteria	3018
622	Ga0207651_10244291	3300025960	Bacteria	1465
623	Ga0207712_10000886	3300025961	Bacteria	21743
624	Ga0207712_10488670	3300025961	Bacteria	1050
625	Ga0207668_10004433	3300025972	Bacteria	8244
626	Ga0207668_10071369	3300025972	Bacteria	2480
627	Ga0207668_10235057	3300025972	Bacteria	1480
628	Ga0207668_10239049	3300025972	Bacteria	1468
629	Ga0207668_10590693	3300025972	Bacteria	966
630	Ga0207668_10671616	3300025972	Bacteria	908
631	Ga0207668_11053288	3300025972	Bacteria	728
632	Ga0207640_10103651	3300025981	Bacteria	2000
633	Ga0207640_10293073	3300025981	Bacteria	1283
634	Ga0207640_10508731	3300025981	Bacteria	1004
635	Ga0207658_10004756	3300025986	Bacteria	9397
636	Ga0207658_10005211	3300025986	Bacteria	8947
637	Ga0207658_10027076	3300025986	Bacteria	4026
638	Ga0207658_10029233	3300025986	Bacteria	3890
639	Ga0207658_10032979	3300025986	Bacteria	3691
640	Ga0207658_10397342	3300025986	Bacteria	1211
641	Ga0207677_10153672	3300026023	Bacteria	1779
642	Ga0207703_10002986	3300026035	Bacteria	14344
643	Ga0207703_10005757	3300026035	Bacteria	9930
644	Ga0207703_10063370	3300026035	Bacteria	3031
645	Ga0207703_10505838	3300026035	Bacteria	1135
646	Ga0207703_10552794	3300026035	Bacteria	1085
647	Ga0207639_10000803	3300026041	Bacteria	21340
648	Ga0207639_10007131	3300026041	Bacteria	7616
649	Ga0207639_10008528	3300026041	Bacteria	7032
650	Ga0207639_10039824	3300026041	Bacteria	3504
651	Ga0207639_10109867	3300026041	Bacteria	2245
652	Ga0207639_10175006	3300026041	Bacteria	1821
653	Ga0207639_10209237	3300026041	Bacteria	1678
654	Ga0207678_10001844	3300026067	Bacteria	19420
655	Ga0207678_10068205	3300026067	Bacteria	3052
656	Ga0207678_10070354	3300026067	Bacteria	3000
657	Ga0207708_10001520	3300026075	Bacteria	17286
658	Ga0207708_10889159	3300026075	Bacteria	770
659	Ga0207702_10000072	3300026078	Bacteria	113840
660	Ga0207702_10000122	3300026078	Bacteria	91685
661	Ga0207702_10049364	3300026078	Bacteria	3551
662	Ga0207702_10069413	3300026078	Bacteria	3030
663	Ga0207641_10002509	3300026088	Bacteria	16932
664	Ga0207641_10002978	3300026088	Bacteria	15327
665	Ga0207641_10032289	3300026088	Bacteria	4346
666	Ga0207641_10552997	3300026088	Bacteria	1122
667	Ga0207648_10002810	3300026089	Bacteria	18461
668	Ga0207648_10110950	3300026089	Bacteria	2408
669	Ga0207648_10198516	3300026089	Bacteria	1779
670	Ga0207648_10566387	3300026089	Bacteria	1045
671	Ga0207676_10021524	3300026095	Bacteria	4730
672	Ga0207676_10026852	3300026095	Bacteria	4283
673	Ga0207676_10133358	3300026095	Bacteria	2115
674	Ga0207676_11107667	3300026095	Bacteria	783
675	Ga0207674_10001996	3300026116	Bacteria	25880
676	Ga0207674_10014657	3300026116	Bacteria	8644
677	Ga0207674_10019607	3300026116	Bacteria	7323
678	Ga0207674_10021817	3300026116	Bacteria	6892
679	Ga0207674_10049158	3300026116	Bacteria	4314
680	Ga0207674_10064762	3300026116	Bacteria	3686
681	Ga0207674_10093240	3300026116	Bacteria	3000
682	Ga0207675_100245415	3300026118	Bacteria	1731
683	Ga0207675_100440132	3300026118	Bacteria	1290
684	Ga0207675_100795184	3300026118	Bacteria	959
685	Ga0207683_10014479	3300026121	Bacteria	6716
686	Ga0207683_10277533	3300026121	Bacteria	1531
687	Ga0207683_10434647	3300026121	Bacteria	1209
688	Ga0207698_10359265	3300026142	Bacteria	1379
689	Ga0207698_10635680	3300026142	Bacteria	1056
690	Ga0209281_1000102	3300027111	Bacteria	221665
691	Ga0209281_1000242	3300027111	Bacteria	110116
692	Ga0209281_1001000	3300027111	Bacteria	22299
693	Ga0209371_1000009	3300027312	Bacteria	963030
694	Ga0209371_1000753	3300027312	Bacteria	27006
695	Ga0209371_1010361	3300027312	Bacteria	2877
696	Ga0209282_1000013	3300027666	Bacteria	215053
697	Ga0209282_1054350	3300027666	Bacteria	2273
698	Ga0209813_10000400	3300027866	Bacteria	10671
699	Ga0209813_10006650	3300027866	Bacteria	2861
700	Ga0209813_10099328	3300027866	Bacteria	988
701	Ga0209813_10256829	3300027866	Bacteria	666
702	Ga0209974_10090688	3300027876	Bacteria	1060
703	Ga0207428_10142986	3300027907	Bacteria	1825
704	Ga0268266_10015894	3300028379	Bacteria	6441
705	Ga0268266_10029225	3300028379	Bacteria	4686
706	Ga0268266_10075513	3300028379	Bacteria	2928
707	Ga0268266_10196760	3300028379	Bacteria	1843
708	Ga0268266_10373791	3300028379	Bacteria	1343
709	Ga0268266_10455714	3300028379	Bacteria	1216
710	Ga0268265_10001073	3300028380	Bacteria	24373
711	Ga0268265_10011654	3300028380	Bacteria	5946
712	Ga0268265_10326542	3300028380	Bacteria	1392
713	Ga0268265_10450413	3300028380	Bacteria	1202
714	Ga0268265_10565486	3300028380	Bacteria	1081
715	Ga0268264_10000395	3300028381	Bacteria	62904
716	Ga0268264_10001789	3300028381	Bacteria	19645
717	Ga0268264_10073176	3300028381	Bacteria	2907
718	Ga0268264_10173491	3300028381	Bacteria	1952
719	Ga0307515_10000029	3300028794	Bacteria	365410
720	Ga0307515_10004789	3300028794	Bacteria	27696
721	Ga0307515_10090749	3300028794	Bacteria	3828
722	Ga0307515_10452174	3300028794	Bacteria	900
723	Ga0268256_1000010	3300030500	Bacteria	963034
724	Ga0268256_1006679	3300030500	Bacteria	4246
725	Ga0268256_1011108	3300030500	Bacteria	2877
726	Ga0316183_1167184	3300030742	Bacteria	1093
727	Ga0316181_1012451	3300030744	Bacteria	1527
728	Ga0307513_10000259	3300031456	Bacteria	76155
729	Ga0307513_10006892	3300031456	Bacteria	14788
730	Ga0307513_10612286	3300031456	Bacteria	798
731	Ga0307408_100139087	3300031548	Bacteria	1904
732	Ga0307408_100188754	3300031548	Bacteria	1659
733	Ga0307408_100224344	3300031548	Bacteria	1535
734	Ga0307408_100356614	3300031548	Bacteria	1242
735	Ga0307408_100560723	3300031548	Bacteria	1009
736	Ga0307408_100624612	3300031548	Bacteria	960
737	Ga0307405_10008332	3300031731	Bacteria	5245
738	Ga0307405_10054996	3300031731	Bacteria	2488
739	Ga0307405_10059053	3300031731	Bacteria	2416
740	Ga0307413_10031611	3300031824	Bacteria	2989
741	Ga0307410_10006758	3300031852	Bacteria	6220
742	Ga0307410_10288213	3300031852	Bacteria	1291
743	Ga0307410_10627656	3300031852	Bacteria	899
744	Ga0307410_10738817	3300031852	Bacteria	832
745	Ga0307406_10016724	3300031901	Bacteria	4268
746	Ga0307406_10018389	3300031901	Bacteria	4083
747	Ga0307406_10111758	3300031901	Bacteria	1882
748	Ga0307407_10002381	3300031903	Bacteria	7336
749	Ga0307412_10002473	3300031911	Bacteria	10282
750	Ga0307412_10023437	3300031911	Bacteria	3798
751	Ga0307412_10053096	3300031911	Bacteria	2685
752	Ga0307412_10134912	3300031911	Bacteria	1799
753	Ga0307412_10140704	3300031911	Bacteria	1767
754	Ga0307412_10246717	3300031911	Bacteria	1384
755	Ga0307412_10876026	3300031911	Bacteria	785
756	Ga0315914_1000004	3300031967	Bacteria	288534
757	Ga0307409_100107301	3300031995	Bacteria	2332
758	Ga0307409_100164025	3300031995	Bacteria	1947
759	Ga0307409_101405674	3300031995	Bacteria	724
760	Ga0307416_100083007	3300032002	Bacteria	2717
761	Ga0307416_100102709	3300032002	Bacteria	2493
762	Ga0307416_101127068	3300032002	Bacteria	889
763	Ga0307414_10006754	3300032004	Bacteria	6419
764	Ga0307414_10292130	3300032004	Bacteria	1374
765	Ga0307411_10585835	3300032005	Bacteria	957
766	Ga0307415_100099954	3300032126	Bacteria	2124
767	Ga0307415_100284250	3300032126	Bacteria	1362
768	Ga0307510_10142663	3300033180	Bacteria	2035
769	Ga0315913_1000011	3300033430	Bacteria	140532
770	Ga0315915_1000003	3300033464	Bacteria	407996
771	Ga0373929_0058171	3300035085	Bacteria	899
772	Ga0373932_0104003	3300035112	Bacteria	928
773	Ga0373936_0272166	3300035113	Bacteria	760
774	Ga0373961_0022011	3300035241	Bacteria	1701
775	Ga0373931_0021546	3300035691	Bacteria	3234
776	Ga0373931_0100984	3300035691	Bacteria	1622
777	Ga0373933_0152060	3300035724	Bacteria	1466
778	Ga0373947_0424826	3300035725	Bacteria	898
779	Ga0395899_0000014	3300037312	Bacteria	488813
780	Ga0395899_0000971	3300037312	Bacteria	26509
781	Ga0395899_0060950	3300037312	Bacteria	2779
782	Ga0395899_0121864	3300037312	Bacteria	1867
783	Ga0395899_0130225	3300037312	Bacteria	1797
784	Ga0395899_0326182	3300037312	Bacteria	1033
785	Ga0395899_0533627	3300037312	Bacteria	757
786	Ga0395900_0000007	3300037418	Bacteria	488860
787	Ga0395900_0000036	3300037418	Bacteria	250619
788	Ga0395900_0018509	3300037418	Bacteria	7104
789	Ga0395900_0028651	3300037418	Bacteria	5708
790	Ga0395900_0042991	3300037418	Bacteria	4655
791	Ga0395900_0084674	3300037418	Bacteria	3258
792	Ga0395900_0135408	3300037418	Bacteria	2524
793	Ga0395900_0157240	3300037418	Bacteria	2321
794	Ga0395900_0317510	3300037418	Bacteria	1539
795	Ga0395900_0445879	3300037418	Bacteria	1251
796	Ga0395900_0745373	3300037418	Bacteria	910
797	Ga0395898_0000011	3300037466	Bacteria	488860
798	Ga0395898_0034098	3300037466	Bacteria	5076
799	Ga0395898_0290469	3300037466	Bacteria	1560
800	Ga0395898_0442827	3300037466	Bacteria	1238
801	Ga0395898_0603793	3300037466	Bacteria	1040
802	Ga0395898_0792537	3300037466	Bacteria	888
803	Ga0395905_0000008	3300037471	Bacteria	488860
804	Ga0395905_0000193	3300037471	Bacteria	96667
805	Ga0395905_0001786	3300037471	Bacteria	24960
806	Ga0395905_0012864	3300037471	Bacteria	8044
807	Ga0395905_0022817	3300037471	Bacteria	5916
808	Ga0395905_0026548	3300037471	Bacteria	5460
809	Ga0395905_0049007	3300037471	Bacteria	3958
810	Ga0395905_0112217	3300037471	Bacteria	2560
811	Ga0395905_0171943	3300037471	Bacteria	2035
812	Ga0395905_0176885	3300037471	Bacteria	2003
813	Ga0395905_0332612	3300037471	Bacteria	1409
814	Ga0395905_0364926	3300037471	Bacteria	1337
815	Ga0395905_0472204	3300037471	Bacteria	1153
816	Ga0395905_0483027	3300037471	Bacteria	1138
817	Ga0395905_0740775	3300037471	Bacteria	885
818	Ga0395901_0000020	3300038443	Bacteria	314918
819	Ga0395901_0000036	3300038443	Bacteria	214274
820	Ga0395901_0039656	3300038443	Bacteria	4875
821	Ga0395901_0044421	3300038443	Bacteria	4609
822	Ga0395901_0047397	3300038443	Bacteria	4462
823	Ga0395901_0118490	3300038443	Bacteria	2781
824	Ga0395901_0123607	3300038443	Bacteria	2719
825	Ga0395901_0254740	3300038443	Bacteria	1828
826	Ga0395901_0443470	3300038443	Bacteria	1328
827	Ga0395901_0588547	3300038443	Bacteria	1123
828	Ga0395901_0858477	3300038443	Bacteria	892
829	Ga0436365_1858586	3300039437	Bacteria	166193
830	Ga0436361_0925979	3300039447	Bacteria	6184
831	Ga0436363_0580193	3300039450	Bacteria	2424
832	Ga0436362_1035670	3300039453	Bacteria	125910
833	Ga0439436_0004015	3300041404	Bacteria	4509
834	Ga0439436_0119861	3300041404	Bacteria	736
835	Ga0439466_0010643	3300041411	Bacteria	3419
836	Ga0439465_0010834	3300041413	Bacteria	2860
837	Ga0439465_0047824	3300041413	Bacteria	1395
838	Ga0439465_0054871	3300041413	Bacteria	1311
839	Ga0439465_0104418	3300041413	Bacteria	981
840	Ga0439465_0111060	3300041413	Bacteria	954
841	Ga0451791_1632668	3300041451	Bacteria	866
842	Ga0451802_0635447	3300041460	Bacteria	872
843	Ga0451802_2010556	3300041460	Bacteria	857
844	Ga0451833_1047326	3300041491	Bacteria	1632
845	Ga0451835_0225566	3300041492	Bacteria	2770
846	Ga0451837_0612366	3300041494	Bacteria	2050
847	Ga0451839_0144518	3300041496	Bacteria	4834
848	Ga0451845_0139134	3300041501	Bacteria	2205
849	Ga0451849_0490860	3300041505	Bacteria	1755
850	Ga0451850_44427	3300041506	Bacteria	1028
851	Ga0451851_0942673	3300041507	Bacteria	1173
852	Ga0451843_0920087	3300041509	Bacteria	1045
853	Ga0451853_1426223	3300041512	Bacteria	2374
854	Ga0439445_0020758	3300042004	Bacteria	1647
855	Ga0439445_0040819	3300042004	Bacteria	1232
856	Ga0439432_016049	3300042006	Bacteria	2523
857	Ga0439432_021943	3300042006	Bacteria	2112
858	Ga0439452_049293	3300042010	Bacteria	969
859	Ga0450898_036743	3300042134	Bacteria	916
860	Ga0439434_0012666	3300042435	Bacteria	2497
861	Ga0466965_0289886	3300044683	Bacteria	886
862	Ga0466970_0040589	3300044765	Bacteria	2471
863	Ga0495592_0169386	3300046454	Bacteria	1497
864	Ga0495629_0103741	3300046459	Bacteria	1983
865	Ga0495638_0000546	3300046460	Bacteria	42990
866	Ga0495638_0077751	3300046460	Bacteria	2020
867	Ga0495638_0244486	3300046460	Bacteria	992
868	Ga0495605_0054245	3300046474	Bacteria	1942
869	Ga0495605_0130573	3300046474	Bacteria	1133
870	Ga0495639_0045687	3300046475	Bacteria	1982
871	Ga0495662_0015245	3300046476	Bacteria	3734
872	Ga0495664_0209758	3300046477	Bacteria	1180
873	Ga0495585_0020311	3300046492	Bacteria	3821
874	Ga0495585_0037183	3300046492	Bacteria	2742
875	Ga0495585_0099951	3300046492	Bacteria	1552
876	Ga0495607_0128246	3300046501	Bacteria	1323
877	Ga0495583_0008658	3300046506	Bacteria	6191
878	Ga0495606_0002266	3300046507	Bacteria	22765
879	Ga0495606_0073940	3300046507	Bacteria	2136
880	Ga0495606_0147526	3300046507	Bacteria	1383
881	Ga0495606_0222122	3300046507	Bacteria	1064
882	Ga0495608_0278944	3300046511	Bacteria	1038
883	Ga0495610_0005975	3300046512	Bacteria	8516
884	Ga0495610_0020444	3300046512	Bacteria	3675
885	Ga0495610_0023252	3300046512	Bacteria	3374
886	Ga0495616_0293280	3300046513	Bacteria	688
887	Ga0495618_0100793	3300046514	Bacteria	1849
888	Ga0495620_0019578	3300046515	Bacteria	3325
889	Ga0495620_0046384	3300046515	Bacteria	1876
890	Ga0495631_0001028	3300046518	Bacteria	17326
891	Ga0495631_0156984	3300046518	Bacteria	976
892	Ga0495632_0005041	3300046519	Bacteria	8841
893	Ga0495632_0019634	3300046519	Bacteria	3677
894	Ga0495632_0044432	3300046519	Bacteria	2217
895	Ga0495632_0109648	3300046519	Bacteria	1297
896	Ga0495643_0015915	3300046522	Bacteria	4430
897	Ga0495643_0296305	3300046522	Bacteria	739
898	Ga0495648_0096410	3300046524	Bacteria	1643
899	Ga0495648_0208941	3300046524	Bacteria	971
900	Ga0495663_0002151	3300046525	Bacteria	6009
901	Ga0495663_0167341	3300046525	Bacteria	756
902	Ga0495654_0008624	3300046530	Bacteria	5621
903	Ga0495654_0015378	3300046530	Bacteria	4063
904	Ga0495654_0122724	3300046530	Bacteria	1174
905	Ga0495609_0034048	3300046538	Bacteria	2310
906	Ga0495609_0070785	3300046538	Bacteria	1533
907	Ga0495621_0090838	3300046539	Bacteria	1150
908	Ga0495633_0040533	3300046558	Bacteria	2218
909	Ga0495633_0158958	3300046558	Bacteria	1043
910	Ga0495668_0005443	3300046616	Bacteria	8636
911	Ga0495668_0005580	3300046616	Bacteria	8460
912	Ga0495668_0012118	3300046616	Bacteria	5128
913	Ga0495668_0117107	3300046616	Bacteria	1457
914	Ga0495668_0237065	3300046616	Bacteria	999
915	Ga0495625_0018733	3300046660	Bacteria	5393
916	Ga0495625_0077382	3300046660	Bacteria	2324
917	Ga0495625_0083613	3300046660	Bacteria	2218
918	Ga0495625_0197453	3300046660	Bacteria	1330
919	Ga0495625_0443835	3300046660	Bacteria	803
920	Ga0495625_0476483	3300046660	Bacteria	767
921	Ga0495635_0060576	3300046663	Bacteria	2601
922	Ga0495588_0011538	3300046674	Bacteria	4149
923	Ga0495588_0188301	3300046674	Bacteria	1090
924	Ga0495588_0383667	3300046674	Bacteria	738
925	Ga0495657_0027079	3300046675	Bacteria	4051
926	Ga0495658_0154600	3300046683	Bacteria	1411
927	Ga0495669_0017398	3300046684	Bacteria	3086
928	Ga0495624_0059561	3300046690	Bacteria	2396
929	Ga0495670_0012454	3300046691	Bacteria	4183
930	Ga0495670_0129084	3300046691	Bacteria	1317
931	Ga0495671_0056499	3300046692	Bacteria	1943
932	Ga0495649_0083801	3300046694	Bacteria	1703
933	Ga0495600_0094487	3300046809	Bacteria	1949
934	Ga0495660_0101960	3300046810	Bacteria	1476
935	Ga0495660_0114109	3300046810	Bacteria	1375
936	Ga0495604_0012170	3300047317	Bacteria	6839
937	Ga0495636_0006784	3300047318	Bacteria	4501
938	Ga0495636_0119252	3300047318	Bacteria	1166
939	Ga0495672_0127518	3300047320	Bacteria	1343
940	Ga0495676_0180875	3300047321	Bacteria	1478
941	Ga0495676_0728792	3300047321	Bacteria	641
942	Ga0495687_045699	3300047443	Bacteria	1894
943	Ga0495681_0009047	3300047470	Bacteria	6174
944	Ga0495681_0087484	3300047470	Bacteria	1381
945	Ga0495686_0002692	3300047472	Bacteria	16309
946	Ga0495686_0008891	3300047472	Bacteria	7305
947	Ga0495686_0024874	3300047472	Bacteria	3929
948	Ga0495686_0106470	3300047472	Bacteria	1686
949	Ga0496100_0000539	3300048903	Bacteria	17954
950	Ga0496100_0052620	3300048903	Bacteria	2648
951	Ga0496100_0230937	3300048903	Bacteria	1361
952	Ga0496101_0001051	3300048904	Bacteria	16323
953	Ga0496101_0068013	3300048904	Bacteria	2603
954	Ga0496101_0140812	3300048904	Bacteria	1838
955	Ga0496101_0720618	3300048904	Bacteria	787
956	Ga0496102_0004672	3300048905	Bacteria	11585
957	Ga0496102_0029874	3300048905	Bacteria	4877
958	Ga0496102_0283808	3300048905	Bacteria	1560
959	Ga0496102_0305582	3300048905	Bacteria	1499
960	Ga0496102_0724333	3300048905	Bacteria	917
961	Ga0496102_0871759	3300048905	Bacteria	822
962	Ga0496103_0023449	3300048906	Bacteria	3721
963	Ga0496103_0039938	3300048906	Bacteria	2884
964	Ga0496103_0048969	3300048906	Bacteria	2612
965	Ga0496103_0343755	3300048906	Bacteria	959
966	Ga0496104_0000516	3300048907	Bacteria	33106
967	Ga0496104_0001175	3300048907	Bacteria	22476
968	Ga0496104_0131427	3300048907	Bacteria	2405
969	Ga0496104_0151214	3300048907	Bacteria	2228
970	Ga0496104_0310088	3300048907	Bacteria	1491
971	Ga0496105_0014075	3300048908	Bacteria	6366
972	Ga0496105_0148874	3300048908	Bacteria	1925
973	Ga0496105_0167920	3300048908	Bacteria	1800
974	Ga0496106_0001500	3300048909	Bacteria	17550
975	Ga0496106_0019514	3300048909	Bacteria	5030
976	Ga0496106_0038635	3300048909	Bacteria	3573
977	Ga0496106_0095009	3300048909	Bacteria	2305
978	Ga0496106_0105565	3300048909	Bacteria	2189
979	Ga0496106_0219559	3300048909	Bacteria	1516
980	Ga0496106_0634488	3300048909	Bacteria	854
981	Ga0496107_0000744	3300048910	Bacteria	18671
982	Ga0496107_0005294	3300048910	Bacteria	8814
983	Ga0496107_0027556	3300048910	Bacteria	4034
984	Ga0496107_0147097	3300048910	Bacteria	1742
985	Ga0496108_0003683	3300048911	Bacteria	12292
986	Ga0496108_0017150	3300048911	Bacteria	5922
987	Ga0496108_0027601	3300048911	Bacteria	4691
988	Ga0496108_0092744	3300048911	Bacteria	2568
989	Ga0496109_0025205	3300048912	Bacteria	5297
990	Ga0496109_0170583	3300048912	Bacteria	2041
991	Ga0496109_0246123	3300048912	Bacteria	1683
992	Ga0496109_0274186	3300048912	Bacteria	1589
993	Ga0496109_1342714	3300048912	Bacteria	651
994	Ga0496110_0014915	3300048913	Bacteria	6458
995	Ga0496110_0092811	3300048913	Bacteria	2702
996	Ga0496111_0000536	3300048914	Bacteria	19644
997	Ga0496111_0012450	3300048914	Bacteria	5759
998	Ga0496111_0056730	3300048914	Bacteria	2834
999	Ga0496111_0221687	3300048914	Bacteria	1405
1000	Ga0496111_0327211	3300048914	Bacteria	1135
1001	Ga0496112_0001133	3300048915	Bacteria	19825
1002	Ga0496112_0009912	3300048915	Bacteria	8616
1003	Ga0496112_0115472	3300048915	Bacteria	2655
1004	Ga0496112_0222777	3300048915	Bacteria	1842
1005	Ga0496112_0444048	3300048915	Bacteria	1235
1006	Ga0496113_0012994	3300048916	Bacteria	5618
1007	Ga0496113_0034741	3300048916	Bacteria	3681
1008	Ga0496113_0043669	3300048916	Bacteria	3318
1009	Ga0496113_0591913	3300048916	Bacteria	888
1010	Ga0496114_0046637	3300048917	Bacteria	3602
1011	Ga0496114_0079087	3300048917	Bacteria	2775
1012	Ga0496114_0375323	3300048917	Bacteria	1259
1013	Ga0496114_0789337	3300048917	Bacteria	828
1014	Ga0496116_0003263	3300048919	Bacteria	16162
1015	Ga0496116_0008065	3300048919	Bacteria	9210
1016	Ga0496116_0010337	3300048919	Bacteria	7837
1017	Ga0496116_0010585	3300048919	Bacteria	7714
1018	Ga0496116_0017190	3300048919	Bacteria	5626
1019	Ga0496116_0032150	3300048919	Bacteria	3744
1020	Ga0496116_0049407	3300048919	Bacteria	2813
1021	Ga0496116_0099238	3300048919	Bacteria	1744
1022	Ga0496116_0158685	3300048919	Bacteria	1244
1023	Ga0496116_0244906	3300048919	Bacteria	897
1024	Ga0496117_0000002	3300048920	Bacteria	2483758
1025	Ga0496117_0005540	3300048920	Bacteria	13216
1026	Ga0496117_0007528	3300048920	Bacteria	10614
1027	Ga0496117_0013881	3300048920	Bacteria	6985
1028	Ga0496117_0019256	3300048920	Bacteria	5613
1029	Ga0496117_0027688	3300048920	Bacteria	4408
1030	Ga0496117_0029148	3300048920	Bacteria	4260
1031	Ga0496117_0067483	3300048920	Bacteria	2420
1032	Ga0496117_0086136	3300048920	Bacteria	2042
1033	Ga0496118_0001144	3300048921	Bacteria	40942
1034	Ga0496118_0001927	3300048921	Bacteria	29427
1035	Ga0496118_0010886	3300048921	Bacteria	8947
1036	Ga0496118_0012872	3300048921	Bacteria	7973
1037	Ga0496118_0015478	3300048921	Bacteria	7059
1038	Ga0496118_0026093	3300048921	Bacteria	4988
1039	Ga0496118_0031868	3300048921	Bacteria	4359
1040	Ga0496118_0037645	3300048921	Bacteria	3890
1041	Ga0496118_0096433	3300048921	Bacteria	2015
1042	Ga0496118_0144614	3300048921	Bacteria	1500
1043	Ga0496118_0263923	3300048921	Bacteria	969
1044	Ga0496118_0263933	3300048921	Bacteria	969
1045	Ga0496119_0030183	3300048922	Bacteria	3660
1046	Ga0496119_0039982	3300048922	Bacteria	3006
1047	Ga0496119_0061336	3300048922	Bacteria	2246
1048	Ga0496119_0074717	3300048922	Bacteria	1972
1049	Ga0496119_0127794	3300048922	Bacteria	1388
1050	Ga0496119_0210866	3300048922	Bacteria	999
1051	Ga0496119_0287327	3300048922	Bacteria	815
1052	Ga0496120_0000897	3300048923	Bacteria	41807
1053	Ga0496120_0004732	3300048923	Bacteria	11183
1054	Ga0496120_0006409	3300048923	Bacteria	9043
1055	Ga0496120_0033065	3300048923	Bacteria	3111
1056	Ga0496120_0051950	3300048923	Bacteria	2337
1057	Ga0496120_0053389	3300048923	Bacteria	2296
1058	Ga0496121_0000001	3300048924	Bacteria	1830318
1059	Ga0496121_0014826	3300048924	Bacteria	8230
1060	Ga0496121_0015513	3300048924	Bacteria	7974
1061	Ga0496121_0037849	3300048924	Bacteria	4279
1062	Ga0496121_0048170	3300048924	Bacteria	3628
1063	Ga0496121_0061121	3300048924	Bacteria	3093
1064	Ga0496121_0068259	3300048924	Bacteria	2876
1065	Ga0496121_0100418	3300048924	Bacteria	2234
1066	Ga0496121_0109219	3300048924	Bacteria	2114
1067	Ga0496121_0241237	3300048924	Bacteria	1259
1068	Ga0496121_0338160	3300048924	Bacteria	1007
1069	Ga0496122_0000001	3300048925	Bacteria	1827766
1070	Ga0496122_0000147	3300048925	Bacteria	165589
1071	Ga0496122_0014175	3300048925	Bacteria	7729
1072	Ga0496122_0017929	3300048925	Bacteria	6573
1073	Ga0496122_0032102	3300048925	Bacteria	4349
1074	Ga0496122_0048435	3300048925	Bacteria	3267
1075	Ga0496122_0073416	3300048925	Bacteria	2425
1076	Ga0496122_0075366	3300048925	Bacteria	2380
1077	Ga0496123_0000001	3300048926	Bacteria	1831497
1078	Ga0496123_0000339	3300048926	Bacteria	88118
1079	Ga0496123_0009975	3300048926	Bacteria	8465
1080	Ga0496123_0026193	3300048926	Bacteria	4376
1081	Ga0496123_0030893	3300048926	Bacteria	3912
1082	Ga0496123_0093601	3300048926	Bacteria	1774
1083	Ga0496123_0167018	3300048926	Bacteria	1165
1084	Ga0496124_0000855	3300048927	Bacteria	49698
1085	Ga0496124_0005152	3300048927	Bacteria	14874
1086	Ga0496124_0009075	3300048927	Bacteria	10287
1087	Ga0496124_0013491	3300048927	Bacteria	7973
1088	Ga0496124_0013971	3300048927	Bacteria	7796
1089	Ga0496124_0035734	3300048927	Bacteria	4345
1090	Ga0496124_0044318	3300048927	Bacteria	3817
1091	Ga0496124_0049119	3300048927	Bacteria	3601
1092	Ga0496124_0065713	3300048927	Bacteria	3023
1093	Ga0496124_0107705	3300048927	Bacteria	2248
1094	Ga0496124_0130299	3300048927	Bacteria	1999
1095	Ga0496124_0165087	3300048927	Bacteria	1722
1096	Ga0496125_0000001	3300048928	Bacteria	1766138
1097	Ga0496125_0000299	3300048928	Bacteria	97532
1098	Ga0496125_0011662	3300048928	Bacteria	8771
1099	Ga0496125_0043778	3300048928	Bacteria	3794
1100	Ga0496125_0127984	3300048928	Bacteria	1795
1101	Ga0496125_0168506	3300048928	Bacteria	1476
1102	Ga0496125_0251824	3300048928	Bacteria	1113
1103	Ga0496126_0007868	3300048929	Bacteria	11604
1104	Ga0496126_0008341	3300048929	Bacteria	11182
1105	Ga0496126_0008758	3300048929	Bacteria	10861
1106	Ga0496126_0017034	3300048929	Bacteria	7251
1107	Ga0496126_0167311	3300048929	Bacteria	1875
1108	Ga0496126_0222780	3300048929	Bacteria	1583
1109	Ga0496126_0245018	3300048929	Bacteria	1495
1110	Ga0496126_0247081	3300048929	Bacteria	1488
1111	Ga0496126_0390062	3300048929	Bacteria	1131
1112	Ga0496126_0494138	3300048929	Bacteria	979
1113	Ga0496126_0895315	3300048929	Bacteria	673
1114	Ga0495678_005547	3300049459	Bacteria	6932
1115	Ga0495678_017432	3300049459	Bacteria	3256
1116	Ga0495682_0049575	3300049460	Bacteria	1530
1117	Ga0501031_0000076	3300049568	Bacteria	51870
1118	Ga0501031_0146384	3300049568	Bacteria	1543
1119	Ga0501032_0000004	3300049569	Bacteria	310855
1120	Ga0501032_0001730	3300049569	Bacteria	17269
1121	Ga0501032_0349534	3300049569	Bacteria	953
1122	Ga0501033_0000156	3300049570	Bacteria	65847
1123	Ga0501033_0004642	3300049570	Bacteria	10996
1124	Ga0501033_0016132	3300049570	Bacteria	5656
1125	Ga0501033_0064673	3300049570	Bacteria	2691
1126	Ga0501034_0000011	3300049571	Bacteria	310855
1127	Ga0501034_0012488	3300049571	Bacteria	8772
1128	Ga0501034_0049747	3300049571	Bacteria	4229
1129	Ga0501034_1101560	3300049571	Bacteria	675
1130	Ga0501036_0000001	3300049572	Bacteria	310855
1131	Ga0501036_0163307	3300049572	Bacteria	1877
1132	Ga0501036_0325085	3300049572	Bacteria	1285
1133	Ga0501036_0481590	3300049572	Bacteria	1033
1134	Ga0501037_0000064	3300049573	Bacteria	97087
1135	Ga0501037_0026452	3300049573	Bacteria	4289
1136	Ga0501037_0423780	3300049573	Bacteria	910
1137	Ga0501037_0561145	3300049573	Bacteria	770
1138	Ga0501038_0000003	3300049574	Bacteria	310855
1139	Ga0501038_0010727	3300049574	Bacteria	8376
1140	Ga0501038_0011121	3300049574	Bacteria	8218
1141	Ga0501038_0532178	3300049574	Bacteria	896
1142	Ga0501038_0703206	3300049574	Bacteria	757
1143	Ga0501039_0000004	3300049575	Bacteria	310855
1144	Ga0501039_0087466	3300049575	Bacteria	2427
1145	Ga0501039_0300938	3300049575	Bacteria	1261
1146	Ga0501039_0376594	3300049575	Bacteria	1115
1147	Ga0501040_0040897	3300049576	Bacteria	3156
1148	Ga0501040_0126891	3300049576	Bacteria	1793
1149	Ga0501040_0173746	3300049576	Bacteria	1526
1150	Ga0501040_0665786	3300049576	Bacteria	752
1151	Ga0501041_0259838	3300049577	Bacteria	1092
1152	Ga0501041_0281211	3300049577	Bacteria	1047
1153	Ga0501041_0644761	3300049577	Bacteria	677
1154	Ga0501042_0385045	3300049578	Bacteria	1015
1155	Ga0501043_0000417	3300049579	Bacteria	38233
1156	Ga0501043_0043205	3300049579	Bacteria	3542
1157	Ga0501043_0107312	3300049579	Bacteria	2193
1158	Ga0501043_0406448	3300049579	Bacteria	1028
1159	Ga0501046_0008545	3300049580	Bacteria	8907
1160	Ga0501046_0037795	3300049580	Bacteria	3878
1161	Ga0501047_0002889	3300049581	Bacteria	16294
1162	Ga0501047_0007276	3300049581	Bacteria	10405
1163	Ga0501047_0599042	3300049581	Bacteria	924
1164	Ga0501048_0006355	3300049582	Bacteria	8982
1165	Ga0501067_0052908	3300049583	Bacteria	2250
1166	Ga0501067_0063546	3300049583	Bacteria	2044
1167	Ga0501067_0066419	3300049583	Bacteria	1996
1168	Ga0501067_0139844	3300049583	Bacteria	1348
1169	Ga0501067_0523979	3300049583	Bacteria	663
1170	Ga0501068_0010696	3300049584	Bacteria	5159
1171	Ga0501070_0009102	3300049586	Bacteria	8397
1172	Ga0501070_0017361	3300049586	Bacteria	6041
1173	Ga0501070_0110086	3300049586	Bacteria	2276
1174	Ga0501070_0269089	3300049586	Bacteria	1392
1175	Ga0501070_0324490	3300049586	Bacteria	1252
1176	Ga0501071_0025630	3300049587	Bacteria	4133
1177	Ga0501071_0332522	3300049587	Bacteria	1155
1178	Ga0501072_0216553	3300049588	Bacteria	1526
1179	Ga0501072_0955943	3300049588	Bacteria	668
1180	Ga0501073_0019818	3300049589	Bacteria	4853
1181	Ga0501073_0203768	3300049589	Bacteria	1368
1182	Ga0501073_0233733	3300049589	Bacteria	1270
1183	Ga0501073_0238232	3300049589	Bacteria	1257
1184	Ga0501073_0539823	3300049589	Bacteria	806
1185	Ga0501074_0112138	3300049590	Bacteria	1951
1186	Ga0501074_0232249	3300049590	Bacteria	1313
1187	Ga0501074_0355804	3300049590	Bacteria	1039
1188	Ga0501075_0005939	3300049591	Bacteria	8355
1189	Ga0501075_0035153	3300049591	Bacteria	3736
1190	Ga0501075_0202729	3300049591	Bacteria	1513
1191	Ga0501076_0015278	3300049592	Bacteria	5800
1192	Ga0501076_0141292	3300049592	Bacteria	1956
1193	Ga0501077_0192544	3300049593	Bacteria	1295
1194	Ga0501249_000464	3300049679	Bacteria	10123
1195	Ga0501249_028485	3300049679	Bacteria	1239
1196	Ga0501225_0035028	3300049705	Bacteria	1382
1197	Ga0501079_0062339	3300049741	Bacteria	2876
1198	Ga0501079_0270581	3300049741	Bacteria	1328
1199	Ga0501079_0661250	3300049741	Bacteria	822
1200	Ga0501079_0775233	3300049741	Bacteria	755
1201	Ga0501080_0019003	3300049742	Bacteria	6364
1202	Ga0501080_0062699	3300049742	Bacteria	3460
1203	Ga0501081_0051720	3300049743	Bacteria	2833
1204	Ga0501081_0068873	3300049743	Bacteria	2464
1205	Ga0501081_0113044	3300049743	Bacteria	1928
1206	Ga0501081_0218675	3300049743	Bacteria	1385
1207	Ga0501081_0227659	3300049743	Bacteria	1357
1208	Ga0501081_0642817	3300049743	Bacteria	795
1209	Ga0501083_0034469	3300049744	Bacteria	3461
1210	Ga0501083_0051249	3300049744	Bacteria	2776
1211	Ga0501268_002627	3300049765	Bacteria	2381
1212	Ga0501273_000192	3300049770	Bacteria	4397
1213	Ga0501035_0000009	3300049822	Bacteria	310827
1214	Ga0501035_0000529	3300049822	Bacteria	42811
1215	Ga0501035_0071606	3300049822	Bacteria	3069
1216	Ga0501035_0074295	3300049822	Bacteria	3007
1217	Ga0501044_0000005	3300049823	Bacteria	310855
1218	Ga0501044_0003713	3300049823	Bacteria	17150
1219	Ga0501044_0055686	3300049823	Bacteria	4061
1220	Ga0501045_0005304	3300049824	Bacteria	8932
1221	Ga0501045_0114330	3300049824	Bacteria	2002
1222	Ga0501045_0208144	3300049824	Bacteria	1457
1223	Ga0501045_0682439	3300049824	Bacteria	758
1224	Ga0501204_020093	3300049850	Bacteria	866
1225	nmdc:mga03683_291862_c1	3300050489	Bacteria	763
1226	nmdc:mga03683_32311_c1	3300050489	Bacteria	2105
1227	nmdc:mga03n38_233173_c1	3300050490	Bacteria	966
1228	nmdc:mga03n38_303_c1	3300050490	Bacteria	11863
1229	nmdc:mga03n38_5304_c1	3300050490	Bacteria	4376
1230	nmdc:mga03n38_70047_c1	3300050490	Bacteria	1621
1231	nmdc:mga00v17_102_c1	3300050491	Bacteria	50732
1232	nmdc:mga00v17_1909_c1	3300050491	Bacteria	10778
1233	nmdc:mga00v17_58439_c1	3300050491	Bacteria	2363
1234	nmdc:mga00v17_86644_c1	3300050491	Bacteria	1963
1235	nmdc:mga00v17_88117_c1	3300050491	Bacteria	1946
1236	nmdc:mga0yw44_183_c1	3300050492	Bacteria	22031
1237	nmdc:mga0yw44_5626_c1	3300050492	Bacteria	5959
1238	nmdc:mga0yw44_7212_c1	3300050492	Bacteria	5448
1239	nmdc:mga0k408_13416_c1	3300050493	Bacteria	4493
1240	nmdc:mga0k408_14555_c1	3300050493	Bacteria	4338
1241	nmdc:mga06z11_1093_c1	3300050494	Bacteria	9890
1242	nmdc:mga06z11_1406_c1	3300050494	Bacteria	8943
1243	nmdc:mga06z11_3460_c1	3300050494	Bacteria	6111
1244	nmdc:mga06z11_39349_c1	3300050494	Bacteria	2353
1245	nmdc:mga04h51_117533_c1	3300050495	Bacteria	987
1246	nmdc:mga04h51_178406_c1	3300050495	Bacteria	826
1247	nmdc:mga04h51_18788_c1	3300050495	Bacteria	2041
1248	nmdc:mga07m45_224961_c1	3300050496	Bacteria	1092
1249	nmdc:mga07m45_70146_c1	3300050496	Bacteria	1993
1250	nmdc:mga05p37_133337_c1	3300050507	Bacteria	3047
1251	nmdc:mga05p37_194265_c1	3300050507	Bacteria	2462
1252	nmdc:mga05p37_538973_c1	3300050507	Bacteria	1331
1253	nmdc:mga09592_15193_c2	3300050508	Bacteria	5136
1254	nmdc:mga09592_199910_c1	3300050508	Bacteria	1731
1255	nmdc:mga0qj67_13558_c1	3300050509	Bacteria	6149
1256	nmdc:mga0qj67_226329_c1	3300050509	Bacteria	1518
1257	nmdc:mga0qj67_24345_c1	3300050509	Bacteria	4666
1258	nmdc:mga06r32_121796_c1	3300050510	Bacteria	2574
1259	nmdc:mga06r32_48108_c1	3300050510	Bacteria	4076
1260	nmdc:mga06r32_49318_c1	3300050510	Bacteria	4026
1261	nmdc:mga06r32_6618_c1	3300050510	Bacteria	10413
1262	nmdc:mga06r32_67386_c1	3300050510	Bacteria	3455
1263	nmdc:mga08y16_113950_c1	3300050511	Bacteria	2815
1264	nmdc:mga08y16_99164_c1	3300050511	Bacteria	3033
1265	nmdc:mga0n895_136398_c1	3300050512	Bacteria	2480
1266	nmdc:mga0n895_85511_c1	3300050512	Bacteria	3149
1267	nmdc:mga0rr50_65904_c1	3300050513	Bacteria	2745
1268	nmdc:mga0rr50_712999_c1	3300050513	Bacteria	856
1269	nmdc:mga0a205_395282_c1	3300050515	Bacteria	1246
1270	nmdc:mga0a205_57133_c1	3300050515	Bacteria	3768
1271	nmdc:mga0sz30_126005_c2	3300050516	Bacteria	670
1272	nmdc:mga0sz30_186200_c1	3300050516	Bacteria	922
1273	nmdc:mga0sz30_21092_c1	3300050516	Bacteria	2633
1274	nmdc:mga0sz30_2245_c1	3300050516	Bacteria	6913
1275	nmdc:mga0sz30_8262_c1	3300050516	Bacteria	3569
1276	Ga0500610_0172121	3300053079	Bacteria	1068
1277	Ga0495619_0209830	3300053085	Bacteria	1349
1278	Ga0500578_0023226	3300053086	Bacteria	3982
1279	Ga0500578_0315407	3300053086	Bacteria	923
1280	Ga0500643_000115	3300053087	Bacteria	84126
1281	Ga0500643_000326	3300053087	Bacteria	38307
1282	Ga0500643_011498	3300053087	Bacteria	3227
1283	Ga0500651_0267223	3300053093	Bacteria	990
1284	Ga0500650_0106819	3300053098	Bacteria	1308
1285	Ga0500569_001711	3300053109	Bacteria	4192
1286	Ga0500569_069772	3300053109	Bacteria	1103
1287	Ga0500592_000322	3300053116	Bacteria	8191
1288	Ga0500594_0008368	3300053118	Bacteria	2357
1289	Ga0500595_120985	3300053119	Bacteria	740
1290	Ga0500608_048497	3300053122	Bacteria	2040
1291	Ga0500618_001168	3300053125	Bacteria	12688
1292	Ga0500621_073642	3300053126	Bacteria	1375
1293	Ga0500658_0001271	3300053134	Bacteria	10232
1294	Ga0500658_0026298	3300053134	Bacteria	2241
1295	Ga0500561_0000341	3300053137	Bacteria	7800
1296	Ga0500568_0000611	3300053139	Bacteria	25855
1297	Ga0500568_0004778	3300053139	Bacteria	7171
1298	Ga0500568_0005331	3300053139	Bacteria	6665
1299	Ga0500568_0055059	3300053139	Bacteria	1554
1300	Ga0500588_0084584	3300053146	Bacteria	1068
1301	Ga0500590_010535	3300053148	Bacteria	4671
1302	Ga0500604_0184196	3300053151	Bacteria	716
1303	Ga0500616_0008121	3300053153	Bacteria	6562
1304	Ga0500616_0053271	3300053153	Bacteria	2123
1305	Ga0500616_0066960	3300053153	Bacteria	1842
1306	Ga0500622_0004278	3300053156	Bacteria	9056
1307	Ga0500624_000676	3300053157	Bacteria	8709
1308	Ga0500627_0000211	3300053158	Bacteria	16854
1309	Ga0500627_0065024	3300053158	Bacteria	1609
1310	Ga0500634_0063231	3300053161	Bacteria	1958
1311	Ga0500636_0000094	3300053177	Bacteria	44967
1312	Ga0500636_0004270	3300053177	Bacteria	8096
1313	Ga0500611_000548	3300053727	Bacteria	3803
1314	Ga0501084_0006560	3300054114	Bacteria	9561
1315	Ga0501084_0203461	3300054114	Bacteria	1671
1316	Ga0501084_0259778	3300054114	Bacteria	1466
1317	Ga0501084_0462928	3300054114	Bacteria	1072
1318	Ga0501082_0002773	3300060353	Bacteria	15309
1319	Ga0501082_0086060	3300060353	Bacteria	2711
1320	Ga0501082_0150797	3300060353	Bacteria	2019
1321	Ga0501082_0650619	3300060353	Bacteria	922
1322	Ga0501082_1060610	3300060353	Bacteria	708
1323	Ga0466962_0072730	3300061719	Bacteria	1643
1324	Ga0530510_0233780	3300061734	Bacteria	1367
1325	2503198054	2503198000	Bacteria	6884444
1326	2509111503	2508501122	Bacteria	6292184
1327	2509140279	2508501127	Bacteria	7037543
1328	2509375501	2509276019	Bacteria	6802256
1329	2509389070	2509276021	Bacteria	7634384
1330	2509444656	2509276033	Bacteria	7180565
1331	2510135597	2510065019	Bacteria	6903379
1332	2510308058	2510065057	Bacteria	6649661
1333	2510314400	2510065059	Bacteria	6847884
1334	2510838940	2510461069	Bacteria	5505000
1335	2510897067	2510461076	Bacteria	8618824
1336	2511132141	2510917022	Bacteria	6504556
1337	2511194261	2510917030	Bacteria	7460662
1338	2511389206	2511231027	Bacteria	5013807
1339	2511498834	2511231052	Bacteria	6974333
1340	2512534970	2512047086	Bacteria	6850303
1341	2512934463	2512875016	Bacteria	6529530
1342	2512962809	2512875024	Bacteria	7195110
1343	2512973208	2512875026	Bacteria	6861065
1344	2513570760	2513237084	Bacteria	7231967
1345	2513575027	2513237085	Bacteria	7695351
1346	2513587522	2513237086	Bacteria	7265287
1347	2513603568	2513237089	Bacteria	6553624
1348	2513618993	2513237091	Bacteria	6900273
1349	2513627009	2513237092	Bacteria	8341956
1350	2513633810	2513237093	Bacteria	7545552
1351	2513638540	2513237094	Bacteria	8789602
1352	2513653111	2513237095	Bacteria	8976980
1353	2513713036	2513237103	Bacteria	7647401
1354	2513714856	2513237104	Bacteria	10034502
1355	2513875654	2513237139	Bacteria	8737671
1356	2513882549	2513237140	Bacteria	7076289
1357	2513904533	2513237143	Bacteria	6664116
1358	2513914464	2513237144	Bacteria	7530820
1359	2513924230	2513237146	Bacteria	7166346
1360	2513983273	2513237156	Bacteria	6402557
1361	2513996244	2513237159	Bacteria	6810126
1362	2514005808	2513237160	Bacteria	6650282
1363	2514016322	2513237161	Bacteria	8871253
1364	2514023603	2513237162	Bacteria	7468464
1365	2514037518	2513237164	Bacteria	7563725
1366	2514586128	2513237351	Bacteria	6968952
1367	2515114760	2515075009	Bacteria	7288508
1368	2515607262	2515154107	Bacteria	6795637
1369	2515638072	2515154113	Bacteria	7807172
1370	2515641499	2515154114	Bacteria	7848616
1371	2515659389	2515154116	Bacteria	7552979
1372	2515741254	2515154134	Bacteria	7220242
1373	2516204849	2516143018	Bacteria	6951533
1374	2516895112	2516653046	Bacteria	6989037
1375	2517038376	2516653077	Bacteria	7555578
1376	2517078655	2516653085	Bacteria	7346596
1377	2517097397	2517093000	Bacteria	7412387
1378	2517105834	2517093001	Bacteria	9002274
1379	2517408851	2517287029	Bacteria	6905599
1380	2517571789	2517487022	Bacteria	7227575
1381	2520381716	2519899620	Bacteria	6499161
1382	2524438629	2524023205	Bacteria	8918781
1383	2524452483	2524023207	Bacteria	6813453
1384	2524462147	2524023209	Bacteria	6679728
1385	2524540384	2524023228	Bacteria	10118060
1386	2528851477	2528768022	Bacteria	10457665
1387	2530648414	2529292951	Bacteria	6916614
1388	2537877237	2537561587	Bacteria	5425293
1389	2551678036	2551306084	Bacteria	8942552
1390	2551685816	2551306085	Bacteria	7347181
1391	2551691144	2551306086	Bacteria	6843938
1392	2551698495	2551306087	Bacteria	7351905
1393	2551708237	2551306089	Bacteria	7162724
1394	2551715806	2551306090	Bacteria	7953713
1395	2551725145	2551306091	Bacteria	7086830
1396	2551731856	2551306092	Bacteria	6992595
1397	2551743225	2551306093	Bacteria	7064773
1398	2554246133	2554235003	Bacteria	5877155
1399	2558866599	2558860100	Bacteria	8458965
1400	2559293356	2558860242	Bacteria	5568029
1401	2585164414	2582581283	Bacteria	6030556
1402	2585223176	2582581298	Bacteria	7315509
1403	2585232339	2582581299	Bacteria	6518058
1404	2585259568	2582581304	Bacteria	5831370
1405	2585264709	2582581306	Bacteria	6450535
1406	2585276369	2582581307	Bacteria	6597605
1407	2585282464	2582581308	Bacteria	7413247
1408	2585328572	2582581315	Bacteria	7318924
1409	2585336126	2582581316	Bacteria	7774528
1410	2585386220	2582581865	Bacteria	6644329
1411	2585394830	2582581866	Bacteria	6859583
1412	2585524030	2585427526	Bacteria	7258840
1413	2585536603	2585427527	Bacteria	7273426
1414	2585542193	2585427528	Bacteria	6842387
1415	2585546228	2585427529	Bacteria	7395659
1416	2585557187	2585427530	Bacteria	7383882
1417	2585564169	2585427531	Bacteria	6992870
1418	2585840611	2585427593	Bacteria	7141551
1419	2585843601	2585427594	Bacteria	6180594
1420	2585897301	2585427608	Bacteria	6544331
1421	2585902970	2585427609	Bacteria	6667127
1422	2587978455	2585428125	Bacteria	6662905
1423	2588520633	2588253730	Bacteria	6881675
1424	2599419816	2599185170	Bacteria	7295545
1425	2599604239	2599185210	Bacteria	5624189
1426	2599718576	2599185236	Bacteria	6875203
1427	2600195250	2599185352	Bacteria	7228948
1428	2601609625	2600255279	Bacteria	5605316
1429	2601746400	2600255308	Bacteria	5611129
1430	2603857931	2602042107	Bacteria	6226103
1431	2616294030	2615840624	Bacteria	6557588
1432	2616311576	2615840626	Bacteria	7921970
1433	2616551708	2615840698	Bacteria	7319877
1434	2617347491	2617270735	Bacteria	9163226
1435	2617377106	2617270741	Bacteria	8201522
1436	2617386449	2617270742	Bacteria	6808054
1437	2643777740	2643221551	Bacteria	3750538
1438	2643796188	2643221555	Bacteria	3749717
1439	2643805757	2643221557	Bacteria	7184309
1440	2643812437	2643221558	Bacteria	5460675
1441	2643839677	2643221564	Bacteria	4193379
1442	2643857473	2643221568	Bacteria	5187270
1443	2643920513	2643221582	Bacteria	5804683
1444	2643985011	2643221595	Bacteria	6565519
1445	2644051647	2643221607	Bacteria	6314006
1446	2644065932	2643221610	Bacteria	7480339
1447	2644103820	2643221618	Bacteria	7717186
1448	2644133593	2643221623	Bacteria	5239945
1449	2644144702	2643221626	Bacteria	8069654
1450	2644154059	2643221627	Bacteria	6761570
1451	2644191121	2643221634	Bacteria	6705461
1452	2644200130	2643221636	Bacteria	6583769
1453	2644207307	2643221637	Bacteria	5345260
1454	2644237831	2643221643	Bacteria	5749658
1455	2644298117	2643221653	Bacteria	4569637
1456	2644306750	2643221655	Bacteria	7722067
1457	2644330942	2643221659	Bacteria	7890716
1458	2644380237	2643221668	Bacteria	7306521
1459	2644417263	2643221675	Bacteria	7473456
1460	2644450659	2643221680	Bacteria	7473610
1461	2644480516	2643221686	Bacteria	6310811
1462	2644495345	2643221688	Bacteria	5260751
1463	2644498771	2643221689	Bacteria	6042950
1464	2644519678	2643221693	Bacteria	5513853
1465	2644541161	2643221698	Bacteria	7756764
1466	2644612361	2643221712	Bacteria	7729434
1467	2644650955	2643221718	Bacteria	5345506
1468	2644656369	2643221719	Bacteria	4568197
1469	2644671444	2643221723	Bacteria	7095460
1470	2644692916	2643221726	Bacteria	7455827
1471	2657682771	2657244999	Bacteria	5946535
1472	2671116341	2667528174	Bacteria	6435400
1473	2688595367	2687453392	Bacteria	6880454
1474	2692320641	2690316117	Bacteria	6800650
1475	2719183263	2718217882	Bacteria	6556348
1476	2719388020	2718217927	Bacteria	6972593
1477	2719667638	2718217997	Bacteria	6740740
1478	2719733980	2718218009	Bacteria	6478651
1479	2720494058	2718218199	Bacteria	6740745
1480	2720615521	2718218232	Bacteria	6720332
1481	2720622304	2718218233	Bacteria	6662049
1482	2720633658	2718218235	Bacteria	6630699
1483	2720777358	2718218269	Bacteria	6906114
1484	2721149375	2718218363	Bacteria	6524337
1485	2721160778	2718218365	Bacteria	6274507
1486	2721166212	2718218366	Bacteria	6425255
1487	2721401653	2718218423	Bacteria	6438183
1488	2722842382	2721755514	Bacteria	6424414
1489	2723028956	2721755556	Bacteria	6745503
1490	2723562572	2721755684	Bacteria	6859907
1491	2723569265	2721755685	Bacteria	6704835
1492	2724040467	2721755809	Bacteria	6438790
1493	2724046736	2721755810	Bacteria	6479005
1494	2724091965	2721755819	Bacteria	6906405
1495	2724106530	2721755822	Bacteria	6726041
1496	2724112337	2721755823	Bacteria	6752556
1497	2725947175	2724679232	Bacteria	7646494
1498	2730109892	2728369352	Bacteria	6745171
1499	2730166498	2728369365	Bacteria	6555560
1500	2730300410	2728369397	Bacteria	6274511
1501	2738800679	2738541293	Bacteria	7065685
1502	2738946807	2738541317	Bacteria	5340176
1503	2739037428	2738541333	Bacteria	7106503
1504	2739308448	2738543024	Bacteria	5603683
1505	2745077654	2744054633	Bacteria	8678936
1506	2753459970	2751185821	Bacteria	6189929
1507	2756674559	2756170246	Bacteria	7451806
1508	2757570145	2757320392	Bacteria	3737298
1509	2758640589	2758568016	Bacteria	5645291
1510	2765464093	2765235802	Bacteria	5618596
1511	2766067235	2765235942	Bacteria	7445910
1512	2770196733	2767802442	Bacteria	5747986
1513	2776272764	2775506902	Bacteria	6208009
1514	2776284708	2775506904	Bacteria	5954060
1515	2776915891	2775507049	Bacteria	6284736
1516	2778179357	2775507266	Bacteria	7392367
1517	2792583433	2791355082	Bacteria	5973319
1518	2792620954	2791355091	Bacteria	6135441
1519	2792625170	2791355092	Bacteria	6248105
1520	2792637585	2791355094	Bacteria	7011481
1521	2792746563	2791355123	Bacteria	8049106
1522	2793282587	2791355253	Bacteria	5171699
1523	2793298388	2791355256	Bacteria	6798008
1524	2793315771	2791355259	Bacteria	7254731
1525	2793323553	2791355260	Bacteria	6598818
1526	2793327499	2791355261	Bacteria	6661293
1527	2793335570	2791355262	Bacteria	6774204
1528	2793340958	2791355263	Bacteria	6872478
1529	2793350356	2791355264	Bacteria	6429314
1530	2793354698	2791355265	Bacteria	6539969
1531	2793358608	2791355266	Bacteria	7116587
1532	2793369061	2791355267	Bacteria	7222458
1533	2802720849	2802428858	Bacteria	6636079
1534	2802724455	2802428859	Bacteria	6667919
1535	2802729880	2802428860	Bacteria	6525526
1536	2802737224	2802428861	Bacteria	6534206
1537	2802746354	2802428862	Bacteria	6633353
1538	2802751843	2802428863	Bacteria	6410669
1539	2804753993	2802429268	Bacteria	6094027
1540	2805919330	2802429603	Bacteria	8777136
1541	2805928980	2802429605	Bacteria	6875453
1542	2805934601	2802429606	Bacteria	6346811
1543	2806047155	2802429633	Bacteria	7341974
1544	2806054846	2802429634	Bacteria	7083200
1545	2806061926	2802429635	Bacteria	7650140
1546	2806069551	2802429636	Bacteria	7597525
1547	2806076078	2802429637	Bacteria	7067217
1548	2808986875	2808606387	Bacteria	5697198
1549	2818243393	2816332527	Bacteria	8933356
1550	2819244291	2818991272	Bacteria	4622173
1551	2819556949	2818991439	Bacteria	6907412
1552	2819613249	2818991448	Bacteria	6772224
1553	2819643718	2818991453	Bacteria	7181617
1554	2821123128	2821123053	Bacteria	7836056
1555	2824608661	2824600985	Bacteria	8488197
1556	2824611997	2824609381	Bacteria	8672835
1557	2824622540	2824617872	Bacteria	8814715
1558	2824633901	2824626560	Bacteria	8813858
1559	2824642344	2824635225	Bacteria	8785348
1560	2824649894	2824644064	Bacteria	8743947
1561	2824660600	2824653114	Bacteria	8493680
1562	2824670277	2824661429	Bacteria	9877870
1563	2824674709	2824671348	Bacteria	8369588
1564	2824684146	2824679649	Bacteria	8248951
1565	2824696139	2824687955	Bacteria	8360029
1566	2824704029	2824696289	Bacteria	8335049
1567	2824711086	2824704595	Bacteria	9667483
1568	2824722362	2824714736	Bacteria	8717648
1569	2824730138	2824723954	Bacteria	8758240
1570	2824738873	2824732956	Bacteria	7810675
1571	2824752537	2824746037	Bacteria	7911610
1572	2824762846	2824753945	Bacteria	9787441
1573	2824770622	2824763712	Bacteria	9792355
1574	2824780171	2824773399	Bacteria	8360218
1575	2837651538	2837651117	Bacteria	3772164
1576	2838020868	2838016132	Bacteria	6577831
1577	2838026775	2838022645	Bacteria	6494267
1578	2838039653	2838035591	Bacteria	7166484
1579	2838044930	2838042994	Bacteria	6046894
1580	2838052990	2838048938	Bacteria	6044578
1581	2838064782	2838061910	Bacteria	6794874
1582	2838070443	2838068647	Bacteria	6208656
1583	2838074862	2838074704	Bacteria	6785777
1584	2838130270	2838122688	Bacteria	8803140
1585	2838663924	2838661181	Bacteria	7385261
1586	2838672607	2838668709	Bacteria	6671819
1587	2838677687	2838675328	Bacteria	4909118
1588	2838685506	2838680041	Bacteria	6545511
1589	2838689914	2838686498	Bacteria	7807632
1590	2838696038	2838694306	Bacteria	6853137
1591	2838705070	2838701080	Bacteria	6669771
1592	2838713437	2838707686	Bacteria	6619912
1593	2838716576	2838714209	Bacteria	5525906
1594	2838719624	2838719591	Bacteria	5523910
1595	2838727327	2838724970	Bacteria	4908691
1596	2838731390	2838729681	Bacteria	7400765
1597	2838739848	2838736955	Bacteria	5760694
1598	2838744331	2838742623	Bacteria	7396178
1599	2840769537	2840764183	Bacteria	6358399
1600	2841735834	2841734538	Bacteria	6784580
1601	2841844028	2841840854	Bacteria	5761912
1602	2841846552	2841846520	Bacteria	5345850
1603	2841852871	2841851746	Bacteria	7532261
1604	2841860916	2841859092	Bacteria	5436171
1605	2841870284	2841864319	Bacteria	6742987
1606	2841944287	2841941048	Bacteria	8688029
1607	2841954536	2841949485	Bacteria	8680857
1608	2841963415	2841957949	Bacteria	8652217
1609	2841969064	2841966195	Bacteria	8673214
1610	2841979838	2841974524	Bacteria	8931498
1611	2841989564	2841983080	Bacteria	8395090
1612	2842044069	2842038055	Bacteria	8002051
1613	2842051942	2842045827	Bacteria	8006841
1614	2842082671	2842077413	Bacteria	6508645
1615	2842112822	2842110456	Bacteria	7656360
1616	2842123770	2842118031	Bacteria	7033875
1617	2842127419	2842124991	Bacteria	5346824
1618	2842132580	2842130223	Bacteria	4909145
1619	2842143749	2842140634	Bacteria	5759631
1620	2842150064	2842146304	Bacteria	5957337
1621	2842152251	2842152218	Bacteria	4908957
1622	2842160198	2842156927	Bacteria	6894975
1623	2842165824	2842163707	Bacteria	6916235
1624	2842172822	2842170452	Bacteria	5525737
1625	2842175870	2842175837	Bacteria	4908771
1626	2842184136	2842180545	Bacteria	6888678
1627	2842189684	2842187318	Bacteria	5524014
1628	2842196441	2842192696	Bacteria	6147454
1629	2842202508	2842198810	Bacteria	6608673
1630	2842208835	2842205361	Bacteria	6340321
1631	2842213998	2842211629	Bacteria	5523832
1632	2842219500	2842217011	Bacteria	7497767
1633	2842224384	2842224351	Bacteria	5524473
1634	2842231718	2842229732	Bacteria	7475766
1635	2842242825	2842237096	Bacteria	6620661
1636	2842245813	2842243621	Bacteria	7421798
1637	2842254750	2842250916	Bacteria	6579627
1638	2842260191	2842257432	Bacteria	7401195
1639	2842267072	2842264693	Bacteria	6472963
1640	2842273602	2842271015	Bacteria	7807131
1641	2842282475	2842278818	Bacteria	6340002
1642	2842289986	2842285085	Bacteria	6011953
1643	2842296898	2842291075	Bacteria	7076806
1644	2842303505	2842298080	Bacteria	6123127
1645	2842308546	2842304105	Bacteria	7023636
1646	2842312144	2842311132	Bacteria	6616990
1647	2842321744	2842317721	Bacteria	6793725
1648	2842344734	2842341865	Bacteria	7003929
1649	2842362776	2842357229	Bacteria	6485165
1650	2842367692	2842363717	Bacteria	6844742
1651	2842376108	2842370503	Bacteria	7038661
1652	2842383318	2842377471	Bacteria	7140707
1653	2842390451	2842384541	Bacteria	7057858
1654	2842397919	2842395702	Bacteria	6780583
1655	2842407595	2842402390	Bacteria	6681310
1656	2842414226	2842409023	Bacteria	6687331
1657	2842420914	2842415677	Bacteria	6596907
1658	2842424057	2842422224	Bacteria	6239196
1659	2842431232	2842428310	Bacteria	6767288
1660	2842437567	2842434925	Bacteria	6502746
1661	2842444382	2842441272	Bacteria	6769273
1662	2842451192	2842447887	Bacteria	6754142
1663	2842465375	2842462802	Bacteria	6588055
1664	2842472156	2842469257	Bacteria	6752936
1665	2842487759	2842482326	Bacteria	7212537
1666	2842494032	2842489311	Bacteria	6620893
1667	2842501321	2842495871	Bacteria	6820686
1668	2842515324	2842509118	Bacteria	6850950
1669	2842517701	2842515876	Bacteria	5436280
1670	2842521201	2842521101	Bacteria	6569494
1671	2842873186	2842871566	Bacteria	4827117
1672	2844004119	2844002411	Bacteria	7168230
1673	2844010089	2844009547	Bacteria	6728125
1674	2844164768	2844163670	Bacteria	7266046
1675	2844316038	2844315083	Bacteria	8138177
1676	2844456662	2844454524	Bacteria	7952546
1677	2847421254	2847417321	Bacteria	6913799
1678	2847672959	2847670302	Bacteria	6165597
1679	2847931525	2847930680	Bacteria	9342022
1680	2847941581	2847939898	Bacteria	8606328
1681	2848996042	2848992105	Bacteria	6810864
1682	2849082504	2849076700	Bacteria	7039503
1683	2850079432	2850079185	Bacteria	6848280
1684	2852387675	2852387548	Bacteria	8025568
1685	2854918156	2854916844	Bacteria	5725939
1686	2855827744	2855825444	Bacteria	6785811
1687	2855843121	2855839649	Bacteria	7135830
1688	2855877750	2855872281	Bacteria	6964271
1689	2856320009	2856314179	Bacteria	6477897
1690	2856332040	2856328259	Bacteria	6528202
1691	2856339333	2856334872	Bacteria	7037011
1692	2856345435	2856342000	Bacteria	7176905
1693	2857374107	2857367948	Bacteria	6965560
1694	2857515805	2857509624	Bacteria	7472071
1695	2857520959	2857516855	Bacteria	7787325
1696	2857527306	2857524615	Bacteria	6615449
1697	2857533919	2857531043	Bacteria	6754041
1698	2858802853	2858800743	Bacteria	6603254
1699	2869169438	2869169390	Bacteria	6659796
1700	2869239803	2869234852	Bacteria	6654993
1701	2869246643	2869242130	Bacteria	6609239
1702	2869252024	2869249662	Bacteria	6868783
1703	2869261201	2869256925	Bacteria	6981691
1704	2869264372	2869264136	Bacteria	6880765
1705	2869271847	2869271264	Bacteria	6908218
1706	2871436151	2871435913	Bacteria	6880295
1707	2871451357	2871444079	Bacteria	6423508
1708	2871459249	2871451962	Bacteria	7336357
1709	2871460099	2871459585	Bacteria	6866887
1710	2871467721	2871466892	Bacteria	6923287
1711	2871478404	2871474448	Bacteria	6806570
1712	2871484477	2871481445	Bacteria	6700002
1713	2871499380	2871495908	Bacteria	6935695
1714	2874115531	2874109183	Bacteria	6517025
1715	2874117338	2874116593	Bacteria	6674494
1716	2874133813	2874131515	Bacteria	6820270
1717	2874162566	2874162495	Bacteria	6174670
1718	2874620260	2874612657	Bacteria	8252029
1719	2874621425	2874620515	Bacteria	8290088
1720	2874634321	2874628541	Bacteria	8630250
1721	2876363275	2876363079	Bacteria	6544991
1722	2876370235	2876369609	Bacteria	6807521
1723	2876387094	2876386047	Bacteria	6698674
1724	2876392922	2876392853	Bacteria	6660880
1725	2876405095	2876399893	Bacteria	6927900
1726	2876409454	2876406927	Bacteria	6191900
1727	2876423633	2876420981	Bacteria	6687741
1728	2876763382	2876761206	Bacteria	10111113
1729	2878035567	2878035449	Bacteria	6555736
1730	2878737524	2878730984	Bacteria	6380721
1731	2878763570	2878760144	Bacteria	6823465
1732	2878770568	2878767105	Bacteria	6898628
1733	2878776149	2878774303	Bacteria	6108671
1734	2878782586	2878781027	Bacteria	6834456
1735	2879091351	2879083081	Bacteria	8587928
1736	2879100196	2879099564	Bacteria	10442239
1737	2881147620	2881147464	Bacteria	7779814
1738	2881164395	2881161766	Bacteria	7127907
1739	2881364924	2881364244	Bacteria	7710352
1740	2881673179	2881665667	Bacteria	8175609
1741	2885306256	2885305155	Bacteria	7348390
1742	2885314695	2885312484	Bacteria	6415165
1743	2885332100	2885326080	Bacteria	7134805
1744	2885336021	2885334103	Bacteria	7216818
1745	2885368171	2885366525	Bacteria	8326213
1746	2885413752	2885409591	Bacteria	9235467
1747	2888352281	2888350351	Bacteria	7372807
1748	2888378826	2888378607	Bacteria	9652610
1749	2888391196	2888388044	Bacteria	7304136
1750	2888427251	2888419890	Bacteria	7857137
1751	2889014271	2889010040	Bacteria	6749192
1752	2889021024	2889016732	Bacteria	6700763
1753	2889792708	2889790730	Bacteria	5689708
1754	2889916215	2889914905	Bacteria	5702301
1755	2891375057	2891373044	Bacteria	5202277
1756	2893071846	2893066018	Bacteria	6158120
1757	2894653006	2894652903	Bacteria	4587256
1758	2896388664	2896384573	Bacteria	7700774
1759	2899794260	2899792073	Bacteria	4926588
1760	2899808350	2899803654	Bacteria	5577784
1761	2899849023	2899845264	Bacteria	5672268
1762	2903454650	2903448605	Bacteria	7357801
1763	2903514629	2903513507	Bacteria	6344008
1764	2903525225	2903521522	Bacteria	6525694
1765	2903532030	2903528002	Bacteria	6586099
1766	2903544185	2903540706	Bacteria	7062119
1767	2903729566	2903727486	Bacteria	8281579
1768	2904579262	2904578770	Bacteria	5302906
1769	2904659628	2904659560	Bacteria	6685615
1770	2904668094	2904666416	Bacteria	8226587
1771	2904719868	2904711408	Bacteria	9771557
1772	2906361005	2906354277	Bacteria	6991324
1773	2906369890	2906363423	Bacteria	6856682
1774	2906374469	2906370794	Bacteria	6881062
1775	2906381295	2906378014	Bacteria	6911440
1776	2906391632	2906386501	Bacteria	5977019
1777	2906400596	2906393657	Bacteria	6790866
1778	2906404645	2906401398	Bacteria	6693206
1779	2906412483	2906408224	Bacteria	6162342
1780	2906420785	2906414383	Bacteria	6580790
1781	2906606071	2906602504	Bacteria	8295279
1782	2906635067	2906626472	Bacteria	8826946
1783	2906645645	2906643746	Bacteria	8722424
1784	2908783018	2908775508	Bacteria	8092255
1785	2913298414	2913295892	Bacteria	6333755
1786	2913311833	2913308742	Bacteria	5350706
1787	2915982705	2915980308	Bacteria	6624279
1788	2915989078	2915986958	Bacteria	6739310
1789	2915999755	2915993759	Bacteria	7016183
1790	2916002265	2916000859	Bacteria	6865702
1791	2916013207	2916007675	Bacteria	6898660
1792	2916019669	2916014648	Bacteria	6946486
1793	2916027360	2916021584	Bacteria	6854472
1794	2916033436	2916028427	Bacteria	6748433
1795	2916037077	2916035215	Bacteria	6755766
1796	2916047714	2916041962	Bacteria	6820487
1797	2916054937	2916048683	Bacteria	6543552
1798	2916056724	2916055098	Bacteria	6758838
1799	2916063909	2916061851	Bacteria	6737736
1800	2916078815	2916076590	Bacteria	6596108
1801	2919078422	2919073203	Bacteria	6531949
1802	2919101947	2919100787	Bacteria	7710546
1803	2919116793	2919114240	Bacteria	5700270
1804	2919121911	2919119836	Bacteria	5208557
1805	2919166547	2919166419	Bacteria	4952238
1806	2919414097	2919408235	Bacteria	6149349
1807	2919454845	2919450847	Bacteria	5631160
1808	2920763893	2920760137	Bacteria	7427611
1809	2920822804	2920822456	Bacteria	6897201
1810	2921207894	2921201388	Bacteria	6926299
1811	2921214794	2921208531	Bacteria	6745326
1812	2921243090	2921237296	Bacteria	6876710
1813	2921244379	2921244191	Bacteria	6568419
1814	2921256320	2921250672	Bacteria	6677771
1815	2921260011	2921257292	Bacteria	6808382
1816	2921265836	2921263974	Bacteria	6864552
1817	2921286373	2921282425	Bacteria	6826397
1818	2921294739	2921289301	Bacteria	7316391
1819	2921299680	2921296804	Bacteria	7176999
1820	2922138563	2922130491	Bacteria	7173936
1821	2922158333	2922151315	Bacteria	6902399
1822	2922165033	2922158528	Bacteria	6573167
1823	2922173402	2922172374	Bacteria	6167644
1824	2922181588	2922178524	Bacteria	6025201
1825	2922188526	2922185730	Bacteria	7113964
1826	2922378534
1827	2922400952	2922393267	Bacteria	8285685
1828	2924145325	2924144063	Bacteria	6883928
1829	2924155193	2924150972	Bacteria	7169444
1830	2924162509	2924158325	Bacteria	7188855
1831	2924172121	2924165586	Bacteria	7260590
1832	2924177662	2924172951	Bacteria	6749356
1833	2924182776	2924179722	Bacteria	6843264
1834	2924187233	2924186466	Bacteria	6876637
1835	2924197301	2924193448	Bacteria	6955718
1836	2924202136	2924200457	Bacteria	6757188
1837	2924211001	2924207177	Bacteria	6917007
1838	2924220721	2924214083	Bacteria	7080103
1839	2924225190	2924221636	Bacteria	7113495
1840	2924230404	2924228884	Bacteria	6633132
1841	2924711835	2924710171	Bacteria	6752351
1842	2924732869	2924726620	Bacteria	6271473
1843	2924734289	2924733363	Bacteria	7574837
1844	2924746989	2924741084	Bacteria	6661321
1845	2924751516	2924748358	Bacteria	6154725
1846	2924756120	2924754689	Bacteria	6774424
1847	2926754804	2926754445	Bacteria	5964435
1848	2926761971	2926760298	Bacteria	5505990
1849	2928522115	2928521798	Bacteria	4960112
1850	2929138903	2929138655	Bacteria	5810547
1851	2929623664	2929615660	Bacteria	9193770
1852	2929632872	2929624759	Bacteria	9339455
1853	2932786151	2932784394	Bacteria	9704911
1854	2932799523	2932794094	Bacteria	7915132
1855	2932805171	2932801729	Bacteria	7987968
1856	2932816888	2932809354	Bacteria	9135765
1857	2932826028	2932818245	Bacteria	9955613
1858	2932829414	2932828146	Bacteria	9745859
1859	2933006897	2933006813	Bacteria	4912075
1860	2933015513	2933011516	Bacteria	5439334
1861	2933022044	2933016740	Bacteria	6355406
1862	2933574995	2933570622	Bacteria	7023390
1863	2933585567	2933577622	Bacteria	9116884
1864	2933588288	2933586486	Bacteria	7667493
1865	2933594097	2933594066	Bacteria	5594265
1866	2933601247	2933599457	Bacteria	5858799
1867	2935617847	2935616580	Bacteria	9032984
1868	2935647820	2935638405	Bacteria	10015038
1869	2935674767	2935665750	Bacteria	9571747
1870	2935678129	2935675223	Bacteria	9928132
1871	2935692417	2935684952	Bacteria	9590419
1872	2935699365	2935694250	Bacteria	9291695
1873	2935707096	2935703347	Bacteria	10242284
1874	2935721035	2935713505	Bacteria	9608509
1875	2935722860	2935722832	Bacteria	9608746
1876	2935739724	2935732158	Bacteria	9706831
1877	2935748762	2935741537	Bacteria	9707219
1878	2935758632	2935750917	Bacteria	9590372
1879	2935764612	2935760218	Bacteria	9817913
1880	2935806662	2935801545	Bacteria	9301974
1881	2935819077	2935810662	Bacteria	9401221
1882	2935837304	2935827899	Bacteria	10038562
1883	2935842009	2935837841	Bacteria	9454360
1884	2935856654	2935855204	Bacteria	9035059
1885	2935872942	2935864058	Bacteria	9784707
1886	2935874381	2935873716	Bacteria	9632195
1887	2935887739	2935883170	Bacteria	7964738
1888	2935900055	2935894831	Bacteria	6620579
1889	2935902251	2935901341	Bacteria	7341747
1890	2935967313	2935959822	Bacteria	7869783
1891	2936001095	2935992306	Bacteria	9802711
1892	2936010749	2936002035	Bacteria	9362176
1893	2936045772	2936037263	Bacteria	9446081
1894	2936369614	2936367885	Bacteria	7324495
1895	2936380354	2936375103	Bacteria	6652732
1896	2936385181	2936381700	Bacteria	7006523
1897	2936998749	2936996657	Bacteria	6298727
1898	2937005799	2937002841	Bacteria	6934057
1899	2937010504	2937009748	Bacteria	6746052
1900	2937017317	2937016420	Bacteria	6782579
1901	2937028263	2937023124	Bacteria	6815156
1902	2937030591	2937029754	Bacteria	6424026
1903	2937039059	2937036028	Bacteria	6846469
1904	2937045680	2937042894	Bacteria	6741576
1905	2937054852	2937049772	Bacteria	6757901
1906	2937062784	2937056579	Bacteria	7107896
1907	2937065987	2937063883	Bacteria	7199456
1908	2937076167	2937071275	Bacteria	6984483
1909	2937083932	2937078374	Bacteria	6610289
1910	2937090809	2937084907	Bacteria	6618516
1911	2937096674	2937091812	Bacteria	6979387
1912	2937104463	2937098957	Bacteria	7249374
1913	2937111654	2937106411	Bacteria	6947143
1914	2937115876	2937113482	Bacteria	6505872
1915	2937122118	2937119839	Bacteria	6597547
1916	2937130810	2937126314	Bacteria	6771275
1917	2937839127	2937836603	Bacteria	6811263
1918	2937849831	2937848649	Bacteria	6983481
1919	2937864138	2937861824	Bacteria	6660327
1920	2937873965	2937868953	Bacteria	6639878
1921	2937983993	2937980651	Bacteria	6517427
1922	2937998029	2937994558	Bacteria	7036190
1923	2940564778	2940556831	Bacteria	9590747
1924	2941504048	2941499720	Bacteria	7599444
1925	2941535899	2941531003	Bacteria	7653939
1926	2941547060	2941538514	Bacteria	9402094
1927	2954014465	2954011201	Bacteria	4762601
1928	2957378025	2957375807	Bacteria	6425588
1929	2957383309	2957382221	Bacteria	6737050
1930	2957390606	2957388812	Bacteria	6778072
1931	2957401515	2957395598	Bacteria	6822399
1932	2957407365	2957402308	Bacteria	6741770
1933	2957409968	2957408893	Bacteria	6558585
1934	2957415685	2957415311	Bacteria	6991633
1935	2957426728	2957422303	Bacteria	7172205
1936	2957435145	2957430029	Bacteria	7022557
1937	2957442467	2957437181	Bacteria	6568994
1938	2957450459	2957443900	Bacteria	6869977
1939	2957451819	2957450854	Bacteria	6765715
1940	2957460733	2957457609	Bacteria	6967680
1941	2957468061	2957464669	Bacteria	6568877
1942	2957475907	2957471148	Bacteria	6797643
1943	2957481828	2957478035	Bacteria	6756658
1944	2957490831	2957484790	Bacteria	6703082
1945	2957492755	2957491536	Bacteria	6695180
1946	2957502948	2957498199	Bacteria	7126688
1947	2957510815	2957505466	Bacteria	7253085
1948	2958076301	2958071322	Bacteria	6815895
1949	2958101457	2958100919	Bacteria	6800575
1950	2958112749	2958108152	Bacteria	6681128
1951	2958129233	2958122699	Bacteria	7280457
1952	2958143451	2958137437	Bacteria	6050276
1953	2958163283	2958158011	Bacteria	6058449
1954	2958168504	2958165035	Bacteria	6906348
1955	2958173742	2958172287	Bacteria	6716688
1956	2960585935	2960584000	Bacteria	6864594
1957	2960593161	2960591022	Bacteria	6622873
1958	2960600911	2960597568	Bacteria	6550735
1959	2960607733	2960603979	Bacteria	6898737
1960	2960616383	2960610863	Bacteria	6691244
1961	2960620135	2960617483	Bacteria	6727748
1962	2960626088	2960624210	Bacteria	6875384
1963	2960635380	2960631154	Bacteria	6732508
1964	2960640395	2960637947	Bacteria	7296468
1965	2960650832	2960645483	Bacteria	7211087
1966	2960656397	2960652885	Bacteria	7083688
1967	2960667262	2960660292	Bacteria	7041660
1968	2960670934	2960667422	Bacteria	6763020
1969	2960677455	2960674078	Bacteria	6609048
1970	2960682665	2960680706	Bacteria	6624464
1971	2960693558	2960687367	Bacteria	6535474
1972	2960700471	2960693952	Bacteria	6749742
1973	2961114953	2961114664	Bacteria	6680456
1974	2961140636	2961136820	Bacteria	6775228
1975	2961166968	2961163497	Bacteria	6901077
1976	2961189633	2961183825	Bacteria	6688536
1977	2963644735	2963644680	Bacteria	6530403
1978	2964614908	2964607997	Bacteria	7101408
1979	2964621200	2964615318	Bacteria	6809089
1980	2964627376	2964621998	Bacteria	6834995
1981	2964631531	2964628898	Bacteria	7083044
1982	2964641353	2964636051	Bacteria	7091832
1983	2964645466	2964643177	Bacteria	6820887
1984	2964651375	2964649959	Bacteria	6675118
1985	2964662944	2964656573	Bacteria	7100150
1986	2964668656	2964663802	Bacteria	7019362
1987	2964673549	2964670856	Bacteria	6851364
1988	2964682268	2964678106	Bacteria	6792020
1989	2964687652	2964685014	Bacteria	6839111
1990	2964695210	2964691889	Bacteria	6802758
1991	2964699979	2964698721	Bacteria	6765331
1992	2964710005	2964705432	Bacteria	7114648
1993	2964716093	2964712639	Bacteria	6695970
1994	2964726020	2964719344	Bacteria	7286602
1995	2965021792	2965018300	Bacteria	6883036
1996	2965028848	2965025482	Bacteria	6532201
1997	2965036956	2965032056	Bacteria	6887443
1998	2965046664	2965040258	Bacteria	6855979
1999	2965053201	2965047637	Bacteria	6623551
2000	2965090693	2965089291	Bacteria	6866420
2001	2965107742	2965102966	Bacteria	6800987
2002	2965118108	2965110997	Bacteria	6693150
2003	2965121451	2965119406	Bacteria	6956431
2004	2967669297	2967664464	Bacteria	6948836
2005	2967676752	2967671571	Bacteria	7021409
2006	2967683483	2967678726	Bacteria	7264382
2007	2967688445	2967686174	Bacteria	6678622
2008	2967694574	2967693043	Bacteria	6804451
2009	2967701620	2967699805	Bacteria	6854538
2010	2967707435	2967706974	Bacteria	7186053
2011	2967716276	2967714385	Bacteria	7000047
2012	2967725878	2967721400	Bacteria	7073753
2013	2967733820	2967728569	Bacteria	6641507
2014	2967740830	2967735183	Bacteria	6827012
2015	2967748152	2967742019	Bacteria	6794534
2016	2967751523	2967748971	Bacteria	6733771
2017	2967756320	2967755722	Bacteria	6814706
2018	2967766373	2967762386	Bacteria	6923502
2019	2967771906	2967769361	Bacteria	6587838
2020	2967776948	2967775926	Bacteria	6738189
2021	2968088989	2968083720	Bacteria	7351627
2022	2968110681	2968110612	Bacteria	6814636
2023	2968146465	2968138860	Bacteria	6605449
2024	2968175374	2968171901	Bacteria	6894245
2025	2970020877	2970019648	Bacteria	7072033
2026	2970031969	2970026789	Bacteria	6785236
2027	2970038054	2970033650	Bacteria	7118744
2028	2970046485	2970040964	Bacteria	6731123
2029	2970052158	2970047711	Bacteria	7088379
2030	2970056002	2970054988	Bacteria	6611507
2031	2970064606	2970061556	Bacteria	7099761
2032	2970073396	2970068827	Bacteria	7123112
2033	2970077154	2970076120	Bacteria	6697332
2034	2970088523	2970082768	Bacteria	6183754
2035	2970094287	2970088815	Bacteria	6933825
2036	2970099298	2970095765	Bacteria	6936963
2037	2970104261	2970102677	Bacteria	6812532
2038	2970112601	2970109326	Bacteria	6863976
2039	2970118888	2970116247	Bacteria	6501857
2040	2970122786	2970122695	Bacteria	6625855
2041	2970130917	2970129317	Bacteria	6806560
2042	2970139361	2970136068	Bacteria	7207982
2043	2970145309	2970143518	Bacteria	6446480
2044	2970153310	2970149975	Bacteria	6779706
2045	2970160462	2970156795	Bacteria	7168044
2046	2970165636	2970164137	Bacteria	6861252
2047	2970172249	2970170962	Bacteria	6876229
2048	2970183879	2970177841	Bacteria	6768001
2049	2970190692	2970184632	Bacteria	7054431
2050	2970194386	2970191845	Bacteria	7032787
2051	2970494151	2970489779	Bacteria	6517260
2052	2970516310	2970510686	Bacteria	7006402
2053	2970525515	2970524798	Bacteria	6840927
2054	2970533720	2970532167	Bacteria	6553173
2055	2970545592	2970540015	Bacteria	6977556
2056	2970553791	2970547951	Bacteria	6931819
2057	2970558412	2970554993	Bacteria	6814252
2058	2970622544	2970619444	Bacteria	6986144
2059	2970632058	2970627176	Bacteria	6680862
2060	2977523350	2977516862	Bacteria	6940108
2061	2977525565	2977523885	Bacteria	6960446
2062	2977530894	2977530762	Bacteria	6951399
2063	2977538786	2977537788	Bacteria	6929320
2064	2977546920	2977544691	Bacteria	6875412
2065	2977556332	2977551784	Bacteria	7125765
2066	2977561867	2977558990	Bacteria	6863948
2067	2977570597	2977565890	Bacteria	6901543
2068	2977576288	2977572785	Bacteria	6763888
2069	2977581050	2977579622	Bacteria	6772100
2070	2977855073	2977851361	Bacteria	6694324
2071	2977879989	2977872689	Bacteria	7270173
2072	2977898654	2977898635	Bacteria	6675551
2073	2977913276	2977907340	Bacteria	6577984
2074	2977916367	2977915119	Bacteria	6829656
2075	2977925375	2977922695	Bacteria	6956781
2076	2977938280	2977935797	Bacteria	6252826
2077	2977953089	2977950692	Bacteria	6893264
2078	2977959927	2977957713	Bacteria	6877875
2079	2977977368	2977971508	Bacteria	7472917
2080	2977987344	2977986579	Bacteria	6581278
2081	2978972935	2978969890	Bacteria	5400756
2082	2979092761	2979089926	Bacteria	5670289
2083	2979099849	2979095461	Bacteria	5669583
2084	2979104734	2979100975	Bacteria	5423623
2085	2979712334	2979710463	Bacteria	6785254
2086	2979749574	2979742915	Bacteria	7301278
2087	2979768658	2979764755	Bacteria	6610066
2088	2979778654	2979772303	Bacteria	6618277
2089	2979794300	2979793036	Bacteria	6808957
2090	2984513468	2984509177	Bacteria	5274802
2091	2984539460	2984537506	Bacteria	5277481
2092	2984591187	2984587000	Bacteria	5263363
2093	2984601687	2984601300	Bacteria	5455244
2094	2987652010	2987645492	Bacteria	6117018
2095	2987658222	2987652177	Bacteria	6969023
2096	2987662980	2987659509	Bacteria	6966464
2097	2987679516	2987673487	Bacteria	6884027
2098	2989351546	2989349275	Bacteria	6349068
2099	2989774515	2989771324	Bacteria	5605128
2100	2989776943	2989776772	Bacteria	4843317
2101	2996314473	2996310559	Bacteria	6357320
2102	2996336803	2996336353	Bacteria	5511628
2103	2996346136	2996341866	Bacteria	6643098
2104	2996388493	2996386984	Bacteria	6978667
2105	2996897138	2996893221	Bacteria	5823108
2106	3000135935	3000135777	Bacteria	6891109
2107	3002142465	3002141150	Bacteria	5254435
2108	3003931401	3003930520	Bacteria	5667563
2109	3004172543	3004167301	Bacteria	8330599
2110	3004192032	3004188549	Bacteria	6952365
2111	3004198415	3004195979	Bacteria	6776956
2112	3004216694	3004211236	Bacteria	7417683
2113	3004219727	3004218560	Bacteria	7421728
2114	3004233564	3004232784	Bacteria	6662140
2115	3004241125	3004239961	Bacteria	6892290
2116	3004255428	3004248173	Bacteria	6563236
2117	3004273059	3004268573	Bacteria	7043476
2118	3004338061	3004334049	Bacteria	8449246
2119	3005410555	3005409236	Bacteria	7188837
2120	3005419273	3005416602	Bacteria	7064308
2121	3005449984	3005445848	Bacteria	6906074
2122	3005490495	3005483717	Bacteria	7877331
2123	3005509711	3005506211	Bacteria	6943378
2124	3005591198	3005587118	Bacteria	7794411
2125	3005595630	3005594810	Bacteria	8716512
2126	3005711621	3005710791	Bacteria	7622528
2127	3005718871	3005718088	Bacteria	8283608
2128	637077634	637000159	Bacteria	7596297
2129	639645997	639633055	Bacteria	7751309
2130	643827744	643692032	Bacteria	6891900
2131	648738267	648276728	Bacteria	6968865
2132	649869927	649633066	Bacteria	6690028
2133	650738591	650716007	Bacteria	5573770
2134	8001850268	8001845381	Bacteria	5804942
2135	8003572132	8003570095	Bacteria	5747666
2136	8003995706	8003992118	Bacteria	7266902
2137	8004003460	8003999396	Bacteria	7063185
2138	8004307130	8004300914	Bacteria	6132239
2139	8004319617	8004312739	Bacteria	7444653
2140	8004365374	8004361976	Bacteria	6858373
2141	8004401993	8004395343	Bacteria	6620908
2142	8004638726	8004633249	Bacteria	6723080
2143	8004732770	8004727605	Bacteria	6643904
2144	8005248030	8005246636	Bacteria	4933972
2145	8005278221	8005275841	Bacteria	6929066
2146	8005282751	8005282627	Bacteria	6675747
2147	8005291717	8005289223	Bacteria	6634003
2148	8005305408	8005301065	Bacteria	6614431
2149	8005310181	8005307578	Bacteria	7395396
2150	8005317571	8005314921	Bacteria	7072929
2151	8005378171	8005376324	Bacteria	6590079
2152	8005384179	8005382845	Bacteria	6732062
2153	8005399543	8005395548	Bacteria	6806915
2154	8005432330	8005430974	Bacteria	6689030
2155	8005465455	8005460587	Bacteria	7157962
2156	8005489289	8005484373	Bacteria	6297373
2157	8005498032	8005497431	Bacteria	6477605
2158	8005559902	8005556819	Bacteria	6908598
2159	8005564602	8005563573	Bacteria	7153261
2160	8005571292	8005570704	Bacteria	6957481
2161	8005619246	8005619151	Bacteria	7030230
2162	8005627807	8005626139	Bacteria	6534237
2163	8005645422	8005645114	Bacteria	6950293
2164	8005661423	8005658619	Bacteria	4500593
2165	8005669439	8005668836	Bacteria	6953162
2166	8005687720	8005682033	Bacteria	6726518
2167	8005692840	8005688590	Bacteria	6610080
2168	8005701547	8005695170	Bacteria	6912330
2169	8006930315	8006926726	Bacteria	6749210
2170	8016518821	8016511872	Bacteria	9921665
2171	8016587089	8016583857	Bacteria	10421953
2172	8017057857	8017057580	Bacteria	10023680
2173	8018132466	8018127388	Bacteria	7351159
2174	8018151094	8018150411	Bacteria	5549903
2175	8018167678	8018163183	Bacteria	7277977
2176	8018176691	8018176218	Bacteria	6896178
2177	8019595971	8019586578	Bacteria	10212056
2178	8019612748	8019608314	Bacteria	10042931
2179	8019653182	8019648815	Bacteria	10014479
2180	8023681343	8023680758	Bacteria	7729763
2181	8024481825	8024479707	Bacteria	6954785
2182	8024489002	8024486573	Bacteria	6540512
2183	8024506263	8024501048	Bacteria	6427847
2184	8046771531	8046767195	Bacteria	7547379
2185	8049296589	8049293176	Bacteria	6128433
2186	8054464024	8054460903	Bacteria	4872905
2187	8054562469	8054558443	Bacteria	5204801
2188	8055433823	8055431914	Bacteria	4551896
2189	8055617364	8055617313	Bacteria	7548464
2190	8055750829	8055742211	Bacteria	9226248
2191	8056381265	8056375014	Bacteria	7006639
2192	8056382753	8056382006	Bacteria	6408074
2193	8056878583	8056875544	Bacteria	4355797
2194	8056970653	8056967851	Bacteria	9038162
2195	8057577882	8057575449	Bacteria	7367519
2196	8057877192	8057874678	Bacteria	7494653
2197	Ga0395901_1021864
2198	JGI24752J21851_1001390
2199	JGI24740J21852_10030451
2200	JGI24739J22299_10006127
2201	JGI24739J22299_10023529
2202	JGI24737J22298_10002277
2203	JGI24737J22298_10006099
2204	JGI24737J22298_10045694
2205	JGI24743J22301_10023704
2206	JGI24735J21928_10007014
2207	JGI24735J21928_10060394
2208	JGI24735J21928_10071112
2209	JGI24748J21848_1000044
2210	JGI24738J21930_10004739
2211	JGI24034J26672_10000020
2212	JGI24742J22300_10000620
2213	JGI25155J39150_1000069
2214	JGI25156J39149_1000095
2215	JGI25162J39368_1002190
2216	JGI25154J39366_1000560
2217	JGI25158J39367_1000029
2218	JGI25157J39369_1000216
2219	JGI25152J39213_1003369
2220	JGI25152J39213_1003399
2221	JGI25152J39213_1004307
2222	JGI25152J39213_1006750
2223	JGI25152J39213_1009332
2224	JGI25150J39212_1000232
2225	JGI25150J39212_1022674
2226	JGI25159J45721_1000192
2227	JGI25159J45721_1000479
2228	JGI25159J45721_1000621
2229	JGI25151J46595_10000439
2230	JGI25151J46595_10001371
2231	JGI25151J46595_10003061
2232	JGI25165J46597_1001961
2233	JGI25165J46597_1001999
2234	JGI25165J46597_1008125
2235	JGI25153J46596_10007562
2236	JGI25153J46596_10011190
2237	JGI25153J46596_10013163
2238	JGI25153J46596_10015668
2239	JGI25153J46596_10018074
2240	JGI25160J50197_1000003
2241	JGI25160J50197_1000287
2242	JGI25160J50197_1001532
2243	JGI25160J50197_1011524
2244	JGI25161J50226_1000176
2245	JGI25161J50226_1000523
2246	JGI25161J50226_1002174
2247	JGI25161J50226_1004992
2248	Ga0006562J51391_1115539
2249	Ga0055526_1003881
2250	Ga0055526_1003970
2251	Ga0055526_1005084
2252	Ga0055526_1005149
2253	Ga0055526_1005215
2254	Ga0055526_1019122
2255	Ga0055537_1001041
2256	Ga0055524_1001632
2257	Ga0055524_1010414
2258	Ga0055524_1012005
2259	Ga0055524_1020751
2260	Ga0055524_1034537
2261	Ga0055536_1008181
2262	Ga0055536_1008884
2263	Ga0055536_1010749
2264	Ga0055528_1003156
2265	Ga0055528_1003713
2266	Ga0055528_1005850
2267	Ga0055528_1007342
2268	Ga0055528_1013747
2269	Ga0055540_1003870
2270	Ga0055540_1016096
2271	Ga0055531_10040672
2272	Ga0058692_1002554
2273	Ga0058692_1006913
2274	Ga0055543_1000069
2275	Ga0055543_1000114
2276	Ga0055543_1000187
2277	Ga0055543_1000247
2278	Ga0065165_1000047
2279	Ga0065165_1000511
2280	Ga0065165_1015496
2281	Ga0065165_1038045
2282	Ga0065165_1062844
2283	Ga0065707_10081865
2284	Ga0070658_10000409
2285	Ga0070658_10013265
2286	Ga0070658_10026510
2287	Ga0070658_10287900
2288	Ga0070683_100000644
2289	Ga0070690_100049725
2290	Ga0070670_100006682
2291	Ga0070670_100016813
2292	Ga0070670_100067225
2293	Ga0070670_101319407
2294	Ga0070677_10088305
2295	Ga0068869_100021828
2296	Ga0068869_100138345
2297	Ga0070666_10001050
2298	Ga0070666_10002373
2299	Ga0070666_10642496
2300	Ga0070680_100004572
2301	Ga0070680_100009894
2302	Ga0070660_100000055
2303	Ga0070660_100016630
2304	Ga0070660_100034146
2305	Ga0070660_100136974
2306	Ga0070691_10209227
2307	Ga0070691_10546220
2308	Ga0070661_100000340
2309	Ga0070661_100013551
2310	Ga0070661_100152831
2311	Ga0070661_100305165
2312	Ga0070692_10001570
2313	Ga0070692_10013728
2314	Ga0070668_100125420
2315	Ga0070668_100603126
2316	Ga0070669_100017639
2317	Ga0070669_100080824
2318	Ga0070669_100081351
2319	Ga0070669_100112579
2320	Ga0070669_100223456
2321	Ga0070675_100442176
2322	Ga0070671_100031788
2323	Ga0070671_100050065
2324	Ga0070671_100112218
2325	Ga0070671_100170118
2326	Ga0070674_100065353
2327	Ga0070674_100633863
2328	Ga0070673_100015703
2329	Ga0070673_100071965
2330	Ga0070673_100171550
2331	Ga0070673_100603259
2332	Ga0070659_100000139
2333	Ga0070659_100011162
2334	Ga0070659_100012287
2335	Ga0070659_100503646
2336	Ga0070659_100541874
2337	Ga0070667_100005245
2338	Ga0070667_100023846
2339	Ga0070667_100157513
2340	Ga0070667_100178909
2341	Ga0070667_100320248
2342	Ga0070667_100339932
2343	Ga0070703_10001725
2344	Ga0070701_10015566
2345	Ga0070705_100003836
2346	Ga0070700_100010792
2347	Ga0070694_100000725
2348	Ga0070708_100156154
2349	Ga0070663_100044978
2350	Ga0070663_100260991
2351	Ga0070663_100390871
2352	Ga0070662_100000024
2353	Ga0070662_100001433
2354	Ga0070662_100015527
2355	Ga0070662_100022218
2356	Ga0070662_100022652
2357	Ga0070662_100104788
2358	Ga0070681_10024817
2359	Ga0068867_100012473
2360	Ga0070706_100069679
2361	Ga0070699_100000188
2362	Ga0070679_100060223
2363	Ga0070684_100100316
2364	Ga0070684_100353189
2365	Ga0070697_100476289
2366	Ga0068853_100000342
2367	Ga0068853_100002373
2368	Ga0068853_100013841
2369	Ga0068853_100164151
2370	Ga0068853_100223366
2371	Ga0068853_100237579
2372	Ga0068853_100376264
2373	Ga0070672_100132185
2374	Ga0070686_100168806
2375	Ga0070695_100000657
2376	Ga0070696_100007361
2377	Ga0070696_100386486
2378	Ga0070665_100000937
2379	Ga0070665_100159460
2380	Ga0070665_100245297
2381	Ga0070665_100306322
2382	Ga0070665_100419424
2383	Ga0070665_100423525
2384	Ga0070665_100532976
2385	Ga0070665_100737797
2386	Ga0070704_100001753
2387	Ga0070704_100302493
2388	Ga0068855_100021596
2389	Ga0068855_100190786
2390	Ga0068855_100495888
2391	Ga0068855_100823789
2392	Ga0070664_100000082
2393	Ga0070664_100004455
2394	Ga0070664_100326470
2395	Ga0070664_100985737
2396	Ga0068857_100004407
2397	Ga0068857_100015287
2398	Ga0068857_100131484
2399	Ga0068854_100061948
2400	Ga0068854_100163575
2401	Ga0068854_100408998
2402	Ga0068856_100000085
2403	Ga0068856_100015293
2404	Ga0068856_100082663
2405	Ga0068856_100111687
2406	Ga0068856_100140701
2407	Ga0070702_100122429
2408	Ga0068852_100007528
2409	Ga0068852_100207630
2410	Ga0068859_100000068
2411	Ga0068859_100014603
2412	Ga0068859_100021782
2413	Ga0068859_100043104
2414	Ga0068864_100000339
2415	Ga0068864_100007897
2416	Ga0068864_100029139
2417	Ga0068864_100041811
2418	Ga0068864_100068189
2419	Ga0068861_100365092
2420	Ga0068861_100704500
2421	Ga0068851_10004531
2422	Ga0068851_10017285
2423	Ga0068851_10034334
2424	Ga0068851_10067695
2425	Ga0068851_10505859
2426	Ga0068870_10261182
2427	Ga0068870_10279070
2428	Ga0068863_100000535
2429	Ga0068863_100009175
2430	Ga0068863_100040654
2431	Ga0068863_100067181
2432	Ga0068863_100320759
2433	Ga0068858_100069802
2434	Ga0068860_100015416
2435	Ga0068860_100052325
2436	Ga0068862_100007255
2437	Ga0068862_100008073
2438	Ga0068862_100205887
2439	Ga0068862_100483681
2440	Ga0081455_10000545
2441	Ga0081455_10074535
2442	Ga0081455_10109732
2443	Ga0081539_10070068
2444	Ga0075365_10002469
2445	Ga0075365_10003608
2446	Ga0075365_10032760
2447	Ga0075368_10000791
2448	Ga0075368_10001299
2449	Ga0075368_10005248
2450	Ga0075368_10025919
2451	Ga0075368_10031036
2452	Ga0075368_10048083
2453	Ga0075368_10140048
2454	Ga0075363_100021865
2455	Ga0075363_100024186
2456	Ga0075363_100030337
2457	Ga0075363_100054278
2458	Ga0075363_100056239
2459	Ga0075364_10003077
2460	Ga0075364_10017668
2461	Ga0075364_10139176
2462	Ga0075362_10010129
2463	Ga0075367_10004018
2464	Ga0075367_10007480
2465	Ga0075367_10020318
2466	Ga0075367_10321591
2467	Ga0075369_10056310
2468	Ga0075369_10289131
2469	Ga0075366_10000883
2470	Ga0097621_100010319
2471	Ga0097621_100066229
2472	Ga0075370_10018662
2473	Ga0075370_10034556
2474	Ga0075370_10206516
2475	Ga0075370_10225078
2476	Ga0075370_10283212
2477	Ga0075370_10358183
2478	Ga0068871_100039095
2479	Ga0075428_100917773
2480	Ga0075430_100069684
2481	Ga0075430_100078448
2482	Ga0075430_100619620
2483	Ga0075431_100003896
2484	Ga0075431_100004223
2485	Ga0075431_100042858
2486	Ga0075431_100049916
2487	Ga0075431_100236910
2488	Ga0075431_100269453
2489	Ga0075433_10031492
2490	Ga0075433_11032696
2491	Ga0075434_100081577
2492	Ga0075434_100194051
2493	Ga0075434_100255331
2494	Ga0075434_100335797
2495	Ga0075429_100026019
2496	Ga0068865_100362021
2497	Ga0097620_100000068
2498	Ga0097620_100014604
2499	Ga0097620_100021781
2500	Ga0097620_100043105
2501	Ga0099824_1005597
2502	Ga0079104_1000125
2503	Ga0079104_1000777
2504	Ga0079104_1018873
2505	Ga0099826_10015705
2506	Ga0099826_10020216
2507	Ga0075435_100467799
2508	Ga0105250_10005874
2509	Ga0105250_10098485
2510	Ga0105240_10000310
2511	Ga0105240_10045075
2512	Ga0105240_10216325
2513	Ga0105240_10479266
2514	Ga0105240_10829396
2515	Ga0111539_10020472
2516	Ga0105245_10005749
2517	Ga0105245_10923469
2518	Ga0105247_10019921
2519	Ga0105247_10070905
2520	Ga0114129_10159134
2521	Ga0114129_10221355
2522	Ga0114129_10233827
2523	Ga0114129_10297959
2524	Ga0114129_10805595
2525	Ga0105243_10003568
2526	Ga0105243_10241288
2527	Ga0105243_10674710
2528	Ga0105241_10242644
2529	Ga0105241_10338070
2530	Ga0105241_10449044
2531	Ga0105241_10633525
2532	Ga0105241_10657845
2533	Ga0105241_11203511
2534	Ga0105242_10016587
2535	Ga0105248_10000059
2536	Ga0105248_10000071
2537	Ga0105248_10016891
2538	Ga0105248_10125939
2539	Ga0105248_10442637
2540	Ga0105248_10652117
2541	Ga0105237_10000459
2542	Ga0105237_10002190
2543	Ga0105237_10027740
2544	Ga0105237_10517685
2545	Ga0105238_10002270
2546	Ga0105238_10009673
2547	Ga0105238_10039938
2548	Ga0105238_10396975
2549	Ga0105238_10639347
2550	Ga0105238_11193250
2551	Ga0105249_10000064
2552	Ga0105249_10004443
2553	Ga0105249_10676556
2554	Ga0123341_1000017
2555	Ga0123342_1029556
2556	Ga0105239_10006653
2557	Ga0105239_10012124
2558	Ga0105239_10056820
2559	Ga0105239_10218974
2560	Ga0105239_10338430
2561	Ga0105239_10370956
2562	Ga0105239_10409896
2563	Ga0105239_10504550
2564	Ga0105239_10538971
2565	Ga0105239_10565985
2566	Ga0105239_10801957
2567	Ga0105246_10008225
2568	Ga0105246_10018438
2569	Ga0157322_1000372
2570	Ga0157373_10007416
2571	Ga0157373_10036131
2572	Ga0157373_10038404
2573	Ga0157373_10093807
2574	Ga0157373_10477277
2575	Ga0157371_10000004
2576	Ga0157371_10006091
2577	Ga0157371_10008339
2578	Ga0157371_10037322
2579	Ga0157371_10875522
2580	Ga0157370_10001506
2581	Ga0157370_10010062
2582	Ga0157370_10039889
2583	Ga0157370_10153906
2584	Ga0157369_10034621
2585	Ga0157369_10049778
2586	Ga0157369_10148721
2587	Ga0171463_1001
2588	Ga0157374_10035946
2589	Ga0157378_10023762
2590	Ga0157378_10078681
2591	Ga0163162_10077001
2592	Ga0163162_10244138
2593	Ga0163162_10965851
2594	Ga0157372_10181542
2595	Ga0157372_10973294
2596	Ga0157372_11329973
2597	Ga0157375_10073535
2598	Ga0157375_10705360
2599	Ga0157375_11329578
2600	Ga0163163_10000763
2601	Ga0163163_10000995
2602	Ga0163163_10020373
2603	Ga0163163_10083912
2604	Ga0163163_10493253
2605	Ga0163163_10517943
2606	Ga0163163_10579196
2607	Ga0157380_10000086
2608	Ga0157380_10000723
2609	Ga0157380_10028805
2610	Ga0157380_10591695
2611	Ga0182008_10020916
2612	Ga0182008_10025465
2613	Ga0157379_10002697
2614	Ga0157379_10012611
2615	Ga0157379_10050744
2616	Ga0157379_10062874
2617	Ga0157379_10285667
2618	Ga0157379_11349690
2619	Ga0182007_10001994
2620	Ga0183365_10115
2621	Ga0183363_1187
2622	Ga0214544_1000434
2623	Ga0214542_1000146
2624	Ga0214542_1025313
2625	Ga0214543_1000049
2626	Ga0214543_1000054
2627	Ga0213873_10000008
2628	Ga0213874_10014768
2629	Ga0213876_10000005
2630	Ga0228711_1000006
2631	Ga0228710_1000004
2632	Ga0209435_100049
2633	Ga0209760_103481
2634	Ga0209436_100107
2635	Ga0209436_101564
2636	Ga0209563_104898
2637	Ga0209437_100376
2638	Ga0209437_100981
2639	Ga0207425_1000052
2640	Ga0207425_1007278
2641	Ga0207425_1015373
2642	Ga0207425_1019367
2643	Ga0207425_1025537
2644	Ga0209646_1000159
2645	Ga0209646_1031776
2646	Ga0209026_1000013
2647	Ga0209026_1000183
2648	Ga0209677_100684
2649	Ga0209148_1000032
2650	Ga0209148_1012400
2651	Ga0209759_1000058
2652	Ga0209759_1000206
2653	Ga0209129_1000512
2654	Ga0209129_1000652
2655	Ga0209129_1000779
2656	Ga0209129_1001160
2657	Ga0209129_1002177
2658	Ga0209129_1008991
2659	Ga0209233_1000034
2660	Ga0209233_1000368
2661	Ga0209233_1000423
2662	Ga0209233_1000458
2663	Ga0209233_1005874
2664	Ga0209233_1023863
2665	Ga0209565_1000099
2666	Ga0209455_1000098
2667	Ga0209673_1000024
2668	Ga0209673_1000358
2669	Ga0209673_1000526
2670	Ga0209673_1005762
2671	Ga0209673_1006556
2672	Ga0209673_1011840
2673	Ga0209673_1017558
2674	Ga0209130_1000002
2675	Ga0209130_1000005
2676	Ga0209130_1000377
2677	Ga0209130_1022883
2678	Ga0209676_1000187
2679	Ga0209676_1008136
2680	Ga0209025_1000037
2681	Ga0209025_1000144
2682	Ga0209025_1000274
2683	Ga0209025_1000553
2684	Ga0209025_1001763
2685	Ga0209025_1001809
2686	Ga0209025_1014907
2687	Ga0209025_1017884
2688	Ga0209025_1028305
2689	Ga0209564_1000113
2690	Ga0209564_1001082
2691	Ga0209564_1003178
2692	Ga0209564_1003326
2693	Ga0209564_1003465
2694	Ga0209564_1004032
2695	Ga0209564_1004773
2696	Ga0209758_1000519
2697	Ga0209758_1000744
2698	Ga0209758_1003444
2699	Ga0209758_1003617
2700	Ga0209758_1003869
2701	Ga0209758_1006551
2702	Ga0209758_1010846
2703	Ga0209758_1019765
2704	Ga0209050_1010553
2705	Ga0209050_1012338
2706	Ga0209050_1022296
2707	Ga0209256_1000595
2708	Ga0209256_1000779
2709	Ga0209256_1001173
2710	Ga0209256_1001742
2711	Ga0209256_1003431
2712	Ga0209256_1006686
2713	Ga0207426_1000013
2714	Ga0207426_1000015
2715	Ga0207426_1000142
2716	Ga0207426_1000330
2717	Ga0207426_1016841
2718	Ga0209051_1000170
2719	Ga0209051_1003992
2720	Ga0209051_1041857
2721	Ga0209051_1072126
2722	Ga0209257_1003747
2723	Ga0209257_1004397
2724	Ga0207697_10015942
2725	Ga0207656_10011471
2726	Ga0207656_10064926
2727	Ga0207653_10001613
2728	Ga0207710_10154789
2729	Ga0207688_10270608
2730	Ga0207680_10001402
2731	Ga0207680_10001928
2732	Ga0207647_10007819
2733	Ga0207647_10015676
2734	Ga0207647_10017963
2735	Ga0207647_10036486
2736	Ga0207647_10313909
2737	Ga0207645_10477341
2738	Ga0207705_10000062
2739	Ga0207705_10009913
2740	Ga0207705_10035585
2741	Ga0207654_10000874
2742	Ga0207654_10103025
2743	Ga0207654_10170111
2744	Ga0207707_10049317
2745	Ga0207707_10635272
2746	Ga0207695_10000403
2747	Ga0207695_10078433
2748	Ga0207695_10299401
2749	Ga0207695_10468702
2750	Ga0207671_10000277
2751	Ga0207671_10014940
2752	Ga0207671_10040568
2753	Ga0207660_10008981
2754	Ga0207660_10217892
2755	Ga0207657_10000015
2756	Ga0207657_10002661
2757	Ga0207657_10015543
2758	Ga0207657_10036956
2759	Ga0207657_10174156
2760	Ga0207649_10000264
2761	Ga0207649_10089675
2762	Ga0207649_10291322
2763	Ga0207649_10435508
2764	Ga0207652_10048966
2765	Ga0207652_10874395
2766	Ga0207646_10353556
2767	Ga0207681_10074068
2768	Ga0207681_10086320
2769	Ga0207681_10182161
2770	Ga0207681_10280828
2771	Ga0207694_10000306
2772	Ga0207694_10021174
2773	Ga0207694_10142708
2774	Ga0207694_10215765
2775	Ga0207694_10490150
2776	Ga0207650_10007746
2777	Ga0207650_10014713
2778	Ga0207687_10126221
2779	Ga0207687_10146986
2780	Ga0207644_10000274
2781	Ga0207644_10025358
2782	Ga0207644_10109491
2783	Ga0207644_10114325
2784	Ga0207644_10137528
2785	Ga0207644_10265209
2786	Ga0207690_10000032
2787	Ga0207690_10181782
2788	Ga0207690_10239786
2789	Ga0207690_10403487
2790	Ga0207706_10000032
2791	Ga0207706_10000143
2792	Ga0207706_10013628
2793	Ga0207706_10025353
2794	Ga0207706_10110034
2795	Ga0207686_10167263
2796	Ga0207709_10074535
2797	Ga0207670_10167942
2798	Ga0207669_10004579
2799	Ga0207691_10003446
2800	Ga0207691_10066693
2801	Ga0207691_10280006
2802	Ga0207711_10000046
2803	Ga0207711_10000476
2804	Ga0207711_10194323
2805	Ga0207711_10472544
2806	Ga0207689_10372285
2807	Ga0207661_10007272
2808	Ga0207679_10001577
2809	Ga0207679_10076796
2810	Ga0207679_10265120
2811	Ga0207667_10028393
2812	Ga0207667_10038209
2813	Ga0207667_10326844
2814	Ga0207667_10545678
2815	Ga0207667_10674262
2816	Ga0207651_10013384
2817	Ga0207651_10042757
2818	Ga0207651_10244291
2819	Ga0207712_10000886
2820	Ga0207712_10488670
2821	Ga0207668_10004433
2822	Ga0207668_10071369
2823	Ga0207668_10235057
2824	Ga0207668_10239049
2825	Ga0207668_10590693
2826	Ga0207668_10671616
2827	Ga0207668_11053288
2828	Ga0207640_10103651
2829	Ga0207640_10293073
2830	Ga0207640_10508731
2831	Ga0207658_10004756
2832	Ga0207658_10005211
2833	Ga0207658_10027076
2834	Ga0207658_10029233
2835	Ga0207658_10032979
2836	Ga0207658_10397342
2837	Ga0207677_10153672
2838	Ga0207703_10002986
2839	Ga0207703_10005757
2840	Ga0207703_10063370
2841	Ga0207703_10505838
2842	Ga0207703_10552794
2843	Ga0207639_10000803
2844	Ga0207639_10007131
2845	Ga0207639_10008528
2846	Ga0207639_10039824
2847	Ga0207639_10109867
2848	Ga0207639_10175006
2849	Ga0207639_10209237
2850	Ga0207678_10001844
2851	Ga0207678_10068205
2852	Ga0207678_10070354
2853	Ga0207708_10001520
2854	Ga0207708_10889159
2855	Ga0207702_10000072
2856	Ga0207702_10000122
2857	Ga0207702_10049364
2858	Ga0207702_10069413
2859	Ga0207641_10002509
2860	Ga0207641_10002978
2861	Ga0207641_10032289
2862	Ga0207641_10552997
2863	Ga0207648_10002810
2864	Ga0207648_10110950
2865	Ga0207648_10198516
2866	Ga0207648_10566387
2867	Ga0207676_10021524
2868	Ga0207676_10026852
2869	Ga0207676_10133358
2870	Ga0207676_11107667
2871	Ga0207674_10001996
2872	Ga0207674_10014657
2873	Ga0207674_10019607
2874	Ga0207674_10021817
2875	Ga0207674_10049158
2876	Ga0207674_10064762
2877	Ga0207674_10093240
2878	Ga0207675_100245415
2879	Ga0207675_100440132
2880	Ga0207675_100795184
2881	Ga0207683_10014479
2882	Ga0207683_10277533
2883	Ga0207683_10434647
2884	Ga0207698_10359265
2885	Ga0207698_10635680
2886	Ga0209281_1000102
2887	Ga0209281_1000242
2888	Ga0209281_1001000
2889	Ga0209371_1000009
2890	Ga0209371_1000753
2891	Ga0209371_1010361
2892	Ga0209282_1000013
2893	Ga0209282_1054350
2894	Ga0209813_10000400
2895	Ga0209813_10006650
2896	Ga0209813_10099328
2897	Ga0209813_10256829
2898	Ga0209974_10090688
2899	Ga0207428_10142986
2900	Ga0268266_10015894
2901	Ga0268266_10029225
2902	Ga0268266_10075513
2903	Ga0268266_10196760
2904	Ga0268266_10373791
2905	Ga0268266_10455714
2906	Ga0268265_10001073
2907	Ga0268265_10011654
2908	Ga0268265_10326542
2909	Ga0268265_10450413
2910	Ga0268265_10565486
2911	Ga0268264_10000395
2912	Ga0268264_10001789
2913	Ga0268264_10073176
2914	Ga0268264_10173491
2915	Ga0307515_10000029
2916	Ga0307515_10004789
2917	Ga0307515_10090749
2918	Ga0307515_10452174
2919	Ga0268256_1000010
2920	Ga0268256_1006679
2921	Ga0268256_1011108
2922	Ga0316183_1167184
2923	Ga0316181_1012451
2924	Ga0307513_10000259
2925	Ga0307513_10006892
2926	Ga0307513_10612286
2927	Ga0307408_100139087
2928	Ga0307408_100188754
2929	Ga0307408_100224344
2930	Ga0307408_100356614
2931	Ga0307408_100560723
2932	Ga0307408_100624612
2933	Ga0307405_10008332
2934	Ga0307405_10054996
2935	Ga0307405_10059053
2936	Ga0307413_10031611
2937	Ga0307410_10006758
2938	Ga0307410_10288213
2939	Ga0307410_10627656
2940	Ga0307410_10738817
2941	Ga0307406_10016724
2942	Ga0307406_10018389
2943	Ga0307406_10111758
2944	Ga0307407_10002381
2945	Ga0307412_10002473
2946	Ga0307412_10023437
2947	Ga0307412_10053096
2948	Ga0307412_10134912
2949	Ga0307412_10140704
2950	Ga0307412_10246717
2951	Ga0307412_10876026
2952	Ga0315914_1000004
2953	Ga0307409_100107301
2954	Ga0307409_100164025
2955	Ga0307409_101405674
2956	Ga0307416_100083007
2957	Ga0307416_100102709
2958	Ga0307416_101127068
2959	Ga0307414_10006754
2960	Ga0307414_10292130
2961	Ga0307411_10585835
2962	Ga0307415_100099954
2963	Ga0307415_100284250
2964	Ga0307510_10142663
2965	Ga0315913_1000011
2966	Ga0315915_1000003
2967	Ga0373929_0058171
2968	Ga0373932_0104003
2969	Ga0373936_0272166
2970	Ga0373961_0022011
2971	Ga0373931_0021546
2972	Ga0373931_0100984
2973	Ga0373933_0152060
2974	Ga0373947_0424826
2975	Ga0395899_0000014
2976	Ga0395899_0000971
2977	Ga0395899_0060950
2978	Ga0395899_0121864
2979	Ga0395899_0130225
2980	Ga0395899_0326182
2981	Ga0395899_0533627
2982	Ga0395900_0000007
2983	Ga0395900_0000036
2984	Ga0395900_0018509
2985	Ga0395900_0028651
2986	Ga0395900_0042991
2987	Ga0395900_0084674
2988	Ga0395900_0135408
2989	Ga0395900_0157240
2990	Ga0395900_0317510
2991	Ga0395900_0445879
2992	Ga0395900_0745373
2993	Ga0395898_0000011
2994	Ga0395898_0034098
2995	Ga0395898_0290469
2996	Ga0395898_0442827
2997	Ga0395898_0603793
2998	Ga0395898_0792537
2999	Ga0395905_0000008
3000	Ga0395905_0000193
3001	Ga0395905_0001786
3002	Ga0395905_0012864
3003	Ga0395905_0022817
3004	Ga0395905_0026548
3005	Ga0395905_0049007
3006	Ga0395905_0112217
3007	Ga0395905_0171943
3008	Ga0395905_0176885
3009	Ga0395905_0332612
3010	Ga0395905_0364926
3011	Ga0395905_0472204
3012	Ga0395905_0483027
3013	Ga0395905_0740775
3014	Ga0395901_0000020
3015	Ga0395901_0000036
3016	Ga0395901_0039656
3017	Ga0395901_0044421
3018	Ga0395901_0047397
3019	Ga0395901_0118490
3020	Ga0395901_0123607
3021	Ga0395901_0254740
3022	Ga0395901_0443470
3023	Ga0395901_0588547
3024	Ga0395901_0858477
3025	Ga0436365_1858586
3026	Ga0436361_0925979
3027	Ga0436363_0580193
3028	Ga0436362_1035670
3029	Ga0439436_0004015
3030	Ga0439436_0119861
3031	Ga0439466_0010643
3032	Ga0439465_0010834
3033	Ga0439465_0047824
3034	Ga0439465_0054871
3035	Ga0439465_0104418
3036	Ga0439465_0111060
3037	Ga0451791_1632668
3038	Ga0451802_0635447
3039	Ga0451802_2010556
3040	Ga0451833_1047326
3041	Ga0451835_0225566
3042	Ga0451837_0612366
3043	Ga0451839_0144518
3044	Ga0451845_0139134
3045	Ga0451849_0490860
3046	Ga0451850_44427
3047	Ga0451851_0942673
3048	Ga0451843_0920087
3049	Ga0451853_1426223
3050	Ga0439445_0020758
3051	Ga0439445_0040819
3052	Ga0439432_016049
3053	Ga0439432_021943
3054	Ga0439452_049293
3055	Ga0450898_036743
3056	Ga0439434_0012666
3057	Ga0466965_0289886
3058	Ga0466970_0040589
3059	Ga0495592_0169386
3060	Ga0495629_0103741
3061	Ga0495638_0000546
3062	Ga0495638_0077751
3063	Ga0495638_0244486
3064	Ga0495605_0054245
3065	Ga0495605_0130573
3066	Ga0495639_0045687
3067	Ga0495662_0015245
3068	Ga0495664_0209758
3069	Ga0495585_0020311
3070	Ga0495585_0037183
3071	Ga0495585_0099951
3072	Ga0495607_0128246
3073	Ga0495583_0008658
3074	Ga0495606_0002266
3075	Ga0495606_0073940
3076	Ga0495606_0147526
3077	Ga0495606_0222122
3078	Ga0495608_0278944
3079	Ga0495610_0005975
3080	Ga0495610_0020444
3081	Ga0495610_0023252
3082	Ga0495616_0293280
3083	Ga0495618_0100793
3084	Ga0495620_0019578
3085	Ga0495620_0046384
3086	Ga0495631_0001028
3087	Ga0495631_0156984
3088	Ga0495632_0005041
3089	Ga0495632_0019634
3090	Ga0495632_0044432
3091	Ga0495632_0109648
3092	Ga0495643_0015915
3093	Ga0495643_0296305
3094	Ga0495648_0096410
3095	Ga0495648_0208941
3096	Ga0495663_0002151
3097	Ga0495663_0167341
3098	Ga0495654_0008624
3099	Ga0495654_0015378
3100	Ga0495654_0122724
3101	Ga0495609_0034048
3102	Ga0495609_0070785
3103	Ga0495621_0090838
3104	Ga0495633_0040533
3105	Ga0495633_0158958
3106	Ga0495668_0005443
3107	Ga0495668_0005580
3108	Ga0495668_0012118
3109	Ga0495668_0117107
3110	Ga0495668_0237065
3111	Ga0495625_0018733
3112	Ga0495625_0077382
3113	Ga0495625_0083613
3114	Ga0495625_0197453
3115	Ga0495625_0443835
3116	Ga0495625_0476483
3117	Ga0495635_0060576
3118	Ga0495588_0011538
3119	Ga0495588_0188301
3120	Ga0495588_0383667
3121	Ga0495657_0027079
3122	Ga0495658_0154600
3123	Ga0495669_0017398
3124	Ga0495624_0059561
3125	Ga0495670_0012454
3126	Ga0495670_0129084
3127	Ga0495671_0056499
3128	Ga0495649_0083801
3129	Ga0495600_0094487
3130	Ga0495660_0101960
3131	Ga0495660_0114109
3132	Ga0495604_0012170
3133	Ga0495636_0006784
3134	Ga0495636_0119252
3135	Ga0495672_0127518
3136	Ga0495676_0180875
3137	Ga0495676_0728792
3138	Ga0495687_045699
3139	Ga0495681_0009047
3140	Ga0495681_0087484
3141	Ga0495686_0002692
3142	Ga0495686_0008891
3143	Ga0495686_0024874
3144	Ga0495686_0106470
3145	Ga0496100_0000539
3146	Ga0496100_0052620
3147	Ga0496100_0230937
3148	Ga0496101_0001051
3149	Ga0496101_0068013
3150	Ga0496101_0140812
3151	Ga0496101_0720618
3152	Ga0496102_0004672
3153	Ga0496102_0029874
3154	Ga0496102_0283808
3155	Ga0496102_0305582
3156	Ga0496102_0724333
3157	Ga0496102_0871759
3158	Ga0496103_0023449
3159	Ga0496103_0039938
3160	Ga0496103_0048969
3161	Ga0496103_0343755
3162	Ga0496104_0000516
3163	Ga0496104_0001175
3164	Ga0496104_0131427
3165	Ga0496104_0151214
3166	Ga0496104_0310088
3167	Ga0496105_0014075
3168	Ga0496105_0148874
3169	Ga0496105_0167920
3170	Ga0496106_0001500
3171	Ga0496106_0019514
3172	Ga0496106_0038635
3173	Ga0496106_0095009
3174	Ga0496106_0105565
3175	Ga0496106_0219559
3176	Ga0496106_0634488
3177	Ga0496107_0000744
3178	Ga0496107_0005294
3179	Ga0496107_0027556
3180	Ga0496107_0147097
3181	Ga0496108_0003683
3182	Ga0496108_0017150
3183	Ga0496108_0027601
3184	Ga0496108_0092744
3185	Ga0496109_0025205
3186	Ga0496109_0170583
3187	Ga0496109_0246123
3188	Ga0496109_0274186
3189	Ga0496109_1342714
3190	Ga0496110_0014915
3191	Ga0496110_0092811
3192	Ga0496111_0000536
3193	Ga0496111_0012450
3194	Ga0496111_0056730
3195	Ga0496111_0221687
3196	Ga0496111_0327211
3197	Ga0496112_0001133
3198	Ga0496112_0009912
3199	Ga0496112_0115472
3200	Ga0496112_0222777
3201	Ga0496112_0444048
3202	Ga0496113_0012994
3203	Ga0496113_0034741
3204	Ga0496113_0043669
3205	Ga0496113_0591913
3206	Ga0496114_0046637
3207	Ga0496114_0079087
3208	Ga0496114_0375323
3209	Ga0496114_0789337
3210	Ga0496116_0003263
3211	Ga0496116_0008065
3212	Ga0496116_0010337
3213	Ga0496116_0010585
3214	Ga0496116_0017190
3215	Ga0496116_0032150
3216	Ga0496116_0049407
3217	Ga0496116_0099238
3218	Ga0496116_0158685
3219	Ga0496116_0244906
3220	Ga0496117_0000002
3221	Ga0496117_0005540
3222	Ga0496117_0007528
3223	Ga0496117_0013881
3224	Ga0496117_0019256
3225	Ga0496117_0027688
3226	Ga0496117_0029148
3227	Ga0496117_0067483
3228	Ga0496117_0086136
3229	Ga0496118_0001144
3230	Ga0496118_0001927
3231	Ga0496118_0010886
3232	Ga0496118_0012872
3233	Ga0496118_0015478
3234	Ga0496118_0026093
3235	Ga0496118_0031868
3236	Ga0496118_0037645
3237	Ga0496118_0096433
3238	Ga0496118_0144614
3239	Ga0496118_0263923
3240	Ga0496118_0263933
3241	Ga0496119_0030183
3242	Ga0496119_0039982
3243	Ga0496119_0061336
3244	Ga0496119_0074717
3245	Ga0496119_0127794
3246	Ga0496119_0210866
3247	Ga0496119_0287327
3248	Ga0496120_0000897
3249	Ga0496120_0004732
3250	Ga0496120_0006409
3251	Ga0496120_0033065
3252	Ga0496120_0051950
3253	Ga0496120_0053389
3254	Ga0496121_0000001
3255	Ga0496121_0014826
3256	Ga0496121_0015513
3257	Ga0496121_0037849
3258	Ga0496121_0048170
3259	Ga0496121_0061121
3260	Ga0496121_0068259
3261	Ga0496121_0100418
3262	Ga0496121_0109219
3263	Ga0496121_0241237
3264	Ga0496121_0338160
3265	Ga0496122_0000001
3266	Ga0496122_0000147
3267	Ga0496122_0014175
3268	Ga0496122_0017929
3269	Ga0496122_0032102
3270	Ga0496122_0048435
3271	Ga0496122_0073416
3272	Ga0496122_0075366
3273	Ga0496123_0000001
3274	Ga0496123_0000339
3275	Ga0496123_0009975
3276	Ga0496123_0026193
3277	Ga0496123_0030893
3278	Ga0496123_0093601
3279	Ga0496123_0167018
3280	Ga0496124_0000855
3281	Ga0496124_0005152
3282	Ga0496124_0009075
3283	Ga0496124_0013491
3284	Ga0496124_0013971
3285	Ga0496124_0035734
3286	Ga0496124_0044318
3287	Ga0496124_0049119
3288	Ga0496124_0065713
3289	Ga0496124_0107705
3290	Ga0496124_0130299
3291	Ga0496124_0165087
3292	Ga0496125_0000001
3293	Ga0496125_0000299
3294	Ga0496125_0011662
3295	Ga0496125_0043778
3296	Ga0496125_0127984
3297	Ga0496125_0168506
3298	Ga0496125_0251824
3299	Ga0496126_0007868
3300	Ga0496126_0008341
3301	Ga0496126_0008758
3302	Ga0496126_0017034
3303	Ga0496126_0167311
3304	Ga0496126_0222780
3305	Ga0496126_0245018
3306	Ga0496126_0247081
3307	Ga0496126_0390062
3308	Ga0496126_0494138
3309	Ga0496126_0895315
3310	Ga0495678_005547
3311	Ga0495678_017432
3312	Ga0495682_0049575
3313	Ga0501031_0000076
3314	Ga0501031_0146384
3315	Ga0501032_0000004
3316	Ga0501032_0001730
3317	Ga0501032_0349534
3318	Ga0501033_0000156
3319	Ga0501033_0004642
3320	Ga0501033_0016132
3321	Ga0501033_0064673
3322	Ga0501034_0000011
3323	Ga0501034_0012488
3324	Ga0501034_0049747
3325	Ga0501034_1101560
3326	Ga0501036_0000001
3327	Ga0501036_0163307
3328	Ga0501036_0325085
3329	Ga0501036_0481590
3330	Ga0501037_0000064
3331	Ga0501037_0026452
3332	Ga0501037_0423780
3333	Ga0501037_0561145
3334	Ga0501038_0000003
3335	Ga0501038_0010727
3336	Ga0501038_0011121
3337	Ga0501038_0532178
3338	Ga0501038_0703206
3339	Ga0501039_0000004
3340	Ga0501039_0087466
3341	Ga0501039_0300938
3342	Ga0501039_0376594
3343	Ga0501040_0040897
3344	Ga0501040_0126891
3345	Ga0501040_0173746
3346	Ga0501040_0665786
3347	Ga0501041_0259838
3348	Ga0501041_0281211
3349	Ga0501041_0644761
3350	Ga0501042_0385045
3351	Ga0501043_0000417
3352	Ga0501043_0043205
3353	Ga0501043_0107312
3354	Ga0501043_0406448
3355	Ga0501046_0008545
3356	Ga0501046_0037795
3357	Ga0501047_0002889
3358	Ga0501047_0007276
3359	Ga0501047_0599042
3360	Ga0501048_0006355
3361	Ga0501067_0052908
3362	Ga0501067_0063546
3363	Ga0501067_0066419
3364	Ga0501067_0139844
3365	Ga0501067_0523979
3366	Ga0501068_0010696
3367	Ga0501070_0009102
3368	Ga0501070_0017361
3369	Ga0501070_0110086
3370	Ga0501070_0269089
3371	Ga0501070_0324490
3372	Ga0501071_0025630
3373	Ga0501071_0332522
3374	Ga0501072_0216553
3375	Ga0501072_0955943
3376	Ga0501073_0019818
3377	Ga0501073_0203768
3378	Ga0501073_0233733
3379	Ga0501073_0238232
3380	Ga0501073_0539823
3381	Ga0501074_0112138
3382	Ga0501074_0232249
3383	Ga0501074_0355804
3384	Ga0501075_0005939
3385	Ga0501075_0035153
3386	Ga0501075_0202729
3387	Ga0501076_0015278
3388	Ga0501076_0141292
3389	Ga0501077_0192544
3390	Ga0501249_000464
3391	Ga0501249_028485
3392	Ga0501225_0035028
3393	Ga0501079_0062339
3394	Ga0501079_0270581
3395	Ga0501079_0661250
3396	Ga0501079_0775233
3397	Ga0501080_0019003
3398	Ga0501080_0062699
3399	Ga0501081_0051720
3400	Ga0501081_0068873
3401	Ga0501081_0113044
3402	Ga0501081_0218675
3403	Ga0501081_0227659
3404	Ga0501081_0642817
3405	Ga0501083_0034469
3406	Ga0501083_0051249
3407	Ga0501268_002627
3408	Ga0501273_000192
3409	Ga0501035_0000009
3410	Ga0501035_0000529
3411	Ga0501035_0071606
3412	Ga0501035_0074295
3413	Ga0501044_0000005
3414	Ga0501044_0003713
3415	Ga0501044_0055686
3416	Ga0501045_0005304
3417	Ga0501045_0114330
3418	Ga0501045_0208144
3419	Ga0501045_0682439
3420	Ga0501204_020093
3421	nmdc:mga03683_291862_c1
3422	nmdc:mga03683_32311_c1
3423	nmdc:mga03n38_233173_c1
3424	nmdc:mga03n38_303_c1
3425	nmdc:mga03n38_5304_c1
3426	nmdc:mga03n38_70047_c1
3427	nmdc:mga00v17_102_c1
3428	nmdc:mga00v17_1909_c1
3429	nmdc:mga00v17_58439_c1
3430	nmdc:mga00v17_86644_c1
3431	nmdc:mga00v17_88117_c1
3432	nmdc:mga0yw44_183_c1
3433	nmdc:mga0yw44_5626_c1
3434	nmdc:mga0yw44_7212_c1
3435	nmdc:mga0k408_13416_c1
3436	nmdc:mga0k408_14555_c1
3437	nmdc:mga06z11_1093_c1
3438	nmdc:mga06z11_1406_c1
3439	nmdc:mga06z11_3460_c1
3440	nmdc:mga06z11_39349_c1
3441	nmdc:mga04h51_117533_c1
3442	nmdc:mga04h51_178406_c1
3443	nmdc:mga04h51_18788_c1
3444	nmdc:mga07m45_224961_c1
3445	nmdc:mga07m45_70146_c1
3446	nmdc:mga05p37_133337_c1
3447	nmdc:mga05p37_194265_c1
3448	nmdc:mga05p37_538973_c1
3449	nmdc:mga09592_15193_c2
3450	nmdc:mga09592_199910_c1
3451	nmdc:mga0qj67_13558_c1
3452	nmdc:mga0qj67_226329_c1
3453	nmdc:mga0qj67_24345_c1
3454	nmdc:mga06r32_121796_c1
3455	nmdc:mga06r32_48108_c1
3456	nmdc:mga06r32_49318_c1
3457	nmdc:mga06r32_6618_c1
3458	nmdc:mga06r32_67386_c1
3459	nmdc:mga08y16_113950_c1
3460	nmdc:mga08y16_99164_c1
3461	nmdc:mga0n895_136398_c1
3462	nmdc:mga0n895_85511_c1
3463	nmdc:mga0rr50_65904_c1
3464	nmdc:mga0rr50_712999_c1
3465	nmdc:mga0a205_395282_c1
3466	nmdc:mga0a205_57133_c1
3467	nmdc:mga0sz30_126005_c2
3468	nmdc:mga0sz30_186200_c1
3469	nmdc:mga0sz30_21092_c1
3470	nmdc:mga0sz30_2245_c1
3471	nmdc:mga0sz30_8262_c1
3472	Ga0500610_0172121
3473	Ga0495619_0209830
3474	Ga0500578_0023226
3475	Ga0500578_0315407
3476	Ga0500643_000115
3477	Ga0500643_000326
3478	Ga0500643_011498
3479	Ga0500651_0267223
3480	Ga0500650_0106819
3481	Ga0500569_001711
3482	Ga0500569_069772
3483	Ga0500592_000322
3484	Ga0500594_0008368
3485	Ga0500595_120985
3486	Ga0500608_048497
3487	Ga0500618_001168
3488	Ga0500621_073642
3489	Ga0500658_0001271
3490	Ga0500658_0026298
3491	Ga0500561_0000341
3492	Ga0500568_0000611
3493	Ga0500568_0004778
3494	Ga0500568_0005331
3495	Ga0500568_0055059
3496	Ga0500588_0084584
3497	Ga0500590_010535
3498	Ga0500604_0184196
3499	Ga0500616_0008121
3500	Ga0500616_0053271
3501	Ga0500616_0066960
3502	Ga0500622_0004278
3503	Ga0500624_000676
3504	Ga0500627_0000211
3505	Ga0500627_0065024
3506	Ga0500634_0063231
3507	Ga0500636_0000094
3508	Ga0500636_0004270
3509	Ga0500611_000548
3510	Ga0501084_0006560
3511	Ga0501084_0203461
3512	Ga0501084_0259778
3513	Ga0501084_0462928
3514	Ga0501082_0002773
3515	Ga0501082_0086060
3516	Ga0501082_0150797
3517	Ga0501082_0650619
3518	Ga0501082_1060610
3519	Ga0466962_0072730
3520	Ga0530510_0233780
3521	2503198054
3522	2509111503
3523	2509140279
3524	2509375501
3525	2509389070
3526	2509444656
3527	2510135597
3528	2510308058
3529	2510314400
3530	2510838940
3531	2510897067
3532	2511132141
3533	2511194261
3534	2511389206
3535	2511498834
3536	2512534970
3537	2512934463
3538	2512962809
3539	2512973208
3540	2513570760
3541	2513575027
3542	2513587522
3543	2513603568
3544	2513618993
3545	2513627009
3546	2513633810
3547	2513638540
3548	2513653111
3549	2513713036
3550	2513714856
3551	2513875654
3552	2513882549
3553	2513904533
3554	2513914464
3555	2513924230
3556	2513983273
3557	2513996244
3558	2514005808
3559	2514016322
3560	2514023603
3561	2514037518
3562	2514586128
3563	2515114760
3564	2515607262
3565	2515638072
3566	2515641499
3567	2515659389
3568	2515741254
3569	2516204849
3570	2516895112
3571	2517038376
3572	2517078655
3573	2517097397
3574	2517105834
3575	2517408851
3576	2517571789
3577	2520381716
3578	2524438629
3579	2524452483
3580	2524462147
3581	2524540384
3582	2528851477
3583	2530648414
3584	2537877237
3585	2551678036
3586	2551685816
3587	2551691144
3588	2551698495
3589	2551708237
3590	2551715806
3591	2551725145
3592	2551731856
3593	2551743225
3594	2554246133
3595	2558866599
3596	2559293356
3597	2585164414
3598	2585223176
3599	2585232339
3600	2585259568
3601	2585264709
3602	2585276369
3603	2585282464
3604	2585328572
3605	2585336126
3606	2585386220
3607	2585394830
3608	2585524030
3609	2585536603
3610	2585542193
3611	2585546228
3612	2585557187
3613	2585564169
3614	2585840611
3615	2585843601
3616	2585897301
3617	2585902970
3618	2587978455
3619	2588520633
3620	2599419816
3621	2599604239
3622	2599718576
3623	2600195250
3624	2601609625
3625	2601746400
3626	2603857931
3627	2616294030
3628	2616311576
3629	2616551708
3630	2617347491
3631	2617377106
3632	2617386449
3633	2643777740
3634	2643796188
3635	2643805757
3636	2643812437
3637	2643839677
3638	2643857473
3639	2643920513
3640	2643985011
3641	2644051647
3642	2644065932
3643	2644103820
3644	2644133593
3645	2644144702
3646	2644154059
3647	2644191121
3648	2644200130
3649	2644207307
3650	2644237831
3651	2644298117
3652	2644306750
3653	2644330942
3654	2644380237
3655	2644417263
3656	2644450659
3657	2644480516
3658	2644495345
3659	2644498771
3660	2644519678
3661	2644541161
3662	2644612361
3663	2644650955
3664	2644656369
3665	2644671444
3666	2644692916
3667	2657682771
3668	2671116341
3669	2688595367
3670	2692320641
3671	2719183263
3672	2719388020
3673	2719667638
3674	2719733980
3675	2720494058
3676	2720615521
3677	2720622304
3678	2720633658
3679	2720777358
3680	2721149375
3681	2721160778
3682	2721166212
3683	2721401653
3684	2722842382
3685	2723028956
3686	2723562572
3687	2723569265
3688	2724040467
3689	2724046736
3690	2724091965
3691	2724106530
3692	2724112337
3693	2725947175
3694	2730109892
3695	2730166498
3696	2730300410
3697	2738800679
3698	2738946807
3699	2739037428
3700	2739308448
3701	2745077654
3702	2753459970
3703	2756674559
3704	2757570145
3705	2758640589
3706	2765464093
3707	2766067235
3708	2770196733
3709	2776272764
3710	2776284708
3711	2776915891
3712	2778179357
3713	2792583433
3714	2792620954
3715	2792625170
3716	2792637585
3717	2792746563
3718	2793282587
3719	2793298388
3720	2793315771
3721	2793323553
3722	2793327499
3723	2793335570
3724	2793340958
3725	2793350356
3726	2793354698
3727	2793358608
3728	2793369061
3729	2802720849
3730	2802724455
3731	2802729880
3732	2802737224
3733	2802746354
3734	2802751843
3735	2804753993
3736	2805919330
3737	2805928980
3738	2805934601
3739	2806047155
3740	2806054846
3741	2806061926
3742	2806069551
3743	2806076078
3744	2808986875
3745	2818243393
3746	2819244291
3747	2819556949
3748	2819613249
3749	2819643718
3750	2821123128
3751	2824608661
3752	2824611997
3753	2824622540
3754	2824633901
3755	2824642344
3756	2824649894
3757	2824660600
3758	2824670277
3759	2824674709
3760	2824684146
3761	2824696139
3762	2824704029
3763	2824711086
3764	2824722362
3765	2824730138
3766	2824738873
3767	2824752537
3768	2824762846
3769	2824770622
3770	2824780171
3771	2837651538
3772	2838020868
3773	2838026775
3774	2838039653
3775	2838044930
3776	2838052990
3777	2838064782
3778	2838070443
3779	2838074862
3780	2838130270
3781	2838663924
3782	2838672607
3783	2838677687
3784	2838685506
3785	2838689914
3786	2838696038
3787	2838705070
3788	2838713437
3789	2838716576
3790	2838719624
3791	2838727327
3792	2838731390
3793	2838739848
3794	2838744331
3795	2840769537
3796	2841735834
3797	2841844028
3798	2841846552
3799	2841852871
3800	2841860916
3801	2841870284
3802	2841944287
3803	2841954536
3804	2841963415
3805	2841969064
3806	2841979838
3807	2841989564
3808	2842044069
3809	2842051942
3810	2842082671
3811	2842112822
3812	2842123770
3813	2842127419
3814	2842132580
3815	2842143749
3816	2842150064
3817	2842152251
3818	2842160198
3819	2842165824
3820	2842172822
3821	2842175870
3822	2842184136
3823	2842189684
3824	2842196441
3825	2842202508
3826	2842208835
3827	2842213998
3828	2842219500
3829	2842224384
3830	2842231718
3831	2842242825
3832	2842245813
3833	2842254750
3834	2842260191
3835	2842267072
3836	2842273602
3837	2842282475
3838	2842289986
3839	2842296898
3840	2842303505
3841	2842308546
3842	2842312144
3843	2842321744
3844	2842344734
3845	2842362776
3846	2842367692
3847	2842376108
3848	2842383318
3849	2842390451
3850	2842397919
3851	2842407595
3852	2842414226
3853	2842420914
3854	2842424057
3855	2842431232
3856	2842437567
3857	2842444382
3858	2842451192
3859	2842465375
3860	2842472156
3861	2842487759
3862	2842494032
3863	2842501321
3864	2842515324
3865	2842517701
3866	2842521201
3867	2842873186
3868	2844004119
3869	2844010089
3870	2844164768
3871	2844316038
3872	2844456662
3873	2847421254
3874	2847672959
3875	2847931525
3876	2847941581
3877	2848996042
3878	2849082504
3879	2850079432
3880	2852387675
3881	2854918156
3882	2855827744
3883	2855843121
3884	2855877750
3885	2856320009
3886	2856332040
3887	2856339333
3888	2856345435
3889	2857374107
3890	2857515805
3891	2857520959
3892	2857527306
3893	2857533919
3894	2858802853
3895	2869169438
3896	2869239803
3897	2869246643
3898	2869252024
3899	2869261201
3900	2869264372
3901	2869271847
3902	2871436151
3903	2871451357
3904	2871459249
3905	2871460099
3906	2871467721
3907	2871478404
3908	2871484477
3909	2871499380
3910	2874115531
3911	2874117338
3912	2874133813
3913	2874162566
3914	2874620260
3915	2874621425
3916	2874634321
3917	2876363275
3918	2876370235
3919	2876387094
3920	2876392922
3921	2876405095
3922	2876409454
3923	2876423633
3924	2876763382
3925	2878035567
3926	2878737524
3927	2878763570
3928	2878770568
3929	2878776149
3930	2878782586
3931	2879091351
3932	2879100196
3933	2881147620
3934	2881164395
3935	2881364924
3936	2881673179
3937	2885306256
3938	2885314695
3939	2885332100
3940	2885336021
3941	2885368171
3942	2885413752
3943	2888352281
3944	2888378826
3945	2888391196
3946	2888427251
3947	2889014271
3948	2889021024
3949	2889792708
3950	2889916215
3951	2891375057
3952	2893071846
3953	2894653006
3954	2896388664
3955	2899794260
3956	2899808350
3957	2899849023
3958	2903454650
3959	2903514629
3960	2903525225
3961	2903532030
3962	2903544185
3963	2903729566
3964	2904579262
3965	2904659628
3966	2904668094
3967	2904719868
3968	2906361005
3969	2906369890
3970	2906374469
3971	2906381295
3972	2906391632
3973	2906400596
3974	2906404645
3975	2906412483
3976	2906420785
3977	2906606071
3978	2906635067
3979	2906645645
3980	2908783018
3981	2913298414
3982	2913311833
3983	2915982705
3984	2915989078
3985	2915999755
3986	2916002265
3987	2916013207
3988	2916019669
3989	2916027360
3990	2916033436
3991	2916037077
3992	2916047714
3993	2916054937
3994	2916056724
3995	2916063909
3996	2916078815
3997	2919078422
3998	2919101947
3999	2919116793
4000	2919121911
4001	2919166547
4002	2919414097
4003	2919454845
4004	2920763893
4005	2920822804
4006	2921207894
4007	2921214794
4008	2921243090
4009	2921244379
4010	2921256320
4011	2921260011
4012	2921265836
4013	2921286373
4014	2921294739
4015	2921299680
4016	2922138563
4017	2922158333
4018	2922165033
4019	2922173402
4020	2922181588
4021	2922188526
4022	2922378534
4023	2922400952
4024	2924145325
4025	2924155193
4026	2924162509
4027	2924172121
4028	2924177662
4029	2924182776
4030	2924187233
4031	2924197301
4032	2924202136
4033	2924211001
4034	2924220721
4035	2924225190
4036	2924230404
4037	2924711835
4038	2924732869
4039	2924734289
4040	2924746989
4041	2924751516
4042	2924756120
4043	2926754804
4044	2926761971
4045	2928522115
4046	2929138903
4047	2929623664
4048	2929632872
4049	2932786151
4050	2932799523
4051	2932805171
4052	2932816888
4053	2932826028
4054	2932829414
4055	2933006897
4056	2933015513
4057	2933022044
4058	2933574995
4059	2933585567
4060	2933588288
4061	2933594097
4062	2933601247
4063	2935617847
4064	2935647820
4065	2935674767
4066	2935678129
4067	2935692417
4068	2935699365
4069	2935707096
4070	2935721035
4071	2935722860
4072	2935739724
4073	2935748762
4074	2935758632
4075	2935764612
4076	2935806662
4077	2935819077
4078	2935837304
4079	2935842009
4080	2935856654
4081	2935872942
4082	2935874381
4083	2935887739
4084	2935900055
4085	2935902251
4086	2935967313
4087	2936001095
4088	2936010749
4089	2936045772
4090	2936369614
4091	2936380354
4092	2936385181
4093	2936998749
4094	2937005799
4095	2937010504
4096	2937017317
4097	2937028263
4098	2937030591
4099	2937039059
4100	2937045680
4101	2937054852
4102	2937062784
4103	2937065987
4104	2937076167
4105	2937083932
4106	2937090809
4107	2937096674
4108	2937104463
4109	2937111654
4110	2937115876
4111	2937122118
4112	2937130810
4113	2937839127
4114	2937849831
4115	2937864138
4116	2937873965
4117	2937983993
4118	2937998029
4119	2940564778
4120	2941504048
4121	2941535899
4122	2941547060
4123	2954014465
4124	2957378025
4125	2957383309
4126	2957390606
4127	2957401515
4128	2957407365
4129	2957409968
4130	2957415685
4131	2957426728
4132	2957435145
4133	2957442467
4134	2957450459
4135	2957451819
4136	2957460733
4137	2957468061
4138	2957475907
4139	2957481828
4140	2957490831
4141	2957492755
4142	2957502948
4143	2957510815
4144	2958076301
4145	2958101457
4146	2958112749
4147	2958129233
4148	2958143451
4149	2958163283
4150	2958168504
4151	2958173742
4152	2960585935
4153	2960593161
4154	2960600911
4155	2960607733
4156	2960616383
4157	2960620135
4158	2960626088
4159	2960635380
4160	2960640395
4161	2960650832
4162	2960656397
4163	2960667262
4164	2960670934
4165	2960677455
4166	2960682665
4167	2960693558
4168	2960700471
4169	2961114953
4170	2961140636
4171	2961166968
4172	2961189633
4173	2963644735
4174	2964614908
4175	2964621200
4176	2964627376
4177	2964631531
4178	2964641353
4179	2964645466
4180	2964651375
4181	2964662944
4182	2964668656
4183	2964673549
4184	2964682268
4185	2964687652
4186	2964695210
4187	2964699979
4188	2964710005
4189	2964716093
4190	2964726020
4191	2965021792
4192	2965028848
4193	2965036956
4194	2965046664
4195	2965053201
4196	2965090693
4197	2965107742
4198	2965118108
4199	2965121451
4200	2967669297
4201	2967676752
4202	2967683483
4203	2967688445
4204	2967694574
4205	2967701620
4206	2967707435
4207	2967716276
4208	2967725878
4209	2967733820
4210	2967740830
4211	2967748152
4212	2967751523
4213	2967756320
4214	2967766373
4215	2967771906
4216	2967776948
4217	2968088989
4218	2968110681
4219	2968146465
4220	2968175374
4221	2970020877
4222	2970031969
4223	2970038054
4224	2970046485
4225	2970052158
4226	2970056002
4227	2970064606
4228	2970073396
4229	2970077154
4230	2970088523
4231	2970094287
4232	2970099298
4233	2970104261
4234	2970112601
4235	2970118888
4236	2970122786
4237	2970130917
4238	2970139361
4239	2970145309
4240	2970153310
4241	2970160462
4242	2970165636
4243	2970172249
4244	2970183879
4245	2970190692
4246	2970194386
4247	2970494151
4248	2970516310
4249	2970525515
4250	2970533720
4251	2970545592
4252	2970553791
4253	2970558412
4254	2970622544
4255	2970632058
4256	2977523350
4257	2977525565
4258	2977530894
4259	2977538786
4260	2977546920
4261	2977556332
4262	2977561867
4263	2977570597
4264	2977576288
4265	2977581050
4266	2977855073
4267	2977879989
4268	2977898654
4269	2977913276
4270	2977916367
4271	2977925375
4272	2977938280
4273	2977953089
4274	2977959927
4275	2977977368
4276	2977987344
4277	2978972935
4278	2979092761
4279	2979099849
4280	2979104734
4281	2979712334
4282	2979749574
4283	2979768658
4284	2979778654
4285	2979794300
4286	2984513468
4287	2984539460
4288	2984591187
4289	2984601687
4290	2987652010
4291	2987658222
4292	2987662980
4293	2987679516
4294	2989351546
4295	2989774515
4296	2989776943
4297	2996314473
4298	2996336803
4299	2996346136
4300	2996388493
4301	2996897138
4302	3000135935
4303	3002142465
4304	3003931401
4305	3004172543
4306	3004192032
4307	3004198415
4308	3004216694
4309	3004219727
4310	3004233564
4311	3004241125
4312	3004255428
4313	3004273059
4314	3004338061
4315	3005410555
4316	3005419273
4317	3005449984
4318	3005490495
4319	3005509711
4320	3005591198
4321	3005595630
4322	3005711621
4323	3005718871
4324	637077634
4325	639645997
4326	643827744
4327	648738267
4328	649869927
4329	650738591
4330	8001850268
4331	8003572132
4332	8003995706
4333	8004003460
4334	8004307130
4335	8004319617
4336	8004365374
4337	8004401993
4338	8004638726
4339	8004732770
4340	8005248030
4341	8005278221
4342	8005282751
4343	8005291717
4344	8005305408
4345	8005310181
4346	8005317571
4347	8005378171
4348	8005384179
4349	8005399543
4350	8005432330
4351	8005465455
4352	8005489289
4353	8005498032
4354	8005559902
4355	8005564602
4356	8005571292
4357	8005619246
4358	8005627807
4359	8005645422
4360	8005661423
4361	8005669439
4362	8005687720
4363	8005692840
4364	8005701547
4365	8006930315
4366	8016518821
4367	8016587089
4368	8017057857
4369	8018132466
4370	8018151094
4371	8018167678
4372	8018176691
4373	8019595971
4374	8019612748
4375	8019653182
4376	8023681343
4377	8024481825
4378	8024489002
4379	8024506263
4380	8046771531
4381	8049296589
4382	8054464024
4383	8054562469
4384	8055433823
4385	8055617364
4386	8055750829
4387	8056381265
4388	8056382753
4389	8056878583
4390	8056970653
4391	8057577882
4392	8057877192

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21175

RecR_C

RecR, C-terminal

205

228

0.99 PF13662

Toprim_4

Toprim domain

112

203

0.97 PF21176

RecR_HhH

RecR, helix-hairpin-helix

39

83

0.95 PF01751

Toprim

Toprim domain

113

202

0.85 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
8a93-assembly1.cif.gz_F	complex of recf-recr-dna from thermus thermophilus.	0.9385	72	162
8a93-assembly1.cif.gz_F	complex of recf-recr-dna from thermus thermophilus.	0.9189	72	162
8ab0-assembly1.cif.gz_F	complex of reco-recr-dna from thermus thermophilus.	0.8339	1	158
3ve5-assembly1.cif.gz_A	structure of recombination mediator protein recr16-196 deletion mutant	0.8147	9	189
3ve5-assembly1.cif.gz_A	structure of recombination mediator protein recr16-196 deletion mutant	0.8105	9	189

ID	Description	Score	Start	End	Superfamily
af_P9WHI3_76_174_3.40.1360.10	Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2;	0.9482	68	161	3.40.1360.10
af_P0A7H6_77_171_3.40.1360.10	Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2;	0.9312	67	161	3.40.1360.10
af_P0A7H6_77_171_3.40.1360.10	Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2;	0.922	67	161	3.40.1360.10
1vddC03	Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2;	0.9213	68	161	3.40.1360.10
3ve5A03	Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2;	0.9213	68	189	3.40.1360.10

ID	Description	Score	Start	End	GO Terms
AF-A0A3B9BGG3-F1-model_v4	Recombination protein RecR	0.9926	51	146	GO:0003677 GO:0006281 GO:0006310 GO:0046872
AF-A0A6P1B0M1-F1-model_v4	deleted	0.9741	49	143
AF-A0A3B9BGG3-F1-model_v4	Recombination protein RecR	0.9725	51	146	GO:0003677 GO:0006281 GO:0006310 GO:0046872
AF-A0A6P1B0M1-F1-model_v4	deleted	0.9642	49	143
AF-A0A268RH89-F1-model_v4	Recombination protein RecR	0.9609	62	164	GO:0003677 GO:0006281 GO:0006310 GO:0046872

F496541

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF21175

RecR_C

RecR, C-terminal

205

228

0.99

PF13662

Toprim_4

Toprim domain

112

203

0.97

PF21176

RecR_HhH

RecR, helix-hairpin-helix

39

83

0.95

PF01751

Toprim

Toprim domain

113

202

0.85

Structural Annotation

Top 5 Hits

Map