F496545

General Info

Members Datasets Scaffolds Average Seq Length
2202 790 4402 491

Family's Representative Sequence

Representative Sequence 3300048923|Ga0496120_0001456|Ga0496120_0001456_209_1891
Length 551
Sequence MRTSSQFIGTPDGKPTLLFATNNAQLGTVVYFPHNGCVLPRVAFDRAKADNGIITKQGRETMIEYGHFIGGKRVAGTSGRKQDVMQPLDGSVRGTVALGSQAELRAAVENAKAAQPKWAATNPQRRVRVLMKFLELVARDYDELADILAREHGKTIADAKGDIQRGLEVVEVCIGAPHMMKGEFTDGAGPGIDVYSMRQPLGVVAGITPFNFPAMIPLWKIAPAIACGNAFILKPSERDPSVPVRLAALMKEAGLPDGVLSVVHGDKEMVDAILDHPDIAAVSFVGSSDIAHYVYQRGVAAGKRVQAMGGAKNHGIVMPDADLDQVVNDLAGAAFGSAGERCMALPVVVPVGEKTADALRAKLIPAIEALRVGVSTDPDAHYGPVVTAAHKAKIENYIQMGIDEGAEIVVDGRGFKLQGHEEGFFVGPTLFDHVKTDMRTYQEEIFGPVLQIVRARDFEEAVALPSKHQYGNGVAIFTRNGHAAREFAARVNVGMVGAYHTFGGWKRSAFGDTNQHGMEGVKFWTKVKTITSRWPDGSPEGSNAFVIPTMG

Samples

Sample ID Description Type Environment
1 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
15 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
16 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
55 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
56 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
57 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
58 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
59 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
60 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
61 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
62 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
63 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
64 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
65 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
66 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
72 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
73 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
74 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
77 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
80 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
81 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
82 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
83 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
84 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
85 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
86 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
87 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
99 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
100 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
101 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
102 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
103 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
104 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
105 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
106 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
107 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
108 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
109 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
110 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
111 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
112 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
113 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
114 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
115 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
116 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
120 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
121 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
122 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
123 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
124 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
125 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
126 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
127 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
130 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
131 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
132 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
133 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
135 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
136 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
138 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
139 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
140 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
141 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
142 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
143 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
144 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
145 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
146 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
147 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
148 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
149 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
150 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
151 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
154 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
155 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
156 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
157 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
158 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
159 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
160 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
161 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
162 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
163 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
164 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
165 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
166 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
167 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
171 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
172 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
173 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
175 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
176 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
182 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
184 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
255 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
257 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
261 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
262 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
263 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
264 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
265 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
267 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
268 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
269 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
270 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
271 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
272 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
273 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
274 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
275 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
276 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
277 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
278 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
279 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
280 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
281 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
282 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
283 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
284 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
285 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
286 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
287 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
288 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
289 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
290 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
291 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
292 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
293 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
294 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
295 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
296 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
297 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
298 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
299 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
300 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
301 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
302 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
303 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
304 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
305 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
306 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
307 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
308 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
309 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
310 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
311 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
312 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
313 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
314 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
315 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
316 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
317 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
318 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
319 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
320 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
321 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
322 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
323 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
324 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
325 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
326 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
327 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
328 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
329 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
330 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
331 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
332 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
333 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
334 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
335 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
336 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
337 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
338 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
339 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
340 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
341 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
342 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
343 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
344 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
345 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
346 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
347 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
348 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
349 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
350 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
351 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
352 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
353 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
354 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
355 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
356 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
357 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
358 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
359 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
360 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
361 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
362 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
363 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
364 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
365 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
366 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
367 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
368 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
369 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
370 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
371 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
372 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
373 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
374 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
375 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
376 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
377 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
378 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
379 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
380 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
381 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
382 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
383 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
384 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
385 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
386 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
387 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
388 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
389 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
390 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
391 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
392 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
393 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
394 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
395 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
396 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
397 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
398 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
399 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
400 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
401 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
402 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
403 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
404 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
405 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
406 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
407 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
408 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
409 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
410 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
411 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
412 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
413 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
414 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
415 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
416 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
417 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
418 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
419 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
420 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
421 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
422 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
423 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
424 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
425 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
426 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
427 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
428 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
435 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
439 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
440 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
441 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
442 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
443 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
444 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
445 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
446 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
447 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
448 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
449 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
450 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
451 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
452 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
453 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
454 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
456 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
457 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
458 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
459 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
460 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
461 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
462 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
463 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
464 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
465 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
466 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
467 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
468 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
469 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
470 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
471 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
472 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
473 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
474 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
475 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
476 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
477 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
478 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
479 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
480 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
481 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
482 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
483 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
484 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
485 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
486 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
487 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
488 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
489 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
490 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
491 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
492 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
493 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
494 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
495 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
496 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
497 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
498 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
499 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
500 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
501 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
502 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
503 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
504 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
505 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
506 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
507 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
508 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
509 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
510 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
511 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
512 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
513 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
514 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
515 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
516 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
517 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
518 2512875024
519 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
520 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
521 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
522 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
523 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
524 2547132424 Nocardia nova SH22a Isolate Unclassified
525 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
526 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
527 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
528 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
529 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
530 2619619003 Frankia sp. CpI1-P Isolate Nodule
531 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
532 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
533 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
534 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
535 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
536 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
537 2643221692 Nocardia sp. Root136 Isolate Unclassified
538 2643221733 Bosea sp. Root381 Isolate Unclassified
539 2643221734 Bosea sp. Root670 Isolate Unclassified
540 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
541 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
542 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
543 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
544 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
545 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
546 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
547 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
548 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
549 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
550 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
551 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
552 2818991467 Bosea vestrisii 3192 Isolate Unclassified
553 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
554 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
555 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
556 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
557 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
558 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
559 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
560 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
561 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
562 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
563 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
564 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
565 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
566 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
567 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
568 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
569 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
570 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
571 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
572 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
573 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
574 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
575 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
576 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
577 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
578 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
579 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
580 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
581 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
582 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
583 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
584 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
585 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
586 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
587 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
588 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
589 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
590 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
591 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
592 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
593 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
594 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
595 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
596 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
597 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
598 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
599 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
600 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
601 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
602 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
603 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
604 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
605 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
606 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
607 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
608 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
609 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
610 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
611 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
612 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
613 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
614 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
615 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
616 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
617 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
618 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
619 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
620 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
621 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
622 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
623 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
624 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
625 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
626 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
627 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
628 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
629 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
630 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
631 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
632 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
633 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
634 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
635 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
636 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
637 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
638 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
639 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
640 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
641 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
642 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
643 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
644 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
645 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
646 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
647 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
648 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
649 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
650 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
651 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
652 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
653 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
654 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
655 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
656 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
657 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
658 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
659 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
660 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
661 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
662 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
663 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
664 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
665 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
666 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
667 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
668 2922554459 Rhodococcus sp. 66b Isolate Unclassified
669 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
670 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
671 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
672 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
673 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
674 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
675 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
676 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
677 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
678 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
679 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
680 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
681 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
682 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
683 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
684 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
685 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
686 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
687 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
688 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
689 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
690 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
691 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
692 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
693 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
694 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
695 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
696 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
697 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
698 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
699 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
700 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
701 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
702 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
703 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
704 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
705 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
706 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
707 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
708 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
709 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
710 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
711 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
712 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
713 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
714 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
715 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
716 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
717 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
718 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
719 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
720 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
721 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
722 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
723 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
724 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
725 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
726 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
727 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
728 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
729 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
730 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
731 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
732 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
733 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
734 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
735 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
736 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
737 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
738 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
739 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
740 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
741 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
742 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
743 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
744 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
745 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
746 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
747 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
748 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
749 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
750 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
751 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
752 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
753 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
754 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
755 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
756 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
757 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
758 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
759 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
760 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
761 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
762 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
763 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
764 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
765 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
766 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
767 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
768 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
769 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
770 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
771 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
772 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
773 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
774 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
775 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
776 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
777 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
778 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
779 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
780 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
781 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
782 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
783 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
784 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
785 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
786 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
787 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
788 8054920844 Frankia tisae Agncl-8 Isolate Nodule
789 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
790 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.1
Metatranscriptomes 0.18
Isolates 12.72

Biome Distribution

Category Percentage (%)
Aerial Root 0.05
Bulb 0
Endosphere 8.99
Nodule 8.54
Rhizoplane 6.31
Rhizosphere 67.08
Stem 0
Stem Tuber 0.05
Unclassified 0.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496120_0001456 3300048923 Bacteria 28320
2 LJQas_1001220 3300000549 Bacteria 3877
3 JGI24752J21851_1000070 3300001976 Bacteria 13227
4 JGI24740J21852_10002361 3300001979 Bacteria 8581
5 JGI24740J21852_10005985 3300001979 Bacteria 5087
6 JGI24740J21852_10008641 3300001979 Bacteria 4047
7 JGI24739J22299_10001530 3300001989 Bacteria 8732
8 JGI24739J22299_10014083 3300001989 Bacteria 2912
9 JGI24737J22298_10000557 3300001990 Bacteria 13073
10 JGI24737J22298_10001461 3300001990 Bacteria 8425
11 JGI24737J22298_10001819 3300001990 Bacteria 7643
12 JGI24737J22298_10012644 3300001990 Bacteria 2751
13 JGI24737J22298_10023133 3300001990 Bacteria 1972
14 JGI24737J22298_10029893 3300001990 Bacteria 1707
15 JGI24743J22301_10004150 3300001991 Bacteria 2340
16 JGI24735J21928_10004299 3300002067 Bacteria 4793
17 JGI24735J21928_10012543 3300002067 Bacteria 2677
18 JGI24735J21928_10019171 3300002067 Bacteria 2104
19 JGI24735J21928_10019707 3300002067 Bacteria 2072
20 JGI24735J21928_10020365 3300002067 Bacteria 2032
21 JGI24750J21931_1001191 3300002070 Bacteria 3321
22 JGI24745J21846_1000602 3300002073 Bacteria 3233
23 JGI24738J21930_10000877 3300002075 Bacteria 8621
24 JGI24738J21930_10006327 3300002075 Bacteria 2786
25 JGI24034J26672_10002795 3300002239 Bacteria 2409
26 JGI24034J26672_10007273 3300002239 Bacteria 1607
27 JGI24751J29686_10003513 3300002459 Unclassified 3157
28 JGI25154J39366_1001768 3300002738 Bacteria 6898
29 JGI25157J39369_1001793 3300002741 Bacteria 6918
30 JGI25150J39212_1000231 3300002774 Bacteria 30274
31 JGI25406J46586_10005971 3300003203 Bacteria 5633
32 JGI25406J46586_10006949 3300003203 Bacteria 5194
33 JGI25406J46586_10013583 3300003203 Bacteria 3491
34 JGI25165J46597_1000026 3300003214 Bacteria 332550
35 JGI25165J46597_1000095 3300003214 Bacteria 163883
36 JGI25153J46596_10000091 3300003215 Bacteria 105614
37 JGI25153J46596_10025526 3300003215 Bacteria 2110
38 Ga0006562J51391_1019900 3300003578 Bacteria 1573
39 Ga0055542_1000831 3300003762 Bacteria 22105
40 Ga0055529_1000207 3300003763 Bacteria 78124
41 Ga0055529_1001996 3300003763 Bacteria 4520
42 Ga0055526_1000947 3300003771 Bacteria 21478
43 Ga0055526_1003216 3300003771 Bacteria 10535
44 Ga0055537_1004843 3300003773 Bacteria 3738
45 Ga0055524_1000320 3300003775 Bacteria 45185
46 Ga0055524_1000341 3300003775 Bacteria 42723
47 Ga0055524_1000618 3300003775 Bacteria 25511
48 Ga0055524_1018445 3300003775 Bacteria 2422
49 Ga0055536_1000816 3300003781 Bacteria 20584
50 Ga0055536_1001254 3300003781 Bacteria 15617
51 Ga0055536_1002212 3300003781 Bacteria 11076
52 Ga0055528_1000602 3300003790 Bacteria 26995
53 Ga0055530_10000099 3300003791 Bacteria 73409
54 Ga0055530_10020952 3300003791 Bacteria 1938
55 Ga0055530_10020964 3300003791 Bacteria 1938
56 Ga0055540_1000044 3300003792 Bacteria 153394
57 Ga0055540_1000593 3300003792 Bacteria 26287
58 Ga0055540_1002244 3300003792 Bacteria 10441
59 Ga0055540_1009744 3300003792 Bacteria 3280
60 Ga0055531_10000498 3300003794 Bacteria 35916
61 Ga0055531_10007874 3300003794 Bacteria 5728
62 Ga0055531_10017857 3300003794 Bacteria 2966
63 Ga0055531_10028289 3300003794 Bacteria 1938
64 Ga0055531_10028290 3300003794 Bacteria 1938
65 Ga0065165_1004186 3300005262 Bacteria 9197
66 Ga0065707_10084177 3300005295 Bacteria 7566
67 Ga0070658_10000970 3300005327 Bacteria 24593
68 Ga0070658_10002909 3300005327 Bacteria 14201
69 Ga0070658_10132252 3300005327 Bacteria 2080
70 Ga0070676_10003330 3300005328 Bacteria 8362
71 Ga0070683_100005087 3300005329 Bacteria 10929
72 Ga0070683_100018072 3300005329 Bacteria 6238
73 Ga0070683_100018814 3300005329 Bacteria 6126
74 Ga0070683_100065856 3300005329 Bacteria 3374
75 Ga0070690_100009984 3300005330 Bacteria 5511
76 Ga0070690_100011493 3300005330 Bacteria 5179
77 Ga0070690_100033935 3300005330 Bacteria 3196
78 Ga0070690_100039501 3300005330 Bacteria 2982
79 Ga0070670_100000100 3300005331 Bacteria 79763
80 Ga0070670_100000435 3300005331 Bacteria 34155
81 Ga0070670_100000918 3300005331 Bacteria 23133
82 Ga0070670_100001151 3300005331 Bacteria 20976
83 Ga0070670_100001295 3300005331 Bacteria 19949
84 Ga0070670_100004118 3300005331 Bacteria 12153
85 Ga0070670_100030273 3300005331 Bacteria 4661
86 Ga0070670_100071113 3300005331 Bacteria 2987
87 Ga0070670_100076338 3300005331 Bacteria 2879
88 Ga0068869_100016531 3300005334 Bacteria 4976
89 Ga0068869_100021834 3300005334 Bacteria 4405
90 Ga0070666_10000842 3300005335 Bacteria 18608
91 Ga0070666_10010979 3300005335 Bacteria 5676
92 Ga0070666_10015060 3300005335 Bacteria 4928
93 Ga0070666_10032623 3300005335 Bacteria 3441
94 Ga0070666_10108003 3300005335 Bacteria 1923
95 Ga0070680_100002422 3300005336 Bacteria 13823
96 Ga0070680_100010744 3300005336 Bacteria 7067
97 Ga0070680_100012365 3300005336 Bacteria 6629
98 Ga0070680_100065811 3300005336 Bacteria 2971
99 Ga0070680_100084568 3300005336 Bacteria 2620
100 Ga0070680_100104096 3300005336 Bacteria 2358
101 Ga0070682_100013858 3300005337 Bacteria 4649
102 Ga0070682_100016983 3300005337 Bacteria 4237
103 Ga0068868_100005603 3300005338 Bacteria 8834
104 Ga0068868_100012543 3300005338 Bacteria 6197
105 Ga0068868_100023340 3300005338 Bacteria 4680
106 Ga0070660_100001303 3300005339 Bacteria 17008
107 Ga0070660_100001449 3300005339 Bacteria 16217
108 Ga0070660_100001588 3300005339 Bacteria 15632
109 Ga0070660_100004144 3300005339 Bacteria 10011
110 Ga0070660_100009468 3300005339 Bacteria 6854
111 Ga0070660_100009837 3300005339 Bacteria 6743
112 Ga0070660_100011154 3300005339 Bacteria 6375
113 Ga0070660_100015424 3300005339 Bacteria 5518
114 Ga0070660_100019930 3300005339 Bacteria 4921
115 Ga0070660_100022714 3300005339 Bacteria 4643
116 Ga0070660_100044124 3300005339 Bacteria 3409
117 Ga0070660_100046591 3300005339 Bacteria 3323
118 Ga0070660_100050376 3300005339 Bacteria 3204
119 Ga0070660_100060165 3300005339 Bacteria 2947
120 Ga0070660_100081201 3300005339 Bacteria 2545
121 Ga0070660_100092914 3300005339 Bacteria 2381
122 Ga0070689_100020701 3300005340 Bacteria 4884
123 Ga0070691_10000937 3300005341 Bacteria 11856
124 Ga0070691_10002229 3300005341 Bacteria 8566
125 Ga0070691_10004796 3300005341 Bacteria 6156
126 Ga0070691_10011558 3300005341 Bacteria 4033
127 Ga0070691_10022237 3300005341 Bacteria 2941
128 Ga0070691_10023248 3300005341 Bacteria 2878
129 Ga0070661_100000028 3300005344 Bacteria 117932
130 Ga0070661_100002551 3300005344 Bacteria 12479
131 Ga0070661_100005980 3300005344 Bacteria 8377
132 Ga0070661_100045678 3300005344 Bacteria 3202
133 Ga0070692_10005236 3300005345 Bacteria 5503
134 Ga0070692_10021837 3300005345 Bacteria 3119
135 Ga0070668_100000294 3300005347 Bacteria 32833
136 Ga0070668_100014902 3300005347 Bacteria 5811
137 Ga0070668_100021095 3300005347 Bacteria 4924
138 Ga0070668_100022512 3300005347 Bacteria 4764
139 Ga0070668_100027628 3300005347 Bacteria 4308
140 Ga0070668_100030569 3300005347 Bacteria 4095
141 Ga0070669_100000455 3300005353 Bacteria 31134
142 Ga0070669_100005832 3300005353 Bacteria 8880
143 Ga0070669_100029399 3300005353 Bacteria 3960
144 Ga0070669_100064587 3300005353 Bacteria 2696
145 Ga0070669_100134329 3300005353 Bacteria 1902
146 Ga0070675_100020328 3300005354 Bacteria 5298
147 Ga0070675_100046541 3300005354 Bacteria 3552
148 Ga0070675_100159541 3300005354 Bacteria 1938
149 Ga0070671_100000031 3300005355 Bacteria 108269
150 Ga0070671_100002313 3300005355 Bacteria 14712
151 Ga0070671_100004754 3300005355 Bacteria 10789
152 Ga0070671_100008818 3300005355 Bacteria 8091
153 Ga0070671_100014958 3300005355 Bacteria 6268
154 Ga0070671_100024953 3300005355 Bacteria 4899
155 Ga0070671_100025140 3300005355 Bacteria 4883
156 Ga0070671_100044064 3300005355 Bacteria 3707
157 Ga0070671_100067437 3300005355 Bacteria 2983
158 Ga0070671_100072499 3300005355 Bacteria 2876
159 Ga0070674_100000255 3300005356 Bacteria 26391
160 Ga0070674_100009116 3300005356 Bacteria 5935
161 Ga0070674_100078153 3300005356 Bacteria 2358
162 Ga0070673_100000577 3300005364 Bacteria 19876
163 Ga0070673_100001132 3300005364 Bacteria 15331
164 Ga0070673_100079341 3300005364 Bacteria 2657
165 Ga0070659_100000401 3300005366 Bacteria 32848
166 Ga0070659_100002369 3300005366 Bacteria 13389
167 Ga0070659_100003269 3300005366 Bacteria 11531
168 Ga0070659_100025902 3300005366 Bacteria 4511
169 Ga0070659_100037580 3300005366 Bacteria 3775
170 Ga0070659_100044295 3300005366 Bacteria 3483
171 Ga0070659_100050666 3300005366 Bacteria 3263
172 Ga0070659_100063996 3300005366 Bacteria 2910
173 Ga0070667_100000074 3300005367 Bacteria 121299
174 Ga0070667_100000288 3300005367 Bacteria 56928
175 Ga0070667_100000814 3300005367 Bacteria 29094
176 Ga0070667_100002739 3300005367 Bacteria 15237
177 Ga0070667_100009549 3300005367 Bacteria 8043
178 Ga0070667_100010538 3300005367 Bacteria 7631
179 Ga0070667_100010825 3300005367 Bacteria 7541
180 Ga0070667_100014963 3300005367 Bacteria 6409
181 Ga0070667_100043616 3300005367 Bacteria 3765
182 Ga0070667_100047421 3300005367 Bacteria 3614
183 Ga0070667_100111938 3300005367 Bacteria 2368
184 Ga0070703_10003032 3300005406 Bacteria 4803
185 Ga0070709_10004826 3300005434 Bacteria 7289
186 Ga0070713_100013671 3300005436 Bacteria 5999
187 Ga0070713_100140252 3300005436 Bacteria 2140
188 Ga0070710_10001139 3300005437 Bacteria 12601
189 Ga0070710_10011989 3300005437 Bacteria 4296
190 Ga0070710_10014441 3300005437 Bacteria 3978
191 Ga0070701_10003158 3300005438 Bacteria 6471
192 Ga0070701_10013248 3300005438 Bacteria 3747
193 Ga0070711_100000479 3300005439 Bacteria 20826
194 Ga0070711_100000991 3300005439 Bacteria 15051
195 Ga0070705_100000224 3300005440 Bacteria 33535
196 Ga0070705_100008721 3300005440 Bacteria 5021
197 Ga0070705_100044493 3300005440 Bacteria 2550
198 Ga0070700_100008734 3300005441 Bacteria 5529
199 Ga0070700_100027467 3300005441 Bacteria 3374
200 Ga0070700_100114985 3300005441 Bacteria 1795
201 Ga0070694_100003603 3300005444 Bacteria 9254
202 Ga0070694_100007783 3300005444 Bacteria 6538
203 Ga0070694_100013044 3300005444 Bacteria 5184
204 Ga0070708_100010366 3300005445 Bacteria 7550
205 Ga0070663_100000970 3300005455 Bacteria 15587
206 Ga0070663_100005415 3300005455 Bacteria 7581
207 Ga0070663_100010071 3300005455 Bacteria 5879
208 Ga0070663_100020033 3300005455 Bacteria 4421
209 Ga0070663_100026656 3300005455 Bacteria 3917
210 Ga0070663_100108728 3300005455 Bacteria 2080
211 Ga0070678_100003901 3300005456 Bacteria 8383
212 Ga0070678_100005204 3300005456 Bacteria 7483
213 Ga0070678_100028975 3300005456 Bacteria 3785
214 Ga0070678_100134971 3300005456 Bacteria 1967
215 Ga0070662_100000857 3300005457 Bacteria 18689
216 Ga0070662_100001676 3300005457 Bacteria 13628
217 Ga0070662_100011053 3300005457 Bacteria 5944
218 Ga0070662_100014321 3300005457 Bacteria 5296
219 Ga0070662_100021936 3300005457 Bacteria 4364
220 Ga0070662_100068597 3300005457 Bacteria 2607
221 Ga0070681_10007954 3300005458 Bacteria 10380
222 Ga0070681_10025559 3300005458 Bacteria 5940
223 Ga0070681_10070094 3300005458 Bacteria 3471
224 Ga0070681_10125927 3300005458 Bacteria 2495
225 Ga0070681_10169497 3300005458 Bacteria 2105
226 Ga0068867_100003921 3300005459 Bacteria 10471
227 Ga0068867_100012582 3300005459 Bacteria 5983
228 Ga0070706_100010819 3300005467 Bacteria 8470
229 Ga0070706_100036063 3300005467 Bacteria 4567
230 Ga0070707_100000208 3300005468 Bacteria 58895
231 Ga0070707_100001119 3300005468 Bacteria 26478
232 Ga0070707_100017535 3300005468 Bacteria 6733
233 Ga0070698_100098484 3300005471 Bacteria 2898
234 Ga0070699_100001188 3300005518 Bacteria 24086
235 Ga0070679_100000010 3300005530 Bacteria 166632
236 Ga0070679_100004553 3300005530 Bacteria 12799
237 Ga0070679_100008127 3300005530 Bacteria 9855
238 Ga0070679_100008584 3300005530 Bacteria 9629
239 Ga0070679_100018379 3300005530 Bacteria 6782
240 Ga0070679_100153977 3300005530 Bacteria 2274
241 Ga0070684_100002241 3300005535 Bacteria 14226
242 Ga0070684_100040801 3300005535 Bacteria 3998
243 Ga0070684_100081034 3300005535 Bacteria 2872
244 Ga0070697_100002550 3300005536 Bacteria 14021
245 Ga0070697_100007366 3300005536 Bacteria 8563
246 Ga0070697_100028731 3300005536 Bacteria 4454
247 Ga0068853_100001949 3300005539 Bacteria 15210
248 Ga0068853_100003719 3300005539 Bacteria 11715
249 Ga0068853_100009377 3300005539 Bacteria 7891
250 Ga0068853_100018252 3300005539 Bacteria 5804
251 Ga0068853_100027432 3300005539 Bacteria 4784
252 Ga0068853_100027482 3300005539 Bacteria 4780
253 Ga0068853_100031321 3300005539 Bacteria 4499
254 Ga0068853_100055242 3300005539 Bacteria 3422
255 Ga0068853_100090905 3300005539 Bacteria 2683
256 Ga0070672_100001538 3300005543 Bacteria 14280
257 Ga0070672_100008610 3300005543 Bacteria 6990
258 Ga0070672_100013713 3300005543 Bacteria 5730
259 Ga0070672_100016170 3300005543 Bacteria 5337
260 Ga0070672_100031016 3300005543 Bacteria 4020
261 Ga0070686_100001426 3300005544 Bacteria 13485
262 Ga0070686_100023312 3300005544 Bacteria 3698
263 Ga0070695_100000088 3300005545 Bacteria 38984
264 Ga0070695_100012884 3300005545 Bacteria 5019
265 Ga0070695_100060823 3300005545 Bacteria 2448
266 Ga0070696_100000693 3300005546 Bacteria 21565
267 Ga0070696_100012293 3300005546 Bacteria 5738
268 Ga0070696_100014406 3300005546 Bacteria 5304
269 Ga0070693_100004808 3300005547 Bacteria 6435
270 Ga0070693_100048163 3300005547 Bacteria 2427
271 Ga0070693_100056008 3300005547 Bacteria 2274
272 Ga0070665_100000011 3300005548 Bacteria 525539
273 Ga0070665_100000084 3300005548 Bacteria 180481
274 Ga0070665_100000287 3300005548 Bacteria 79790
275 Ga0070665_100000694 3300005548 Bacteria 44898
276 Ga0070665_100000766 3300005548 Bacteria 42469
277 Ga0070665_100001116 3300005548 Bacteria 33034
278 Ga0070665_100002409 3300005548 Bacteria 20630
279 Ga0070665_100004155 3300005548 Bacteria 15236
280 Ga0070665_100005713 3300005548 Bacteria 12770
281 Ga0070665_100026559 3300005548 Bacteria 5830
282 Ga0070665_100031850 3300005548 Bacteria 5307
283 Ga0070665_100037213 3300005548 Bacteria 4895
284 Ga0070665_100046893 3300005548 Bacteria 4338
285 Ga0070704_100009090 3300005549 Bacteria 5995
286 Ga0070704_100015946 3300005549 Bacteria 4735
287 Ga0070704_100110753 3300005549 Bacteria 2089
288 Ga0068855_100000117 3300005563 Bacteria 99215
289 Ga0068855_100004642 3300005563 Bacteria 16763
290 Ga0068855_100007520 3300005563 Bacteria 13186
291 Ga0068855_100007660 3300005563 Bacteria 13055
292 Ga0068855_100030673 3300005563 Bacteria 6427
293 Ga0068855_100036308 3300005563 Bacteria 5867
294 Ga0068855_100054269 3300005563 Bacteria 4710
295 Ga0068855_100055585 3300005563 Bacteria 4648
296 Ga0068855_100079137 3300005563 Bacteria 3813
297 Ga0070664_100000464 3300005564 Bacteria 30816
298 Ga0070664_100001697 3300005564 Bacteria 17648
299 Ga0070664_100005415 3300005564 Bacteria 10246
300 Ga0070664_100027233 3300005564 Bacteria 4749
301 Ga0070664_100062458 3300005564 Bacteria 3175
302 Ga0068857_100005766 3300005577 Bacteria 10586
303 Ga0068857_100014420 3300005577 Bacteria 6893
304 Ga0068857_100014688 3300005577 Bacteria 6832
305 Ga0068857_100049590 3300005577 Bacteria 3725
306 Ga0068857_100065924 3300005577 Bacteria 3221
307 Ga0068857_100122752 3300005577 Bacteria 2340
308 Ga0068857_100141052 3300005577 Bacteria 2178
309 Ga0068857_100165901 3300005577 Bacteria 2005
310 Ga0068854_100003774 3300005578 Bacteria 9473
311 Ga0068854_100005832 3300005578 Bacteria 7798
312 Ga0068854_100010696 3300005578 Bacteria 5955
313 Ga0068856_100009131 3300005614 Bacteria 9641
314 Ga0068856_100014377 3300005614 Bacteria 7651
315 Ga0068856_100019074 3300005614 Bacteria 6656
316 Ga0068856_100023905 3300005614 Bacteria 5944
317 Ga0068856_100092073 3300005614 Bacteria 3016
318 Ga0070702_100005015 3300005615 Bacteria 6115
319 Ga0070702_100014147 3300005615 Bacteria 4043
320 Ga0068852_100003938 3300005616 Bacteria 10438
321 Ga0068852_100033199 3300005616 Bacteria 4283
322 Ga0068852_100047516 3300005616 Bacteria 3662
323 Ga0068852_100054351 3300005616 Bacteria 3451
324 Ga0068852_100164663 3300005616 Bacteria 2074
325 Ga0068859_100000567 3300005617 Bacteria 36774
326 Ga0068859_100007890 3300005617 Bacteria 10800
327 Ga0068859_100018515 3300005617 Bacteria 6998
328 Ga0068859_100019045 3300005617 Bacteria 6892
329 Ga0068859_100021896 3300005617 Bacteria 6408
330 Ga0068859_100030432 3300005617 Bacteria 5417
331 Ga0068859_100123604 3300005617 Bacteria 2655
332 Ga0068864_100000038 3300005618 Bacteria 181005
333 Ga0068864_100000077 3300005618 Bacteria 104141
334 Ga0068864_100000529 3300005618 Bacteria 32834
335 Ga0068864_100000986 3300005618 Bacteria 23851
336 Ga0068864_100001642 3300005618 Bacteria 18433
337 Ga0068864_100003490 3300005618 Bacteria 12996
338 Ga0068864_100005281 3300005618 Bacteria 10583
339 Ga0068864_100008425 3300005618 Bacteria 8506
340 Ga0068864_100022693 3300005618 Bacteria 5264
341 Ga0068864_100029834 3300005618 Bacteria 4622
342 Ga0068864_100043947 3300005618 Bacteria 3827
343 Ga0068866_10001475 3300005718 Bacteria 10029
344 Ga0068866_10066296 3300005718 Bacteria 1891
345 Ga0068861_100003267 3300005719 Bacteria 10724
346 Ga0068861_100007855 3300005719 Bacteria 7338
347 Ga0068851_10041220 3300005834 Bacteria 2321
348 Ga0068863_100000026 3300005841 Bacteria 185590
349 Ga0068863_100000083 3300005841 Bacteria 104757
350 Ga0068863_100001341 3300005841 Bacteria 24489
351 Ga0068863_100001963 3300005841 Bacteria 20438
352 Ga0068863_100007448 3300005841 Bacteria 10711
353 Ga0068863_100012424 3300005841 Bacteria 8223
354 Ga0068863_100039586 3300005841 Bacteria 4484
355 Ga0068863_100054777 3300005841 Bacteria 3778
356 Ga0068863_100196159 3300005841 Bacteria 1941
357 Ga0068858_100000061 3300005842 Bacteria 113998
358 Ga0068858_100000933 3300005842 Bacteria 30312
359 Ga0068858_100001928 3300005842 Bacteria 21132
360 Ga0068858_100002545 3300005842 Bacteria 18388
361 Ga0068858_100002818 3300005842 Bacteria 17483
362 Ga0068858_100004629 3300005842 Bacteria 13470
363 Ga0068858_100004733 3300005842 Bacteria 13328
364 Ga0068858_100016016 3300005842 Bacteria 7042
365 Ga0068858_100049130 3300005842 Bacteria 3907
366 Ga0068858_100062331 3300005842 Bacteria 3447
367 Ga0068860_100000276 3300005843 Bacteria 74447
368 Ga0068860_100000453 3300005843 Bacteria 51733
369 Ga0068860_100000501 3300005843 Bacteria 48658
370 Ga0068860_100003938 3300005843 Bacteria 15247
371 Ga0068860_100018345 3300005843 Bacteria 6808
372 Ga0068860_100022645 3300005843 Bacteria 6073
373 Ga0068860_100038419 3300005843 Bacteria 4578
374 Ga0068862_100000065 3300005844 Bacteria 124435
375 Ga0068862_100000098 3300005844 Bacteria 104141
376 Ga0068862_100000874 3300005844 Bacteria 29378
377 Ga0068862_100008981 3300005844 Bacteria 8276
378 Ga0068862_100013623 3300005844 Bacteria 6735
379 Ga0068862_100019796 3300005844 Bacteria 5621
380 Ga0068862_100034010 3300005844 Bacteria 4310
381 Ga0068862_100082005 3300005844 Bacteria 2798
382 Ga0068862_100088496 3300005844 Bacteria 2694
383 Ga0068862_100117484 3300005844 Bacteria 2340
384 Ga0081455_10005213 3300005937 Bacteria 14298
385 Ga0081538_10021051 3300005981 Bacteria 4779
386 Ga0081538_10051790 3300005981 Bacteria 2460
387 Ga0081540_1021554 3300005983 Bacteria 3831
388 Ga0081540_1037703 3300005983 Bacteria 2558
389 Ga0081539_10000604 3300005985 Bacteria 73040
390 Ga0081539_10001065 3300005985 Bacteria 50187
391 Ga0081539_10003993 3300005985 Bacteria 17021
392 Ga0081539_10011070 3300005985 Bacteria 7209
393 Ga0081539_10018973 3300005985 Bacteria 4736
394 Ga0081539_10021499 3300005985 Bacteria 4307
395 Ga0081539_10027633 3300005985 Bacteria 3588
396 Ga0081539_10076710 3300005985 Bacteria 1770
397 Ga0070717_10051405 3300006028 Bacteria 3391
398 Ga0075365_10011049 3300006038 Bacteria 5292
399 Ga0075368_10000035 3300006042 Bacteria 31869
400 Ga0075368_10010582 3300006042 Bacteria 3339
401 Ga0075363_100001170 3300006048 Bacteria 9633
402 Ga0075363_100002220 3300006048 Bacteria 7844
403 Ga0075363_100013779 3300006048 Bacteria 3933
404 Ga0075363_100018437 3300006048 Bacteria 3478
405 Ga0075363_100025976 3300006048 Bacteria 2993
406 Ga0075364_10000049 3300006051 Bacteria 42765
407 Ga0075364_10000591 3300006051 Bacteria 18727
408 Ga0075364_10005266 3300006051 Bacteria 7509
409 Ga0075364_10011033 3300006051 Bacteria 5481
410 Ga0075364_10071413 3300006051 Bacteria 2287
411 Ga0070715_10001572 3300006163 Bacteria 6703
412 Ga0070716_100001930 3300006173 Bacteria 9436
413 Ga0070716_100008352 3300006173 Bacteria 5136
414 Ga0070712_100002669 3300006175 Bacteria 11008
415 Ga0070712_100031726 3300006175 Bacteria 3562
416 Ga0075362_10003279 3300006177 Bacteria 5624
417 Ga0075367_10008467 3300006178 Bacteria 5330
418 Ga0075367_10077379 3300006178 Bacteria 2008
419 Ga0075369_10002203 3300006186 Bacteria 6896
420 Ga0075369_10010423 3300006186 Bacteria 3635
421 Ga0075369_10011807 3300006186 Bacteria 3440
422 Ga0075369_10011987 3300006186 Bacteria 3418
423 Ga0075369_10016701 3300006186 Bacteria 2965
424 Ga0075369_10036538 3300006186 Bacteria 2090
425 Ga0075369_10041858 3300006186 Bacteria 1962
426 Ga0075366_10028722 3300006195 Bacteria 3265
427 Ga0075366_10030256 3300006195 Bacteria 3182
428 Ga0097621_100002474 3300006237 Bacteria 12652
429 Ga0097621_100015820 3300006237 Bacteria 5687
430 Ga0097621_100050399 3300006237 Bacteria 3386
431 Ga0075370_10010573 3300006353 Bacteria 4831
432 Ga0075370_10020090 3300006353 Bacteria 3646
433 Ga0075370_10024860 3300006353 Bacteria 3311
434 Ga0075370_10027626 3300006353 Bacteria 3150
435 Ga0075370_10059436 3300006353 Bacteria 2175
436 Ga0068871_100039776 3300006358 Bacteria 3765
437 Ga0068871_100043052 3300006358 Bacteria 3627
438 Ga0068871_100049889 3300006358 Bacteria 3384
439 Ga0075428_100010305 3300006844 Bacteria 10371
440 Ga0075428_100039315 3300006844 Bacteria 5205
441 Ga0075428_100093797 3300006844 Bacteria 3273
442 Ga0075430_100008169 3300006846 Bacteria 8844
443 Ga0075431_100001468 3300006847 Bacteria 21760
444 Ga0075431_100003004 3300006847 Bacteria 16322
445 Ga0075431_100027228 3300006847 Bacteria 5865
446 Ga0075433_10000449 3300006852 Bacteria 26665
447 Ga0075433_10036911 3300006852 Bacteria 4212
448 Ga0075434_100000020 3300006871 Bacteria 72327
449 Ga0075434_100033324 3300006871 Bacteria 5083
450 Ga0075434_100046757 3300006871 Bacteria 4294
451 Ga0068865_100005660 3300006881 Bacteria 7588
452 Ga0068865_100034934 3300006881 Bacteria 3377
453 Ga0068865_100090069 3300006881 Bacteria 2223
454 Ga0075436_100007352 3300006914 Bacteria 7527
455 Ga0075436_100025151 3300006914 Bacteria 4095
456 Ga0097620_100000567 3300006931 Bacteria 36774
457 Ga0097620_100007889 3300006931 Bacteria 10800
458 Ga0097620_100018515 3300006931 Bacteria 6998
459 Ga0097620_100019045 3300006931 Bacteria 6892
460 Ga0097620_100021896 3300006931 Bacteria 6408
461 Ga0097620_100030432 3300006931 Bacteria 5417
462 Ga0097620_100123605 3300006931 Bacteria 2655
463 Ga0075435_100000210 3300007076 Bacteria 35567
464 Ga0075435_100002188 3300007076 Bacteria 12891
465 Ga0075435_100005765 3300007076 Bacteria 8698
466 Ga0075435_100024229 3300007076 Bacteria 4706
467 Ga0075435_100045776 3300007076 Bacteria 3509
468 Ga0099794_10008668 3300007265 Bacteria 4234
469 Ga0099794_10043488 3300007265 Bacteria 2145
470 Ga0099795_10019616 3300007788 Bacteria 2191
471 Ga0105240_10001530 3300009093 Bacteria 39246
472 Ga0105240_10013197 3300009093 Bacteria 11365
473 Ga0105240_10050753 3300009093 Bacteria 5227
474 Ga0105240_10053879 3300009093 Bacteria 5046
475 Ga0105240_10066058 3300009093 Bacteria 4489
476 Ga0105240_10333886 3300009093 Bacteria 1724
477 Ga0111539_10003134 3300009094 Bacteria 21872
478 Ga0111539_10044324 3300009094 Bacteria 5329
479 Ga0111539_10044461 3300009094 Bacteria 5321
480 Ga0111539_10087075 3300009094 Bacteria 3670
481 Ga0105245_10001226 3300009098 Bacteria 23156
482 Ga0105245_10008882 3300009098 Bacteria 8770
483 Ga0105245_10010714 3300009098 Bacteria 7976
484 Ga0105245_10017687 3300009098 Bacteria 6223
485 Ga0105245_10018434 3300009098 Bacteria 6103
486 Ga0105245_10027790 3300009098 Bacteria 4985
487 Ga0105245_10072387 3300009098 Bacteria 3131
488 Ga0105247_10000017 3300009101 Bacteria 260438
489 Ga0105247_10002602 3300009101 Bacteria 12197
490 Ga0105247_10008008 3300009101 Bacteria 6456
491 Ga0105247_10011149 3300009101 Bacteria 5420
492 Ga0105247_10041232 3300009101 Bacteria 2824
493 Ga0114129_10001566 3300009147 Bacteria 31036
494 Ga0114129_10097693 3300009147 Bacteria 4066
495 Ga0114129_10331361 3300009147 Bacteria 2021
496 Ga0105243_10000278 3300009148 Bacteria 57245
497 Ga0105243_10003108 3300009148 Bacteria 13655
498 Ga0105243_10015495 3300009148 Bacteria 5764
499 Ga0105243_10019994 3300009148 Bacteria 5077
500 Ga0105243_10076685 3300009148 Bacteria 2717
501 Ga0105241_10000871 3300009174 Bacteria 22894
502 Ga0105241_10013847 3300009174 Bacteria 5907
503 Ga0105241_10112089 3300009174 Bacteria 2185
504 Ga0105241_10208368 3300009174 Bacteria 1637
505 Ga0105242_10001113 3300009176 Bacteria 21179
506 Ga0105242_10004838 3300009176 Bacteria 10429
507 Ga0105242_10010292 3300009176 Bacteria 7171
508 Ga0105242_10131359 3300009176 Bacteria 2162
509 Ga0105248_10000194 3300009177 Bacteria 70286
510 Ga0105248_10000478 3300009177 Bacteria 45595
511 Ga0105248_10002050 3300009177 Bacteria 22321
512 Ga0105248_10007323 3300009177 Bacteria 12111
513 Ga0105248_10011419 3300009177 Bacteria 9789
514 Ga0105248_10019304 3300009177 Bacteria 7542
515 Ga0105248_10021555 3300009177 Bacteria 7137
516 Ga0105248_10023033 3300009177 Bacteria 6916
517 Ga0105248_10026023 3300009177 Bacteria 6508
518 Ga0105248_10077700 3300009177 Bacteria 3732
519 Ga0105248_10092973 3300009177 Bacteria 3396
520 Ga0105248_10184223 3300009177 Bacteria 2353
521 Ga0105248_10306061 3300009177 Bacteria 1790
522 Ga0105237_10014883 3300009545 Bacteria 8113
523 Ga0105237_10020018 3300009545 Bacteria 6908
524 Ga0105237_10024962 3300009545 Bacteria 6114
525 Ga0105237_10026250 3300009545 Bacteria 5953
526 Ga0105237_10042064 3300009545 Bacteria 4608
527 Ga0105238_10003553 3300009551 Bacteria 15544
528 Ga0105238_10014790 3300009551 Bacteria 7891
529 Ga0105238_10028258 3300009551 Bacteria 5714
530 Ga0105238_10031483 3300009551 Bacteria 5401
531 Ga0105238_10097683 3300009551 Bacteria 2922
532 Ga0105249_10000096 3300009553 Bacteria 121083
533 Ga0105249_10000347 3300009553 Bacteria 46517
534 Ga0105249_10000667 3300009553 Bacteria 31155
535 Ga0105249_10001976 3300009553 Bacteria 17791
536 Ga0105249_10004132 3300009553 Bacteria 12539
537 Ga0105249_10035086 3300009553 Bacteria 4546
538 Ga0105239_10000138 3300010375 Bacteria 102176
539 Ga0105239_10009981 3300010375 Bacteria 10657
540 Ga0105239_10035893 3300010375 Bacteria 5443
541 Ga0105239_10043379 3300010375 Bacteria 4930
542 Ga0105239_10052534 3300010375 Bacteria 4469
543 Ga0105246_10012836 3300011119 Bacteria 5239
544 Ga0157373_10015037 3300013100 Bacteria 5661
545 Ga0157373_10017636 3300013100 Bacteria 5199
546 Ga0157373_10018194 3300013100 Bacteria 5117
547 Ga0157373_10021592 3300013100 Bacteria 4674
548 Ga0157373_10034344 3300013100 Bacteria 3642
549 Ga0157373_10064173 3300013100 Bacteria 2600
550 Ga0157371_10000285 3300013102 Bacteria 68525
551 Ga0157371_10003605 3300013102 Bacteria 13952
552 Ga0157371_10008004 3300013102 Bacteria 8471
553 Ga0157371_10014873 3300013102 Bacteria 5857
554 Ga0157370_10001875 3300013104 Bacteria 25926
555 Ga0157370_10007662 3300013104 Bacteria 11718
556 Ga0157370_10016907 3300013104 Bacteria 7374
557 Ga0157370_10107542 3300013104 Bacteria 2608
558 Ga0157370_10141241 3300013104 Bacteria 2244
559 Ga0157369_10000762 3300013105 Bacteria 41569
560 Ga0157369_10006045 3300013105 Bacteria 14052
561 Ga0157369_10008974 3300013105 Bacteria 11453
562 Ga0157369_10023362 3300013105 Bacteria 6886
563 Ga0157369_10025652 3300013105 Bacteria 6541
564 Ga0157369_10077730 3300013105 Bacteria 3557
565 Ga0157369_10096569 3300013105 Bacteria 3153
566 Ga0157369_10102351 3300013105 Bacteria 3052
567 Ga0171462_1034 3300013250 Bacteria 85441
568 Ga0157374_10002527 3300013296 Bacteria 15425
569 Ga0157374_10006400 3300013296 Bacteria 9996
570 Ga0157374_10017353 3300013296 Bacteria 6337
571 Ga0157374_10042226 3300013296 Bacteria 4205
572 Ga0157374_10128250 3300013296 Bacteria 2453
573 Ga0157374_10154030 3300013296 Bacteria 2236
574 Ga0157378_10004024 3300013297 Bacteria 12979
575 Ga0157378_10006478 3300013297 Bacteria 10239
576 Ga0157378_10024918 3300013297 Bacteria 5269
577 Ga0157378_10056933 3300013297 Bacteria 3484
578 Ga0157378_10119478 3300013297 Bacteria 2427
579 Ga0163162_10000908 3300013306 Bacteria 27533
580 Ga0163162_10003133 3300013306 Bacteria 15798
581 Ga0163162_10008178 3300013306 Bacteria 10204
582 Ga0163162_10111519 3300013306 Bacteria 2833
583 Ga0163162_10188278 3300013306 Bacteria 2191
584 Ga0163162_10190253 3300013306 Bacteria 2180
585 Ga0163162_10202752 3300013306 Bacteria 2113
586 Ga0157372_10006083 3300013307 Bacteria 12826
587 Ga0157372_10007353 3300013307 Bacteria 11718
588 Ga0157372_10010396 3300013307 Bacteria 9893
589 Ga0157372_10129720 3300013307 Bacteria 2900
590 Ga0157372_10154379 3300013307 Bacteria 2651
591 Ga0157372_10157822 3300013307 Bacteria 2621
592 Ga0157372_10173925 3300013307 Bacteria 2492
593 Ga0157372_10195592 3300013307 Bacteria 2342
594 Ga0157372_10271157 3300013307 Bacteria 1972
595 Ga0157372_10293096 3300013307 Bacteria 1892
596 Ga0157375_10000021 3300013308 Bacteria 249616
597 Ga0157375_10011984 3300013308 Bacteria 7678
598 Ga0163163_10002969 3300014325 Bacteria 14347
599 Ga0163163_10002975 3300014325 Bacteria 14335
600 Ga0163163_10003346 3300014325 Bacteria 13602
601 Ga0163163_10008341 3300014325 Bacteria 9201
602 Ga0163163_10091763 3300014325 Bacteria 3052
603 Ga0157380_10000771 3300014326 Bacteria 20026
604 Ga0157380_10004376 3300014326 Bacteria 9789
605 Ga0157380_10007672 3300014326 Bacteria 7678
606 Ga0157377_10007843 3300014745 Bacteria 5176
607 Ga0157379_10001433 3300014968 Bacteria 19592
608 Ga0157379_10018232 3300014968 Bacteria 6186
609 Ga0157379_10027385 3300014968 Bacteria 5076
610 Ga0157379_10035942 3300014968 Bacteria 4418
611 Ga0157376_10000238 3300014969 Bacteria 38500
612 Ga0157376_10078395 3300014969 Bacteria 2829
613 Ga0157376_10093756 3300014969 Bacteria 2607
614 Ga0183365_10001 3300015684 Bacteria 2090444
615 Ga0183363_1007 3300015690 Bacteria 315687
616 Ga0163161_10017880 3300017792 Bacteria 4967
617 Ga0163161_10018870 3300017792 Bacteria 4834
618 Ga0163161_10073941 3300017792 Bacteria 2499
619 Ga0163161_10078588 3300017792 Bacteria 2425
620 Ga0213873_10000020 3300021358 Bacteria 119758
621 Ga0213873_10005323 3300021358 Bacteria 2463
622 Ga0213876_10000004 3300021384 Bacteria 943822
623 Ga0213876_10000174 3300021384 Bacteria 66934
624 Ga0213876_10000276 3300021384 Bacteria 47195
625 Ga0213876_10001440 3300021384 Bacteria 14809
626 Ga0213876_10002796 3300021384 Bacteria 10164
627 Ga0213876_10003024 3300021384 Bacteria 9730
628 Ga0213875_10001704 3300021388 Bacteria 13833
629 Ga0213875_10003004 3300021388 Bacteria 9809
630 Ga0213875_10009445 3300021388 Bacteria 4941
631 Ga0213875_10069062 3300021388 Bacteria 1650
632 Ga0224712_10006159 3300022467 Bacteria 3395
633 Ga0224712_10034971 3300022467 Bacteria 1851
634 Ga0209147_100773 3300025229 Bacteria 15599
635 Ga0209563_100105 3300025230 Bacteria 147936
636 Ga0207425_1000049 3300025245 Bacteria 180735
637 Ga0207425_1008232 3300025245 Bacteria 2685
638 Ga0209646_1000014 3300025246 Bacteria 550484
639 Ga0209026_1000032 3300025250 Bacteria 322378
640 Ga0209148_1000011 3300025254 Bacteria 1196503
641 Ga0209148_1000094 3300025254 Bacteria 241711
642 Ga0209148_1000146 3300025254 Bacteria 160734
643 Ga0209148_1001233 3300025254 Bacteria 14316
644 Ga0209759_1000168 3300025256 Bacteria 111106
645 Ga0209233_1000030 3300025261 Bacteria 636702
646 Ga0209233_1000052 3300025261 Bacteria 445813
647 Ga0209565_1000007 3300025263 Bacteria 784361
648 Ga0209565_1000170 3300025263 Bacteria 84580
649 Ga0209565_1000667 3300025263 Bacteria 21737
650 Ga0209455_1000006 3300025272 Bacteria 1196503
651 Ga0209455_1000152 3300025272 Bacteria 125942
652 Ga0209455_1000742 3300025272 Bacteria 18682
653 Ga0209673_1000475 3300025273 Bacteria 67091
654 Ga0209673_1000718 3300025273 Bacteria 46280
655 Ga0209673_1008733 3300025273 Bacteria 4478
656 Ga0209673_1023646 3300025273 Bacteria 2086
657 Ga0209675_1000227 3300025291 Bacteria 57390
658 Ga0209675_1005898 3300025291 Bacteria 5025
659 Ga0209675_1011780 3300025291 Bacteria 2875
660 Ga0209676_1000084 3300025292 Bacteria 274330
661 Ga0209676_1000115 3300025292 Bacteria 205183
662 Ga0209676_1000330 3300025292 Bacteria 91216
663 Ga0209676_1000479 3300025292 Bacteria 65868
664 Ga0209676_1006893 3300025292 Bacteria 5490
665 Ga0209676_1017220 3300025292 Bacteria 2568
666 Ga0209025_1000068 3300025294 Bacteria 294129
667 Ga0209564_1000019 3300025295 Bacteria 573686
668 Ga0209564_1000335 3300025295 Bacteria 91079
669 Ga0209564_1000496 3300025295 Bacteria 64984
670 Ga0209758_1000019 3300025297 Bacteria 743682
671 Ga0209758_1007500 3300025297 Bacteria 7397
672 Ga0209758_1020486 3300025297 Bacteria 3126
673 Ga0209050_1000001 3300025298 Bacteria 3563507
674 Ga0209050_1000108 3300025298 Bacteria 222534
675 Ga0209050_1000113 3300025298 Bacteria 209222
676 Ga0209050_1001042 3300025298 Bacteria 34358
677 Ga0209050_1002946 3300025298 Bacteria 13310
678 Ga0209050_1013540 3300025298 Bacteria 3611
679 Ga0209050_1015652 3300025298 Bacteria 3166
680 Ga0209256_1000009 3300025299 Bacteria 922071
681 Ga0209256_1000010 3300025299 Bacteria 912110
682 Ga0209256_1000439 3300025299 Bacteria 64161
683 Ga0209256_1013739 3300025299 Bacteria 2981
684 Ga0209256_1015189 3300025299 Bacteria 2710
685 Ga0209051_1000051 3300025303 Bacteria 283620
686 Ga0209051_1001135 3300025303 Bacteria 24362
687 Ga0209051_1002338 3300025303 Bacteria 13731
688 Ga0209051_1005060 3300025303 Bacteria 7845
689 Ga0209257_1000083 3300025304 Bacteria 296207
690 Ga0209257_1000090 3300025304 Bacteria 274746
691 Ga0209257_1000126 3300025304 Bacteria 215705
692 Ga0209257_1000340 3300025304 Bacteria 97492
693 Ga0209257_1000676 3300025304 Bacteria 53204
694 Ga0209257_1001463 3300025304 Bacteria 27865
695 Ga0209257_1001476 3300025304 Bacteria 27662
696 Ga0209257_1002515 3300025304 Bacteria 18019
697 Ga0209257_1003616 3300025304 Bacteria 13022
698 Ga0209257_1014514 3300025304 Bacteria 3379
699 Ga0207697_10005519 3300025315 Bacteria 5867
700 Ga0207653_10000464 3300025885 Bacteria 16287
701 Ga0207682_10034946 3300025893 Bacteria 2029
702 Ga0207692_10004686 3300025898 Bacteria 5425
703 Ga0207692_10008547 3300025898 Bacteria 4241
704 Ga0207642_10000124 3300025899 Bacteria 21177
705 Ga0207710_10000033 3300025900 Bacteria 260531
706 Ga0207710_10008379 3300025900 Bacteria 4361
707 Ga0207710_10059533 3300025900 Bacteria 1729
708 Ga0207688_10000446 3300025901 Bacteria 19571
709 Ga0207688_10005045 3300025901 Bacteria 7181
710 Ga0207680_10007731 3300025903 Bacteria 5254
711 Ga0207680_10010486 3300025903 Bacteria 4637
712 Ga0207680_10017313 3300025903 Bacteria 3806
713 Ga0207680_10018241 3300025903 Bacteria 3725
714 Ga0207647_10000259 3300025904 Bacteria 43433
715 Ga0207647_10000559 3300025904 Bacteria 29551
716 Ga0207647_10001136 3300025904 Bacteria 20506
717 Ga0207647_10010336 3300025904 Bacteria 6590
718 Ga0207647_10017551 3300025904 Bacteria 4864
719 Ga0207647_10024923 3300025904 Bacteria 3939
720 Ga0207647_10028491 3300025904 Bacteria 3626
721 Ga0207685_10005951 3300025905 Bacteria 3273
722 Ga0207699_10009889 3300025906 Bacteria 4766
723 Ga0207699_10032504 3300025906 Bacteria 2940
724 Ga0207645_10023537 3300025907 Bacteria 4003
725 Ga0207645_10035929 3300025907 Bacteria 3181
726 Ga0207705_10000002 3300025909 Bacteria 2046852
727 Ga0207705_10000058 3300025909 Bacteria 155967
728 Ga0207705_10000208 3300025909 Bacteria 59559
729 Ga0207705_10000927 3300025909 Bacteria 23934
730 Ga0207705_10001458 3300025909 Bacteria 18853
731 Ga0207705_10001872 3300025909 Bacteria 16509
732 Ga0207705_10002232 3300025909 Bacteria 14951
733 Ga0207705_10002640 3300025909 Bacteria 13741
734 Ga0207705_10012877 3300025909 Bacteria 6038
735 Ga0207705_10018043 3300025909 Bacteria 5046
736 Ga0207705_10023395 3300025909 Bacteria 4408
737 Ga0207705_10035940 3300025909 Bacteria 3546
738 Ga0207705_10047425 3300025909 Bacteria 3089
739 Ga0207705_10050780 3300025909 Bacteria 2986
740 Ga0207705_10055674 3300025909 Bacteria 2852
741 Ga0207705_10067091 3300025909 Bacteria 2596
742 Ga0207705_10094000 3300025909 Bacteria 2198
743 Ga0207684_10022384 3300025910 Bacteria 5393
744 Ga0207684_10032022 3300025910 Bacteria 4472
745 Ga0207654_10001881 3300025911 Bacteria 10879
746 Ga0207654_10081743 3300025911 Bacteria 1946
747 Ga0207707_10003186 3300025912 Bacteria 14568
748 Ga0207707_10037722 3300025912 Bacteria 4222
749 Ga0207707_10060507 3300025912 Bacteria 3294
750 Ga0207707_10086973 3300025912 Bacteria 2731
751 Ga0207707_10147149 3300025912 Bacteria 2059
752 Ga0207707_10153233 3300025912 Bacteria 2015
753 Ga0207695_10001848 3300025913 Bacteria 33178
754 Ga0207695_10003427 3300025913 Bacteria 22376
755 Ga0207695_10004478 3300025913 Bacteria 19028
756 Ga0207695_10004987 3300025913 Bacteria 17866
757 Ga0207695_10006985 3300025913 Bacteria 14489
758 Ga0207695_10017679 3300025913 Bacteria 8282
759 Ga0207695_10020106 3300025913 Bacteria 7660
760 Ga0207695_10038875 3300025913 Bacteria 5117
761 Ga0207695_10043032 3300025913 Bacteria 4817
762 Ga0207695_10054120 3300025913 Bacteria 4193
763 Ga0207695_10111661 3300025913 Bacteria 2712
764 Ga0207671_10000545 3300025914 Bacteria 50856
765 Ga0207671_10005363 3300025914 Bacteria 11851
766 Ga0207671_10022339 3300025914 Bacteria 4785
767 Ga0207671_10035374 3300025914 Bacteria 3707
768 Ga0207693_10000551 3300025915 Bacteria 33845
769 Ga0207693_10001966 3300025915 Bacteria 18015
770 Ga0207693_10002737 3300025915 Bacteria 15258
771 Ga0207693_10013205 3300025915 Bacteria 6664
772 Ga0207663_10003077 3300025916 Bacteria 8085
773 Ga0207663_10003079 3300025916 Bacteria 8084
774 Ga0207663_10006007 3300025916 Bacteria 6172
775 Ga0207663_10014785 3300025916 Bacteria 4287
776 Ga0207660_10000422 3300025917 Bacteria 27929
777 Ga0207660_10001309 3300025917 Bacteria 16627
778 Ga0207660_10002243 3300025917 Bacteria 12768
779 Ga0207660_10003491 3300025917 Bacteria 10250
780 Ga0207660_10016465 3300025917 Bacteria 4894
781 Ga0207660_10032042 3300025917 Bacteria 3625
782 Ga0207660_10116726 3300025917 Bacteria 2016
783 Ga0207660_10163893 3300025917 Bacteria 1717
784 Ga0207662_10001396 3300025918 Bacteria 11670
785 Ga0207657_10000082 3300025919 Bacteria 89667
786 Ga0207657_10000123 3300025919 Bacteria 77348
787 Ga0207657_10000671 3300025919 Bacteria 36483
788 Ga0207657_10001451 3300025919 Bacteria 25361
789 Ga0207657_10001591 3300025919 Bacteria 24403
790 Ga0207657_10002637 3300025919 Bacteria 19364
791 Ga0207657_10004016 3300025919 Bacteria 15639
792 Ga0207657_10004689 3300025919 Bacteria 14434
793 Ga0207657_10007624 3300025919 Bacteria 11076
794 Ga0207657_10021578 3300025919 Bacteria 6056
795 Ga0207657_10022716 3300025919 Bacteria 5860
796 Ga0207657_10024416 3300025919 Bacteria 5597
797 Ga0207657_10035495 3300025919 Bacteria 4470
798 Ga0207657_10038274 3300025919 Bacteria 4272
799 Ga0207657_10050472 3300025919 Bacteria 3621
800 Ga0207657_10051036 3300025919 Bacteria 3596
801 Ga0207657_10057853 3300025919 Bacteria 3339
802 Ga0207657_10075560 3300025919 Bacteria 2843
803 Ga0207657_10084386 3300025919 Bacteria 2662
804 Ga0207657_10087018 3300025919 Bacteria 2614
805 Ga0207657_10094129 3300025919 Bacteria 2495
806 Ga0207657_10117408 3300025919 Bacteria 2191
807 Ga0207649_10000336 3300025920 Bacteria 35670
808 Ga0207649_10005063 3300025920 Bacteria 7128
809 Ga0207649_10009635 3300025920 Bacteria 5288
810 Ga0207652_10000005 3300025921 Bacteria 343384
811 Ga0207652_10000006 3300025921 Bacteria 302991
812 Ga0207652_10000007 3300025921 Bacteria 301303
813 Ga0207652_10000205 3300025921 Bacteria 62657
814 Ga0207652_10031099 3300025921 Bacteria 4479
815 Ga0207652_10117408 3300025921 Bacteria 2364
816 Ga0207652_10130224 3300025921 Bacteria 2244
817 Ga0207646_10000015 3300025922 Bacteria 337243
818 Ga0207646_10000016 3300025922 Bacteria 337048
819 Ga0207646_10040408 3300025922 Bacteria 4194
820 Ga0207681_10000849 3300025923 Bacteria 20076
821 Ga0207681_10000910 3300025923 Bacteria 19309
822 Ga0207681_10040414 3300025923 Bacteria 3103
823 Ga0207681_10044829 3300025923 Bacteria 2965
824 Ga0207694_10002464 3300025924 Bacteria 15081
825 Ga0207694_10005485 3300025924 Bacteria 9745
826 Ga0207694_10012209 3300025924 Bacteria 6478
827 Ga0207694_10079478 3300025924 Bacteria 2572
828 Ga0207694_10117319 3300025924 Bacteria 2122
829 Ga0207694_10182145 3300025924 Bacteria 1704
830 Ga0207650_10000014 3300025925 Bacteria 398063
831 Ga0207650_10000054 3300025925 Bacteria 162602
832 Ga0207650_10001590 3300025925 Bacteria 16213
833 Ga0207650_10001833 3300025925 Bacteria 15000
834 Ga0207650_10011526 3300025925 Bacteria 6087
835 Ga0207650_10014474 3300025925 Bacteria 5483
836 Ga0207650_10062980 3300025925 Bacteria 2772
837 Ga0207650_10065389 3300025925 Bacteria 2725
838 Ga0207650_10068024 3300025925 Bacteria 2674
839 Ga0207687_10005011 3300025927 Bacteria 8770
840 Ga0207687_10014080 3300025927 Bacteria 5230
841 Ga0207687_10016286 3300025927 Bacteria 4881
842 Ga0207687_10108441 3300025927 Bacteria 2056
843 Ga0207700_10005166 3300025928 Bacteria 7772
844 Ga0207700_10020041 3300025928 Bacteria 4532
845 Ga0207664_10044000 3300025929 Bacteria 3495
846 Ga0207664_10108834 3300025929 Bacteria 2302
847 Ga0207644_10000018 3300025931 Bacteria 174861
848 Ga0207644_10000061 3300025931 Bacteria 79079
849 Ga0207644_10001036 3300025931 Bacteria 17813
850 Ga0207644_10001838 3300025931 Bacteria 13801
851 Ga0207644_10007939 3300025931 Bacteria 6941
852 Ga0207644_10022631 3300025931 Bacteria 4295
853 Ga0207644_10065044 3300025931 Bacteria 2651
854 Ga0207644_10088253 3300025931 Bacteria 2306
855 Ga0207690_10000315 3300025932 Bacteria 32724
856 Ga0207690_10000544 3300025932 Bacteria 24602
857 Ga0207690_10000613 3300025932 Bacteria 23034
858 Ga0207690_10001436 3300025932 Bacteria 14907
859 Ga0207690_10004727 3300025932 Bacteria 8044
860 Ga0207690_10005775 3300025932 Bacteria 7317
861 Ga0207690_10011498 3300025932 Bacteria 5291
862 Ga0207690_10016813 3300025932 Bacteria 4457
863 Ga0207690_10074017 3300025932 Bacteria 2358
864 Ga0207706_10000193 3300025933 Bacteria 68202
865 Ga0207706_10001303 3300025933 Bacteria 25092
866 Ga0207706_10002010 3300025933 Bacteria 19918
867 Ga0207706_10002923 3300025933 Bacteria 16502
868 Ga0207706_10003479 3300025933 Bacteria 15026
869 Ga0207706_10005808 3300025933 Bacteria 11479
870 Ga0207706_10020981 3300025933 Bacteria 5867
871 Ga0207706_10023349 3300025933 Bacteria 5555
872 Ga0207706_10066755 3300025933 Bacteria 3166
873 Ga0207706_10079040 3300025933 Bacteria 2893
874 Ga0207686_10002557 3300025934 Bacteria 9890
875 Ga0207686_10004973 3300025934 Bacteria 7157
876 Ga0207686_10050651 3300025934 Bacteria 2583
877 Ga0207686_10150142 3300025934 Bacteria 1621
878 Ga0207709_10000039 3300025935 Bacteria 260127
879 Ga0207709_10007188 3300025935 Bacteria 6214
880 Ga0207709_10008112 3300025935 Bacteria 5819
881 Ga0207709_10017505 3300025935 Bacteria 3999
882 Ga0207709_10080672 3300025935 Bacteria 2096
883 Ga0207709_10091171 3300025935 Bacteria 1992
884 Ga0207709_10104563 3300025935 Bacteria 1879
885 Ga0207709_10118698 3300025935 Bacteria 1782
886 Ga0207670_10021086 3300025936 Bacteria 4015
887 Ga0207670_10085189 3300025936 Bacteria 2221
888 Ga0207670_10105566 3300025936 Bacteria 2019
889 Ga0207669_10002924 3300025937 Bacteria 7335
890 Ga0207669_10012433 3300025937 Bacteria 4185
891 Ga0207669_10118516 3300025937 Bacteria 1791
892 Ga0207704_10000291 3300025938 Bacteria 23769
893 Ga0207704_10087085 3300025938 Bacteria 2039
894 Ga0207665_10000478 3300025939 Bacteria 27104
895 Ga0207665_10013327 3300025939 Bacteria 5404
896 Ga0207665_10030281 3300025939 Bacteria 3576
897 Ga0207691_10004370 3300025940 Bacteria 13701
898 Ga0207691_10006970 3300025940 Bacteria 10901
899 Ga0207691_10021952 3300025940 Bacteria 6023
900 Ga0207691_10056912 3300025940 Bacteria 3561
901 Ga0207691_10084915 3300025940 Bacteria 2841
902 Ga0207691_10126498 3300025940 Bacteria 2261
903 Ga0207711_10000017 3300025941 Bacteria 441730
904 Ga0207711_10000169 3300025941 Bacteria 70227
905 Ga0207711_10000665 3300025941 Bacteria 34189
906 Ga0207711_10001108 3300025941 Bacteria 25741
907 Ga0207711_10003024 3300025941 Bacteria 14701
908 Ga0207711_10007427 3300025941 Bacteria 9173
909 Ga0207711_10010537 3300025941 Bacteria 7681
910 Ga0207711_10013176 3300025941 Bacteria 6868
911 Ga0207711_10016000 3300025941 Bacteria 6224
912 Ga0207711_10018653 3300025941 Bacteria 5768
913 Ga0207711_10141982 3300025941 Bacteria 2161
914 Ga0207711_10266951 3300025941 Bacteria 1574
915 Ga0207689_10000561 3300025942 Bacteria 35545
916 Ga0207689_10074058 3300025942 Bacteria 2798
917 Ga0207689_10177472 3300025942 Bacteria 1757
918 Ga0207661_10013650 3300025944 Bacteria 5931
919 Ga0207661_10015725 3300025944 Bacteria 5574
920 Ga0207661_10027905 3300025944 Bacteria 4318
921 Ga0207661_10087965 3300025944 Bacteria 2581
922 Ga0207679_10002303 3300025945 Bacteria 11761
923 Ga0207679_10014106 3300025945 Bacteria 5244
924 Ga0207679_10153160 3300025945 Bacteria 1879
925 Ga0207667_10000006 3300025949 Bacteria 679876
926 Ga0207667_10000017 3300025949 Bacteria 390654
927 Ga0207667_10004287 3300025949 Bacteria 17471
928 Ga0207667_10006466 3300025949 Bacteria 14182
929 Ga0207667_10012536 3300025949 Bacteria 9758
930 Ga0207667_10020240 3300025949 Bacteria 7405
931 Ga0207667_10022807 3300025949 Bacteria 6904
932 Ga0207667_10066629 3300025949 Bacteria 3753
933 Ga0207667_10082273 3300025949 Bacteria 3335
934 Ga0207667_10121234 3300025949 Bacteria 2694
935 Ga0207667_10154833 3300025949 Bacteria 2358
936 Ga0207667_10207145 3300025949 Bacteria 2010
937 Ga0207651_10021655 3300025960 Bacteria 3911
938 Ga0207651_10036204 3300025960 Bacteria 3219
939 Ga0207712_10000005 3300025961 Bacteria 608697
940 Ga0207712_10000594 3300025961 Bacteria 28960
941 Ga0207712_10000632 3300025961 Bacteria 27823
942 Ga0207712_10000840 3300025961 Bacteria 22594
943 Ga0207712_10010101 3300025961 Bacteria 5986
944 Ga0207712_10011030 3300025961 Bacteria 5754
945 Ga0207712_10027060 3300025961 Bacteria 3826
946 Ga0207712_10072123 3300025961 Bacteria 2486
947 Ga0207668_10000199 3300025972 Bacteria 40942
948 Ga0207668_10000307 3300025972 Bacteria 32051
949 Ga0207668_10003517 3300025972 Bacteria 9202
950 Ga0207668_10024131 3300025972 Bacteria 3920
951 Ga0207668_10042458 3300025972 Bacteria 3079
952 Ga0207640_10001675 3300025981 Bacteria 11884
953 Ga0207640_10002234 3300025981 Bacteria 10419
954 Ga0207640_10090903 3300025981 Bacteria 2113
955 Ga0207640_10186172 3300025981 Bacteria 1561
956 Ga0207658_10000321 3300025986 Bacteria 48316
957 Ga0207658_10000351 3300025986 Bacteria 45804
958 Ga0207658_10000743 3300025986 Bacteria 28083
959 Ga0207658_10001887 3300025986 Bacteria 15691
960 Ga0207658_10002871 3300025986 Bacteria 12343
961 Ga0207658_10004634 3300025986 Bacteria 9531
962 Ga0207658_10040302 3300025986 Bacteria 3375
963 Ga0207677_10011440 3300026023 Bacteria 5062
964 Ga0207677_10023098 3300026023 Bacteria 3834
965 Ga0207703_10000149 3300026035 Bacteria 80168
966 Ga0207703_10000964 3300026035 Bacteria 27813
967 Ga0207703_10001077 3300026035 Bacteria 25994
968 Ga0207703_10001264 3300026035 Bacteria 23607
969 Ga0207703_10013390 3300026035 Bacteria 6393
970 Ga0207703_10027927 3300026035 Bacteria 4444
971 Ga0207703_10029798 3300026035 Bacteria 4308
972 Ga0207703_10040515 3300026035 Bacteria 3728
973 Ga0207703_10056882 3300026035 Bacteria 3187
974 Ga0207639_10000332 3300026041 Bacteria 32793
975 Ga0207639_10000804 3300026041 Bacteria 21326
976 Ga0207639_10006337 3300026041 Bacteria 8034
977 Ga0207639_10017659 3300026041 Bacteria 5059
978 Ga0207639_10018513 3300026041 Bacteria 4951
979 Ga0207639_10023592 3300026041 Bacteria 4442
980 Ga0207639_10037288 3300026041 Bacteria 3610
981 Ga0207639_10081594 3300026041 Bacteria 2562
982 Ga0207639_10112256 3300026041 Bacteria 2224
983 Ga0207678_10000781 3300026067 Bacteria 29060
984 Ga0207678_10000961 3300026067 Bacteria 26351
985 Ga0207678_10001177 3300026067 Bacteria 23961
986 Ga0207678_10001243 3300026067 Bacteria 23511
987 Ga0207678_10005610 3300026067 Bacteria 11225
988 Ga0207678_10008244 3300026067 Bacteria 9182
989 Ga0207678_10012711 3300026067 Bacteria 7393
990 Ga0207678_10026110 3300026067 Bacteria 5096
991 Ga0207678_10059512 3300026067 Bacteria 3286
992 Ga0207678_10074062 3300026067 Bacteria 2918
993 Ga0207678_10109413 3300026067 Bacteria 2357
994 Ga0207708_10005906 3300026075 Bacteria 9057
995 Ga0207708_10010888 3300026075 Bacteria 6765
996 Ga0207708_10045007 3300026075 Bacteria 3363
997 Ga0207702_10019053 3300026078 Bacteria 5679
998 Ga0207702_10030684 3300026078 Bacteria 4478
999 Ga0207702_10032934 3300026078 Bacteria 4326
1000 Ga0207702_10065994 3300026078 Bacteria 3100
1001 Ga0207702_10068804 3300026078 Bacteria 3042
1002 Ga0207702_10229816 3300026078 Bacteria 1733
1003 Ga0207641_10000005 3300026088 Bacteria 470841
1004 Ga0207641_10000008 3300026088 Bacteria 424415
1005 Ga0207641_10000908 3300026088 Bacteria 30712
1006 Ga0207641_10001186 3300026088 Bacteria 26142
1007 Ga0207641_10001342 3300026088 Bacteria 24372
1008 Ga0207641_10003662 3300026088 Bacteria 13540
1009 Ga0207641_10006236 3300026088 Bacteria 10086
1010 Ga0207641_10007252 3300026088 Bacteria 9238
1011 Ga0207641_10020095 3300026088 Bacteria 5482
1012 Ga0207641_10027023 3300026088 Bacteria 4738
1013 Ga0207641_10051713 3300026088 Bacteria 3479
1014 Ga0207641_10058396 3300026088 Bacteria 3283
1015 Ga0207641_10107883 3300026088 Bacteria 2463
1016 Ga0207648_10002008 3300026089 Bacteria 22201
1017 Ga0207648_10002485 3300026089 Bacteria 19787
1018 Ga0207648_10038684 3300026089 Bacteria 4197
1019 Ga0207676_10000060 3300026095 Bacteria 118841
1020 Ga0207676_10000085 3300026095 Bacteria 90147
1021 Ga0207676_10000164 3300026095 Bacteria 57910
1022 Ga0207676_10002922 3300026095 Bacteria 12179
1023 Ga0207676_10007262 3300026095 Bacteria 7849
1024 Ga0207676_10010426 3300026095 Bacteria 6616
1025 Ga0207676_10010543 3300026095 Bacteria 6584
1026 Ga0207676_10023714 3300026095 Bacteria 4532
1027 Ga0207676_10034529 3300026095 Bacteria 3830
1028 Ga0207676_10040058 3300026095 Bacteria 3588
1029 Ga0207676_10152412 3300026095 Bacteria 1992
1030 Ga0207674_10000271 3300026116 Bacteria 65366
1031 Ga0207674_10002255 3300026116 Bacteria 24429
1032 Ga0207674_10005179 3300026116 Bacteria 15532
1033 Ga0207674_10007422 3300026116 Bacteria 12778
1034 Ga0207674_10007476 3300026116 Bacteria 12732
1035 Ga0207674_10022912 3300026116 Bacteria 6700
1036 Ga0207674_10023100 3300026116 Bacteria 6669
1037 Ga0207674_10033217 3300026116 Bacteria 5403
1038 Ga0207674_10033484 3300026116 Bacteria 5379
1039 Ga0207674_10037459 3300026116 Bacteria 5044
1040 Ga0207674_10042454 3300026116 Bacteria 4696
1041 Ga0207674_10055653 3300026116 Bacteria 4021
1042 Ga0207674_10062984 3300026116 Bacteria 3745
1043 Ga0207674_10187707 3300026116 Bacteria 2017
1044 Ga0207675_100003266 3300026118 Bacteria 15871
1045 Ga0207675_100015049 3300026118 Bacteria 7218
1046 Ga0207675_100020835 3300026118 Bacteria 6112
1047 Ga0207683_10004828 3300026121 Bacteria 11609
1048 Ga0207683_10013670 3300026121 Bacteria 6923
1049 Ga0207683_10029045 3300026121 Bacteria 4786
1050 Ga0207683_10051606 3300026121 Bacteria 3604
1051 Ga0207698_10007496 3300026142 Bacteria 6839
1052 Ga0207698_10014594 3300026142 Bacteria 5229
1053 Ga0207698_10017896 3300026142 Bacteria 4817
1054 Ga0207698_10021498 3300026142 Bacteria 4464
1055 Ga0207698_10130321 3300026142 Bacteria 2148
1056 Ga0207698_10183028 3300026142 Bacteria 1858
1057 Ga0209999_1007850 3300027543 Bacteria 1919
1058 Ga0209813_10000040 3300027866 Bacteria 53861
1059 Ga0209813_10008253 3300027866 Bacteria 2624
1060 Ga0209813_10023694 3300027866 Bacteria 1747
1061 Ga0209974_10028774 3300027876 Bacteria 1840
1062 Ga0209974_10036639 3300027876 Bacteria 1629
1063 Ga0207428_10013315 3300027907 Bacteria 7191
1064 Ga0207428_10047746 3300027907 Bacteria 3437
1065 Ga0268266_10000002 3300028379 Bacteria 3059047
1066 Ga0268266_10000003 3300028379 Bacteria 1701703
1067 Ga0268266_10000058 3300028379 Bacteria 277346
1068 Ga0268266_10000458 3300028379 Bacteria 59553
1069 Ga0268266_10000819 3300028379 Bacteria 40698
1070 Ga0268266_10006101 3300028379 Bacteria 11098
1071 Ga0268266_10007042 3300028379 Bacteria 10210
1072 Ga0268266_10012444 3300028379 Bacteria 7354
1073 Ga0268266_10022860 3300028379 Bacteria 5322
1074 Ga0268266_10047971 3300028379 Bacteria 3660
1075 Ga0268266_10115829 3300028379 Bacteria 2380
1076 Ga0268266_10188611 3300028379 Bacteria 1881
1077 Ga0268265_10000011 3300028380 Bacteria 343832
1078 Ga0268265_10000022 3300028380 Bacteria 270788
1079 Ga0268265_10000959 3300028380 Bacteria 26502
1080 Ga0268265_10001107 3300028380 Bacteria 23892
1081 Ga0268265_10006679 3300028380 Bacteria 7810
1082 Ga0268265_10010519 3300028380 Bacteria 6247
1083 Ga0268265_10011108 3300028380 Bacteria 6085
1084 Ga0268265_10012836 3300028380 Bacteria 5689
1085 Ga0268265_10025385 3300028380 Bacteria 4205
1086 Ga0268265_10039497 3300028380 Bacteria 3479
1087 Ga0268265_10055071 3300028380 Bacteria 3021
1088 Ga0268265_10243985 3300028380 Bacteria 1587
1089 Ga0268264_10000005 3300028381 Bacteria 934972
1090 Ga0268264_10000396 3300028381 Bacteria 62748
1091 Ga0268264_10002785 3300028381 Bacteria 15261
1092 Ga0268264_10002955 3300028381 Bacteria 14764
1093 Ga0268264_10004230 3300028381 Bacteria 12253
1094 Ga0268264_10005583 3300028381 Bacteria 10655
1095 Ga0268264_10006218 3300028381 Bacteria 10077
1096 Ga0268264_10018337 3300028381 Bacteria 5723
1097 Ga0268264_10035187 3300028381 Bacteria 4123
1098 Ga0268264_10046242 3300028381 Bacteria 3615
1099 Ga0265337_1016775 3300028556 Bacteria 2361
1100 Ga0307517_10002922 3300028786 Bacteria 27037
1101 Ga0307517_10010748 3300028786 Bacteria 12762
1102 Ga0307517_10049033 3300028786 Bacteria 4330
1103 Ga0307517_10055001 3300028786 Bacteria 3919
1104 Ga0307515_10014980 3300028794 Bacteria 14323
1105 Ga0307515_10021185 3300028794 Bacteria 11542
1106 Ga0265338_10022700 3300028800 Bacteria 6481
1107 Ga0265338_10023393 3300028800 Bacteria 6355
1108 Ga0265338_10056352 3300028800 Bacteria 3486
1109 Ga0307511_10002013 3300030521 Bacteria 21324
1110 Ga0265760_10000019 3300031090 Bacteria 81444
1111 Ga0265330_10029057 3300031235 Bacteria 2488
1112 Ga0265328_10011517 3300031239 Bacteria 3530
1113 Ga0265325_10000039 3300031241 Bacteria 93014
1114 Ga0265325_10005811 3300031241 Bacteria 7563
1115 Ga0265325_10025631 3300031241 Bacteria 3200
1116 Ga0265325_10042321 3300031241 Bacteria 2382
1117 Ga0265339_10002178 3300031249 Bacteria 14208
1118 Ga0265327_10000004 3300031251 Bacteria 803973
1119 Ga0265327_10000128 3300031251 Bacteria 165601
1120 Ga0265327_10023964 3300031251 Bacteria 3597
1121 Ga0307513_10000069 3300031456 Bacteria 140558
1122 Ga0307513_10000541 3300031456 Bacteria 54065
1123 Ga0307513_10030774 3300031456 Bacteria 6092
1124 Ga0307513_10105283 3300031456 Bacteria 2831
1125 Ga0307408_100001695 3300031548 Bacteria 16200
1126 Ga0307408_100004305 3300031548 Bacteria 9661
1127 Ga0307408_100091142 3300031548 Bacteria 2301
1128 Ga0307508_10000018 3300031616 Bacteria 202701
1129 Ga0265314_10068730 3300031711 Bacteria 2381
1130 Ga0316576_10023528 3300031727 Bacteria 4293
1131 Ga0316578_10022903 3300031728 Bacteria 3490
1132 Ga0307516_10046345 3300031730 Bacteria 4290
1133 Ga0307405_10000284 3300031731 Bacteria 18720
1134 Ga0307405_10002521 3300031731 Bacteria 8108
1135 Ga0307405_10010856 3300031731 Bacteria 4744
1136 Ga0307405_10040352 3300031731 Bacteria 2826
1137 Ga0307405_10045379 3300031731 Bacteria 2692
1138 Ga0307405_10077043 3300031731 Bacteria 2165
1139 Ga0307405_10110631 3300031731 Bacteria 1860
1140 Ga0307413_10000137 3300031824 Bacteria 19402
1141 Ga0307413_10000754 3300031824 Bacteria 11163
1142 Ga0307413_10003765 3300031824 Bacteria 6461
1143 Ga0307413_10004464 3300031824 Bacteria 6094
1144 Ga0307413_10005317 3300031824 Bacteria 5730
1145 Ga0307413_10021522 3300031824 Bacteria 3456
1146 Ga0307413_10037041 3300031824 Bacteria 2814
1147 Ga0307413_10117428 3300031824 Bacteria 1794
1148 Ga0307413_10146087 3300031824 Bacteria 1641
1149 Ga0307410_10006058 3300031852 Bacteria 6482
1150 Ga0307410_10019043 3300031852 Bacteria 4165
1151 Ga0307410_10023412 3300031852 Bacteria 3838
1152 Ga0307410_10042545 3300031852 Bacteria 3004
1153 Ga0307410_10044208 3300031852 Bacteria 2957
1154 Ga0307410_10078981 3300031852 Bacteria 2304
1155 Ga0307410_10089195 3300031852 Bacteria 2184
1156 Ga0307406_10000756 3300031901 Bacteria 18176
1157 Ga0307406_10001463 3300031901 Bacteria 13061
1158 Ga0307406_10001597 3300031901 Bacteria 12467
1159 Ga0307406_10007567 3300031901 Bacteria 6030
1160 Ga0307406_10010778 3300031901 Bacteria 5166
1161 Ga0307406_10018484 3300031901 Bacteria 4073
1162 Ga0307406_10018817 3300031901 Bacteria 4043
1163 Ga0307406_10028813 3300031901 Bacteria 3357
1164 Ga0307406_10044959 3300031901 Bacteria 2769
1165 Ga0307407_10000496 3300031903 Bacteria 12113
1166 Ga0307407_10006157 3300031903 Bacteria 5299
1167 Ga0307407_10022936 3300031903 Bacteria 3248
1168 Ga0307407_10047610 3300031903 Bacteria 2434
1169 Ga0307412_10002585 3300031911 Bacteria 10061
1170 Ga0307412_10004506 3300031911 Bacteria 7762
1171 Ga0307412_10011803 3300031911 Bacteria 5070
1172 Ga0307412_10014643 3300031911 Bacteria 4632
1173 Ga0307412_10020554 3300031911 Bacteria 4020
1174 Ga0307412_10034066 3300031911 Bacteria 3243
1175 Ga0307412_10115621 3300031911 Bacteria 1923
1176 Ga0307412_10141726 3300031911 Bacteria 1761
1177 Ga0307409_100007007 3300031995 Bacteria 6698
1178 Ga0307409_100120058 3300031995 Bacteria 2224
1179 Ga0307409_100164557 3300031995 Bacteria 1944
1180 Ga0307416_100016736 3300032002 Bacteria 5107
1181 Ga0307416_100102929 3300032002 Bacteria 2491
1182 Ga0307416_100128728 3300032002 Bacteria 2273
1183 Ga0307414_10000073 3300032004 Bacteria 94656
1184 Ga0307414_10005242 3300032004 Bacteria 7124
1185 Ga0307414_10006551 3300032004 Bacteria 6499
1186 Ga0307414_10011988 3300032004 Bacteria 5110
1187 Ga0307414_10016629 3300032004 Bacteria 4478
1188 Ga0307414_10017610 3300032004 Bacteria 4376
1189 Ga0307414_10023539 3300032004 Bacteria 3908
1190 Ga0307414_10044349 3300032004 Bacteria 3036
1191 Ga0307414_10052483 3300032004 Bacteria 2838
1192 Ga0307414_10076460 3300032004 Bacteria 2433
1193 Ga0307414_10089900 3300032004 Bacteria 2277
1194 Ga0307414_10109539 3300032004 Bacteria 2098
1195 Ga0307414_10113412 3300032004 Bacteria 2069
1196 Ga0307411_10001675 3300032005 Bacteria 9271
1197 Ga0307411_10003929 3300032005 Bacteria 7015
1198 Ga0307411_10004508 3300032005 Bacteria 6681
1199 Ga0307411_10008457 3300032005 Bacteria 5335
1200 Ga0307411_10015506 3300032005 Bacteria 4283
1201 Ga0307411_10026456 3300032005 Bacteria 3494
1202 Ga0307411_10046104 3300032005 Bacteria 2808
1203 Ga0307411_10053661 3300032005 Bacteria 2643
1204 Ga0307411_10059582 3300032005 Bacteria 2531
1205 Ga0307411_10113483 3300032005 Bacteria 1944
1206 Ga0307415_100003750 3300032126 Bacteria 7789
1207 Ga0307415_100004184 3300032126 Bacteria 7451
1208 Ga0307415_100005234 3300032126 Bacteria 6862
1209 Ga0307415_100046185 3300032126 Bacteria 2924
1210 Ga0307415_100049729 3300032126 Bacteria 2836
1211 Ga0307415_100089758 3300032126 Bacteria 2221
1212 Ga0307415_100096613 3300032126 Bacteria 2154
1213 Ga0307415_100104772 3300032126 Bacteria 2084
1214 Ga0307510_10084916 3300033180 Bacteria 3046
1215 Ga0307510_10111548 3300033180 Bacteria 2475
1216 Ga0373934_0002051 3300035086 Bacteria 7408
1217 Ga0373936_0036562 3300035113 Bacteria 1959
1218 Ga0373945_0012591 3300035116 Bacteria 2812
1219 Ga0373953_0000370 3300035117 Bacteria 12142
1220 Ga0373956_0001015 3300035119 Bacteria 11589
1221 Ga0373943_0012542 3300035170 Bacteria 3819
1222 Ga0373955_0000271 3300035172 Bacteria 21553
1223 Ga0373955_0002468 3300035172 Bacteria 8082
1224 Ga0316574_0015344 3300035398 Bacteria 4444
1225 Ga0316574_0020031 3300035398 Bacteria 3954
1226 Ga0316574_0024440 3300035398 Bacteria 3616
1227 Ga0373924_0004632 3300035410 Bacteria 4821
1228 Ga0373931_0001699 3300035691 Bacteria 9542
1229 Ga0373931_0005781 3300035691 Bacteria 5748
1230 Ga0373935_0023898 3300035692 Bacteria 3756
1231 Ga0373935_0058085 3300035692 Bacteria 2470
1232 Ga0373927_0000772 3300035695 Bacteria 24478
1233 Ga0373933_0002469 3300035724 Bacteria 10403
1234 Ga0373933_0057145 3300035724 Bacteria 2344
1235 Ga0373947_0015691 3300035725 Bacteria 4351
1236 Ga0373937_0021117 3300036401 Bacteria 5844
1237 Ga0373937_0060477 3300036401 Bacteria 3481
1238 Ga0373937_0065741 3300036401 Bacteria 3338
1239 Ga0316584_0026547 3300036712 Bacteria 4258
1240 Ga0316584_0052634 3300036712 Bacteria 3045
1241 Ga0373925_0001415 3300037068 Bacteria 20837
1242 Ga0373925_0077549 3300037068 Bacteria 2522
1243 Ga0395899_0000018 3300037312 Bacteria 423194
1244 Ga0395899_0000105 3300037312 Bacteria 146163
1245 Ga0395899_0000224 3300037312 Bacteria 76706
1246 Ga0395899_0000288 3300037312 Bacteria 64881
1247 Ga0395899_0002312 3300037312 Bacteria 15534
1248 Ga0395899_0010408 3300037312 Bacteria 7127
1249 Ga0395899_0023576 3300037312 Bacteria 4658
1250 Ga0395899_0026415 3300037312 Bacteria 4382
1251 Ga0395899_0029891 3300037312 Bacteria 4100
1252 Ga0395899_0050931 3300037312 Bacteria 3073
1253 Ga0395899_0087649 3300037312 Bacteria 2259
1254 Ga0395900_0000246 3300037418 Bacteria 85104
1255 Ga0395900_0000294 3300037418 Bacteria 75260
1256 Ga0395900_0001134 3300037418 Bacteria 33662
1257 Ga0395900_0004612 3300037418 Bacteria 14542
1258 Ga0395900_0007653 3300037418 Bacteria 11152
1259 Ga0395900_0013037 3300037418 Bacteria 8496
1260 Ga0395900_0015268 3300037418 Bacteria 7830
1261 Ga0395900_0016847 3300037418 Bacteria 7456
1262 Ga0395900_0024016 3300037418 Bacteria 6238
1263 Ga0395900_0026423 3300037418 Bacteria 5944
1264 Ga0395900_0027347 3300037418 Bacteria 5841
1265 Ga0395900_0034799 3300037418 Bacteria 5189
1266 Ga0395900_0039656 3300037418 Bacteria 4852
1267 Ga0395900_0045677 3300037418 Bacteria 4511
1268 Ga0395900_0055849 3300037418 Bacteria 4065
1269 Ga0395900_0073616 3300037418 Bacteria 3512
1270 Ga0395900_0096427 3300037418 Bacteria 3038
1271 Ga0395900_0111256 3300037418 Bacteria 2813
1272 Ga0395900_0112447 3300037418 Bacteria 2796
1273 Ga0395900_0149837 3300037418 Bacteria 2383
1274 Ga0395898_0000192 3300037466 Bacteria 156121
1275 Ga0395898_0000447 3300037466 Bacteria 85103
1276 Ga0395898_0001747 3300037466 Bacteria 28657
1277 Ga0395898_0002761 3300037466 Bacteria 20224
1278 Ga0395898_0022475 3300037466 Bacteria 6387
1279 Ga0395898_0031234 3300037466 Bacteria 5323
1280 Ga0395898_0048317 3300037466 Bacteria 4173
1281 Ga0395898_0074845 3300037466 Bacteria 3271
1282 Ga0395898_0128698 3300037466 Bacteria 2425
1283 Ga0395898_0221517 3300037466 Bacteria 1805
1284 Ga0395905_0000066 3300037471 Bacteria 183121
1285 Ga0395905_0000128 3300037471 Bacteria 124305
1286 Ga0395905_0000228 3300037471 Bacteria 85103
1287 Ga0395905_0000358 3300037471 Bacteria 64883
1288 Ga0395905_0000521 3300037471 Bacteria 52722
1289 Ga0395905_0001563 3300037471 Bacteria 27336
1290 Ga0395905_0001605 3300037471 Bacteria 26873
1291 Ga0395905_0001734 3300037471 Bacteria 25503
1292 Ga0395905_0001997 3300037471 Bacteria 23312
1293 Ga0395905_0003182 3300037471 Bacteria 17675
1294 Ga0395905_0014226 3300037471 Bacteria 7602
1295 Ga0395905_0016299 3300037471 Bacteria 7061
1296 Ga0395905_0016381 3300037471 Bacteria 7042
1297 Ga0395905_0017957 3300037471 Bacteria 6717
1298 Ga0395905_0019110 3300037471 Bacteria 6499
1299 Ga0395905_0025830 3300037471 Bacteria 5537
1300 Ga0395905_0027108 3300037471 Bacteria 5403
1301 Ga0395905_0028881 3300037471 Bacteria 5227
1302 Ga0395905_0052508 3300037471 Bacteria 3816
1303 Ga0395905_0053153 3300037471 Bacteria 3791
1304 Ga0395905_0069550 3300037471 Bacteria 3297
1305 Ga0395905_0073168 3300037471 Bacteria 3212
1306 Ga0395905_0078062 3300037471 Bacteria 3102
1307 Ga0395905_0099480 3300037471 Bacteria 2731
1308 Ga0395905_0105334 3300037471 Bacteria 2648
1309 Ga0395905_0243645 3300037471 Bacteria 1679
1310 Ga0436364_0040477 3300037853 Bacteria 8459
1311 Ga0436364_0140547 3300037853 Bacteria 2589
1312 Ga0436364_0206741 3300037853 Bacteria 3240
1313 Ga0436364_1038812 3300037853 Bacteria 24190
1314 Ga0436364_1176408 3300037853 Bacteria 4490
1315 Ga0395901_0000167 3300038443 Bacteria 85844
1316 Ga0395901_0000232 3300038443 Bacteria 69963
1317 Ga0395901_0001005 3300038443 Bacteria 30513
1318 Ga0395901_0001222 3300038443 Bacteria 27379
1319 Ga0395901_0002015 3300038443 Bacteria 20901
1320 Ga0395901_0007044 3300038443 Bacteria 11365
1321 Ga0395901_0008904 3300038443 Bacteria 10165
1322 Ga0395901_0009785 3300038443 Bacteria 9723
1323 Ga0395901_0010259 3300038443 Bacteria 9488
1324 Ga0395901_0012489 3300038443 Bacteria 8618
1325 Ga0395901_0019035 3300038443 Bacteria 7019
1326 Ga0395901_0024655 3300038443 Bacteria 6176
1327 Ga0395901_0027973 3300038443 Bacteria 5797
1328 Ga0395901_0042882 3300038443 Bacteria 4692
1329 Ga0395901_0047177 3300038443 Bacteria 4473
1330 Ga0395901_0050356 3300038443 Bacteria 4328
1331 Ga0395901_0065314 3300038443 Bacteria 3788
1332 Ga0395901_0114655 3300038443 Bacteria 2830
1333 Ga0395901_0122103 3300038443 Bacteria 2738
1334 Ga0395901_0135260 3300038443 Bacteria 2591
1335 Ga0395901_0146265 3300038443 Bacteria 2484
1336 Ga0395901_0150947 3300038443 Bacteria 2442
1337 Ga0395901_0314120 3300038443 Bacteria 1622
1338 Ga0436365_0005019 3300039437 Bacteria 3326
1339 Ga0436365_0142234 3300039437 Bacteria 7973
1340 Ga0436365_0158844 3300039437 Bacteria 4677
1341 Ga0436365_0463115 3300039437 Bacteria 13950
1342 Ga0436365_0484364 3300039437 Bacteria 53953
1343 Ga0436365_0567701 3300039437 Bacteria 13379
1344 Ga0436365_0714679 3300039437 Bacteria 1725
1345 Ga0436365_0790831 3300039437 Bacteria 15194
1346 Ga0436365_1205090 3300039437 Bacteria 128002
1347 Ga0436365_1460153 3300039437 Bacteria 77405
1348 Ga0436365_1487752 3300039437 Bacteria 4629
1349 Ga0436365_1625582 3300039437 Bacteria 25653
1350 Ga0436365_1723092 3300039437 Bacteria 6835
1351 Ga0436360_0870404 3300039438 Bacteria 1659
1352 Ga0436361_0418711 3300039447 Bacteria 2750
1353 Ga0436361_0767272 3300039447 Bacteria 33690
1354 Ga0436361_1014773 3300039447 Bacteria 4660
1355 Ga0436363_0610096 3300039450 Bacteria 8494
1356 Ga0436362_0395602 3300039453 Bacteria 4018
1357 Ga0436362_0461905 3300039453 Bacteria 3656
1358 Ga0436362_0634959 3300039453 Bacteria 65311
1359 Ga0439461_0000185 3300041410 Bacteria 8524
1360 Ga0439461_0000509 3300041410 Bacteria 5644
1361 Ga0439466_0008577 3300041411 Bacteria 3851
1362 Ga0439466_0010668 3300041411 Bacteria 3414
1363 Ga0439465_0001455 3300041413 Bacteria 7665
1364 Ga0439465_0003295 3300041413 Bacteria 5274
1365 Ga0439465_0006654 3300041413 Bacteria 3670
1366 Ga0439465_0007084 3300041413 Bacteria 3564
1367 Ga0439465_0012336 3300041413 Bacteria 2674
1368 Ga0439431_0000154 3300041997 Bacteria 12647
1369 Ga0439431_0001441 3300041997 Bacteria 5254
1370 Ga0439431_0014052 3300041997 Bacteria 1853
1371 Ga0439441_006682 3300042001 Bacteria 1837
1372 Ga0439445_0011468 3300042004 Bacteria 2115
1373 Ga0439448_0001228 3300042005 Bacteria 6542
1374 Ga0439452_010805 3300042010 Bacteria 2642
1375 Ga0439446_0010505 3300042156 Bacteria 2495
1376 Ga0439446_0016003 3300042156 Bacteria 2086
1377 Ga0439458_0000074 3300042157 Bacteria 18402
1378 Ga0439458_0011513 3300042157 Bacteria 1979
1379 Ga0439434_0001116 3300042435 Bacteria 7760
1380 Ga0439464_0004011 3300042439 Bacteria 3748
1381 Ga0466969_0001258 3300044656 Bacteria 13667
1382 Ga0466969_0029365 3300044656 Bacteria 2807
1383 Ga0466972_0006865 3300044658 Bacteria 5714
1384 Ga0466972_0018879 3300044658 Bacteria 3446
1385 Ga0466972_0025490 3300044658 Bacteria 2931
1386 Ga0453683_0005062 3300044673 Bacteria 9253
1387 Ga0453683_0015023 3300044673 Bacteria 5027
1388 Ga0453683_0017222 3300044673 Bacteria 4655
1389 Ga0466965_0025024 3300044683 Bacteria 2888
1390 Ga0466965_0049346 3300044683 Bacteria 2086
1391 Ga0466965_0084498 3300044683 Bacteria 1608
1392 Ga0466966_0000994 3300044684 Bacteria 18155
1393 Ga0466966_0007032 3300044684 Bacteria 7451
1394 Ga0466966_0012243 3300044684 Bacteria 5682
1395 Ga0466966_0065145 3300044684 Bacteria 2292
1396 Ga0466961_0032775 3300044693 Bacteria 3338
1397 Ga0466961_0108767 3300044693 Bacteria 1745
1398 Ga0466963_0002039 3300044694 Bacteria 11121
1399 Ga0466963_0011975 3300044694 Bacteria 5297
1400 Ga0466963_0045631 3300044694 Bacteria 2887
1401 Ga0466964_0002516 3300044706 Bacteria 6519
1402 Ga0453684_0032752 3300044712 Bacteria 7262
1403 Ga0453684_0095577 3300044712 Bacteria 3652
1404 Ga0466971_0022988 3300044719 Bacteria 2779
1405 Ga0466971_0039235 3300044719 Bacteria 2125
1406 Ga0466968_0001476 3300044735 Bacteria 8419
1407 Ga0466970_0000170 3300044765 Bacteria 30839
1408 Ga0466970_0003173 3300044765 Bacteria 7989
1409 Ga0466970_0018515 3300044765 Bacteria 3606
1410 Ga0466970_0023360 3300044765 Bacteria 3228
1411 Ga0466957_0004154 3300044842 Bacteria 8021
1412 Ga0466957_0046232 3300044842 Bacteria 2642
1413 Ga0466957_0060038 3300044842 Bacteria 2331
1414 Ga0466957_0075392 3300044842 Bacteria 2093
1415 Ga0466960_0000298 3300044901 Bacteria 17254
1416 Ga0466960_0005318 3300044901 Bacteria 5090
1417 Ga0466959_0006453 3300045049 Bacteria 8122
1418 Ga0466959_0008755 3300045049 Bacteria 7165
1419 Ga0466959_0099667 3300045049 Bacteria 2080
1420 Ga0451576_0000017 3300045051 Bacteria 558261
1421 Ga0451576_0012723 3300045051 Bacteria 9446
1422 Ga0451576_0036689 3300045051 Bacteria 5195
1423 Ga0466958_0000981 3300045836 Bacteria 12891
1424 Ga0466958_0008787 3300045836 Bacteria 5610
1425 Ga0466958_0018974 3300045836 Bacteria 3998
1426 Ga0466958_0077172 3300045836 Bacteria 2046
1427 Ga0466967_0001069 3300045976 Bacteria 15118
1428 Ga0466967_0012795 3300045976 Bacteria 6446
1429 Ga0466967_0015458 3300045976 Bacteria 5983
1430 Ga0466967_0061043 3300045976 Bacteria 3343
1431 Ga0466967_0133113 3300045976 Bacteria 2310
1432 Ga0495627_000189 3300046453 Bacteria 68103
1433 Ga0495592_0020816 3300046454 Bacteria 4989
1434 Ga0495592_0026172 3300046454 Bacteria 4425
1435 Ga0495629_0007149 3300046459 Bacteria 8224
1436 Ga0495629_0032761 3300046459 Bacteria 3678
1437 Ga0495629_0036913 3300046459 Bacteria 3447
1438 Ga0495638_0000593 3300046460 Bacteria 40881
1439 Ga0495638_0011334 3300046460 Bacteria 6143
1440 Ga0495641_0012247 3300046461 Bacteria 4811
1441 Ga0495641_0044694 3300046461 Bacteria 2042
1442 Ga0495650_0000030 3300046471 Bacteria 436318
1443 Ga0495639_0034093 3300046475 Bacteria 2276
1444 Ga0495594_0111141 3300046499 Bacteria 1545
1445 Ga0495596_0002343 3300046500 Bacteria 10258
1446 Ga0495583_0000286 3300046506 Bacteria 80417
1447 Ga0495606_0000598 3300046507 Bacteria 57087
1448 Ga0495606_0066391 3300046507 Bacteria 2288
1449 Ga0495608_0037098 3300046511 Bacteria 3278
1450 Ga0495610_0000046 3300046512 Bacteria 153789
1451 Ga0495610_0013516 3300046512 Bacteria 4849
1452 Ga0495610_0019406 3300046512 Bacteria 3805
1453 Ga0495618_0073195 3300046514 Bacteria 2181
1454 Ga0495628_0013061 3300046516 Bacteria 6994
1455 Ga0495628_0052579 3300046516 Bacteria 3217
1456 Ga0495637_0010370 3300046520 Bacteria 4511
1457 Ga0495637_0041438 3300046520 Bacteria 1975
1458 Ga0495643_0000332 3300046522 Bacteria 64478
1459 Ga0495643_0004547 3300046522 Bacteria 9659
1460 Ga0495643_0010673 3300046522 Bacteria 5643
1461 Ga0495648_0000189 3300046524 Bacteria 70824
1462 Ga0495648_0012148 3300046524 Bacteria 6442
1463 Ga0495642_0020118 3300046528 Bacteria 2619
1464 Ga0495654_0000048 3300046530 Bacteria 147348
1465 Ga0495640_0087745 3300046533 Bacteria 2057
1466 Ga0495587_0021777 3300046536 Bacteria 3955
1467 Ga0495598_0005329 3300046537 Bacteria 2843
1468 Ga0495609_0034585 3300046538 Bacteria 2290
1469 Ga0495645_0000656 3300046543 Bacteria 23844
1470 Ga0495645_0004742 3300046543 Bacteria 9292
1471 Ga0495622_0002164 3300046557 Bacteria 9569
1472 Ga0495668_0000015 3300046616 Bacteria 441932
1473 Ga0495668_0000352 3300046616 Bacteria 61322
1474 Ga0495668_0017446 3300046616 Bacteria 4164
1475 Ga0495668_0021658 3300046616 Bacteria 3683
1476 Ga0495634_0105098 3300046642 Bacteria 1821
1477 Ga0495611_0007526 3300046648 Bacteria 4623
1478 Ga0495625_0000054 3300046660 Bacteria 187599
1479 Ga0495625_0007142 3300046660 Bacteria 9808
1480 Ga0495625_0129508 3300046660 Bacteria 1710
1481 Ga0495635_0013502 3300046663 Bacteria 5715
1482 Ga0495635_0112562 3300046663 Bacteria 1859
1483 Ga0495588_0047909 3300046674 Bacteria 2195
1484 Ga0495599_0012174 3300046678 Bacteria 5297
1485 Ga0495646_0012592 3300046680 Bacteria 5375
1486 Ga0495669_0000613 3300046684 Bacteria 15538
1487 Ga0495669_0011329 3300046684 Bacteria 3786
1488 Ga0495669_0025170 3300046684 Bacteria 2594
1489 Ga0495624_0035242 3300046690 Bacteria 3231
1490 Ga0495670_0000015 3300046691 Bacteria 131137
1491 Ga0495649_0002867 3300046694 Bacteria 11950
1492 Ga0495600_0009290 3300046809 Bacteria 6069
1493 Ga0495581_0019489 3300047315 Bacteria 3938
1494 Ga0495604_0020211 3300047317 Bacteria 5321
1495 Ga0495674_0026786 3300047319 Bacteria 5273
1496 Ga0495672_0002169 3300047320 Bacteria 18286
1497 Ga0495672_0023065 3300047320 Bacteria 4035
1498 Ga0495672_0034513 3300047320 Bacteria 3124
1499 Ga0495672_0045360 3300047320 Bacteria 2630
1500 Ga0495680_0017868 3300047322 Bacteria 6036
1501 Ga0495687_013923 3300047443 Bacteria 4168
1502 Ga0495677_0011627 3300047445 Bacteria 3218
1503 Ga0495673_0001996 3300047469 Bacteria 15032
1504 Ga0495684_0009505 3300047471 Bacteria 7502
1505 Ga0495684_0086821 3300047471 Bacteria 2371
1506 Ga0495686_0000023 3300047472 Bacteria 400457
1507 Ga0495686_0000579 3300047472 Bacteria 51834
1508 Ga0495686_0000903 3300047472 Bacteria 37367
1509 Ga0495686_0002754 3300047472 Bacteria 16062
1510 Ga0495686_0017403 3300047472 Unclassified 4845
1511 Ga0495593_0003370 3300047673 Bacteria 9576
1512 Ga0495593_0015804 3300047673 Bacteria 4265
1513 Ga0495593_0038290 3300047673 Bacteria 2590
1514 Ga0495602_0008181 3300048088 Bacteria 10926
1515 Ga0495602_0147847 3300048088 Bacteria 1851
1516 Ga0495626_0001517 3300048091 Bacteria 18250
1517 Ga0496100_0000109 3300048903 Bacteria 47454
1518 Ga0496100_0002884 3300048903 Bacteria 8817
1519 Ga0496100_0003669 3300048903 Bacteria 8034
1520 Ga0496100_0007695 3300048903 Bacteria 5963
1521 Ga0496100_0033974 3300048903 Bacteria 3195
1522 Ga0496101_0000020 3300048904 Bacteria 218859
1523 Ga0496101_0000075 3300048904 Bacteria 112785
1524 Ga0496101_0000310 3300048904 Bacteria 33833
1525 Ga0496101_0001332 3300048904 Bacteria 14794
1526 Ga0496101_0002044 3300048904 Bacteria 12282
1527 Ga0496101_0003714 3300048904 Bacteria 9522
1528 Ga0496101_0031192 3300048904 Bacteria 3744
1529 Ga0496101_0042352 3300048904 Bacteria 3250
1530 Ga0496101_0135245 3300048904 Bacteria 1875
1531 Ga0496102_0000003 3300048905 Bacteria 592263
1532 Ga0496102_0000126 3300048905 Bacteria 105053
1533 Ga0496102_0000260 3300048905 Bacteria 67869
1534 Ga0496102_0002509 3300048905 Bacteria 15658
1535 Ga0496102_0002696 3300048905 Bacteria 15099
1536 Ga0496102_0004756 3300048905 Bacteria 11489
1537 Ga0496102_0016728 3300048905 Bacteria 6414
1538 Ga0496102_0024275 3300048905 Bacteria 5389
1539 Ga0496102_0086610 3300048905 Bacteria 2893
1540 Ga0496102_0126959 3300048905 Bacteria 2385
1541 Ga0496103_0000014 3300048906 Bacteria 290397
1542 Ga0496103_0000089 3300048906 Bacteria 104353
1543 Ga0496103_0000093 3300048906 Bacteria 100010
1544 Ga0496103_0000171 3300048906 Bacteria 67895
1545 Ga0496103_0003295 3300048906 Bacteria 9880
1546 Ga0496103_0047241 3300048906 Bacteria 2659
1547 Ga0496103_0103463 3300048906 Bacteria 1804
1548 Ga0496104_0000315 3300048907 Bacteria 43085
1549 Ga0496104_0000892 3300048907 Bacteria 25671
1550 Ga0496104_0000934 3300048907 Bacteria 25066
1551 Ga0496104_0002562 3300048907 Bacteria 15662
1552 Ga0496104_0004658 3300048907 Bacteria 11933
1553 Ga0496104_0008405 3300048907 Bacteria 9176
1554 Ga0496104_0047066 3300048907 Bacteria 4064
1555 Ga0496104_0162809 3300048907 Bacteria 2140
1556 Ga0496104_0208548 3300048907 Bacteria 1866
1557 Ga0496104_0224545 3300048907 Bacteria 1790
1558 Ga0496105_0000162 3300048908 Bacteria 44507
1559 Ga0496105_0001760 3300048908 Bacteria 15478
1560 Ga0496105_0003992 3300048908 Bacteria 11047
1561 Ga0496105_0013485 3300048908 Bacteria 6489
1562 Ga0496105_0042550 3300048908 Bacteria 3744
1563 Ga0496106_0000500 3300048909 Bacteria 27760
1564 Ga0496106_0002456 3300048909 Bacteria 13809
1565 Ga0496106_0002847 3300048909 Bacteria 12845
1566 Ga0496106_0004836 3300048909 Bacteria 9966
1567 Ga0496106_0011313 3300048909 Bacteria 6604
1568 Ga0496106_0011738 3300048909 Bacteria 6467
1569 Ga0496106_0052686 3300048909 Bacteria 3071
1570 Ga0496107_0000883 3300048910 Bacteria 17669
1571 Ga0496107_0002241 3300048910 Bacteria 12454
1572 Ga0496107_0005283 3300048910 Bacteria 8824
1573 Ga0496107_0017601 3300048910 Bacteria 5027
1574 Ga0496107_0018545 3300048910 Bacteria 4900
1575 Ga0496107_0023740 3300048910 Bacteria 4334
1576 Ga0496107_0041504 3300048910 Bacteria 3303
1577 Ga0496107_0048719 3300048910 Bacteria 3053
1578 Ga0496107_0063572 3300048910 Bacteria 2675
1579 Ga0496107_0166591 3300048910 Bacteria 1634
1580 Ga0496108_0000222 3300048911 Bacteria 50962
1581 Ga0496108_0000405 3300048911 Bacteria 35593
1582 Ga0496108_0001588 3300048911 Bacteria 18009
1583 Ga0496108_0001675 3300048911 Bacteria 17589
1584 Ga0496108_0008147 3300048911 Bacteria 8500
1585 Ga0496108_0008946 3300048911 Bacteria 8114
1586 Ga0496108_0026644 3300048911 Bacteria 4770
1587 Ga0496108_0043373 3300048911 Bacteria 3757
1588 Ga0496108_0057729 3300048911 Bacteria 3261
1589 Ga0496108_0073965 3300048911 Bacteria 2877
1590 Ga0496109_0000440 3300048912 Bacteria 35903
1591 Ga0496109_0001534 3300048912 Bacteria 19228
1592 Ga0496109_0004236 3300048912 Bacteria 11975
1593 Ga0496109_0005102 3300048912 Bacteria 10966
1594 Ga0496109_0009526 3300048912 Bacteria 8278
1595 Ga0496109_0011881 3300048912 Bacteria 7496
1596 Ga0496109_0066427 3300048912 Bacteria 3302
1597 Ga0496110_0000032 3300048913 Bacteria 65830
1598 Ga0496110_0004600 3300048913 Bacteria 10718
1599 Ga0496110_0011986 3300048913 Bacteria 7121
1600 Ga0496110_0016028 3300048913 Bacteria 6251
1601 Ga0496110_0018619 3300048913 Bacteria 5824
1602 Ga0496110_0026450 3300048913 Bacteria 4966
1603 Ga0496110_0034017 3300048913 Bacteria 4411
1604 Ga0496110_0162875 3300048913 Bacteria 2022
1605 Ga0496110_0210593 3300048913 Bacteria 1767
1606 Ga0496111_0003922 3300048914 Bacteria 9325
1607 Ga0496111_0009851 3300048914 Bacteria 6388
1608 Ga0496111_0020713 3300048914 Bacteria 4583
1609 Ga0496111_0027242 3300048914 Bacteria 4041
1610 Ga0496111_0028741 3300048914 Bacteria 3941
1611 Ga0496111_0043864 3300048914 Bacteria 3215
1612 Ga0496111_0045302 3300048914 Bacteria 3164
1613 Ga0496111_0057987 3300048914 Bacteria 2803
1614 Ga0496111_0062431 3300048914 Bacteria 2702
1615 Ga0496112_0000610 3300048915 Bacteria 24634
1616 Ga0496112_0016969 3300048915 Bacteria 6833
1617 Ga0496112_0026961 3300048915 Bacteria 5538
1618 Ga0496112_0035098 3300048915 Bacteria 4881
1619 Ga0496112_0042739 3300048915 Bacteria 4435
1620 Ga0496112_0058587 3300048915 Bacteria 3793
1621 Ga0496112_0067518 3300048915 Bacteria 3529
1622 Ga0496112_0081443 3300048915 Bacteria 3201
1623 Ga0496112_0085440 3300048915 Bacteria 3121
1624 Ga0496112_0100366 3300048915 Bacteria 2864
1625 Ga0496113_0001800 3300048916 Bacteria 12155
1626 Ga0496113_0009324 3300048916 Bacteria 6434
1627 Ga0496113_0018117 3300048916 Bacteria 4900
1628 Ga0496113_0019462 3300048916 Bacteria 4749
1629 Ga0496113_0019828 3300048916 Bacteria 4714
1630 Ga0496113_0020159 3300048916 Bacteria 4681
1631 Ga0496113_0060290 3300048916 Bacteria 2860
1632 Ga0496113_0072045 3300048916 Bacteria 2629
1633 Ga0496113_0116933 3300048916 Bacteria 2081
1634 Ga0496114_0000006 3300048917 Bacteria 472921
1635 Ga0496114_0000181 3300048917 Bacteria 45025
1636 Ga0496114_0008650 3300048917 Bacteria 8068
1637 Ga0496114_0016477 3300048917 Bacteria 5957
1638 Ga0496114_0016728 3300048917 Bacteria 5915
1639 Ga0496114_0029912 3300048917 Bacteria 4478
1640 Ga0496114_0037359 3300048917 Bacteria 4016
1641 Ga0496114_0045052 3300048917 Bacteria 3663
1642 Ga0496114_0115066 3300048917 Bacteria 2307
1643 Ga0496115_0000147 3300048918 Bacteria 64872
1644 Ga0496115_0003000 3300048918 Bacteria 12126
1645 Ga0496115_0003195 3300048918 Bacteria 11766
1646 Ga0496115_0005883 3300048918 Bacteria 8941
1647 Ga0496115_0007247 3300048918 Bacteria 8149
1648 Ga0496115_0011153 3300048918 Bacteria 6733
1649 Ga0496115_0037928 3300048918 Bacteria 3821
1650 Ga0496115_0053894 3300048918 Bacteria 3229
1651 Ga0496115_0063030 3300048918 Bacteria 2991
1652 Ga0496116_0000039 3300048919 Bacteria 349134
1653 Ga0496116_0000071 3300048919 Bacteria 244521
1654 Ga0496116_0011639 3300048919 Bacteria 7258
1655 Ga0496116_0014852 3300048919 Bacteria 6189
1656 Ga0496116_0104971 3300048919 Bacteria 1677
1657 Ga0496117_0000003 3300048920 Bacteria 1881097
1658 Ga0496117_0000121 3300048920 Bacteria 171532
1659 Ga0496117_0000329 3300048920 Bacteria 83691
1660 Ga0496117_0000606 3300048920 Bacteria 58662
1661 Ga0496117_0000711 3300048920 Bacteria 52638
1662 Ga0496117_0065124 3300048920 Bacteria 2480
1663 Ga0496117_0112898 3300048920 Bacteria 1688
1664 Ga0496118_0000001 3300048921 Bacteria 1881100
1665 Ga0496118_0000095 3300048921 Bacteria 164850
1666 Ga0496118_0000164 3300048921 Bacteria 119381
1667 Ga0496118_0000359 3300048921 Bacteria 77146
1668 Ga0496118_0000488 3300048921 Bacteria 65611
1669 Ga0496118_0000683 3300048921 Bacteria 55137
1670 Ga0496118_0009165 3300048921 Bacteria 10054
1671 Ga0496118_0022231 3300048921 Bacteria 5553
1672 Ga0496118_0027075 3300048921 Bacteria 4860
1673 Ga0496118_0087913 3300048921 Bacteria 2152
1674 Ga0496119_0000266 3300048922 Bacteria 74075
1675 Ga0496119_0002301 3300048922 Bacteria 21118
1676 Ga0496119_0010303 3300048922 Bacteria 7880
1677 Ga0496119_0012296 3300048922 Bacteria 6972
1678 Ga0496120_0000235 3300048923 Bacteria 94653
1679 Ga0496120_0001188 3300048923 Bacteria 33095
1680 Ga0496121_0000002 3300048924 Bacteria 1494588
1681 Ga0496121_0000019 3300048924 Bacteria 499976
1682 Ga0496121_0000061 3300048924 Bacteria 275757
1683 Ga0496121_0000232 3300048924 Bacteria 119519
1684 Ga0496121_0000387 3300048924 Bacteria 89835
1685 Ga0496121_0000733 3300048924 Bacteria 60446
1686 Ga0496121_0003147 3300048924 Bacteria 23806
1687 Ga0496121_0004752 3300048924 Bacteria 17931
1688 Ga0496121_0006826 3300048924 Bacteria 13964
1689 Ga0496122_0000312 3300048925 Bacteria 107109
1690 Ga0496122_0001014 3300048925 Bacteria 49714
1691 Ga0496122_0001502 3300048925 Bacteria 37251
1692 Ga0496122_0001526 3300048925 Bacteria 36870
1693 Ga0496122_0004400 3300048925 Bacteria 17539
1694 Ga0496122_0023511 3300048925 Bacteria 5430
1695 Ga0496122_0049719 3300048925 Bacteria 3206
1696 Ga0496122_0083593 3300048925 Bacteria 2212
1697 Ga0496122_0087400 3300048925 Bacteria 2142
1698 Ga0496123_0000212 3300048926 Bacteria 118628
1699 Ga0496123_0002207 3300048926 Bacteria 24751
1700 Ga0496123_0003840 3300048926 Bacteria 16384
1701 Ga0496123_0004892 3300048926 Bacteria 13763
1702 Ga0496123_0033490 3300048926 Bacteria 3696
1703 Ga0496123_0073643 3300048926 Bacteria 2118
1704 Ga0496124_0000002 3300048927 Bacteria 1494588
1705 Ga0496124_0000041 3300048927 Bacteria 303887
1706 Ga0496124_0000119 3300048927 Bacteria 163996
1707 Ga0496124_0000609 3300048927 Bacteria 60122
1708 Ga0496124_0001412 3300048927 Bacteria 35756
1709 Ga0496124_0002126 3300048927 Bacteria 26658
1710 Ga0496124_0008807 3300048927 Bacteria 10480
1711 Ga0496124_0017007 3300048927 Bacteria 6881
1712 Ga0496124_0034532 3300048927 Bacteria 4436
1713 Ga0496124_0152267 3300048927 Bacteria 1812
1714 Ga0496125_0000002 3300048928 Bacteria 1480920
1715 Ga0496125_0000060 3300048928 Bacteria 264143
1716 Ga0496125_0000639 3300048928 Bacteria 58529
1717 Ga0496125_0002810 3300048928 Bacteria 21973
1718 Ga0496125_0006777 3300048928 Bacteria 12306
1719 Ga0496125_0008596 3300048928 Bacteria 10658
1720 Ga0496125_0012568 3300048928 Bacteria 8391
1721 Ga0496125_0017755 3300048928 Bacteria 6772
1722 Ga0496125_0019071 3300048928 Bacteria 6488
1723 Ga0496125_0071840 3300048928 Bacteria 2701
1724 Ga0496125_0108016 3300048928 Bacteria 2026
1725 Ga0496125_0140848 3300048928 Bacteria 1677
1726 Ga0496126_0000011 3300048929 Bacteria 744275
1727 Ga0496126_0000041 3300048929 Bacteria 340389
1728 Ga0496126_0000324 3300048929 Bacteria 101936
1729 Ga0496126_0003151 3300048929 Bacteria 21253
1730 Ga0496126_0003649 3300048929 Bacteria 19231
1731 Ga0496126_0004196 3300048929 Bacteria 17363
1732 Ga0496126_0005320 3300048929 Bacteria 14768
1733 Ga0496126_0012605 3300048929 Bacteria 8653
1734 Ga0496126_0022964 3300048929 Bacteria 6054
1735 Ga0496126_0027502 3300048929 Bacteria 5431
1736 Ga0496126_0035524 3300048929 Bacteria 4671
1737 Ga0496126_0056953 3300048929 Bacteria 3531
1738 Ga0496126_0140238 3300048929 Bacteria 2082
1739 Ga0495682_0018613 3300049460 Bacteria 2616
1740 Ga0501300_001280 3300049523 Bacteria 3792
1741 Ga0501032_0000469 3300049569 Bacteria 32526
1742 Ga0501032_0001987 3300049569 Bacteria 16109
1743 Ga0501032_0078347 3300049569 Bacteria 2200
1744 Ga0501033_0001498 3300049570 Bacteria 20686
1745 Ga0501033_0075794 3300049570 Bacteria 2469
1746 Ga0501033_0107393 3300049570 Bacteria 2033
1747 Ga0501033_0138266 3300049570 Bacteria 1762
1748 Ga0501034_0000176 3300049571 Bacteria 119228
1749 Ga0501034_0001299 3300049571 Bacteria 33800
1750 Ga0501034_0002830 3300049571 Bacteria 20227
1751 Ga0501034_0015495 3300049571 Bacteria 7832
1752 Ga0501034_0053873 3300049571 Bacteria 4050
1753 Ga0501034_0117074 3300049571 Bacteria 2652
1754 Ga0501034_0124867 3300049571 Bacteria 2559
1755 Ga0501034_0142281 3300049571 Bacteria 2378
1756 Ga0501034_0185902 3300049571 Bacteria 2041
1757 Ga0501036_0024625 3300049572 Bacteria 5075
1758 Ga0501036_0105756 3300049572 Bacteria 2380
1759 Ga0501038_0000365 3300049574 Bacteria 39105
1760 Ga0501038_0006551 3300049574 Bacteria 10769
1761 Ga0501038_0015639 3300049574 Bacteria 6897
1762 Ga0501039_0000113 3300049575 Bacteria 54895
1763 Ga0501039_0031681 3300049575 Bacteria 4077
1764 Ga0501041_0032024 3300049577 Bacteria 3178
1765 Ga0501043_0000082 3300049579 Bacteria 84442
1766 Ga0501046_0000441 3300049580 Bacteria 41763
1767 Ga0501046_0066197 3300049580 Bacteria 2817
1768 Ga0501047_0001270 3300049581 Bacteria 24972
1769 Ga0501047_0004362 3300049581 Bacteria 13313
1770 Ga0501047_0006865 3300049581 Bacteria 10697
1771 Ga0501047_0016563 3300049581 Bacteria 7038
1772 Ga0501047_0066372 3300049581 Bacteria 3478
1773 Ga0501047_0079801 3300049581 Bacteria 3146
1774 Ga0501047_0212925 3300049581 Bacteria 1790
1775 Ga0501067_0008234 3300049583 Bacteria 5789
1776 Ga0501070_0001505 3300049586 Bacteria 20787
1777 Ga0501070_0033923 3300049586 Bacteria 4270
1778 Ga0501071_0066579 3300049587 Bacteria 2618
1779 Ga0501072_0019906 3300049588 Bacteria 5194
1780 Ga0501073_0024864 3300049589 Bacteria 4299
1781 Ga0501073_0033007 3300049589 Bacteria 3688
1782 Ga0501074_0019317 3300049590 Bacteria 4950
1783 Ga0501075_0011885 3300049591 Bacteria 6176
1784 Ga0501075_0036159 3300049591 Bacteria 3686
1785 Ga0501076_0090015 3300049592 Bacteria 2468
1786 Ga0501077_0034187 3300049593 Bacteria 3235
1787 Ga0501077_0047698 3300049593 Bacteria 2722
1788 Ga0501249_000202 3300049679 Bacteria 18257
1789 Ga0501257_000527 3300049686 Bacteria 7611
1790 Ga0501079_0030608 3300049741 Bacteria 4136
1791 Ga0501079_0034917 3300049741 Bacteria 3869
1792 Ga0501080_0003050 3300049742 Bacteria 14785
1793 Ga0501081_0044143 3300049743 Bacteria 3059
1794 Ga0501081_0047073 3300049743 Bacteria 2966
1795 Ga0501083_0033452 3300049744 Bacteria 3520
1796 Ga0501083_0094110 3300049744 Bacteria 1978
1797 Ga0501035_0002808 3300049822 Bacteria 16843
1798 Ga0501035_0004316 3300049822 Bacteria 13512
1799 Ga0501035_0009531 3300049822 Bacteria 9030
1800 Ga0501035_0038425 3300049822 Bacteria 4334
1801 Ga0501035_0087021 3300049822 Bacteria 2753
1802 Ga0501035_0112024 3300049822 Bacteria 2391
1803 Ga0501035_0142030 3300049822 Bacteria 2087
1804 Ga0501044_0003845 3300049823 Bacteria 16843
1805 Ga0501044_0009175 3300049823 Bacteria 10806
1806 Ga0501044_0010779 3300049823 Bacteria 9918
1807 Ga0501044_0013412 3300049823 Bacteria 8862
1808 Ga0501044_0014692 3300049823 Bacteria 8442
1809 Ga0501044_0014788 3300049823 Bacteria 8413
1810 Ga0501044_0083798 3300049823 Bacteria 3223
1811 Ga0501044_0154043 3300049823 Bacteria 2279
1812 Ga0501044_0184573 3300049823 Bacteria 2051
1813 Ga0501045_0050318 3300049824 Bacteria 3040
1814 nmdc:mga03683_47519_c1 3300050489 Bacteria 1781
1815 nmdc:mga03n38_1064_c1 3300050490 Bacteria 7571
1816 nmdc:mga03n38_3813_c1 3300050490 Bacteria 4900
1817 nmdc:mga00v17_274_c1 3300050491 Bacteria 30424
1818 nmdc:mga00v17_3698_c1 3300050491 Bacteria 7904
1819 nmdc:mga00v17_4868_c1 3300050491 Bacteria 7037
1820 nmdc:mga00v17_5797_c2 3300050491 Bacteria 3941
1821 nmdc:mga00v17_79848_c1 3300050491 Bacteria 2041
1822 nmdc:mga0yw44_21353_c1 3300050492 Bacteria 3610
1823 nmdc:mga0yw44_21535_c1 3300050492 Bacteria 3598
1824 nmdc:mga0k408_11932_c1 3300050493 Bacteria 4740
1825 nmdc:mga0k408_33111_c1 3300050493 Bacteria 2954
1826 nmdc:mga06z11_15096_c1 3300050494 Bacteria 3439
1827 nmdc:mga06z11_4788_c1 3300050494 Bacteria 5355
1828 nmdc:mga04h51_15027_c1 3300050495 Bacteria 2224
1829 nmdc:mga04h51_45_c1 3300050495 Bacteria 40312
1830 nmdc:mga07m45_1682_c1 3300050496 Bacteria 10177
1831 nmdc:mga07m45_43700_c1 3300050496 Bacteria 2512
1832 nmdc:mga07m45_45644_c1 3300050496 Bacteria 2460
1833 nmdc:mga05p37_106164_c1 3300050507 Bacteria 3455
1834 nmdc:mga05p37_127402_c1 3300050507 Bacteria 3126
1835 nmdc:mga05p37_430_c1 3300050507 Bacteria 45408
1836 nmdc:mga09592_259197_c1 3300050508 Bacteria 1508
1837 nmdc:mga0qj67_11808_c1 3300050509 Bacteria 6556
1838 nmdc:mga0qj67_77598_c1 3300050509 Bacteria 2658
1839 nmdc:mga06r32_1291_c1 3300050510 Bacteria 22555
1840 nmdc:mga06r32_763_c1 3300050510 Bacteria 28387
1841 nmdc:mga08y16_1565_c1 3300050511 Bacteria 23071
1842 nmdc:mga08y16_273987_c1 3300050511 Bacteria 1741
1843 nmdc:mga08y16_55327_c1 3300050511 Bacteria 4147
1844 nmdc:mga0n895_153_c1 3300050512 Bacteria 42630
1845 nmdc:mga0n895_31835_c1 3300050512 Bacteria 5055
1846 nmdc:mga0rr50_100_c1 3300050513 Bacteria 48322
1847 nmdc:mga0rr50_145764_c1 3300050513 Bacteria 1909
1848 nmdc:mga0rr50_2827_c1 3300050513 Bacteria 9871
1849 nmdc:mga08x19_22607_c2 3300050514 Bacteria 2596
1850 nmdc:mga08x19_23194_c1 3300050514 Bacteria 3849
1851 nmdc:mga08x19_24_c1 3300050514 Bacteria 245940
1852 nmdc:mga0a205_191_c2 3300050515 Bacteria 30461
1853 nmdc:mga0a205_38887_c1 3300050515 Bacteria 4578
1854 nmdc:mga0sz30_10629_c1 3300050516 Bacteria 3530
1855 nmdc:mga0sz30_1356_c1 3300050516 Bacteria 8744
1856 nmdc:mga0sz30_16205_c1 3300050516 Bacteria 2955
1857 nmdc:mga0sz30_33776_c1 3300050516 Bacteria 2127
1858 nmdc:mga0sz30_52451_c1 3300050516 Bacteria 1732
1859 nmdc:mga0sz30_9436_c1 3300050516 Bacteria 3714
1860 Ga0495601_0000068 3300053077 Bacteria 56524
1861 Ga0495601_0009741 3300053077 Bacteria 5682
1862 Ga0495612_0003612 3300053078 Bacteria 6417
1863 Ga0500635_0001009 3300053080 Bacteria 6738
1864 Ga0495655_0006068 3300053083 Bacteria 2174
1865 Ga0495595_0010358 3300053084 Bacteria 3873
1866 Ga0495619_0000154 3300053085 Bacteria 50900
1867 Ga0495619_0001765 3300053085 Bacteria 14387
1868 Ga0495619_0016353 3300053085 Bacteria 4696
1869 Ga0500643_000004 3300053087 Bacteria 857484
1870 Ga0500643_000245 3300053087 Bacteria 49888
1871 Ga0500643_000419 3300053087 Bacteria 32299
1872 Ga0500643_001415 3300053087 Bacteria 13867
1873 Ga0500643_001890 3300053087 Bacteria 11384
1874 Ga0500583_0026389 3300053092 Bacteria 2494
1875 Ga0500651_0029011 3300053093 Bacteria 3478
1876 Ga0500566_0000006 3300053094 Bacteria 153632
1877 Ga0500566_0055838 3300053094 Bacteria 2247
1878 Ga0500640_006355 3300053095 Bacteria 4500
1879 Ga0500641_0030815 3300053096 Bacteria 2111
1880 Ga0500650_0002576 3300053098 Bacteria 6033
1881 Ga0500555_000119 3300053103 Bacteria 37588
1882 Ga0500562_006590 3300053108 Bacteria 2926
1883 Ga0500608_000012 3300053122 Bacteria 91378
1884 Ga0500608_000098 3300053122 Bacteria 35436
1885 Ga0500618_000473 3300053125 Bacteria 26049
1886 Ga0500652_000895 3300053131 Bacteria 9819
1887 Ga0500658_0000037 3300053134 Bacteria 84326
1888 Ga0500559_0000003 3300053136 Bacteria 252693
1889 Ga0500559_0003063 3300053136 Bacteria 8351
1890 Ga0500559_0004488 3300053136 Bacteria 6611
1891 Ga0500559_0005074 3300053136 Bacteria 6100
1892 Ga0500559_0048714 3300053136 Bacteria 1865
1893 Ga0500573_0023933 3300053140 Bacteria 3509
1894 Ga0500590_003717 3300053148 Bacteria 7089
1895 Ga0500603_007606 3300053150 Bacteria 2384
1896 Ga0500604_0000048 3300053151 Bacteria 45446
1897 Ga0500616_0001872 3300053153 Bacteria 18976
1898 Ga0500616_0002132 3300053153 Bacteria 17148
1899 Ga0500616_0005608 3300053153 Bacteria 8474
1900 Ga0500616_0011416 3300053153 Bacteria 5247
1901 Ga0500616_0016614 3300053153 Bacteria 4186
1902 Ga0500620_000203 3300053155 Bacteria 11817
1903 Ga0500622_0012929 3300053156 Bacteria 4509
1904 Ga0500624_000041 3300053157 Bacteria 90321
1905 Ga0500627_0000029 3300053158 Bacteria 94759
1906 Ga0500627_0006675 3300053158 Bacteria 3951
1907 Ga0500639_000016 3300053163 Bacteria 118099
1908 Ga0500636_0011726 3300053177 Bacteria 5132
1909 Ga0500611_000077 3300053727 Bacteria 38126
1910 Ga0500645_000988 3300053730 Bacteria 16082
1911 Ga0500645_002767 3300053730 Bacteria 7588
1912 Ga0500645_026445 3300053730 Bacteria 1766
1913 Ga0500596_004688 3300053735 Bacteria 2483
1914 Ga0501084_0002530 3300054114 Bacteria 14730
1915 Ga0501084_0052022 3300054114 Bacteria 3427
1916 Ga0501084_0221052 3300054114 Bacteria 1598
1917 Ga0501082_0062480 3300060353 Bacteria 3206
1918 Ga0466962_0015555 3300061719 Bacteria 3669
1919 Ga0466962_0028235 3300061719 Bacteria 2688
1920 Ga0530510_0033473 3300061734 Bacteria 3700
1921 Ga0530510_0090690 3300061734 Bacteria 2229
1922 2509113276 2508501123 Bacteria 6283661
1923 2509369805 2509276018 Bacteria 6910194
1924 2509394194 2509276022 Bacteria 6200534
1925 2512037758 2511231221 Bacteria 6846400
1926 2512644233 2512564014 Bacteria 4639632
1927 2512933352 2512875016 Bacteria 6529530
1928 2512961456 2512875024 Bacteria 7195110
1929 2513592261 2513237087 Bacteria 5817514
1930 2513610427 2513237090 Bacteria 7096802
1931 2514036747 2513237164 Bacteria 7563725
1932 2514421492 2513237305 Bacteria 7293571
1933 2523382607 2523231044 Bacteria 6434991
1934 2548693476 2547132424 Bacteria 8348532
1935 2566991330 2565956761 Bacteria 6601618
1936 2588519421 2588253730 Bacteria 6881675
1937 2597811695 2597489875 Bacteria 7010078
1938 2599937176 2599185301 Bacteria 6161860
1939 2603858216 2602042107 Bacteria 6226103
1940 2620352709 2619619003 Bacteria 7619552
1941 2643777142 2643221551 Bacteria 3750538
1942 2643795590 2643221555 Bacteria 3749717
1943 2643819334 2643221560 Bacteria 4801179
1944 2643836049 2643221563 Bacteria 4726935
1945 2644052526 2643221608 Bacteria 4724829
1946 2644353110 2643221663 Bacteria 3425771
1947 2644516371 2643221692 Bacteria 7282860
1948 2644728155 2643221733 Bacteria 5690728
1949 2644733967 2643221734 Bacteria 5365412
1950 2688596541 2687453392 Bacteria 6880454
1951 2694629922 2693429783 Bacteria 7019804
1952 2694635734 2693429784 Bacteria 7241525
1953 2723573642 2721755686 Bacteria 7343952
1954 2738664290 2738541264 Bacteria 5935393
1955 2739143425 2738541356 Bacteria 5935017
1956 2739329977 2738543028 Bacteria 6917070
1957 2753035825 2751185725 Bacteria 5740550
1958 2753326150 2751185792 Bacteria 5739090
1959 2765468052 2765235802 Bacteria 5618596
1960 2770198789 2767802442 Bacteria 5747986
1961 2776377265 2775506925 Bacteria 7237746
1962 2819716759 2818991467 Bacteria 5893227
1963 2824746547 2824746037 Bacteria 7911610
1964 2834580613 2834578030 Bacteria 3530182
1965 2837653073 2837651117 Bacteria 3772164
1966 2839993172 2839993093 Bacteria 5512535
1967 2840766181 2840764183 Bacteria 6358399
1968 2840879346 2840878972 Bacteria 5483153
1969 2841736961 2841734538 Bacteria 6784580
1970 2842136811 2842134933 Bacteria 5847019
1971 2842890945 2842888712 Bacteria 4279094
1972 2847674314 2847670302 Bacteria 6165597
1973 2847690430 2847686936 Bacteria 6278406
1974 2852656026 2852653556 Bacteria 4050083
1975 2852683161 2852680915 Bacteria 4100189
1976 2855020565 2855020534 Bacteria 3204685
1977 2856317769 2856314179 Bacteria 6477897
1978 2856321170 2856320880 Bacteria 7263508
1979 2856328305 2856328259 Bacteria 6528202
1980 2856335582 2856334872 Bacteria 7037011
1981 2856342491 2856342000 Bacteria 7176905
1982 2856366410 2856364286 Bacteria 6939991
1983 2857356905 2857349434 Bacteria 7926032
1984 2857373057 2857367948 Bacteria 6965560
1985 2869165131 2869162929 Bacteria 6399702
1986 2869253955 2869249662 Bacteria 6868783
1987 2869270591 2869264136 Bacteria 6880765
1988 2869276665 2869271264 Bacteria 6908218
1989 2869285289 2869278585 Bacteria 7077053
1990 2869288179 2869285874 Bacteria 6901219
1991 2871430065 2871429161 Bacteria 6547891
1992 2871448414 2871444079 Bacteria 6423508
1993 2871453920 2871451962 Bacteria 7336357
1994 2871464113 2871459585 Bacteria 6866887
1995 2871479583 2871474448 Bacteria 6806570
1996 2871494725 2871488783 Bacteria 6929816
1997 2871497714 2871495908 Bacteria 6935695
1998 2874105610 2874102143 Bacteria 6342645
1999 2874132764 2874131515 Bacteria 6820270
2000 2874140381 2874139085 Bacteria 7021506
2001 2874151812 2874146452 Bacteria 7533118
2002 2874159445 2874155637 Bacteria 6724144
2003 2874168128 2874162495 Bacteria 6174670
2004 2876364395 2876363079 Bacteria 6544991
2005 2876376679 2876369609 Bacteria 6807521
2006 2876378480 2876377896 Bacteria 6565995
2007 2876396571 2876392853 Bacteria 6660880
2008 2876402051 2876399893 Bacteria 6927900
2009 2876411374 2876406927 Bacteria 6191900
2010 2876417863 2876413966 Bacteria 6831344
2011 2876764784 2876761206 Bacteria 10111113
2012 2878038828 2878035449 Bacteria 6555736
2013 2878741516 2878738818 Bacteria 7136951
2014 2878749690 2878745973 Bacteria 6867388
2015 2878759859 2878753008 Bacteria 6922523
2016 2878761937 2878760144 Bacteria 6823465
2017 2878768903 2878767105 Bacteria 6898628
2018 2878775443 2878774303 Bacteria 6108671
2019 2878784843 2878781027 Bacteria 6834456
2020 2878788868 2878788777 Bacteria 6567085
2021 2881149072 2881147464 Bacteria 7779814
2022 2881160309 2881155292 Bacteria 6461656
2023 2881165911 2881161766 Bacteria 7127907
2024 2881846568 2881845957 Bacteria 6611900
2025 2881858053 2881853255 Bacteria 6698367
2026 2881868806 2881861095 Bacteria 7128710
2027 2882636073 2882632389 Bacteria 8154593
2028 2882808865 2882806704 Bacteria 3007728
2029 2882915743 2882912400 Bacteria 6801539
2030 2885307395 2885305155 Bacteria 7348390
2031 2885313570 2885312484 Bacteria 6415165
2032 2885322357 2885318864 Bacteria 6729568
2033 2885347655 2885342637 Bacteria 7011821
2034 2885351486 2885350715 Bacteria 6787678
2035 2888337602 2888337043 Bacteria 6629336
2036 2888344923 2888343758 Bacteria 6611049
2037 2888354117 2888350351 Bacteria 7372807
2038 2889015831 2889010040 Bacteria 6749192
2039 2889019119 2889016732 Bacteria 6700763
2040 2889793045 2889790730 Bacteria 5689708
2041 2889917384 2889914905 Bacteria 5702301
2042 2894653927 2894652903 Bacteria 4587256
2043 2895883170 2895880812 Bacteria 11255272
2044 2898795929 2898795034 Bacteria 4294459
2045 2899261932 2899259804 Bacteria 3320927
2046 2899276365 2899275550 Bacteria 3958688
2047 2899369556 2899359706 Bacteria 10940472
2048 2902803481 2902799365 Bacteria 5419524
2049 2902813668 2902810491 Bacteria 6794147
2050 2902841678 2902837492 Bacteria 6697721
2051 2903455080 2903448605 Bacteria 7357801
2052 2903493919 2903492973 Bacteria 13473544
2053 2903494083 2903492973 Bacteria 13473544
2054 2903523380 2903521522 Bacteria 6525694
2055 2903531418 2903528002 Bacteria 6586099
2056 2903542512 2903540706 Bacteria 7062119
2057 2904541709 2904535858 Bacteria 6308016
2058 2904580175 2904578770 Bacteria 5302906
2059 2904663347 2904659560 Bacteria 6685615
2060 2906310728 2906308376 Bacteria 6841989
2061 2906324791 2906321335 Bacteria 6579571
2062 2906333585 2906328253 Bacteria 6585166
2063 2906360637 2906354277 Bacteria 6991324
2064 2906372783 2906370794 Bacteria 6881062
2065 2906389333 2906386501 Bacteria 5977019
2066 2906396628 2906393657 Bacteria 6790866
2067 2906408582 2906408224 Bacteria 6162342
2068 2906417834 2906414383 Bacteria 6580790
2069 2915773322 2915768154 Bacteria 8424322
2070 2917701731 2917699015 Bacteria 7043791
2071 2919120152 2919119836 Bacteria 5208557
2072 2919140815 2919138771 Bacteria 5281312
2073 2919711422 2919709256 Bacteria 4318106
2074 2922138738 2922130491 Bacteria 7173936
2075 2922155503 2922151315 Bacteria 6902399
2076 2922161910 2922158528 Bacteria 6573167
2077 2922174928 2922172374 Bacteria 6167644
2078 2922188463 2922185730 Bacteria 7113964
2079 2922556211 2922554459 Bacteria 6683962
2080 2924720850 2924718760 Bacteria 6331356
2081 2924750428 2924748358 Bacteria 6154725
2082 2924756479 2924754689 Bacteria 6774424
2083 2924767315 2924762789 Bacteria 6561353
2084 2924779198 2924776078 Bacteria 7492003
2085 2924790501 2924784321 Bacteria 7416538
2086 2929213807 2929212328 Bacteria 7708288
2087 2932401177 2932398195 Bacteria 3847976
2088 2937817555 2937813078 Bacteria 7783518
2089 2937825337 2937822353 Bacteria 7290551
2090 2937841189 2937836603 Bacteria 6811263
2091 2937848609 2937843397 Bacteria 5256375
2092 2937871838 2937868953 Bacteria 6639878
2093 2937880254 2937877337 Bacteria 7246526
2094 2937893044 2937891427 Bacteria 6357007
2095 2937979237 2937972304 Bacteria 7532020
2096 2937996365 2937994558 Bacteria 7036190
2097 2938018325 2938014810 Bacteria 6700592
2098 2939589088 2939582691 Bacteria 7088898
2099 2958040994 2958034702 Bacteria 6989922
2100 2958057488 2958041894 Bacteria 13082850
2101 2958070180 2958064165 Bacteria 7158582
2102 2958073241 2958071322 Bacteria 6815895
2103 2958087307 2958084443 Bacteria 7312792
2104 2958096730 2958092219 Bacteria 6861151
2105 2958115238 2958115193 Bacteria 6923548
2106 2958127957 2958122699 Bacteria 7280457
2107 2958132581 2958130278 Bacteria 6897202
2108 2958139531 2958137437 Bacteria 6050276
2109 2958162315 2958158011 Bacteria 6058449
2110 2958166835 2958165035 Bacteria 6906348
2111 2958182395 2958179912 Bacteria 6874908
2112 2961080240 2961077736 Bacteria 7079850
2113 2961118374 2961114664 Bacteria 6680456
2114 2961135261 2961127735 Bacteria 7196641
2115 2961138112 2961136820 Bacteria 6775228
2116 2961165305 2961163497 Bacteria 6901077
2117 2961177692 2961170736 Bacteria 7072258
2118 2963645852 2963644680 Bacteria 6530403
2119 2965020127 2965018300 Bacteria 6883036
2120 2965030839 2965025482 Bacteria 6532201
2121 2965036853 2965032056 Bacteria 6887443
2122 2965041388 2965040258 Bacteria 6855979
2123 2965051158 2965047637 Bacteria 6623551
2124 2965062981 2965062239 Bacteria 7412989
2125 2965110412 2965102966 Bacteria 6800987
2126 2968002221 2967996073 Bacteria 6787468
2127 2968009455 2968003550 Bacteria 6929263
2128 2968022588 2968016561 Bacteria 7022047
2129 2968089362 2968083720 Bacteria 7351627
2130 2968091735 2968091066 Bacteria 6052692
2131 2968102066 2968097103 Bacteria 6107094
2132 2968114435 2968110612 Bacteria 6814636
2133 2968122134 2968117919 Bacteria 6536078
2134 2968133294 2968128360 Bacteria 6270294
2135 2968173706 2968171901 Bacteria 6894245
2136 2970475172 2970469710 Bacteria 6969209
2137 2970510370 2970503327 Bacteria 7099517
2138 2970526650 2970524798 Bacteria 6840927
2139 2970546006 2970540015 Bacteria 6977556
2140 2970553689 2970547951 Bacteria 6931819
2141 2970556792 2970554993 Bacteria 6814252
2142 2970599905 2970593180 Bacteria 7073582
2143 2974316578 2974315732 Bacteria 4602776
2144 2977828381 2977821940 Bacteria 6906439
2145 2977831681 2977828996 Bacteria 7007971
2146 2977847843 2977843712 Bacteria 6753583
2147 2977861463 2977858184 Bacteria 6215359
2148 2977868818 2977864932 Bacteria 7534097
2149 2977876423 2977872689 Bacteria 7270173
2150 2977916460 2977915119 Bacteria 6829656
2151 2977923755 2977922695 Bacteria 6956781
2152 2977937928 2977935797 Bacteria 6252826
2153 2977950118 2977942078 Bacteria 7570577
2154 2977955817 2977950692 Bacteria 6893264
2155 2977962659 2977957713 Bacteria 6877875
2156 2977975557 2977971508 Bacteria 7472917
2157 2977989612 2977986579 Bacteria 6581278
2158 2979785835 2979779861 Bacteria 6219781
2159 2979815243 2979808191 Bacteria 7179355
2160 2984524754 2984523437 Bacteria 4508481
2161 2987644186 2987636660 Bacteria 8088555
2162 2987653040 2987652177 Bacteria 6969023
2163 2987661312 2987659509 Bacteria 6966464
2164 2987671162 2987666974 Bacteria 6509233
2165 2987674668 2987673487 Bacteria 6884027
2166 2996315383 2996310559 Bacteria 6357320
2167 2996339507 2996336353 Bacteria 5511628
2168 2996348180 2996341866 Bacteria 6643098
2169 2996353402 2996348954 Bacteria 7239054
2170 3000018716 3000017691 Bacteria 3772574
2171 3000141680 3000135777 Bacteria 6891109
2172 3002141488 3002141150 Bacteria 5254435
2173 3004190361 3004188549 Bacteria 6952365
2174 3004199833 3004195979 Bacteria 6776956
2175 3004208335 3004203850 Bacteria 7307914
2176 3004212906 3004211236 Bacteria 7417683
2177 3004220585 3004218560 Bacteria 7421728
2178 3004246677 3004239961 Bacteria 6892290
2179 3004252958 3004248173 Bacteria 6563236
2180 3004280084 3004275668 Bacteria 7114440
2181 3004292557 3004289098 Bacteria 6135450
2182 3004336603 3004334049 Bacteria 8449246
2183 637076432 637000159 Bacteria 7596297
2184 649871098 649633066 Bacteria 6690028
2185 8002812320 8002811521 Bacteria 2942897
2186 8004302910 8004300914 Bacteria 6132239
2187 8004318325 8004312739 Bacteria 7444653
2188 8004381357 8004374579 Bacteria 6898112
2189 8004389966 8004387939 Bacteria 7049250
2190 8004399587 8004395343 Bacteria 6620908
2191 8004450963 8004445564 Bacteria 6322258
2192 8004639274 8004633249 Bacteria 6723080
2193 8004646293 8004640170 Bacteria 6723001
2194 8004713994 8004703790 Bacteria 8006957
2195 8004718363 8004714634 Bacteria 6776161
2196 8045865994 8045864390 Bacteria 5043873
2197 8054007095 8054002106 Bacteria 7987183
2198 8054916297 8054913762 Bacteria 7713009
2199 8054924906 8054920844 Bacteria 7068637
2200 8055618487 8055617313 Bacteria 7548464
2201 8057136433 8057132660 Bacteria 4061191
2202 Ga0496120_0001456
2203 LJQas_1001220
2204 JGI24752J21851_1000070
2205 JGI24740J21852_10002361
2206 JGI24740J21852_10005985
2207 JGI24740J21852_10008641
2208 JGI24739J22299_10001530
2209 JGI24739J22299_10014083
2210 JGI24737J22298_10000557
2211 JGI24737J22298_10001461
2212 JGI24737J22298_10001819
2213 JGI24737J22298_10012644
2214 JGI24737J22298_10023133
2215 JGI24737J22298_10029893
2216 JGI24743J22301_10004150
2217 JGI24735J21928_10004299
2218 JGI24735J21928_10012543
2219 JGI24735J21928_10019171
2220 JGI24735J21928_10019707
2221 JGI24735J21928_10020365
2222 JGI24750J21931_1001191
2223 JGI24745J21846_1000602
2224 JGI24738J21930_10000877
2225 JGI24738J21930_10006327
2226 JGI24034J26672_10002795
2227 JGI24034J26672_10007273
2228 JGI24751J29686_10003513
2229 JGI25154J39366_1001768
2230 JGI25157J39369_1001793
2231 JGI25150J39212_1000231
2232 JGI25406J46586_10005971
2233 JGI25406J46586_10006949
2234 JGI25406J46586_10013583
2235 JGI25165J46597_1000026
2236 JGI25165J46597_1000095
2237 JGI25153J46596_10000091
2238 JGI25153J46596_10025526
2239 Ga0006562J51391_1019900
2240 Ga0055542_1000831
2241 Ga0055529_1000207
2242 Ga0055529_1001996
2243 Ga0055526_1000947
2244 Ga0055526_1003216
2245 Ga0055537_1004843
2246 Ga0055524_1000320
2247 Ga0055524_1000341
2248 Ga0055524_1000618
2249 Ga0055524_1018445
2250 Ga0055536_1000816
2251 Ga0055536_1001254
2252 Ga0055536_1002212
2253 Ga0055528_1000602
2254 Ga0055530_10000099
2255 Ga0055530_10020952
2256 Ga0055530_10020964
2257 Ga0055540_1000044
2258 Ga0055540_1000593
2259 Ga0055540_1002244
2260 Ga0055540_1009744
2261 Ga0055531_10000498
2262 Ga0055531_10007874
2263 Ga0055531_10017857
2264 Ga0055531_10028289
2265 Ga0055531_10028290
2266 Ga0065165_1004186
2267 Ga0065707_10084177
2268 Ga0070658_10000970
2269 Ga0070658_10002909
2270 Ga0070658_10132252
2271 Ga0070676_10003330
2272 Ga0070683_100005087
2273 Ga0070683_100018072
2274 Ga0070683_100018814
2275 Ga0070683_100065856
2276 Ga0070690_100009984
2277 Ga0070690_100011493
2278 Ga0070690_100033935
2279 Ga0070690_100039501
2280 Ga0070670_100000100
2281 Ga0070670_100000435
2282 Ga0070670_100000918
2283 Ga0070670_100001151
2284 Ga0070670_100001295
2285 Ga0070670_100004118
2286 Ga0070670_100030273
2287 Ga0070670_100071113
2288 Ga0070670_100076338
2289 Ga0068869_100016531
2290 Ga0068869_100021834
2291 Ga0070666_10000842
2292 Ga0070666_10010979
2293 Ga0070666_10015060
2294 Ga0070666_10032623
2295 Ga0070666_10108003
2296 Ga0070680_100002422
2297 Ga0070680_100010744
2298 Ga0070680_100012365
2299 Ga0070680_100065811
2300 Ga0070680_100084568
2301 Ga0070680_100104096
2302 Ga0070682_100013858
2303 Ga0070682_100016983
2304 Ga0068868_100005603
2305 Ga0068868_100012543
2306 Ga0068868_100023340
2307 Ga0070660_100001303
2308 Ga0070660_100001449
2309 Ga0070660_100001588
2310 Ga0070660_100004144
2311 Ga0070660_100009468
2312 Ga0070660_100009837
2313 Ga0070660_100011154
2314 Ga0070660_100015424
2315 Ga0070660_100019930
2316 Ga0070660_100022714
2317 Ga0070660_100044124
2318 Ga0070660_100046591
2319 Ga0070660_100050376
2320 Ga0070660_100060165
2321 Ga0070660_100081201
2322 Ga0070660_100092914
2323 Ga0070689_100020701
2324 Ga0070691_10000937
2325 Ga0070691_10002229
2326 Ga0070691_10004796
2327 Ga0070691_10011558
2328 Ga0070691_10022237
2329 Ga0070691_10023248
2330 Ga0070661_100000028
2331 Ga0070661_100002551
2332 Ga0070661_100005980
2333 Ga0070661_100045678
2334 Ga0070692_10005236
2335 Ga0070692_10021837
2336 Ga0070668_100000294
2337 Ga0070668_100014902
2338 Ga0070668_100021095
2339 Ga0070668_100022512
2340 Ga0070668_100027628
2341 Ga0070668_100030569
2342 Ga0070669_100000455
2343 Ga0070669_100005832
2344 Ga0070669_100029399
2345 Ga0070669_100064587
2346 Ga0070669_100134329
2347 Ga0070675_100020328
2348 Ga0070675_100046541
2349 Ga0070675_100159541
2350 Ga0070671_100000031
2351 Ga0070671_100002313
2352 Ga0070671_100004754
2353 Ga0070671_100008818
2354 Ga0070671_100014958
2355 Ga0070671_100024953
2356 Ga0070671_100025140
2357 Ga0070671_100044064
2358 Ga0070671_100067437
2359 Ga0070671_100072499
2360 Ga0070674_100000255
2361 Ga0070674_100009116
2362 Ga0070674_100078153
2363 Ga0070673_100000577
2364 Ga0070673_100001132
2365 Ga0070673_100079341
2366 Ga0070659_100000401
2367 Ga0070659_100002369
2368 Ga0070659_100003269
2369 Ga0070659_100025902
2370 Ga0070659_100037580
2371 Ga0070659_100044295
2372 Ga0070659_100050666
2373 Ga0070659_100063996
2374 Ga0070667_100000074
2375 Ga0070667_100000288
2376 Ga0070667_100000814
2377 Ga0070667_100002739
2378 Ga0070667_100009549
2379 Ga0070667_100010538
2380 Ga0070667_100010825
2381 Ga0070667_100014963
2382 Ga0070667_100043616
2383 Ga0070667_100047421
2384 Ga0070667_100111938
2385 Ga0070703_10003032
2386 Ga0070709_10004826
2387 Ga0070713_100013671
2388 Ga0070713_100140252
2389 Ga0070710_10001139
2390 Ga0070710_10011989
2391 Ga0070710_10014441
2392 Ga0070701_10003158
2393 Ga0070701_10013248
2394 Ga0070711_100000479
2395 Ga0070711_100000991
2396 Ga0070705_100000224
2397 Ga0070705_100008721
2398 Ga0070705_100044493
2399 Ga0070700_100008734
2400 Ga0070700_100027467
2401 Ga0070700_100114985
2402 Ga0070694_100003603
2403 Ga0070694_100007783
2404 Ga0070694_100013044
2405 Ga0070708_100010366
2406 Ga0070663_100000970
2407 Ga0070663_100005415
2408 Ga0070663_100010071
2409 Ga0070663_100020033
2410 Ga0070663_100026656
2411 Ga0070663_100108728
2412 Ga0070678_100003901
2413 Ga0070678_100005204
2414 Ga0070678_100028975
2415 Ga0070678_100134971
2416 Ga0070662_100000857
2417 Ga0070662_100001676
2418 Ga0070662_100011053
2419 Ga0070662_100014321
2420 Ga0070662_100021936
2421 Ga0070662_100068597
2422 Ga0070681_10007954
2423 Ga0070681_10025559
2424 Ga0070681_10070094
2425 Ga0070681_10125927
2426 Ga0070681_10169497
2427 Ga0068867_100003921
2428 Ga0068867_100012582
2429 Ga0070706_100010819
2430 Ga0070706_100036063
2431 Ga0070707_100000208
2432 Ga0070707_100001119
2433 Ga0070707_100017535
2434 Ga0070698_100098484
2435 Ga0070699_100001188
2436 Ga0070679_100000010
2437 Ga0070679_100004553
2438 Ga0070679_100008127
2439 Ga0070679_100008584
2440 Ga0070679_100018379
2441 Ga0070679_100153977
2442 Ga0070684_100002241
2443 Ga0070684_100040801
2444 Ga0070684_100081034
2445 Ga0070697_100002550
2446 Ga0070697_100007366
2447 Ga0070697_100028731
2448 Ga0068853_100001949
2449 Ga0068853_100003719
2450 Ga0068853_100009377
2451 Ga0068853_100018252
2452 Ga0068853_100027432
2453 Ga0068853_100027482
2454 Ga0068853_100031321
2455 Ga0068853_100055242
2456 Ga0068853_100090905
2457 Ga0070672_100001538
2458 Ga0070672_100008610
2459 Ga0070672_100013713
2460 Ga0070672_100016170
2461 Ga0070672_100031016
2462 Ga0070686_100001426
2463 Ga0070686_100023312
2464 Ga0070695_100000088
2465 Ga0070695_100012884
2466 Ga0070695_100060823
2467 Ga0070696_100000693
2468 Ga0070696_100012293
2469 Ga0070696_100014406
2470 Ga0070693_100004808
2471 Ga0070693_100048163
2472 Ga0070693_100056008
2473 Ga0070665_100000011
2474 Ga0070665_100000084
2475 Ga0070665_100000287
2476 Ga0070665_100000694
2477 Ga0070665_100000766
2478 Ga0070665_100001116
2479 Ga0070665_100002409
2480 Ga0070665_100004155
2481 Ga0070665_100005713
2482 Ga0070665_100026559
2483 Ga0070665_100031850
2484 Ga0070665_100037213
2485 Ga0070665_100046893
2486 Ga0070704_100009090
2487 Ga0070704_100015946
2488 Ga0070704_100110753
2489 Ga0068855_100000117
2490 Ga0068855_100004642
2491 Ga0068855_100007520
2492 Ga0068855_100007660
2493 Ga0068855_100030673
2494 Ga0068855_100036308
2495 Ga0068855_100054269
2496 Ga0068855_100055585
2497 Ga0068855_100079137
2498 Ga0070664_100000464
2499 Ga0070664_100001697
2500 Ga0070664_100005415
2501 Ga0070664_100027233
2502 Ga0070664_100062458
2503 Ga0068857_100005766
2504 Ga0068857_100014420
2505 Ga0068857_100014688
2506 Ga0068857_100049590
2507 Ga0068857_100065924
2508 Ga0068857_100122752
2509 Ga0068857_100141052
2510 Ga0068857_100165901
2511 Ga0068854_100003774
2512 Ga0068854_100005832
2513 Ga0068854_100010696
2514 Ga0068856_100009131
2515 Ga0068856_100014377
2516 Ga0068856_100019074
2517 Ga0068856_100023905
2518 Ga0068856_100092073
2519 Ga0070702_100005015
2520 Ga0070702_100014147
2521 Ga0068852_100003938
2522 Ga0068852_100033199
2523 Ga0068852_100047516
2524 Ga0068852_100054351
2525 Ga0068852_100164663
2526 Ga0068859_100000567
2527 Ga0068859_100007890
2528 Ga0068859_100018515
2529 Ga0068859_100019045
2530 Ga0068859_100021896
2531 Ga0068859_100030432
2532 Ga0068859_100123604
2533 Ga0068864_100000038
2534 Ga0068864_100000077
2535 Ga0068864_100000529
2536 Ga0068864_100000986
2537 Ga0068864_100001642
2538 Ga0068864_100003490
2539 Ga0068864_100005281
2540 Ga0068864_100008425
2541 Ga0068864_100022693
2542 Ga0068864_100029834
2543 Ga0068864_100043947
2544 Ga0068866_10001475
2545 Ga0068866_10066296
2546 Ga0068861_100003267
2547 Ga0068861_100007855
2548 Ga0068851_10041220
2549 Ga0068863_100000026
2550 Ga0068863_100000083
2551 Ga0068863_100001341
2552 Ga0068863_100001963
2553 Ga0068863_100007448
2554 Ga0068863_100012424
2555 Ga0068863_100039586
2556 Ga0068863_100054777
2557 Ga0068863_100196159
2558 Ga0068858_100000061
2559 Ga0068858_100000933
2560 Ga0068858_100001928
2561 Ga0068858_100002545
2562 Ga0068858_100002818
2563 Ga0068858_100004629
2564 Ga0068858_100004733
2565 Ga0068858_100016016
2566 Ga0068858_100049130
2567 Ga0068858_100062331
2568 Ga0068860_100000276
2569 Ga0068860_100000453
2570 Ga0068860_100000501
2571 Ga0068860_100003938
2572 Ga0068860_100018345
2573 Ga0068860_100022645
2574 Ga0068860_100038419
2575 Ga0068862_100000065
2576 Ga0068862_100000098
2577 Ga0068862_100000874
2578 Ga0068862_100008981
2579 Ga0068862_100013623
2580 Ga0068862_100019796
2581 Ga0068862_100034010
2582 Ga0068862_100082005
2583 Ga0068862_100088496
2584 Ga0068862_100117484
2585 Ga0081455_10005213
2586 Ga0081538_10021051
2587 Ga0081538_10051790
2588 Ga0081540_1021554
2589 Ga0081540_1037703
2590 Ga0081539_10000604
2591 Ga0081539_10001065
2592 Ga0081539_10003993
2593 Ga0081539_10011070
2594 Ga0081539_10018973
2595 Ga0081539_10021499
2596 Ga0081539_10027633
2597 Ga0081539_10076710
2598 Ga0070717_10051405
2599 Ga0075365_10011049
2600 Ga0075368_10000035
2601 Ga0075368_10010582
2602 Ga0075363_100001170
2603 Ga0075363_100002220
2604 Ga0075363_100013779
2605 Ga0075363_100018437
2606 Ga0075363_100025976
2607 Ga0075364_10000049
2608 Ga0075364_10000591
2609 Ga0075364_10005266
2610 Ga0075364_10011033
2611 Ga0075364_10071413
2612 Ga0070715_10001572
2613 Ga0070716_100001930
2614 Ga0070716_100008352
2615 Ga0070712_100002669
2616 Ga0070712_100031726
2617 Ga0075362_10003279
2618 Ga0075367_10008467
2619 Ga0075367_10077379
2620 Ga0075369_10002203
2621 Ga0075369_10010423
2622 Ga0075369_10011807
2623 Ga0075369_10011987
2624 Ga0075369_10016701
2625 Ga0075369_10036538
2626 Ga0075369_10041858
2627 Ga0075366_10028722
2628 Ga0075366_10030256
2629 Ga0097621_100002474
2630 Ga0097621_100015820
2631 Ga0097621_100050399
2632 Ga0075370_10010573
2633 Ga0075370_10020090
2634 Ga0075370_10024860
2635 Ga0075370_10027626
2636 Ga0075370_10059436
2637 Ga0068871_100039776
2638 Ga0068871_100043052
2639 Ga0068871_100049889
2640 Ga0075428_100010305
2641 Ga0075428_100039315
2642 Ga0075428_100093797
2643 Ga0075430_100008169
2644 Ga0075431_100001468
2645 Ga0075431_100003004
2646 Ga0075431_100027228
2647 Ga0075433_10000449
2648 Ga0075433_10036911
2649 Ga0075434_100000020
2650 Ga0075434_100033324
2651 Ga0075434_100046757
2652 Ga0068865_100005660
2653 Ga0068865_100034934
2654 Ga0068865_100090069
2655 Ga0075436_100007352
2656 Ga0075436_100025151
2657 Ga0097620_100000567
2658 Ga0097620_100007889
2659 Ga0097620_100018515
2660 Ga0097620_100019045
2661 Ga0097620_100021896
2662 Ga0097620_100030432
2663 Ga0097620_100123605
2664 Ga0075435_100000210
2665 Ga0075435_100002188
2666 Ga0075435_100005765
2667 Ga0075435_100024229
2668 Ga0075435_100045776
2669 Ga0099794_10008668
2670 Ga0099794_10043488
2671 Ga0099795_10019616
2672 Ga0105240_10001530
2673 Ga0105240_10013197
2674 Ga0105240_10050753
2675 Ga0105240_10053879
2676 Ga0105240_10066058
2677 Ga0105240_10333886
2678 Ga0111539_10003134
2679 Ga0111539_10044324
2680 Ga0111539_10044461
2681 Ga0111539_10087075
2682 Ga0105245_10001226
2683 Ga0105245_10008882
2684 Ga0105245_10010714
2685 Ga0105245_10017687
2686 Ga0105245_10018434
2687 Ga0105245_10027790
2688 Ga0105245_10072387
2689 Ga0105247_10000017
2690 Ga0105247_10002602
2691 Ga0105247_10008008
2692 Ga0105247_10011149
2693 Ga0105247_10041232
2694 Ga0114129_10001566
2695 Ga0114129_10097693
2696 Ga0114129_10331361
2697 Ga0105243_10000278
2698 Ga0105243_10003108
2699 Ga0105243_10015495
2700 Ga0105243_10019994
2701 Ga0105243_10076685
2702 Ga0105241_10000871
2703 Ga0105241_10013847
2704 Ga0105241_10112089
2705 Ga0105241_10208368
2706 Ga0105242_10001113
2707 Ga0105242_10004838
2708 Ga0105242_10010292
2709 Ga0105242_10131359
2710 Ga0105248_10000194
2711 Ga0105248_10000478
2712 Ga0105248_10002050
2713 Ga0105248_10007323
2714 Ga0105248_10011419
2715 Ga0105248_10019304
2716 Ga0105248_10021555
2717 Ga0105248_10023033
2718 Ga0105248_10026023
2719 Ga0105248_10077700
2720 Ga0105248_10092973
2721 Ga0105248_10184223
2722 Ga0105248_10306061
2723 Ga0105237_10014883
2724 Ga0105237_10020018
2725 Ga0105237_10024962
2726 Ga0105237_10026250
2727 Ga0105237_10042064
2728 Ga0105238_10003553
2729 Ga0105238_10014790
2730 Ga0105238_10028258
2731 Ga0105238_10031483
2732 Ga0105238_10097683
2733 Ga0105249_10000096
2734 Ga0105249_10000347
2735 Ga0105249_10000667
2736 Ga0105249_10001976
2737 Ga0105249_10004132
2738 Ga0105249_10035086
2739 Ga0105239_10000138
2740 Ga0105239_10009981
2741 Ga0105239_10035893
2742 Ga0105239_10043379
2743 Ga0105239_10052534
2744 Ga0105246_10012836
2745 Ga0157373_10015037
2746 Ga0157373_10017636
2747 Ga0157373_10018194
2748 Ga0157373_10021592
2749 Ga0157373_10034344
2750 Ga0157373_10064173
2751 Ga0157371_10000285
2752 Ga0157371_10003605
2753 Ga0157371_10008004
2754 Ga0157371_10014873
2755 Ga0157370_10001875
2756 Ga0157370_10007662
2757 Ga0157370_10016907
2758 Ga0157370_10107542
2759 Ga0157370_10141241
2760 Ga0157369_10000762
2761 Ga0157369_10006045
2762 Ga0157369_10008974
2763 Ga0157369_10023362
2764 Ga0157369_10025652
2765 Ga0157369_10077730
2766 Ga0157369_10096569
2767 Ga0157369_10102351
2768 Ga0171462_1034
2769 Ga0157374_10002527
2770 Ga0157374_10006400
2771 Ga0157374_10017353
2772 Ga0157374_10042226
2773 Ga0157374_10128250
2774 Ga0157374_10154030
2775 Ga0157378_10004024
2776 Ga0157378_10006478
2777 Ga0157378_10024918
2778 Ga0157378_10056933
2779 Ga0157378_10119478
2780 Ga0163162_10000908
2781 Ga0163162_10003133
2782 Ga0163162_10008178
2783 Ga0163162_10111519
2784 Ga0163162_10188278
2785 Ga0163162_10190253
2786 Ga0163162_10202752
2787 Ga0157372_10006083
2788 Ga0157372_10007353
2789 Ga0157372_10010396
2790 Ga0157372_10129720
2791 Ga0157372_10154379
2792 Ga0157372_10157822
2793 Ga0157372_10173925
2794 Ga0157372_10195592
2795 Ga0157372_10271157
2796 Ga0157372_10293096
2797 Ga0157375_10000021
2798 Ga0157375_10011984
2799 Ga0163163_10002969
2800 Ga0163163_10002975
2801 Ga0163163_10003346
2802 Ga0163163_10008341
2803 Ga0163163_10091763
2804 Ga0157380_10000771
2805 Ga0157380_10004376
2806 Ga0157380_10007672
2807 Ga0157377_10007843
2808 Ga0157379_10001433
2809 Ga0157379_10018232
2810 Ga0157379_10027385
2811 Ga0157379_10035942
2812 Ga0157376_10000238
2813 Ga0157376_10078395
2814 Ga0157376_10093756
2815 Ga0183365_10001
2816 Ga0183363_1007
2817 Ga0163161_10017880
2818 Ga0163161_10018870
2819 Ga0163161_10073941
2820 Ga0163161_10078588
2821 Ga0213873_10000020
2822 Ga0213873_10005323
2823 Ga0213876_10000004
2824 Ga0213876_10000174
2825 Ga0213876_10000276
2826 Ga0213876_10001440
2827 Ga0213876_10002796
2828 Ga0213876_10003024
2829 Ga0213875_10001704
2830 Ga0213875_10003004
2831 Ga0213875_10009445
2832 Ga0213875_10069062
2833 Ga0224712_10006159
2834 Ga0224712_10034971
2835 Ga0209147_100773
2836 Ga0209563_100105
2837 Ga0207425_1000049
2838 Ga0207425_1008232
2839 Ga0209646_1000014
2840 Ga0209026_1000032
2841 Ga0209148_1000011
2842 Ga0209148_1000094
2843 Ga0209148_1000146
2844 Ga0209148_1001233
2845 Ga0209759_1000168
2846 Ga0209233_1000030
2847 Ga0209233_1000052
2848 Ga0209565_1000007
2849 Ga0209565_1000170
2850 Ga0209565_1000667
2851 Ga0209455_1000006
2852 Ga0209455_1000152
2853 Ga0209455_1000742
2854 Ga0209673_1000475
2855 Ga0209673_1000718
2856 Ga0209673_1008733
2857 Ga0209673_1023646
2858 Ga0209675_1000227
2859 Ga0209675_1005898
2860 Ga0209675_1011780
2861 Ga0209676_1000084
2862 Ga0209676_1000115
2863 Ga0209676_1000330
2864 Ga0209676_1000479
2865 Ga0209676_1006893
2866 Ga0209676_1017220
2867 Ga0209025_1000068
2868 Ga0209564_1000019
2869 Ga0209564_1000335
2870 Ga0209564_1000496
2871 Ga0209758_1000019
2872 Ga0209758_1007500
2873 Ga0209758_1020486
2874 Ga0209050_1000001
2875 Ga0209050_1000108
2876 Ga0209050_1000113
2877 Ga0209050_1001042
2878 Ga0209050_1002946
2879 Ga0209050_1013540
2880 Ga0209050_1015652
2881 Ga0209256_1000009
2882 Ga0209256_1000010
2883 Ga0209256_1000439
2884 Ga0209256_1013739
2885 Ga0209256_1015189
2886 Ga0209051_1000051
2887 Ga0209051_1001135
2888 Ga0209051_1002338
2889 Ga0209051_1005060
2890 Ga0209257_1000083
2891 Ga0209257_1000090
2892 Ga0209257_1000126
2893 Ga0209257_1000340
2894 Ga0209257_1000676
2895 Ga0209257_1001463
2896 Ga0209257_1001476
2897 Ga0209257_1002515
2898 Ga0209257_1003616
2899 Ga0209257_1014514
2900 Ga0207697_10005519
2901 Ga0207653_10000464
2902 Ga0207682_10034946
2903 Ga0207692_10004686
2904 Ga0207692_10008547
2905 Ga0207642_10000124
2906 Ga0207710_10000033
2907 Ga0207710_10008379
2908 Ga0207710_10059533
2909 Ga0207688_10000446
2910 Ga0207688_10005045
2911 Ga0207680_10007731
2912 Ga0207680_10010486
2913 Ga0207680_10017313
2914 Ga0207680_10018241
2915 Ga0207647_10000259
2916 Ga0207647_10000559
2917 Ga0207647_10001136
2918 Ga0207647_10010336
2919 Ga0207647_10017551
2920 Ga0207647_10024923
2921 Ga0207647_10028491
2922 Ga0207685_10005951
2923 Ga0207699_10009889
2924 Ga0207699_10032504
2925 Ga0207645_10023537
2926 Ga0207645_10035929
2927 Ga0207705_10000002
2928 Ga0207705_10000058
2929 Ga0207705_10000208
2930 Ga0207705_10000927
2931 Ga0207705_10001458
2932 Ga0207705_10001872
2933 Ga0207705_10002232
2934 Ga0207705_10002640
2935 Ga0207705_10012877
2936 Ga0207705_10018043
2937 Ga0207705_10023395
2938 Ga0207705_10035940
2939 Ga0207705_10047425
2940 Ga0207705_10050780
2941 Ga0207705_10055674
2942 Ga0207705_10067091
2943 Ga0207705_10094000
2944 Ga0207684_10022384
2945 Ga0207684_10032022
2946 Ga0207654_10001881
2947 Ga0207654_10081743
2948 Ga0207707_10003186
2949 Ga0207707_10037722
2950 Ga0207707_10060507
2951 Ga0207707_10086973
2952 Ga0207707_10147149
2953 Ga0207707_10153233
2954 Ga0207695_10001848
2955 Ga0207695_10003427
2956 Ga0207695_10004478
2957 Ga0207695_10004987
2958 Ga0207695_10006985
2959 Ga0207695_10017679
2960 Ga0207695_10020106
2961 Ga0207695_10038875
2962 Ga0207695_10043032
2963 Ga0207695_10054120
2964 Ga0207695_10111661
2965 Ga0207671_10000545
2966 Ga0207671_10005363
2967 Ga0207671_10022339
2968 Ga0207671_10035374
2969 Ga0207693_10000551
2970 Ga0207693_10001966
2971 Ga0207693_10002737
2972 Ga0207693_10013205
2973 Ga0207663_10003077
2974 Ga0207663_10003079
2975 Ga0207663_10006007
2976 Ga0207663_10014785
2977 Ga0207660_10000422
2978 Ga0207660_10001309
2979 Ga0207660_10002243
2980 Ga0207660_10003491
2981 Ga0207660_10016465
2982 Ga0207660_10032042
2983 Ga0207660_10116726
2984 Ga0207660_10163893
2985 Ga0207662_10001396
2986 Ga0207657_10000082
2987 Ga0207657_10000123
2988 Ga0207657_10000671
2989 Ga0207657_10001451
2990 Ga0207657_10001591
2991 Ga0207657_10002637
2992 Ga0207657_10004016
2993 Ga0207657_10004689
2994 Ga0207657_10007624
2995 Ga0207657_10021578
2996 Ga0207657_10022716
2997 Ga0207657_10024416
2998 Ga0207657_10035495
2999 Ga0207657_10038274
3000 Ga0207657_10050472
3001 Ga0207657_10051036
3002 Ga0207657_10057853
3003 Ga0207657_10075560
3004 Ga0207657_10084386
3005 Ga0207657_10087018
3006 Ga0207657_10094129
3007 Ga0207657_10117408
3008 Ga0207649_10000336
3009 Ga0207649_10005063
3010 Ga0207649_10009635
3011 Ga0207652_10000005
3012 Ga0207652_10000006
3013 Ga0207652_10000007
3014 Ga0207652_10000205
3015 Ga0207652_10031099
3016 Ga0207652_10117408
3017 Ga0207652_10130224
3018 Ga0207646_10000015
3019 Ga0207646_10000016
3020 Ga0207646_10040408
3021 Ga0207681_10000849
3022 Ga0207681_10000910
3023 Ga0207681_10040414
3024 Ga0207681_10044829
3025 Ga0207694_10002464
3026 Ga0207694_10005485
3027 Ga0207694_10012209
3028 Ga0207694_10079478
3029 Ga0207694_10117319
3030 Ga0207694_10182145
3031 Ga0207650_10000014
3032 Ga0207650_10000054
3033 Ga0207650_10001590
3034 Ga0207650_10001833
3035 Ga0207650_10011526
3036 Ga0207650_10014474
3037 Ga0207650_10062980
3038 Ga0207650_10065389
3039 Ga0207650_10068024
3040 Ga0207687_10005011
3041 Ga0207687_10014080
3042 Ga0207687_10016286
3043 Ga0207687_10108441
3044 Ga0207700_10005166
3045 Ga0207700_10020041
3046 Ga0207664_10044000
3047 Ga0207664_10108834
3048 Ga0207644_10000018
3049 Ga0207644_10000061
3050 Ga0207644_10001036
3051 Ga0207644_10001838
3052 Ga0207644_10007939
3053 Ga0207644_10022631
3054 Ga0207644_10065044
3055 Ga0207644_10088253
3056 Ga0207690_10000315
3057 Ga0207690_10000544
3058 Ga0207690_10000613
3059 Ga0207690_10001436
3060 Ga0207690_10004727
3061 Ga0207690_10005775
3062 Ga0207690_10011498
3063 Ga0207690_10016813
3064 Ga0207690_10074017
3065 Ga0207706_10000193
3066 Ga0207706_10001303
3067 Ga0207706_10002010
3068 Ga0207706_10002923
3069 Ga0207706_10003479
3070 Ga0207706_10005808
3071 Ga0207706_10020981
3072 Ga0207706_10023349
3073 Ga0207706_10066755
3074 Ga0207706_10079040
3075 Ga0207686_10002557
3076 Ga0207686_10004973
3077 Ga0207686_10050651
3078 Ga0207686_10150142
3079 Ga0207709_10000039
3080 Ga0207709_10007188
3081 Ga0207709_10008112
3082 Ga0207709_10017505
3083 Ga0207709_10080672
3084 Ga0207709_10091171
3085 Ga0207709_10104563
3086 Ga0207709_10118698
3087 Ga0207670_10021086
3088 Ga0207670_10085189
3089 Ga0207670_10105566
3090 Ga0207669_10002924
3091 Ga0207669_10012433
3092 Ga0207669_10118516
3093 Ga0207704_10000291
3094 Ga0207704_10087085
3095 Ga0207665_10000478
3096 Ga0207665_10013327
3097 Ga0207665_10030281
3098 Ga0207691_10004370
3099 Ga0207691_10006970
3100 Ga0207691_10021952
3101 Ga0207691_10056912
3102 Ga0207691_10084915
3103 Ga0207691_10126498
3104 Ga0207711_10000017
3105 Ga0207711_10000169
3106 Ga0207711_10000665
3107 Ga0207711_10001108
3108 Ga0207711_10003024
3109 Ga0207711_10007427
3110 Ga0207711_10010537
3111 Ga0207711_10013176
3112 Ga0207711_10016000
3113 Ga0207711_10018653
3114 Ga0207711_10141982
3115 Ga0207711_10266951
3116 Ga0207689_10000561
3117 Ga0207689_10074058
3118 Ga0207689_10177472
3119 Ga0207661_10013650
3120 Ga0207661_10015725
3121 Ga0207661_10027905
3122 Ga0207661_10087965
3123 Ga0207679_10002303
3124 Ga0207679_10014106
3125 Ga0207679_10153160
3126 Ga0207667_10000006
3127 Ga0207667_10000017
3128 Ga0207667_10004287
3129 Ga0207667_10006466
3130 Ga0207667_10012536
3131 Ga0207667_10020240
3132 Ga0207667_10022807
3133 Ga0207667_10066629
3134 Ga0207667_10082273
3135 Ga0207667_10121234
3136 Ga0207667_10154833
3137 Ga0207667_10207145
3138 Ga0207651_10021655
3139 Ga0207651_10036204
3140 Ga0207712_10000005
3141 Ga0207712_10000594
3142 Ga0207712_10000632
3143 Ga0207712_10000840
3144 Ga0207712_10010101
3145 Ga0207712_10011030
3146 Ga0207712_10027060
3147 Ga0207712_10072123
3148 Ga0207668_10000199
3149 Ga0207668_10000307
3150 Ga0207668_10003517
3151 Ga0207668_10024131
3152 Ga0207668_10042458
3153 Ga0207640_10001675
3154 Ga0207640_10002234
3155 Ga0207640_10090903
3156 Ga0207640_10186172
3157 Ga0207658_10000321
3158 Ga0207658_10000351
3159 Ga0207658_10000743
3160 Ga0207658_10001887
3161 Ga0207658_10002871
3162 Ga0207658_10004634
3163 Ga0207658_10040302
3164 Ga0207677_10011440
3165 Ga0207677_10023098
3166 Ga0207703_10000149
3167 Ga0207703_10000964
3168 Ga0207703_10001077
3169 Ga0207703_10001264
3170 Ga0207703_10013390
3171 Ga0207703_10027927
3172 Ga0207703_10029798
3173 Ga0207703_10040515
3174 Ga0207703_10056882
3175 Ga0207639_10000332
3176 Ga0207639_10000804
3177 Ga0207639_10006337
3178 Ga0207639_10017659
3179 Ga0207639_10018513
3180 Ga0207639_10023592
3181 Ga0207639_10037288
3182 Ga0207639_10081594
3183 Ga0207639_10112256
3184 Ga0207678_10000781
3185 Ga0207678_10000961
3186 Ga0207678_10001177
3187 Ga0207678_10001243
3188 Ga0207678_10005610
3189 Ga0207678_10008244
3190 Ga0207678_10012711
3191 Ga0207678_10026110
3192 Ga0207678_10059512
3193 Ga0207678_10074062
3194 Ga0207678_10109413
3195 Ga0207708_10005906
3196 Ga0207708_10010888
3197 Ga0207708_10045007
3198 Ga0207702_10019053
3199 Ga0207702_10030684
3200 Ga0207702_10032934
3201 Ga0207702_10065994
3202 Ga0207702_10068804
3203 Ga0207702_10229816
3204 Ga0207641_10000005
3205 Ga0207641_10000008
3206 Ga0207641_10000908
3207 Ga0207641_10001186
3208 Ga0207641_10001342
3209 Ga0207641_10003662
3210 Ga0207641_10006236
3211 Ga0207641_10007252
3212 Ga0207641_10020095
3213 Ga0207641_10027023
3214 Ga0207641_10051713
3215 Ga0207641_10058396
3216 Ga0207641_10107883
3217 Ga0207648_10002008
3218 Ga0207648_10002485
3219 Ga0207648_10038684
3220 Ga0207676_10000060
3221 Ga0207676_10000085
3222 Ga0207676_10000164
3223 Ga0207676_10002922
3224 Ga0207676_10007262
3225 Ga0207676_10010426
3226 Ga0207676_10010543
3227 Ga0207676_10023714
3228 Ga0207676_10034529
3229 Ga0207676_10040058
3230 Ga0207676_10152412
3231 Ga0207674_10000271
3232 Ga0207674_10002255
3233 Ga0207674_10005179
3234 Ga0207674_10007422
3235 Ga0207674_10007476
3236 Ga0207674_10022912
3237 Ga0207674_10023100
3238 Ga0207674_10033217
3239 Ga0207674_10033484
3240 Ga0207674_10037459
3241 Ga0207674_10042454
3242 Ga0207674_10055653
3243 Ga0207674_10062984
3244 Ga0207674_10187707
3245 Ga0207675_100003266
3246 Ga0207675_100015049
3247 Ga0207675_100020835
3248 Ga0207683_10004828
3249 Ga0207683_10013670
3250 Ga0207683_10029045
3251 Ga0207683_10051606
3252 Ga0207698_10007496
3253 Ga0207698_10014594
3254 Ga0207698_10017896
3255 Ga0207698_10021498
3256 Ga0207698_10130321
3257 Ga0207698_10183028
3258 Ga0209999_1007850
3259 Ga0209813_10000040
3260 Ga0209813_10008253
3261 Ga0209813_10023694
3262 Ga0209974_10028774
3263 Ga0209974_10036639
3264 Ga0207428_10013315
3265 Ga0207428_10047746
3266 Ga0268266_10000002
3267 Ga0268266_10000003
3268 Ga0268266_10000058
3269 Ga0268266_10000458
3270 Ga0268266_10000819
3271 Ga0268266_10006101
3272 Ga0268266_10007042
3273 Ga0268266_10012444
3274 Ga0268266_10022860
3275 Ga0268266_10047971
3276 Ga0268266_10115829
3277 Ga0268266_10188611
3278 Ga0268265_10000011
3279 Ga0268265_10000022
3280 Ga0268265_10000959
3281 Ga0268265_10001107
3282 Ga0268265_10006679
3283 Ga0268265_10010519
3284 Ga0268265_10011108
3285 Ga0268265_10012836
3286 Ga0268265_10025385
3287 Ga0268265_10039497
3288 Ga0268265_10055071
3289 Ga0268265_10243985
3290 Ga0268264_10000005
3291 Ga0268264_10000396
3292 Ga0268264_10002785
3293 Ga0268264_10002955
3294 Ga0268264_10004230
3295 Ga0268264_10005583
3296 Ga0268264_10006218
3297 Ga0268264_10018337
3298 Ga0268264_10035187
3299 Ga0268264_10046242
3300 Ga0265337_1016775
3301 Ga0307517_10002922
3302 Ga0307517_10010748
3303 Ga0307517_10049033
3304 Ga0307517_10055001
3305 Ga0307515_10014980
3306 Ga0307515_10021185
3307 Ga0265338_10022700
3308 Ga0265338_10023393
3309 Ga0265338_10056352
3310 Ga0307511_10002013
3311 Ga0265760_10000019
3312 Ga0265330_10029057
3313 Ga0265328_10011517
3314 Ga0265325_10000039
3315 Ga0265325_10005811
3316 Ga0265325_10025631
3317 Ga0265325_10042321
3318 Ga0265339_10002178
3319 Ga0265327_10000004
3320 Ga0265327_10000128
3321 Ga0265327_10023964
3322 Ga0307513_10000069
3323 Ga0307513_10000541
3324 Ga0307513_10030774
3325 Ga0307513_10105283
3326 Ga0307408_100001695
3327 Ga0307408_100004305
3328 Ga0307408_100091142
3329 Ga0307508_10000018
3330 Ga0265314_10068730
3331 Ga0316576_10023528
3332 Ga0316578_10022903
3333 Ga0307516_10046345
3334 Ga0307405_10000284
3335 Ga0307405_10002521
3336 Ga0307405_10010856
3337 Ga0307405_10040352
3338 Ga0307405_10045379
3339 Ga0307405_10077043
3340 Ga0307405_10110631
3341 Ga0307413_10000137
3342 Ga0307413_10000754
3343 Ga0307413_10003765
3344 Ga0307413_10004464
3345 Ga0307413_10005317
3346 Ga0307413_10021522
3347 Ga0307413_10037041
3348 Ga0307413_10117428
3349 Ga0307413_10146087
3350 Ga0307410_10006058
3351 Ga0307410_10019043
3352 Ga0307410_10023412
3353 Ga0307410_10042545
3354 Ga0307410_10044208
3355 Ga0307410_10078981
3356 Ga0307410_10089195
3357 Ga0307406_10000756
3358 Ga0307406_10001463
3359 Ga0307406_10001597
3360 Ga0307406_10007567
3361 Ga0307406_10010778
3362 Ga0307406_10018484
3363 Ga0307406_10018817
3364 Ga0307406_10028813
3365 Ga0307406_10044959
3366 Ga0307407_10000496
3367 Ga0307407_10006157
3368 Ga0307407_10022936
3369 Ga0307407_10047610
3370 Ga0307412_10002585
3371 Ga0307412_10004506
3372 Ga0307412_10011803
3373 Ga0307412_10014643
3374 Ga0307412_10020554
3375 Ga0307412_10034066
3376 Ga0307412_10115621
3377 Ga0307412_10141726
3378 Ga0307409_100007007
3379 Ga0307409_100120058
3380 Ga0307409_100164557
3381 Ga0307416_100016736
3382 Ga0307416_100102929
3383 Ga0307416_100128728
3384 Ga0307414_10000073
3385 Ga0307414_10005242
3386 Ga0307414_10006551
3387 Ga0307414_10011988
3388 Ga0307414_10016629
3389 Ga0307414_10017610
3390 Ga0307414_10023539
3391 Ga0307414_10044349
3392 Ga0307414_10052483
3393 Ga0307414_10076460
3394 Ga0307414_10089900
3395 Ga0307414_10109539
3396 Ga0307414_10113412
3397 Ga0307411_10001675
3398 Ga0307411_10003929
3399 Ga0307411_10004508
3400 Ga0307411_10008457
3401 Ga0307411_10015506
3402 Ga0307411_10026456
3403 Ga0307411_10046104
3404 Ga0307411_10053661
3405 Ga0307411_10059582
3406 Ga0307411_10113483
3407 Ga0307415_100003750
3408 Ga0307415_100004184
3409 Ga0307415_100005234
3410 Ga0307415_100046185
3411 Ga0307415_100049729
3412 Ga0307415_100089758
3413 Ga0307415_100096613
3414 Ga0307415_100104772
3415 Ga0307510_10084916
3416 Ga0307510_10111548
3417 Ga0373934_0002051
3418 Ga0373936_0036562
3419 Ga0373945_0012591
3420 Ga0373953_0000370
3421 Ga0373956_0001015
3422 Ga0373943_0012542
3423 Ga0373955_0000271
3424 Ga0373955_0002468
3425 Ga0316574_0015344
3426 Ga0316574_0020031
3427 Ga0316574_0024440
3428 Ga0373924_0004632
3429 Ga0373931_0001699
3430 Ga0373931_0005781
3431 Ga0373935_0023898
3432 Ga0373935_0058085
3433 Ga0373927_0000772
3434 Ga0373933_0002469
3435 Ga0373933_0057145
3436 Ga0373947_0015691
3437 Ga0373937_0021117
3438 Ga0373937_0060477
3439 Ga0373937_0065741
3440 Ga0316584_0026547
3441 Ga0316584_0052634
3442 Ga0373925_0001415
3443 Ga0373925_0077549
3444 Ga0395899_0000018
3445 Ga0395899_0000105
3446 Ga0395899_0000224
3447 Ga0395899_0000288
3448 Ga0395899_0002312
3449 Ga0395899_0010408
3450 Ga0395899_0023576
3451 Ga0395899_0026415
3452 Ga0395899_0029891
3453 Ga0395899_0050931
3454 Ga0395899_0087649
3455 Ga0395900_0000246
3456 Ga0395900_0000294
3457 Ga0395900_0001134
3458 Ga0395900_0004612
3459 Ga0395900_0007653
3460 Ga0395900_0013037
3461 Ga0395900_0015268
3462 Ga0395900_0016847
3463 Ga0395900_0024016
3464 Ga0395900_0026423
3465 Ga0395900_0027347
3466 Ga0395900_0034799
3467 Ga0395900_0039656
3468 Ga0395900_0045677
3469 Ga0395900_0055849
3470 Ga0395900_0073616
3471 Ga0395900_0096427
3472 Ga0395900_0111256
3473 Ga0395900_0112447
3474 Ga0395900_0149837
3475 Ga0395898_0000192
3476 Ga0395898_0000447
3477 Ga0395898_0001747
3478 Ga0395898_0002761
3479 Ga0395898_0022475
3480 Ga0395898_0031234
3481 Ga0395898_0048317
3482 Ga0395898_0074845
3483 Ga0395898_0128698
3484 Ga0395898_0221517
3485 Ga0395905_0000066
3486 Ga0395905_0000128
3487 Ga0395905_0000228
3488 Ga0395905_0000358
3489 Ga0395905_0000521
3490 Ga0395905_0001563
3491 Ga0395905_0001605
3492 Ga0395905_0001734
3493 Ga0395905_0001997
3494 Ga0395905_0003182
3495 Ga0395905_0014226
3496 Ga0395905_0016299
3497 Ga0395905_0016381
3498 Ga0395905_0017957
3499 Ga0395905_0019110
3500 Ga0395905_0025830
3501 Ga0395905_0027108
3502 Ga0395905_0028881
3503 Ga0395905_0052508
3504 Ga0395905_0053153
3505 Ga0395905_0069550
3506 Ga0395905_0073168
3507 Ga0395905_0078062
3508 Ga0395905_0099480
3509 Ga0395905_0105334
3510 Ga0395905_0243645
3511 Ga0436364_0040477
3512 Ga0436364_0140547
3513 Ga0436364_0206741
3514 Ga0436364_1038812
3515 Ga0436364_1176408
3516 Ga0395901_0000167
3517 Ga0395901_0000232
3518 Ga0395901_0001005
3519 Ga0395901_0001222
3520 Ga0395901_0002015
3521 Ga0395901_0007044
3522 Ga0395901_0008904
3523 Ga0395901_0009785
3524 Ga0395901_0010259
3525 Ga0395901_0012489
3526 Ga0395901_0019035
3527 Ga0395901_0024655
3528 Ga0395901_0027973
3529 Ga0395901_0042882
3530 Ga0395901_0047177
3531 Ga0395901_0050356
3532 Ga0395901_0065314
3533 Ga0395901_0114655
3534 Ga0395901_0122103
3535 Ga0395901_0135260
3536 Ga0395901_0146265
3537 Ga0395901_0150947
3538 Ga0395901_0314120
3539 Ga0436365_0005019
3540 Ga0436365_0142234
3541 Ga0436365_0158844
3542 Ga0436365_0463115
3543 Ga0436365_0484364
3544 Ga0436365_0567701
3545 Ga0436365_0714679
3546 Ga0436365_0790831
3547 Ga0436365_1205090
3548 Ga0436365_1460153
3549 Ga0436365_1487752
3550 Ga0436365_1625582
3551 Ga0436365_1723092
3552 Ga0436360_0870404
3553 Ga0436361_0418711
3554 Ga0436361_0767272
3555 Ga0436361_1014773
3556 Ga0436363_0610096
3557 Ga0436362_0395602
3558 Ga0436362_0461905
3559 Ga0436362_0634959
3560 Ga0439461_0000185
3561 Ga0439461_0000509
3562 Ga0439466_0008577
3563 Ga0439466_0010668
3564 Ga0439465_0001455
3565 Ga0439465_0003295
3566 Ga0439465_0006654
3567 Ga0439465_0007084
3568 Ga0439465_0012336
3569 Ga0439431_0000154
3570 Ga0439431_0001441
3571 Ga0439431_0014052
3572 Ga0439441_006682
3573 Ga0439445_0011468
3574 Ga0439448_0001228
3575 Ga0439452_010805
3576 Ga0439446_0010505
3577 Ga0439446_0016003
3578 Ga0439458_0000074
3579 Ga0439458_0011513
3580 Ga0439434_0001116
3581 Ga0439464_0004011
3582 Ga0466969_0001258
3583 Ga0466969_0029365
3584 Ga0466972_0006865
3585 Ga0466972_0018879
3586 Ga0466972_0025490
3587 Ga0453683_0005062
3588 Ga0453683_0015023
3589 Ga0453683_0017222
3590 Ga0466965_0025024
3591 Ga0466965_0049346
3592 Ga0466965_0084498
3593 Ga0466966_0000994
3594 Ga0466966_0007032
3595 Ga0466966_0012243
3596 Ga0466966_0065145
3597 Ga0466961_0032775
3598 Ga0466961_0108767
3599 Ga0466963_0002039
3600 Ga0466963_0011975
3601 Ga0466963_0045631
3602 Ga0466964_0002516
3603 Ga0453684_0032752
3604 Ga0453684_0095577
3605 Ga0466971_0022988
3606 Ga0466971_0039235
3607 Ga0466968_0001476
3608 Ga0466970_0000170
3609 Ga0466970_0003173
3610 Ga0466970_0018515
3611 Ga0466970_0023360
3612 Ga0466957_0004154
3613 Ga0466957_0046232
3614 Ga0466957_0060038
3615 Ga0466957_0075392
3616 Ga0466960_0000298
3617 Ga0466960_0005318
3618 Ga0466959_0006453
3619 Ga0466959_0008755
3620 Ga0466959_0099667
3621 Ga0451576_0000017
3622 Ga0451576_0012723
3623 Ga0451576_0036689
3624 Ga0466958_0000981
3625 Ga0466958_0008787
3626 Ga0466958_0018974
3627 Ga0466958_0077172
3628 Ga0466967_0001069
3629 Ga0466967_0012795
3630 Ga0466967_0015458
3631 Ga0466967_0061043
3632 Ga0466967_0133113
3633 Ga0495627_000189
3634 Ga0495592_0020816
3635 Ga0495592_0026172
3636 Ga0495629_0007149
3637 Ga0495629_0032761
3638 Ga0495629_0036913
3639 Ga0495638_0000593
3640 Ga0495638_0011334
3641 Ga0495641_0012247
3642 Ga0495641_0044694
3643 Ga0495650_0000030
3644 Ga0495639_0034093
3645 Ga0495594_0111141
3646 Ga0495596_0002343
3647 Ga0495583_0000286
3648 Ga0495606_0000598
3649 Ga0495606_0066391
3650 Ga0495608_0037098
3651 Ga0495610_0000046
3652 Ga0495610_0013516
3653 Ga0495610_0019406
3654 Ga0495618_0073195
3655 Ga0495628_0013061
3656 Ga0495628_0052579
3657 Ga0495637_0010370
3658 Ga0495637_0041438
3659 Ga0495643_0000332
3660 Ga0495643_0004547
3661 Ga0495643_0010673
3662 Ga0495648_0000189
3663 Ga0495648_0012148
3664 Ga0495642_0020118
3665 Ga0495654_0000048
3666 Ga0495640_0087745
3667 Ga0495587_0021777
3668 Ga0495598_0005329
3669 Ga0495609_0034585
3670 Ga0495645_0000656
3671 Ga0495645_0004742
3672 Ga0495622_0002164
3673 Ga0495668_0000015
3674 Ga0495668_0000352
3675 Ga0495668_0017446
3676 Ga0495668_0021658
3677 Ga0495634_0105098
3678 Ga0495611_0007526
3679 Ga0495625_0000054
3680 Ga0495625_0007142
3681 Ga0495625_0129508
3682 Ga0495635_0013502
3683 Ga0495635_0112562
3684 Ga0495588_0047909
3685 Ga0495599_0012174
3686 Ga0495646_0012592
3687 Ga0495669_0000613
3688 Ga0495669_0011329
3689 Ga0495669_0025170
3690 Ga0495624_0035242
3691 Ga0495670_0000015
3692 Ga0495649_0002867
3693 Ga0495600_0009290
3694 Ga0495581_0019489
3695 Ga0495604_0020211
3696 Ga0495674_0026786
3697 Ga0495672_0002169
3698 Ga0495672_0023065
3699 Ga0495672_0034513
3700 Ga0495672_0045360
3701 Ga0495680_0017868
3702 Ga0495687_013923
3703 Ga0495677_0011627
3704 Ga0495673_0001996
3705 Ga0495684_0009505
3706 Ga0495684_0086821
3707 Ga0495686_0000023
3708 Ga0495686_0000579
3709 Ga0495686_0000903
3710 Ga0495686_0002754
3711 Ga0495686_0017403
3712 Ga0495593_0003370
3713 Ga0495593_0015804
3714 Ga0495593_0038290
3715 Ga0495602_0008181
3716 Ga0495602_0147847
3717 Ga0495626_0001517
3718 Ga0496100_0000109
3719 Ga0496100_0002884
3720 Ga0496100_0003669
3721 Ga0496100_0007695
3722 Ga0496100_0033974
3723 Ga0496101_0000020
3724 Ga0496101_0000075
3725 Ga0496101_0000310
3726 Ga0496101_0001332
3727 Ga0496101_0002044
3728 Ga0496101_0003714
3729 Ga0496101_0031192
3730 Ga0496101_0042352
3731 Ga0496101_0135245
3732 Ga0496102_0000003
3733 Ga0496102_0000126
3734 Ga0496102_0000260
3735 Ga0496102_0002509
3736 Ga0496102_0002696
3737 Ga0496102_0004756
3738 Ga0496102_0016728
3739 Ga0496102_0024275
3740 Ga0496102_0086610
3741 Ga0496102_0126959
3742 Ga0496103_0000014
3743 Ga0496103_0000089
3744 Ga0496103_0000093
3745 Ga0496103_0000171
3746 Ga0496103_0003295
3747 Ga0496103_0047241
3748 Ga0496103_0103463
3749 Ga0496104_0000315
3750 Ga0496104_0000892
3751 Ga0496104_0000934
3752 Ga0496104_0002562
3753 Ga0496104_0004658
3754 Ga0496104_0008405
3755 Ga0496104_0047066
3756 Ga0496104_0162809
3757 Ga0496104_0208548
3758 Ga0496104_0224545
3759 Ga0496105_0000162
3760 Ga0496105_0001760
3761 Ga0496105_0003992
3762 Ga0496105_0013485
3763 Ga0496105_0042550
3764 Ga0496106_0000500
3765 Ga0496106_0002456
3766 Ga0496106_0002847
3767 Ga0496106_0004836
3768 Ga0496106_0011313
3769 Ga0496106_0011738
3770 Ga0496106_0052686
3771 Ga0496107_0000883
3772 Ga0496107_0002241
3773 Ga0496107_0005283
3774 Ga0496107_0017601
3775 Ga0496107_0018545
3776 Ga0496107_0023740
3777 Ga0496107_0041504
3778 Ga0496107_0048719
3779 Ga0496107_0063572
3780 Ga0496107_0166591
3781 Ga0496108_0000222
3782 Ga0496108_0000405
3783 Ga0496108_0001588
3784 Ga0496108_0001675
3785 Ga0496108_0008147
3786 Ga0496108_0008946
3787 Ga0496108_0026644
3788 Ga0496108_0043373
3789 Ga0496108_0057729
3790 Ga0496108_0073965
3791 Ga0496109_0000440
3792 Ga0496109_0001534
3793 Ga0496109_0004236
3794 Ga0496109_0005102
3795 Ga0496109_0009526
3796 Ga0496109_0011881
3797 Ga0496109_0066427
3798 Ga0496110_0000032
3799 Ga0496110_0004600
3800 Ga0496110_0011986
3801 Ga0496110_0016028
3802 Ga0496110_0018619
3803 Ga0496110_0026450
3804 Ga0496110_0034017
3805 Ga0496110_0162875
3806 Ga0496110_0210593
3807 Ga0496111_0003922
3808 Ga0496111_0009851
3809 Ga0496111_0020713
3810 Ga0496111_0027242
3811 Ga0496111_0028741
3812 Ga0496111_0043864
3813 Ga0496111_0045302
3814 Ga0496111_0057987
3815 Ga0496111_0062431
3816 Ga0496112_0000610
3817 Ga0496112_0016969
3818 Ga0496112_0026961
3819 Ga0496112_0035098
3820 Ga0496112_0042739
3821 Ga0496112_0058587
3822 Ga0496112_0067518
3823 Ga0496112_0081443
3824 Ga0496112_0085440
3825 Ga0496112_0100366
3826 Ga0496113_0001800
3827 Ga0496113_0009324
3828 Ga0496113_0018117
3829 Ga0496113_0019462
3830 Ga0496113_0019828
3831 Ga0496113_0020159
3832 Ga0496113_0060290
3833 Ga0496113_0072045
3834 Ga0496113_0116933
3835 Ga0496114_0000006
3836 Ga0496114_0000181
3837 Ga0496114_0008650
3838 Ga0496114_0016477
3839 Ga0496114_0016728
3840 Ga0496114_0029912
3841 Ga0496114_0037359
3842 Ga0496114_0045052
3843 Ga0496114_0115066
3844 Ga0496115_0000147
3845 Ga0496115_0003000
3846 Ga0496115_0003195
3847 Ga0496115_0005883
3848 Ga0496115_0007247
3849 Ga0496115_0011153
3850 Ga0496115_0037928
3851 Ga0496115_0053894
3852 Ga0496115_0063030
3853 Ga0496116_0000039
3854 Ga0496116_0000071
3855 Ga0496116_0011639
3856 Ga0496116_0014852
3857 Ga0496116_0104971
3858 Ga0496117_0000003
3859 Ga0496117_0000121
3860 Ga0496117_0000329
3861 Ga0496117_0000606
3862 Ga0496117_0000711
3863 Ga0496117_0065124
3864 Ga0496117_0112898
3865 Ga0496118_0000001
3866 Ga0496118_0000095
3867 Ga0496118_0000164
3868 Ga0496118_0000359
3869 Ga0496118_0000488
3870 Ga0496118_0000683
3871 Ga0496118_0009165
3872 Ga0496118_0022231
3873 Ga0496118_0027075
3874 Ga0496118_0087913
3875 Ga0496119_0000266
3876 Ga0496119_0002301
3877 Ga0496119_0010303
3878 Ga0496119_0012296
3879 Ga0496120_0000235
3880 Ga0496120_0001188
3881 Ga0496121_0000002
3882 Ga0496121_0000019
3883 Ga0496121_0000061
3884 Ga0496121_0000232
3885 Ga0496121_0000387
3886 Ga0496121_0000733
3887 Ga0496121_0003147
3888 Ga0496121_0004752
3889 Ga0496121_0006826
3890 Ga0496122_0000312
3891 Ga0496122_0001014
3892 Ga0496122_0001502
3893 Ga0496122_0001526
3894 Ga0496122_0004400
3895 Ga0496122_0023511
3896 Ga0496122_0049719
3897 Ga0496122_0083593
3898 Ga0496122_0087400
3899 Ga0496123_0000212
3900 Ga0496123_0002207
3901 Ga0496123_0003840
3902 Ga0496123_0004892
3903 Ga0496123_0033490
3904 Ga0496123_0073643
3905 Ga0496124_0000002
3906 Ga0496124_0000041
3907 Ga0496124_0000119
3908 Ga0496124_0000609
3909 Ga0496124_0001412
3910 Ga0496124_0002126
3911 Ga0496124_0008807
3912 Ga0496124_0017007
3913 Ga0496124_0034532
3914 Ga0496124_0152267
3915 Ga0496125_0000002
3916 Ga0496125_0000060
3917 Ga0496125_0000639
3918 Ga0496125_0002810
3919 Ga0496125_0006777
3920 Ga0496125_0008596
3921 Ga0496125_0012568
3922 Ga0496125_0017755
3923 Ga0496125_0019071
3924 Ga0496125_0071840
3925 Ga0496125_0108016
3926 Ga0496125_0140848
3927 Ga0496126_0000011
3928 Ga0496126_0000041
3929 Ga0496126_0000324
3930 Ga0496126_0003151
3931 Ga0496126_0003649
3932 Ga0496126_0004196
3933 Ga0496126_0005320
3934 Ga0496126_0012605
3935 Ga0496126_0022964
3936 Ga0496126_0027502
3937 Ga0496126_0035524
3938 Ga0496126_0056953
3939 Ga0496126_0140238
3940 Ga0495682_0018613
3941 Ga0501300_001280
3942 Ga0501032_0000469
3943 Ga0501032_0001987
3944 Ga0501032_0078347
3945 Ga0501033_0001498
3946 Ga0501033_0075794
3947 Ga0501033_0107393
3948 Ga0501033_0138266
3949 Ga0501034_0000176
3950 Ga0501034_0001299
3951 Ga0501034_0002830
3952 Ga0501034_0015495
3953 Ga0501034_0053873
3954 Ga0501034_0117074
3955 Ga0501034_0124867
3956 Ga0501034_0142281
3957 Ga0501034_0185902
3958 Ga0501036_0024625
3959 Ga0501036_0105756
3960 Ga0501038_0000365
3961 Ga0501038_0006551
3962 Ga0501038_0015639
3963 Ga0501039_0000113
3964 Ga0501039_0031681
3965 Ga0501041_0032024
3966 Ga0501043_0000082
3967 Ga0501046_0000441
3968 Ga0501046_0066197
3969 Ga0501047_0001270
3970 Ga0501047_0004362
3971 Ga0501047_0006865
3972 Ga0501047_0016563
3973 Ga0501047_0066372
3974 Ga0501047_0079801
3975 Ga0501047_0212925
3976 Ga0501067_0008234
3977 Ga0501070_0001505
3978 Ga0501070_0033923
3979 Ga0501071_0066579
3980 Ga0501072_0019906
3981 Ga0501073_0024864
3982 Ga0501073_0033007
3983 Ga0501074_0019317
3984 Ga0501075_0011885
3985 Ga0501075_0036159
3986 Ga0501076_0090015
3987 Ga0501077_0034187
3988 Ga0501077_0047698
3989 Ga0501249_000202
3990 Ga0501257_000527
3991 Ga0501079_0030608
3992 Ga0501079_0034917
3993 Ga0501080_0003050
3994 Ga0501081_0044143
3995 Ga0501081_0047073
3996 Ga0501083_0033452
3997 Ga0501083_0094110
3998 Ga0501035_0002808
3999 Ga0501035_0004316
4000 Ga0501035_0009531
4001 Ga0501035_0038425
4002 Ga0501035_0087021
4003 Ga0501035_0112024
4004 Ga0501035_0142030
4005 Ga0501044_0003845
4006 Ga0501044_0009175
4007 Ga0501044_0010779
4008 Ga0501044_0013412
4009 Ga0501044_0014692
4010 Ga0501044_0014788
4011 Ga0501044_0083798
4012 Ga0501044_0154043
4013 Ga0501044_0184573
4014 Ga0501045_0050318
4015 nmdc:mga03683_47519_c1
4016 nmdc:mga03n38_1064_c1
4017 nmdc:mga03n38_3813_c1
4018 nmdc:mga00v17_274_c1
4019 nmdc:mga00v17_3698_c1
4020 nmdc:mga00v17_4868_c1
4021 nmdc:mga00v17_5797_c2
4022 nmdc:mga00v17_79848_c1
4023 nmdc:mga0yw44_21353_c1
4024 nmdc:mga0yw44_21535_c1
4025 nmdc:mga0k408_11932_c1
4026 nmdc:mga0k408_33111_c1
4027 nmdc:mga06z11_15096_c1
4028 nmdc:mga06z11_4788_c1
4029 nmdc:mga04h51_15027_c1
4030 nmdc:mga04h51_45_c1
4031 nmdc:mga07m45_1682_c1
4032 nmdc:mga07m45_43700_c1
4033 nmdc:mga07m45_45644_c1
4034 nmdc:mga05p37_106164_c1
4035 nmdc:mga05p37_127402_c1
4036 nmdc:mga05p37_430_c1
4037 nmdc:mga09592_259197_c1
4038 nmdc:mga0qj67_11808_c1
4039 nmdc:mga0qj67_77598_c1
4040 nmdc:mga06r32_1291_c1
4041 nmdc:mga06r32_763_c1
4042 nmdc:mga08y16_1565_c1
4043 nmdc:mga08y16_273987_c1
4044 nmdc:mga08y16_55327_c1
4045 nmdc:mga0n895_153_c1
4046 nmdc:mga0n895_31835_c1
4047 nmdc:mga0rr50_100_c1
4048 nmdc:mga0rr50_145764_c1
4049 nmdc:mga0rr50_2827_c1
4050 nmdc:mga08x19_22607_c2
4051 nmdc:mga08x19_23194_c1
4052 nmdc:mga08x19_24_c1
4053 nmdc:mga0a205_191_c2
4054 nmdc:mga0a205_38887_c1
4055 nmdc:mga0sz30_10629_c1
4056 nmdc:mga0sz30_1356_c1
4057 nmdc:mga0sz30_16205_c1
4058 nmdc:mga0sz30_33776_c1
4059 nmdc:mga0sz30_52451_c1
4060 nmdc:mga0sz30_9436_c1
4061 Ga0495601_0000068
4062 Ga0495601_0009741
4063 Ga0495612_0003612
4064 Ga0500635_0001009
4065 Ga0495655_0006068
4066 Ga0495595_0010358
4067 Ga0495619_0000154
4068 Ga0495619_0001765
4069 Ga0495619_0016353
4070 Ga0500643_000004
4071 Ga0500643_000245
4072 Ga0500643_000419
4073 Ga0500643_001415
4074 Ga0500643_001890
4075 Ga0500583_0026389
4076 Ga0500651_0029011
4077 Ga0500566_0000006
4078 Ga0500566_0055838
4079 Ga0500640_006355
4080 Ga0500641_0030815
4081 Ga0500650_0002576
4082 Ga0500555_000119
4083 Ga0500562_006590
4084 Ga0500608_000012
4085 Ga0500608_000098
4086 Ga0500618_000473
4087 Ga0500652_000895
4088 Ga0500658_0000037
4089 Ga0500559_0000003
4090 Ga0500559_0003063
4091 Ga0500559_0004488
4092 Ga0500559_0005074
4093 Ga0500559_0048714
4094 Ga0500573_0023933
4095 Ga0500590_003717
4096 Ga0500603_007606
4097 Ga0500604_0000048
4098 Ga0500616_0001872
4099 Ga0500616_0002132
4100 Ga0500616_0005608
4101 Ga0500616_0011416
4102 Ga0500616_0016614
4103 Ga0500620_000203
4104 Ga0500622_0012929
4105 Ga0500624_000041
4106 Ga0500627_0000029
4107 Ga0500627_0006675
4108 Ga0500639_000016
4109 Ga0500636_0011726
4110 Ga0500611_000077
4111 Ga0500645_000988
4112 Ga0500645_002767
4113 Ga0500645_026445
4114 Ga0500596_004688
4115 Ga0501084_0002530
4116 Ga0501084_0052022
4117 Ga0501084_0221052
4118 Ga0501082_0062480
4119 Ga0466962_0015555
4120 Ga0466962_0028235
4121 Ga0530510_0033473
4122 Ga0530510_0090690
4123 2509113276
4124 2509369805
4125 2509394194
4126 2512037758
4127 2512644233
4128 2512933352
4129 2512961456
4130 2513592261
4131 2513610427
4132 2514036747
4133 2514421492
4134 2523382607
4135 2548693476
4136 2566991330
4137 2588519421
4138 2597811695
4139 2599937176
4140 2603858216
4141 2620352709
4142 2643777142
4143 2643795590
4144 2643819334
4145 2643836049
4146 2644052526
4147 2644353110
4148 2644516371
4149 2644728155
4150 2644733967
4151 2688596541
4152 2694629922
4153 2694635734
4154 2723573642
4155 2738664290
4156 2739143425
4157 2739329977
4158 2753035825
4159 2753326150
4160 2765468052
4161 2770198789
4162 2776377265
4163 2819716759
4164 2824746547
4165 2834580613
4166 2837653073
4167 2839993172
4168 2840766181
4169 2840879346
4170 2841736961
4171 2842136811
4172 2842890945
4173 2847674314
4174 2847690430
4175 2852656026
4176 2852683161
4177 2855020565
4178 2856317769
4179 2856321170
4180 2856328305
4181 2856335582
4182 2856342491
4183 2856366410
4184 2857356905
4185 2857373057
4186 2869165131
4187 2869253955
4188 2869270591
4189 2869276665
4190 2869285289
4191 2869288179
4192 2871430065
4193 2871448414
4194 2871453920
4195 2871464113
4196 2871479583
4197 2871494725
4198 2871497714
4199 2874105610
4200 2874132764
4201 2874140381
4202 2874151812
4203 2874159445
4204 2874168128
4205 2876364395
4206 2876376679
4207 2876378480
4208 2876396571
4209 2876402051
4210 2876411374
4211 2876417863
4212 2876764784
4213 2878038828
4214 2878741516
4215 2878749690
4216 2878759859
4217 2878761937
4218 2878768903
4219 2878775443
4220 2878784843
4221 2878788868
4222 2881149072
4223 2881160309
4224 2881165911
4225 2881846568
4226 2881858053
4227 2881868806
4228 2882636073
4229 2882808865
4230 2882915743
4231 2885307395
4232 2885313570
4233 2885322357
4234 2885347655
4235 2885351486
4236 2888337602
4237 2888344923
4238 2888354117
4239 2889015831
4240 2889019119
4241 2889793045
4242 2889917384
4243 2894653927
4244 2895883170
4245 2898795929
4246 2899261932
4247 2899276365
4248 2899369556
4249 2902803481
4250 2902813668
4251 2902841678
4252 2903455080
4253 2903493919
4254 2903494083
4255 2903523380
4256 2903531418
4257 2903542512
4258 2904541709
4259 2904580175
4260 2904663347
4261 2906310728
4262 2906324791
4263 2906333585
4264 2906360637
4265 2906372783
4266 2906389333
4267 2906396628
4268 2906408582
4269 2906417834
4270 2915773322
4271 2917701731
4272 2919120152
4273 2919140815
4274 2919711422
4275 2922138738
4276 2922155503
4277 2922161910
4278 2922174928
4279 2922188463
4280 2922556211
4281 2924720850
4282 2924750428
4283 2924756479
4284 2924767315
4285 2924779198
4286 2924790501
4287 2929213807
4288 2932401177
4289 2937817555
4290 2937825337
4291 2937841189
4292 2937848609
4293 2937871838
4294 2937880254
4295 2937893044
4296 2937979237
4297 2937996365
4298 2938018325
4299 2939589088
4300 2958040994
4301 2958057488
4302 2958070180
4303 2958073241
4304 2958087307
4305 2958096730
4306 2958115238
4307 2958127957
4308 2958132581
4309 2958139531
4310 2958162315
4311 2958166835
4312 2958182395
4313 2961080240
4314 2961118374
4315 2961135261
4316 2961138112
4317 2961165305
4318 2961177692
4319 2963645852
4320 2965020127
4321 2965030839
4322 2965036853
4323 2965041388
4324 2965051158
4325 2965062981
4326 2965110412
4327 2968002221
4328 2968009455
4329 2968022588
4330 2968089362
4331 2968091735
4332 2968102066
4333 2968114435
4334 2968122134
4335 2968133294
4336 2968173706
4337 2970475172
4338 2970510370
4339 2970526650
4340 2970546006
4341 2970553689
4342 2970556792
4343 2970599905
4344 2974316578
4345 2977828381
4346 2977831681
4347 2977847843
4348 2977861463
4349 2977868818
4350 2977876423
4351 2977916460
4352 2977923755
4353 2977937928
4354 2977950118
4355 2977955817
4356 2977962659
4357 2977975557
4358 2977989612
4359 2979785835
4360 2979815243
4361 2984524754
4362 2987644186
4363 2987653040
4364 2987661312
4365 2987671162
4366 2987674668
4367 2996315383
4368 2996339507
4369 2996348180
4370 2996353402
4371 3000018716
4372 3000141680
4373 3002141488
4374 3004190361
4375 3004199833
4376 3004208335
4377 3004212906
4378 3004220585
4379 3004246677
4380 3004252958
4381 3004280084
4382 3004292557
4383 3004336603
4384 637076432
4385 649871098
4386 8002812320
4387 8004302910
4388 8004318325
4389 8004381357
4390 8004389966
4391 8004399587
4392 8004450963
4393 8004639274
4394 8004646293
4395 8004713994
4396 8004718363
4397 8045865994
4398 8054007095
4399 8054916297
4400 8054924906
4401 8055618487
4402 8057136433

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00171

Aldedh

Aldehyde dehydrogenase family

74

530

0.97

PF05893

LuxC

Acyl-CoA reductase (LuxC)

101

345

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4iym-assembly1.cif.gz_C crystal structure of putative methylmalonate-semialdehyde dehydrogenase from sinorhizobium meliloti 1021 complexed with nad, target 011934 0.9841 1 475
4zz7-assembly2.cif.gz_G crystal structure of methylmalonate-semialdehyde dehydrogenase (dddc) from oceanimonas doudoroffii 0.9818 1 477
1t90-assembly1.cif.gz_D crystal structure of methylmalonate semialdehyde dehydrogenase from bacillus subtilis 0.9719 1 476
4zz7-assembly2.cif.gz_G crystal structure of methylmalonate-semialdehyde dehydrogenase (dddc) from oceanimonas doudoroffii 0.9598 1 477
3k2w-assembly2.cif.gz_E crystal structure of betaine-aldehyde dehydrogenase from pseudoalteromonas atlantica t6c 0.9582 3 474
ID Description Score Start End Superfamily
af_O53816_3_249_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9934 3 247 3.40.605.10
af_Q54I10_27_272_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9859 1 243 3.40.605.10
1t90B01 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9834 1 246 3.40.605.10
af_Q02253_6_514_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9822 2 470 3.40.50.150
af_O53816_3_249_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.9815 3 247 3.40.605.10
ID Description Score Start End GO Terms
AF-A0A534CCL6-F1-model_v4 Aldehyde dehydrogenase family protein 0.9955 3 267 GO:0004491
GO:0006210
GO:0006574
AF-A0A3M2VYW1-F1-model_v4 methylmalonate-semialdehyde dehydrogenase (CoA acylating) (EC 1.2.1.27) 0.9952 155 411 GO:0004491
GO:0006210
GO:0006574
AF-A0A2S7N5H9-F1-model_v4 deleted 0.9946 63 262
AF-A0A506XM08-F1-model_v4 Aldehyde dehydrogenase family protein 0.9943 140 259 GO:0004491
GO:0006210
GO:0006574
AF-A0A834BDA3-F1-model_v4 Aldehyde dehydrogenase 6 family member A1 0.9921 2 251 GO:0004491
GO:0005739
GO:0006210
GO:0006574

Map