F496547

General Info

Members Datasets Scaffolds Average Seq Length
2204 807 4408 375

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10003010|Ga0070658_1000301013
Length 447
Sequence MLCSDSHSESQQSDPITACSGRLPRPDCPGQDTDQRHQPTPRRRLSARPAIIEHTGSVADSSELITKREFSVTDAPKIEIPANLKPSDGRFGAGPSKIRPESVAALAASSAGYLGTSHRRPAVKNVVGKVRAGLTQLFNLPDGYEVVLGNGGATAFWDIATFNLIRERSQHLNFGEFSSKFAAAAKAAPFLADPSVIKSDPGTHPLPRAEAGIDAYALTHNETSTGVMMPIKRVQGADDGALVLVDATSGAGGLPVDVNETDVYYFSPQKCFASDGGLWLGLFSPAAIERVAQIKESGRWIPTSYDLTTAIDNSRLDQTYNTPALVTLWLLADQLDWMNSNGGLQFTTSRTADSAQRLYTWAEKTDYTTPYVTDADKRSNVIGTIDFDDAIDAEQVAKTLRANGILDTEPYRKLGRNQLRIAMFPAIDPADVEALTACIDYVVAKLS

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
16 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
95 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
96 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
133 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
134 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
207 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
212 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
213 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
214 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
215 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
216 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
217 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
218 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
219 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
220 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
221 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
222 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
223 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
224 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
225 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
226 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
227 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
228 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
229 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
230 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
231 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
232 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
233 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
234 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
235 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
236 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
237 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
238 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
239 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
240 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
241 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
242 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
243 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
244 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
245 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
246 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
247 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
248 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
249 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
250 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
251 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
252 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
253 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
254 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
255 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
256 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
257 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
258 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
259 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
260 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
261 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
262 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
263 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
264 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
265 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
266 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
267 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
268 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
269 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
270 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
271 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
272 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
273 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
274 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
275 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
276 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
277 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
278 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
279 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
280 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
281 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
282 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
283 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
284 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
285 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
286 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
287 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
288 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
289 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
290 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
291 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
292 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
293 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
294 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
295 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
296 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
297 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
298 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
299 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
300 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
301 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
302 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
303 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
304 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
305 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
306 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
307 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
308 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
309 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
310 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
311 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
312 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
313 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
314 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
315 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
316 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
317 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
318 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
319 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
320 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
321 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
322 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
323 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
324 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
325 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
326 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
327 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
328 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
329 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
330 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
331 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
332 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
333 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
334 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
335 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
336 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
337 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
338 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
339 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
340 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
341 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
342 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
343 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
344 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
345 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
346 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
347 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
348 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
349 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
350 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
351 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
352 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
353 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
354 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
355 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
356 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
357 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
358 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
359 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
360 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
361 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
362 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
363 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
364 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
365 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
366 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
367 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
368 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
369 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
370 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
371 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
372 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
373 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
374 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
375 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
376 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
377 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
378 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
379 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
380 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
381 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
382 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
383 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
384 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
385 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
386 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
387 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
388 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
389 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
390 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
391 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
392 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
393 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
394 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
395 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
396 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
397 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
398 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
399 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
400 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
401 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
402 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
403 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
404 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
405 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
406 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
407 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
408 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
409 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
410 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
411 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
412 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
413 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
414 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
415 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
416 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
417 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
418 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
419 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
420 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
421 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
422 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
423 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
424 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
425 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
426 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
427 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
428 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
429 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
430 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
431 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
432 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
433 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
434 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
435 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
436 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
437 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
438 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
439 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
440 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
441 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
442 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
443 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
444 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
445 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
446 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
447 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
448 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
449 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
450 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
451 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
452 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
453 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
454 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
456 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
457 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
460 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
461 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
463 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
464 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
470 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
471 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
472 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
473 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
474 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
475 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
476 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
477 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
478 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
479 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
480 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
481 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
482 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
483 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
484 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
485 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
486 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
488 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
489 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
490 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
491 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
492 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
493 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
494 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
495 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
496 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
497 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
498 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
499 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
500 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
501 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
502 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
503 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
504 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
505 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
506 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
507 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
508 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
509 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
510 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
511 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
512 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
513 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
514 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
515 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
516 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
517 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
518 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
519 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
520 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
521 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
522 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
523 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
524 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
525 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
526 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
527 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
528 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
529 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
530 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
531 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
532 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
533 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
534 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
535 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
536 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
537 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
538 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
539 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
540 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
541 2501939600 Micromonospora sp. L5 Isolate Unclassified
542 2506783011 Frankia datiscae Dg1 Isolate Nodule
543 2508501039 Frankia saprophytica CN3 Isolate Nodule
544 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
545 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
546 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
547 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
548 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
549 2517572101 Frankia sp. DC12 Isolate Nodule
550 2527291627 Frankia casuarinae Thr Isolate Nodule
551 2527291629 Frankia sp. BMG5.23 Isolate Nodule
552 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
553 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
554 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
555 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
556 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
557 2576861822 Frankia sp. CeD Isolate Nodule
558 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
559 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
560 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
561 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
562 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
563 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
564 2619618881 Frankia sp. ACN1ag Isolate Unclassified
565 2619619003 Frankia sp. CpI1-P Isolate Nodule
566 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
567 2626541554 Frankia sp. AvcI.1 Isolate Nodule
568 2643221548 Streptomyces sp. Root55 Isolate Unclassified
569 2643221561 Nocardioides sp. Root151 Isolate Unclassified
570 2643221566 Microbacterium sp. Root166 Isolate Unclassified
571 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
572 2643221576 Nocardioides sp. Root614 Isolate Unclassified
573 2643221578 Streptomyces sp. Root63 Isolate Unclassified
574 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
575 2643221590 Nocardioides sp. Root682 Isolate Unclassified
576 2643221597 Microbacterium sp. Root180 Isolate Unclassified
577 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
578 2643221604 Nocardioides sp. Root190 Isolate Unclassified
579 2643221615 Nocardioides sp. Root224 Isolate Unclassified
580 2643221617 Nocardioides sp. Root79 Isolate Unclassified
581 2643221620 Nocardioides sp. Root240 Isolate Unclassified
582 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
583 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
584 2643221641 Nocardioides sp. Root122 Isolate Unclassified
585 2643221647 Streptomyces sp. Root369 Isolate Unclassified
586 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
587 2643221670 Streptomyces sp. Root431 Isolate Unclassified
588 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
589 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
590 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
591 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
592 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
593 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
594 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
595 2643221696 Nocardioides sp. Root140 Isolate Unclassified
596 2643221711 Terrabacter sp. Root85 Isolate Unclassified
597 2643221714 Streptomyces sp. Root264 Isolate Unclassified
598 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
599 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
600 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
601 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
602 2671180195 Frankia sp. CcI49 Isolate Nodule
603 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
604 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
605 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
606 2684623036 Frankia sp. CgIM4 Isolate Nodule
607 2687453737 Frankia sp. BMG5.36 Isolate Nodule
608 2710264753 Frankia sp. KB5 Isolate Nodule
609 2739367898 Nocardioides sp. CF479 Isolate Unclassified
610 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
611 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
612 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
613 2773857759 Microbacterium sp. 1294 Isolate Unclassified
614 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
615 2773857922 Frankia sp. CcI49 Isolate Nodule
616 2773857924 Frankia sp. CgIS1 Isolate Nodule
617 2773857933 Frankia sp. BMG5.30 Isolate Nodule
618 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
619 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
620 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
621 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
622 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
623 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
624 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
625 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
626 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
627 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
628 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
629 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
630 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
631 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
632 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
633 2808606448 Streptomyces sp. 193411 Isolate Unclassified
634 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
635 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
636 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
637 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
638 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
639 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
640 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
641 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
642 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
643 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
644 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
645 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
646 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
647 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
648 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
649 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
650 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
651 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
652 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
653 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
654 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
655 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
656 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
657 2855683550 Micromonospora sp. RP3T Isolate Unclassified
658 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
659 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
660 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
661 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
662 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
663 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
664 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
665 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
666 2858868258 Micromonospora sp. MH33 Isolate Unclassified
667 2858882152 Micromonospora noduli MED15 Isolate Nodule
668 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
669 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
670 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
671 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
672 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
673 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
674 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
675 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
676 2862574272 Streptomyces sp. AcE210 Isolate Nodule
677 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
678 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
679 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
680 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
681 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
682 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
683 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
684 2867369537 Streptomyces sp. Z26 Isolate Unclassified
685 2867428634 Streptomyces sp. RP5T Isolate Unclassified
686 2867475112 Streptomyces sp. TM32 Isolate Unclassified
687 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
688 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
689 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
690 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
691 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
692 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
693 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
694 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
695 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
696 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
697 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
698 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
699 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
700 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
701 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
702 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
703 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
704 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
705 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
706 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
707 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
708 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
709 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
710 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
711 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
712 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
713 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
714 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
715 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
716 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
717 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
718 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
719 2920879853 Kocuria salina CV6 Isolate Unclassified
720 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
721 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
722 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
723 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
724 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
725 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
726 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
727 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
728 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
729 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
730 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
731 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
732 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
733 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
734 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
735 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
736 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
737 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
738 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
739 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
740 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
741 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
742 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
743 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
744 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
745 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
746 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
747 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
748 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
749 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
750 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
751 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
752 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
753 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
754 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
755 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
756 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
757 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
758 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
759 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
760 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
761 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
762 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
763 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
764 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
765 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
766 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
767 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
768 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
769 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
770 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
771 637000116 Frankia casuarinae CcI3 Isolate Nodule
772 649633069 Micromonospora sp. L5 Isolate Unclassified
773 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
774 8002775197 Frankia nepalensis CN7 Isolate Nodule
775 8002784119 Frankia sp. AgB1.9 Isolate Nodule
776 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
777 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
778 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
779 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
780 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
781 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
782 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
783 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
784 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
785 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
786 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
787 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
788 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
789 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
790 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
791 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
792 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
793 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
794 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
795 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
796 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
797 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
798 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
799 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
800 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
801 8054920844 Frankia tisae Agncl-8 Isolate Nodule
802 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule
803 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
804 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
805 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
806 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
807 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.48
Metatranscriptomes 1.36
Isolates 12.16

Biome Distribution

Category Percentage (%)
Aerial Root 0.09
Bulb 0
Endosphere 4.95
Nodule 1.5
Rhizoplane 6.26
Rhizosphere 76.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10003010 3300005327 Bacteria 13946
2 LJQas_1001827 3300000549 Bacteria 3107
3 JGI24740J21852_10012278 3300001979 Bacteria 3234
4 JGI24740J21852_10024718 3300001979 Bacteria 2035
5 JGI24739J22299_10004610 3300001989 Bacteria 5271
6 JGI24737J22298_10005964 3300001990 Bacteria 4184
7 JGI24737J22298_10050458 3300001990 Bacteria 1264
8 JGI24735J21928_10005250 3300002067 Bacteria 4303
9 JGI24735J21928_10035354 3300002067 Bacteria 1469
10 JGI24738J21930_10011549 3300002075 Bacteria 1940
11 JGI24738J21930_10020922 3300002075 Bacteria 1359
12 JGI25164J39214_1000508 3300002772 Bacteria 18811
13 JGI25152J39213_1000323 3300002773 Bacteria 30643
14 JGI25406J46586_10006250 3300003203 Bacteria 5498
15 JGI25406J46586_10027794 3300003203 Bacteria 2164
16 rootH1_10000474 3300003316 Bacteria 6566
17 JGI25407J50210_10001412 3300003373 Bacteria 5445
18 JGI25407J50210_10007122 3300003373 Bacteria 2798
19 Ga0006562J51391_1027612 3300003578 Bacteria 3990
20 Ga0006562J51391_1027614 3300003578 Bacteria 5600
21 Ga0006562J51391_1047252 3300003578 Bacteria 6850
22 Ga0006562J51391_1054242 3300003578 Bacteria 3200
23 Ga0006562J51391_1124095 3300003578 Bacteria 3207
24 Ga0055539_1000005 3300003752 Bacteria 609598
25 Ga0055532_1007097 3300003758 Bacteria 1460
26 JGI25405J52794_10017243 3300003911 Bacteria 1432
27 Ga0070658_10001049 3300005327 Bacteria 23614
28 Ga0070658_10001184 3300005327 Bacteria 22310
29 Ga0070658_10001244 3300005327 Bacteria 21827
30 Ga0070658_10029880 3300005327 Bacteria 4378
31 Ga0070658_10067351 3300005327 Bacteria 2925
32 Ga0070658_10077960 3300005327 Bacteria 2718
33 Ga0070658_10137783 3300005327 Bacteria 2037
34 Ga0070658_10215687 3300005327 Bacteria 1622
35 Ga0070676_10036896 3300005328 Bacteria 2816
36 Ga0070683_100009639 3300005329 Bacteria 8263
37 Ga0070683_100020537 3300005329 Bacteria 5877
38 Ga0070683_100022815 3300005329 Bacteria 5598
39 Ga0070683_100051863 3300005329 Bacteria 3799
40 Ga0070683_100177871 3300005329 Bacteria 2020
41 Ga0070683_100410443 3300005329 Bacteria 1292
42 Ga0068869_100023696 3300005334 Bacteria 4245
43 Ga0068869_100239303 3300005334 Bacteria 1446
44 Ga0068869_100310161 3300005334 Bacteria 1277
45 Ga0070680_100004871 3300005336 Bacteria 10107
46 Ga0070680_100021665 3300005336 Bacteria 5110
47 Ga0070680_100102504 3300005336 Bacteria 2377
48 Ga0070682_100011844 3300005337 Bacteria 4988
49 Ga0070682_100024609 3300005337 Bacteria 3585
50 Ga0070682_100139847 3300005337 Bacteria 1649
51 Ga0068868_100117287 3300005338 Bacteria 2169
52 Ga0070660_100066881 3300005339 Bacteria 2799
53 Ga0070660_100187500 3300005339 Bacteria 1675
54 Ga0070660_100351238 3300005339 Bacteria 1214
55 Ga0070661_100051362 3300005344 Bacteria 3017
56 Ga0070661_100086714 3300005344 Bacteria 2315
57 Ga0070661_100094069 3300005344 Bacteria 2221
58 Ga0070661_100271339 3300005344 Bacteria 1314
59 Ga0070692_10025969 3300005345 Bacteria 2892
60 Ga0070692_10078446 3300005345 Bacteria 1773
61 Ga0070668_100000183 3300005347 Bacteria 40650
62 Ga0070675_100001049 3300005354 Bacteria 19919
63 Ga0070675_100028678 3300005354 Bacteria 4481
64 Ga0070674_100019612 3300005356 Bacteria 4299
65 Ga0070674_100136724 3300005356 Bacteria 1834
66 Ga0070688_100109479 3300005365 Bacteria 1835
67 Ga0070659_100000331 3300005366 Bacteria 36451
68 Ga0070659_100007388 3300005366 Bacteria 7983
69 Ga0070659_100009022 3300005366 Bacteria 7314
70 Ga0070659_100010310 3300005366 Bacteria 6872
71 Ga0070659_100076338 3300005366 Bacteria 2672
72 Ga0070659_100120684 3300005366 Bacteria 2123
73 Ga0070659_100179332 3300005366 Bacteria 1738
74 Ga0070667_100002049 3300005367 Bacteria 17842
75 Ga0070709_10001322 3300005434 Bacteria 13497
76 Ga0070709_10160270 3300005434 Bacteria 1563
77 Ga0070709_10191751 3300005434 Bacteria 1442
78 Ga0070714_100003654 3300005435 Bacteria 11518
79 Ga0070714_100004246 3300005435 Bacteria 10794
80 Ga0070714_100016064 3300005435 Bacteria 6034
81 Ga0070714_100029830 3300005435 Bacteria 4537
82 Ga0070714_100046660 3300005435 Bacteria 3676
83 Ga0070714_100059039 3300005435 Bacteria 3288
84 Ga0070714_100092360 3300005435 Bacteria 2653
85 Ga0070714_100158003 3300005435 Bacteria 2048
86 Ga0070714_100356968 3300005435 Bacteria 1373
87 Ga0070713_100042937 3300005436 Bacteria 3693
88 Ga0070713_100047895 3300005436 Bacteria 3516
89 Ga0070713_100139419 3300005436 Bacteria 2146
90 Ga0070710_10001003 3300005437 Bacteria 13427
91 Ga0070710_10002233 3300005437 Bacteria 9158
92 Ga0070710_10002612 3300005437 Bacteria 8563
93 Ga0070710_10036922 3300005437 Bacteria 2674
94 Ga0070711_100010024 3300005439 Bacteria 5847
95 Ga0070711_100064623 3300005439 Bacteria 2557
96 Ga0070711_100096095 3300005439 Bacteria 2146
97 Ga0070711_100174880 3300005439 Bacteria 1639
98 Ga0070700_100005333 3300005441 Bacteria 6800
99 Ga0070700_100010186 3300005441 Bacteria 5184
100 Ga0070663_100024148 3300005455 Bacteria 4086
101 Ga0070663_100040245 3300005455 Bacteria 3271
102 Ga0070663_100157716 3300005455 Bacteria 1745
103 Ga0070678_100019785 3300005456 Bacteria 4400
104 Ga0070678_100140937 3300005456 Bacteria 1929
105 Ga0070678_100229439 3300005456 Bacteria 1547
106 Ga0070662_100007273 3300005457 Bacteria 7174
107 Ga0070662_100015432 3300005457 Bacteria 5117
108 Ga0070681_10003004 3300005458 Bacteria 15654
109 Ga0070681_10041744 3300005458 Bacteria 4599
110 Ga0070681_10043431 3300005458 Bacteria 4503
111 Ga0070681_10074174 3300005458 Bacteria 3364
112 Ga0068867_100008050 3300005459 Bacteria 7449
113 Ga0070706_100004341 3300005467 Bacteria 13715
114 Ga0070706_100070700 3300005467 Bacteria 3228
115 Ga0070707_100069853 3300005468 Bacteria 3382
116 Ga0070707_100178664 3300005468 Bacteria 2069
117 Ga0070707_100332979 3300005468 Bacteria 1475
118 Ga0070698_100002205 3300005471 Bacteria 21598
119 Ga0070698_100010603 3300005471 Bacteria 9817
120 Ga0070698_100036593 3300005471 Bacteria 5068
121 Ga0070679_100003703 3300005530 Bacteria 14009
122 Ga0070679_100012146 3300005530 Bacteria 8227
123 Ga0070679_100013183 3300005530 Bacteria 7914
124 Ga0070679_100055836 3300005530 Bacteria 3934
125 Ga0070679_100087398 3300005530 Bacteria 3104
126 Ga0070684_100032029 3300005535 Bacteria 4478
127 Ga0070684_100053278 3300005535 Bacteria 3521
128 Ga0070684_100067991 3300005535 Bacteria 3130
129 Ga0070684_100099709 3300005535 Bacteria 2593
130 Ga0070684_100130315 3300005535 Bacteria 2268
131 Ga0068853_100064870 3300005539 Bacteria 3168
132 Ga0068853_100147353 3300005539 Bacteria 2116
133 Ga0070672_100008591 3300005543 Bacteria 6993
134 Ga0070695_100005591 3300005545 Bacteria 7402
135 Ga0070665_100002967 3300005548 Bacteria 18327
136 Ga0070665_100064400 3300005548 Bacteria 3676
137 Ga0070665_100101717 3300005548 Bacteria 2878
138 Ga0070665_100130858 3300005548 Bacteria 2512
139 Ga0070704_100041196 3300005549 Bacteria 3186
140 Ga0068855_100001428 3300005563 Bacteria 29696
141 Ga0068855_100079030 3300005563 Bacteria 3816
142 Ga0070664_100023722 3300005564 Bacteria 5066
143 Ga0068857_100007045 3300005577 Bacteria 9679
144 Ga0068857_100013000 3300005577 Bacteria 7252
145 Ga0068857_100187880 3300005577 Bacteria 1881
146 Ga0068857_100207577 3300005577 Bacteria 1787
147 Ga0068854_100015333 3300005578 Bacteria 5074
148 Ga0068856_100076027 3300005614 Bacteria 3327
149 Ga0068856_100197911 3300005614 Bacteria 2024
150 Ga0070702_100004888 3300005615 Bacteria 6171
151 Ga0068852_100020429 3300005616 Bacteria 5267
152 Ga0068859_100000067 3300005617 Bacteria 98013
153 Ga0068859_100039334 3300005617 Bacteria 4744
154 Ga0068859_100047695 3300005617 Bacteria 4304
155 Ga0068859_100350487 3300005617 Bacteria 1571
156 Ga0068861_100029657 3300005719 Bacteria 4003
157 Ga0068861_100102696 3300005719 Bacteria 2277
158 Ga0068861_100118255 3300005719 Bacteria 2134
159 Ga0068851_10000025 3300005834 Bacteria 123782
160 Ga0068870_10036993 3300005840 Bacteria 2514
161 Ga0068863_100004056 3300005841 Bacteria 14461
162 Ga0068863_100024933 3300005841 Bacteria 5704
163 Ga0068863_100224579 3300005841 Bacteria 1810
164 Ga0068863_100247885 3300005841 Bacteria 1720
165 Ga0068858_100000001 3300005842 Bacteria 417735
166 Ga0068858_100000073 3300005842 Bacteria 104882
167 Ga0068858_100022212 3300005842 Bacteria 5925
168 Ga0068860_100000160 3300005843 Bacteria 110266
169 Ga0068860_100185576 3300005843 Bacteria 2011
170 Ga0068860_100379660 3300005843 Bacteria 1395
171 Ga0068862_100000061 3300005844 Bacteria 129972
172 Ga0068862_100000131 3300005844 Bacteria 87720
173 Ga0081455_10000159 3300005937 Bacteria 82220
174 Ga0081455_10001413 3300005937 Bacteria 29717
175 Ga0081455_10003874 3300005937 Bacteria 17047
176 Ga0081455_10006383 3300005937 Bacteria 12657
177 Ga0081455_10020441 3300005937 Bacteria 6233
178 Ga0081455_10020874 3300005937 Bacteria 6156
179 Ga0081455_10043153 3300005937 Bacteria 3949
180 Ga0081455_10043453 3300005937 Bacteria 3930
181 Ga0081455_10103941 3300005937 Bacteria 2273
182 Ga0081455_10126898 3300005937 Bacteria 2000
183 Ga0081538_10001163 3300005981 Bacteria 27775
184 Ga0081538_10001523 3300005981 Bacteria 23782
185 Ga0081538_10002152 3300005981 Bacteria 19604
186 Ga0081538_10007077 3300005981 Bacteria 9748
187 Ga0081538_10035352 3300005981 Bacteria 3284
188 Ga0081538_10044152 3300005981 Bacteria 2784
189 Ga0081540_1002855 3300005983 Bacteria 13990
190 Ga0081540_1030633 3300005983 Bacteria 2976
191 Ga0081540_1039207 3300005983 Bacteria 2486
192 Ga0081539_10000205 3300005985 Bacteria 137262
193 Ga0081539_10001811 3300005985 Bacteria 33775
194 Ga0081539_10003373 3300005985 Bacteria 19777
195 Ga0081539_10003816 3300005985 Bacteria 17715
196 Ga0081539_10008555 3300005985 Bacteria 8857
197 Ga0081539_10009590 3300005985 Bacteria 8046
198 Ga0081539_10036960 3300005985 Bacteria 2915
199 Ga0070717_10012997 3300006028 Bacteria 6359
200 Ga0070717_10016221 3300006028 Bacteria 5772
201 Ga0070717_10033577 3300006028 Bacteria 4140
202 Ga0070717_10198024 3300006028 Bacteria 1758
203 Ga0075365_10000486 3300006038 Bacteria 15093
204 Ga0075365_10014721 3300006038 Bacteria 4710
205 Ga0075365_10033347 3300006038 Bacteria 3317
206 Ga0075365_10034752 3300006038 Bacteria 3257
207 Ga0075365_10056700 3300006038 Bacteria 2605
208 Ga0075365_10056989 3300006038 Bacteria 2599
209 Ga0075365_10062852 3300006038 Bacteria 2484
210 Ga0075365_10129814 3300006038 Bacteria 1744
211 Ga0075368_10000878 3300006042 Bacteria 9319
212 Ga0075363_100008537 3300006048 Bacteria 4776
213 Ga0075363_100012931 3300006048 Bacteria 4031
214 Ga0075363_100023615 3300006048 Bacteria 3119
215 Ga0075363_100043142 3300006048 Bacteria 2385
216 Ga0075363_100104540 3300006048 Bacteria 1570
217 Ga0075363_100105059 3300006048 Bacteria 1566
218 Ga0075363_100111867 3300006048 Bacteria 1518
219 Ga0075364_10001480 3300006051 Bacteria 12798
220 Ga0075364_10002322 3300006051 Bacteria 10666
221 Ga0075364_10004050 3300006051 Bacteria 8418
222 Ga0075364_10011600 3300006051 Bacteria 5357
223 Ga0075432_10002641 3300006058 Bacteria 5980
224 Ga0070716_100000703 3300006173 Bacteria 14262
225 Ga0070716_100006125 3300006173 Bacteria 5867
226 Ga0070712_100002734 3300006175 Bacteria 10892
227 Ga0070712_100320632 3300006175 Bacteria 1260
228 Ga0075362_10000684 3300006177 Bacteria 10015
229 Ga0075367_10006299 3300006178 Bacteria 5982
230 Ga0075367_10009909 3300006178 Bacteria 4992
231 Ga0075367_10050343 3300006178 Bacteria 2459
232 Ga0075367_10059194 3300006178 Bacteria 2280
233 Ga0075367_10074734 3300006178 Bacteria 2043
234 Ga0075367_10093752 3300006178 Bacteria 1829
235 Ga0075369_10009130 3300006186 Bacteria 3842
236 Ga0075370_10007490 3300006353 Bacteria 5562
237 Ga0075370_10007584 3300006353 Bacteria 5532
238 Ga0075428_100000389 3300006844 Bacteria 43497
239 Ga0075428_100004341 3300006844 Bacteria 15638
240 Ga0075428_100007979 3300006844 Bacteria 11744
241 Ga0075428_100011245 3300006844 Bacteria 9961
242 Ga0075428_100021756 3300006844 Bacteria 7100
243 Ga0075428_100316310 3300006844 Bacteria 1678
244 Ga0075430_100010091 3300006846 Bacteria 7992
245 Ga0075430_100012981 3300006846 Bacteria 7100
246 Ga0075430_100015263 3300006846 Bacteria 6540
247 Ga0075430_100091383 3300006846 Bacteria 2545
248 Ga0075431_100004396 3300006847 Bacteria 13822
249 Ga0075431_100006800 3300006847 Bacteria 11360
250 Ga0075431_100009948 3300006847 Bacteria 9553
251 Ga0075431_100018477 3300006847 Bacteria 7100
252 Ga0075431_100020488 3300006847 Bacteria 6755
253 Ga0075431_100026181 3300006847 Bacteria 5983
254 Ga0075431_100047653 3300006847 Bacteria 4418
255 Ga0075431_100366333 3300006847 Bacteria 1447
256 Ga0075431_100451928 3300006847 Bacteria 1280
257 Ga0075433_10020188 3300006852 Bacteria 5565
258 Ga0075434_100038493 3300006871 Bacteria 4736
259 Ga0075429_100000908 3300006880 Bacteria 23437
260 Ga0075429_100013442 3300006880 Bacteria 7100
261 Ga0075429_100017753 3300006880 Bacteria 6153
262 Ga0075429_100096524 3300006880 Bacteria 2578
263 Ga0075429_100188247 3300006880 Bacteria 1809
264 Ga0068865_100018317 3300006881 Bacteria 4516
265 Ga0075436_100030029 3300006914 Bacteria 3740
266 Ga0097620_100000067 3300006931 Bacteria 98013
267 Ga0097620_100039334 3300006931 Bacteria 4744
268 Ga0097620_100047694 3300006931 Bacteria 4304
269 Ga0097620_100350465 3300006931 Bacteria 1571
270 Ga0075435_100004795 3300007076 Bacteria 9351
271 Ga0075435_100048185 3300007076 Bacteria 3423
272 Ga0075435_100185124 3300007076 Bacteria 1761
273 Ga0105251_10003753 3300009011 Bacteria 10872
274 Ga0105251_10003783 3300009011 Bacteria 10816
275 Ga0105244_10001928 3300009036 Bacteria 16123
276 Ga0105244_10012472 3300009036 Bacteria 5019
277 Ga0105250_10043082 3300009092 Bacteria 1809
278 Ga0105240_10042031 3300009093 Bacteria 5827
279 Ga0111539_10005032 3300009094 Bacteria 17184
280 Ga0111539_10005100 3300009094 Bacteria 17037
281 Ga0111539_10010425 3300009094 Bacteria 11695
282 Ga0111539_10017829 3300009094 Bacteria 8791
283 Ga0111539_10110689 3300009094 Bacteria 3222
284 Ga0111539_10348652 3300009094 Bacteria 1723
285 Ga0105245_10004977 3300009098 Bacteria 11683
286 Ga0105245_10006307 3300009098 Bacteria 10438
287 Ga0105245_10067457 3300009098 Bacteria 3240
288 Ga0105245_10107343 3300009098 Bacteria 2592
289 Ga0105245_10172357 3300009098 Bacteria 2061
290 Ga0105245_10178526 3300009098 Bacteria 2027
291 Ga0105245_10200160 3300009098 Bacteria 1918
292 Ga0105247_10000024 3300009101 Bacteria 210946
293 Ga0105247_10000078 3300009101 Bacteria 110404
294 Ga0105247_10009918 3300009101 Bacteria 5769
295 Ga0105247_10076014 3300009101 Bacteria 2108
296 Ga0114129_10000039 3300009147 Bacteria 108531
297 Ga0114129_10000131 3300009147 Bacteria 76741
298 Ga0114129_10000932 3300009147 Bacteria 38196
299 Ga0114129_10002109 3300009147 Bacteria 27389
300 Ga0114129_10048876 3300009147 Bacteria 5945
301 Ga0114129_10281097 3300009147 Bacteria 2224
302 Ga0114129_10336013 3300009147 Bacteria 2005
303 Ga0105243_10029942 3300009148 Bacteria 4189
304 Ga0105243_10036949 3300009148 Bacteria 3793
305 Ga0105243_10040731 3300009148 Bacteria 3630
306 Ga0105243_10072185 3300009148 Bacteria 2793
307 Ga0105243_10396929 3300009148 Bacteria 1280
308 Ga0105241_10021369 3300009174 Bacteria 4784
309 Ga0105242_10041626 3300009176 Bacteria 3706
310 Ga0105248_10000055 3300009177 Bacteria 141968
311 Ga0105248_10000082 3300009177 Bacteria 110759
312 Ga0105248_10000529 3300009177 Bacteria 43587
313 Ga0105248_10004955 3300009177 Bacteria 14715
314 Ga0105248_10009087 3300009177 Bacteria 10930
315 Ga0105248_10019185 3300009177 Bacteria 7565
316 Ga0105248_10165622 3300009177 Bacteria 2492
317 Ga0105248_10623057 3300009177 Bacteria 1217
318 Ga0105237_10000308 3300009545 Bacteria 67971
319 Ga0105237_10016427 3300009545 Bacteria 7690
320 Ga0105238_10008834 3300009551 Bacteria 10078
321 Ga0105238_10369110 3300009551 Bacteria 1425
322 Ga0105249_10000031 3300009553 Bacteria 220006
323 Ga0105249_10001144 3300009553 Bacteria 23483
324 Ga0105249_10018272 3300009553 Bacteria 6233
325 Ga0105249_10136450 3300009553 Bacteria 2348
326 Ga0105249_10164022 3300009553 Bacteria 2150
327 Ga0105239_10007263 3300010375 Bacteria 12726
328 Ga0105239_10008306 3300010375 Bacteria 11834
329 Ga0105239_10118655 3300010375 Bacteria 2936
330 Ga0105239_10433460 3300010375 Bacteria 1490
331 Ga0105246_10001132 3300011119 Bacteria 15464
332 Ga0105246_10002305 3300011119 Bacteria 11521
333 Ga0105246_10002378 3300011119 Bacteria 11346
334 Ga0105246_10032742 3300011119 Bacteria 3450
335 Ga0105246_10034427 3300011119 Bacteria 3375
336 Ga0105246_10187408 3300011119 Bacteria 1598
337 Ga0157371_10027112 3300013102 Bacteria 4158
338 Ga0157370_10025167 3300013104 Bacteria 5891
339 Ga0157370_10026798 3300013104 Bacteria 5685
340 Ga0157370_10139184 3300013104 Bacteria 2262
341 Ga0157369_10000422 3300013105 Bacteria 56065
342 Ga0157369_10001067 3300013105 Bacteria 34384
343 Ga0157369_10001126 3300013105 Bacteria 33440
344 Ga0157369_10006480 3300013105 Bacteria 13565
345 Ga0157369_10028541 3300013105 Bacteria 6176
346 Ga0157369_10038886 3300013105 Bacteria 5200
347 Ga0157369_10045621 3300013105 Bacteria 4765
348 Ga0157369_10052990 3300013105 Bacteria 4387
349 Ga0157369_10082912 3300013105 Bacteria 3430
350 Ga0157369_10154305 3300013105 Bacteria 2426
351 Ga0157369_10177108 3300013105 Bacteria 2245
352 Ga0171462_1004 3300013250 Bacteria 678877
353 Ga0157374_10424739 3300013296 Bacteria 1328
354 Ga0163162_10022417 3300013306 Bacteria 6222
355 Ga0163162_10055426 3300013306 Bacteria 3991
356 Ga0163162_10108128 3300013306 Bacteria 2877
357 Ga0157372_10003775 3300013307 Bacteria 16262
358 Ga0157372_10073291 3300013307 Bacteria 3860
359 Ga0157372_10094569 3300013307 Bacteria 3403
360 Ga0157372_10121930 3300013307 Bacteria 2995
361 Ga0157372_10202469 3300013307 Bacteria 2300
362 Ga0157372_10289668 3300013307 Bacteria 1904
363 Ga0157372_10426996 3300013307 Bacteria 1545
364 Ga0157375_10004628 3300013308 Bacteria 11955
365 Ga0157375_10028843 3300013308 Bacteria 5210
366 Ga0157375_10109120 3300013308 Bacteria 2863
367 Ga0157375_10185198 3300013308 Bacteria 2235
368 Ga0157375_10195676 3300013308 Bacteria 2177
369 Ga0157375_10361725 3300013308 Bacteria 1617
370 Ga0163163_10014442 3300014325 Bacteria 7260
371 Ga0163163_10032958 3300014325 Bacteria 5007
372 Ga0163163_10112269 3300014325 Bacteria 2755
373 Ga0163163_10141673 3300014325 Bacteria 2447
374 Ga0163163_10471369 3300014325 Bacteria 1316
375 Ga0157380_10117172 3300014326 Bacteria 2249
376 Ga0182008_10041266 3300014497 Bacteria 2302
377 Ga0182008_10050302 3300014497 Bacteria 2068
378 Ga0157377_10012796 3300014745 Bacteria 4229
379 Ga0157377_10044816 3300014745 Bacteria 2468
380 Ga0157379_10000059 3300014968 Bacteria 69772
381 Ga0157379_10000289 3300014968 Bacteria 39807
382 Ga0157379_10002960 3300014968 Bacteria 14328
383 Ga0157379_10012749 3300014968 Bacteria 7351
384 Ga0182007_10031963 3300015262 Bacteria 1790
385 Ga0182007_10038282 3300015262 Bacteria 1609
386 Ga0163161_10037148 3300017792 Bacteria 3491
387 Ga0197907_10031078 3300020069 Bacteria 1463
388 Ga0197907_10410903 3300020069 Bacteria 1533
389 Ga0206356_10755570 3300020070 Bacteria 2682
390 Ga0206356_11644942 3300020070 Bacteria 2159
391 Ga0206351_10447535 3300020077 Bacteria 1379
392 Ga0206350_10967704 3300020080 Bacteria 1845
393 Ga0206354_10323126 3300020081 Bacteria 1739
394 Ga0206354_10773930 3300020081 Bacteria 3591
395 Ga0206354_10785617 3300020081 Bacteria 2774
396 Ga0206354_11275952 3300020081 Bacteria 1408
397 Ga0206354_11281303 3300020081 Bacteria 13672
398 Ga0206353_10110127 3300020082 Bacteria 2191
399 Ga0206353_10404455 3300020082 Bacteria 11000
400 Ga0206353_10623844 3300020082 Bacteria 2051
401 Ga0206353_10717728 3300020082 Bacteria 1262
402 Ga0206353_11446185 3300020082 Bacteria 1892
403 Ga0206353_11629272 3300020082 Bacteria 1691
404 Ga0206353_12032015 3300020082 Bacteria 2710
405 Ga0213876_10015875 3300021384 Bacteria 3985
406 Ga0213876_10032087 3300021384 Bacteria 2771
407 Ga0213875_10009163 3300021388 Bacteria 5025
408 Ga0213875_10009179 3300021388 Bacteria 5019
409 Ga0213875_10016007 3300021388 Bacteria 3641
410 Ga0213875_10030369 3300021388 Bacteria 2558
411 Ga0224712_10001604 3300022467 Bacteria 5304
412 Ga0224712_10016756 3300022467 Bacteria 2414
413 Ga0209563_100349 3300025230 Bacteria 17553
414 Ga0209129_1000109 3300025258 Bacteria 153068
415 Ga0209025_1000984 3300025294 Bacteria 42427
416 Ga0207426_1017639 3300025302 Bacteria 2532
417 Ga0209051_1001258 3300025303 Bacteria 22641
418 Ga0207697_10004003 3300025315 Bacteria 7142
419 Ga0207656_10000001 3300025321 Bacteria 1323684
420 Ga0207696_1018500 3300025711 Bacteria 2285
421 Ga0207655_1008569 3300025728 Bacteria 6473
422 Ga0207655_1008906 3300025728 Bacteria 6303
423 Ga0207655_1022210 3300025728 Bacteria 3190
424 Ga0207713_1029743 3300025735 Bacteria 2441
425 Ga0207682_10005812 3300025893 Bacteria 4999
426 Ga0207692_10000890 3300025898 Bacteria 10798
427 Ga0207692_10002582 3300025898 Bacteria 6961
428 Ga0207692_10004306 3300025898 Bacteria 5628
429 Ga0207642_10038384 3300025899 Bacteria 2072
430 Ga0207710_10000022 3300025900 Bacteria 335632
431 Ga0207710_10000045 3300025900 Bacteria 210957
432 Ga0207710_10000249 3300025900 Bacteria 45249
433 Ga0207710_10060310 3300025900 Bacteria 1719
434 Ga0207688_10008035 3300025901 Bacteria 5741
435 Ga0207647_10018358 3300025904 Bacteria 4734
436 Ga0207647_10031102 3300025904 Bacteria 3437
437 Ga0207647_10038168 3300025904 Bacteria 3039
438 Ga0207685_10102201 3300025905 Bacteria 1227
439 Ga0207699_10000452 3300025906 Bacteria 20998
440 Ga0207699_10018969 3300025906 Bacteria 3656
441 Ga0207699_10063482 3300025906 Bacteria 2231
442 Ga0207699_10113570 3300025906 Bacteria 1740
443 Ga0207645_10000233 3300025907 Bacteria 46095
444 Ga0207645_10030709 3300025907 Bacteria 3462
445 Ga0207643_10005573 3300025908 Bacteria 6728
446 Ga0207705_10001165 3300025909 Bacteria 21410
447 Ga0207705_10002204 3300025909 Bacteria 15064
448 Ga0207705_10008166 3300025909 Bacteria 7664
449 Ga0207705_10137202 3300025909 Bacteria 1824
450 Ga0207684_10026114 3300025910 Bacteria 4977
451 Ga0207654_10011007 3300025911 Bacteria 4603
452 Ga0207707_10000376 3300025912 Bacteria 46648
453 Ga0207707_10010705 3300025912 Bacteria 7969
454 Ga0207707_10054680 3300025912 Bacteria 3475
455 Ga0207707_10056837 3300025912 Bacteria 3405
456 Ga0207695_10005783 3300025913 Bacteria 16280
457 Ga0207695_10216505 3300025913 Bacteria 1824
458 Ga0207671_10000001 3300025914 Bacteria 1318881
459 Ga0207671_10000216 3300025914 Bacteria 86159
460 Ga0207671_10007161 3300025914 Bacteria 9727
461 Ga0207693_10000318 3300025915 Bacteria 44789
462 Ga0207693_10002107 3300025915 Bacteria 17358
463 Ga0207693_10009636 3300025915 Bacteria 7865
464 Ga0207693_10169868 3300025915 Bacteria 1717
465 Ga0207663_10136242 3300025916 Bacteria 1704
466 Ga0207663_10177271 3300025916 Bacteria 1519
467 Ga0207663_10260913 3300025916 Bacteria 1279
468 Ga0207660_10000754 3300025917 Bacteria 21515
469 Ga0207660_10017022 3300025917 Bacteria 4822
470 Ga0207660_10071902 3300025917 Bacteria 2518
471 Ga0207660_10243374 3300025917 Bacteria 1418
472 Ga0207662_10011022 3300025918 Bacteria 5002
473 Ga0207657_10001578 3300025919 Bacteria 24478
474 Ga0207657_10025004 3300025919 Bacteria 5517
475 Ga0207657_10049197 3300025919 Bacteria 3676
476 Ga0207657_10072049 3300025919 Bacteria 2924
477 Ga0207657_10133726 3300025919 Bacteria 2031
478 Ga0207649_10006873 3300025920 Bacteria 6182
479 Ga0207652_10000591 3300025921 Bacteria 36343
480 Ga0207652_10004252 3300025921 Bacteria 11682
481 Ga0207652_10032574 3300025921 Bacteria 4384
482 Ga0207652_10067633 3300025921 Bacteria 3098
483 Ga0207652_10119121 3300025921 Bacteria 2348
484 Ga0207652_10202293 3300025921 Bacteria 1787
485 Ga0207646_10437409 3300025922 Bacteria 1180
486 Ga0207681_10004026 3300025923 Bacteria 9117
487 Ga0207694_10000052 3300025924 Bacteria 157700
488 Ga0207694_10002482 3300025924 Bacteria 15012
489 Ga0207694_10334333 3300025924 Bacteria 1252
490 Ga0207650_10143136 3300025925 Bacteria 1881
491 Ga0207659_10021801 3300025926 Bacteria 4260
492 Ga0207659_10023126 3300025926 Bacteria 4145
493 Ga0207687_10015080 3300025927 Bacteria 5061
494 Ga0207687_10055033 3300025927 Bacteria 2786
495 Ga0207687_10127963 3300025927 Bacteria 1910
496 Ga0207687_10152794 3300025927 Bacteria 1763
497 Ga0207700_10000250 3300025928 Bacteria 32146
498 Ga0207700_10006774 3300025928 Bacteria 6962
499 Ga0207700_10017655 3300025928 Bacteria 4771
500 Ga0207700_10055708 3300025928 Bacteria 2972
501 Ga0207700_10235875 3300025928 Bacteria 1557
502 Ga0207664_10003365 3300025929 Bacteria 10634
503 Ga0207664_10010336 3300025929 Bacteria 6592
504 Ga0207664_10047601 3300025929 Bacteria 3370
505 Ga0207664_10054835 3300025929 Bacteria 3160
506 Ga0207664_10061277 3300025929 Bacteria 3001
507 Ga0207664_10096040 3300025929 Bacteria 2439
508 Ga0207664_10125022 3300025929 Bacteria 2158
509 Ga0207664_10255118 3300025929 Bacteria 1532
510 Ga0207664_10350152 3300025929 Bacteria 1307
511 Ga0207644_10026394 3300025931 Bacteria 4002
512 Ga0207690_10057057 3300025932 Bacteria 2637
513 Ga0207706_10031749 3300025933 Bacteria 4703
514 Ga0207706_10079844 3300025933 Bacteria 2877
515 Ga0207709_10008158 3300025935 Bacteria 5800
516 Ga0207709_10025391 3300025935 Bacteria 3391
517 Ga0207709_10107809 3300025935 Bacteria 1856
518 Ga0207669_10004037 3300025937 Bacteria 6424
519 Ga0207669_10086815 3300025937 Bacteria 2024
520 Ga0207669_10105698 3300025937 Bacteria 1873
521 Ga0207704_10102974 3300025938 Bacteria 1908
522 Ga0207665_10006709 3300025939 Bacteria 7634
523 Ga0207665_10017534 3300025939 Bacteria 4706
524 Ga0207665_10102803 3300025939 Bacteria 1997
525 Ga0207691_10008796 3300025940 Bacteria 9683
526 Ga0207691_10015983 3300025940 Bacteria 7130
527 Ga0207691_10106923 3300025940 Bacteria 2491
528 Ga0207691_10160805 3300025940 Bacteria 1970
529 Ga0207711_10000030 3300025941 Bacteria 206250
530 Ga0207711_10000537 3300025941 Bacteria 38776
531 Ga0207711_10000984 3300025941 Bacteria 27321
532 Ga0207711_10143468 3300025941 Bacteria 2150
533 Ga0207711_10180524 3300025941 Bacteria 1919
534 Ga0207711_10185668 3300025941 Bacteria 1893
535 Ga0207689_10005246 3300025942 Bacteria 11627
536 Ga0207689_10015663 3300025942 Bacteria 6420
537 Ga0207689_10225787 3300025942 Bacteria 1548
538 Ga0207661_10049543 3300025944 Bacteria 3343
539 Ga0207661_10065411 3300025944 Bacteria 2951
540 Ga0207661_10108019 3300025944 Bacteria 2348
541 Ga0207661_10268776 3300025944 Bacteria 1521
542 Ga0207661_10312331 3300025944 Bacteria 1411
543 Ga0207679_10005355 3300025945 Bacteria 8044
544 Ga0207667_10140104 3300025949 Bacteria 2490
545 Ga0207712_10000029 3300025961 Bacteria 220014
546 Ga0207712_10166044 3300025961 Bacteria 1721
547 Ga0207668_10000831 3300025972 Bacteria 18686
548 Ga0207640_10097971 3300025981 Bacteria 2048
549 Ga0207658_10001194 3300025986 Bacteria 20724
550 Ga0207677_10004264 3300026023 Bacteria 7647
551 Ga0207677_10084079 3300026023 Bacteria 2293
552 Ga0207703_10000007 3300026035 Bacteria 418220
553 Ga0207703_10000025 3300026035 Bacteria 214692
554 Ga0207703_10027058 3300026035 Bacteria 4517
555 Ga0207703_10113321 3300026035 Bacteria 2317
556 Ga0207703_10158718 3300026035 Bacteria 1979
557 Ga0207703_10223235 3300026035 Bacteria 1686
558 Ga0207639_10111830 3300026041 Bacteria 2227
559 Ga0207678_10006441 3300026067 Bacteria 10414
560 Ga0207678_10046758 3300026067 Bacteria 3743
561 Ga0207708_10001321 3300026075 Bacteria 18631
562 Ga0207702_10065625 3300026078 Bacteria 3109
563 Ga0207702_10068786 3300026078 Bacteria 3043
564 Ga0207702_10252232 3300026078 Bacteria 1657
565 Ga0207641_10003684 3300026088 Bacteria 13499
566 Ga0207641_10097909 3300026088 Bacteria 2579
567 Ga0207648_10007694 3300026089 Bacteria 10542
568 Ga0207676_10208312 3300026095 Bacteria 1733
569 Ga0207674_10006951 3300026116 Bacteria 13248
570 Ga0207674_10009685 3300026116 Bacteria 10983
571 Ga0207674_10015743 3300026116 Bacteria 8296
572 Ga0207674_10074159 3300026116 Bacteria 3415
573 Ga0207675_100004867 3300026118 Bacteria 12941
574 Ga0207675_100025855 3300026118 Bacteria 5461
575 Ga0207675_100028903 3300026118 Bacteria 5165
576 Ga0207675_100094919 3300026118 Bacteria 2806
577 Ga0207675_100169101 3300026118 Bacteria 2089
578 Ga0207683_10021922 3300026121 Bacteria 5480
579 Ga0207683_10024767 3300026121 Bacteria 5170
580 Ga0207683_10116141 3300026121 Bacteria 2399
581 Ga0207683_10136562 3300026121 Bacteria 2207
582 Ga0207683_10155475 3300026121 Bacteria 2065
583 Ga0207698_10002488 3300026142 Bacteria 10926
584 Ga0209813_10011294 3300027866 Bacteria 2331
585 Ga0209813_10017570 3300027866 Bacteria 1965
586 Ga0207428_10001881 3300027907 Bacteria 21371
587 Ga0207428_10007432 3300027907 Bacteria 9990
588 Ga0207428_10011894 3300027907 Bacteria 7664
589 Ga0207428_10059544 3300027907 Bacteria 3028
590 Ga0268266_10003905 3300028379 Bacteria 14494
591 Ga0268266_10028674 3300028379 Bacteria 4731
592 Ga0268266_10111773 3300028379 Bacteria 2421
593 Ga0268266_10406801 3300028379 Bacteria 1288
594 Ga0268265_10000040 3300028380 Bacteria 194156
595 Ga0268265_10000721 3300028380 Bacteria 32446
596 Ga0268264_10000017 3300028381 Bacteria 498037
597 Ga0268264_10280490 3300028381 Bacteria 1560
598 Ga0265337_1000015 3300028556 Bacteria 80871
599 Ga0265326_10006985 3300028558 Bacteria 3479
600 Ga0265319_1003575 3300028563 Bacteria 8064
601 Ga0265334_10000328 3300028573 Bacteria 25639
602 Ga0265334_10002545 3300028573 Bacteria 8514
603 Ga0265318_10004466 3300028577 Bacteria 6774
604 Ga0265318_10025592 3300028577 Bacteria 2329
605 Ga0265318_10049013 3300028577 Bacteria 1590
606 Ga0265323_10028082 3300028653 Bacteria 2110
607 Ga0265322_10020887 3300028654 Bacteria 1876
608 Ga0265336_10018156 3300028666 Bacteria 2282
609 Ga0307517_10089007 3300028786 Bacteria 2546
610 Ga0307515_10000379 3300028794 Bacteria 108548
611 Ga0307515_10000732 3300028794 Bacteria 75720
612 Ga0307515_10033054 3300028794 Bacteria 8536
613 Ga0307515_10038784 3300028794 Bacteria 7604
614 Ga0307515_10221688 3300028794 Bacteria 1707
615 Ga0265338_10000073 3300028800 Bacteria 181521
616 Ga0265338_10000767 3300028800 Bacteria 54778
617 Ga0265338_10005370 3300028800 Bacteria 16751
618 Ga0265338_10008838 3300028800 Bacteria 12154
619 Ga0265338_10029943 3300028800 Bacteria 5381
620 Ga0265324_10006721 3300029957 Bacteria 4750
621 Ga0307511_10002182 3300030521 Bacteria 20560
622 Ga0307511_10070493 3300030521 Bacteria 2559
623 Ga0307512_10003334 3300030522 Bacteria 18844
624 Ga0307512_10005672 3300030522 Bacteria 12892
625 Ga0307512_10009307 3300030522 Bacteria 9474
626 Ga0307512_10017588 3300030522 Bacteria 6552
627 Ga0316181_1197229 3300030744 Bacteria 3084
628 Ga0265320_10005644 3300031240 Bacteria 7993
629 Ga0265320_10006011 3300031240 Bacteria 7714
630 Ga0265320_10008148 3300031240 Bacteria 6437
631 Ga0265325_10001073 3300031241 Bacteria 19703
632 Ga0265325_10022527 3300031241 Bacteria 3450
633 Ga0265325_10024264 3300031241 Bacteria 3301
634 Ga0265340_10000565 3300031247 Bacteria 20551
635 Ga0265340_10002581 3300031247 Bacteria 10284
636 Ga0265339_10002688 3300031249 Bacteria 12643
637 Ga0265339_10009462 3300031249 Bacteria 6127
638 Ga0265339_10033756 3300031249 Bacteria 2879
639 Ga0265339_10076679 3300031249 Bacteria 1772
640 Ga0265327_10000001 3300031251 Bacteria 894475
641 Ga0265327_10001602 3300031251 Bacteria 27454
642 Ga0265327_10017868 3300031251 Bacteria 4424
643 Ga0265327_10028282 3300031251 Bacteria 3211
644 Ga0265327_10039390 3300031251 Bacteria 2567
645 Ga0265316_10029288 3300031344 Bacteria 4529
646 Ga0265316_10048500 3300031344 Bacteria 3351
647 Ga0307513_10000163 3300031456 Bacteria 95775
648 Ga0307513_10002467 3300031456 Bacteria 25604
649 Ga0307513_10009749 3300031456 Bacteria 12129
650 Ga0307513_10012802 3300031456 Bacteria 10329
651 Ga0307509_10004994 3300031507 Bacteria 18718
652 Ga0307509_10033071 3300031507 Bacteria 5694
653 Ga0307509_10059047 3300031507 Bacteria 4059
654 Ga0307509_10124736 3300031507 Bacteria 2544
655 Ga0307408_100004432 3300031548 Bacteria 9530
656 Ga0307408_100005591 3300031548 Bacteria 8404
657 Ga0307408_100008967 3300031548 Bacteria 6608
658 Ga0307408_100010273 3300031548 Bacteria 6175
659 Ga0307408_100012300 3300031548 Bacteria 5666
660 Ga0307408_100014274 3300031548 Bacteria 5277
661 Ga0307408_100071569 3300031548 Bacteria 2564
662 Ga0307408_100101821 3300031548 Bacteria 2189
663 Ga0307408_100103867 3300031548 Bacteria 2170
664 Ga0307408_100114861 3300031548 Bacteria 2075
665 Ga0307408_100160846 3300031548 Bacteria 1783
666 Ga0307408_100201203 3300031548 Bacteria 1612
667 Ga0265313_10000614 3300031595 Bacteria 36958
668 Ga0265313_10028421 3300031595 Bacteria 2907
669 Ga0307508_10002053 3300031616 Bacteria 21741
670 Ga0307508_10005976 3300031616 Bacteria 11480
671 Ga0307508_10018562 3300031616 Bacteria 6321
672 Ga0307508_10094044 3300031616 Bacteria 2588
673 Ga0307508_10118451 3300031616 Bacteria 2249
674 Ga0307508_10267593 3300031616 Bacteria 1303
675 Ga0307514_10001479 3300031649 Bacteria 28450
676 Ga0307514_10008804 3300031649 Bacteria 8542
677 Ga0307514_10016383 3300031649 Bacteria 6106
678 Ga0307514_10113967 3300031649 Bacteria 1906
679 Ga0316575_10001935 3300031665 Bacteria 6851
680 Ga0316579_10000014 3300031691 Bacteria 39927
681 Ga0316579_10020088 3300031691 Bacteria 2957
682 Ga0265314_10008595 3300031711 Bacteria 8732
683 Ga0265314_10020900 3300031711 Bacteria 5046
684 Ga0265314_10066870 3300031711 Bacteria 2423
685 Ga0265314_10132830 3300031711 Bacteria 1550
686 Ga0316576_10022075 3300031727 Bacteria 4415
687 Ga0316576_10032808 3300031727 Bacteria 3692
688 Ga0316576_10035603 3300031727 Bacteria 3554
689 Ga0316576_10070794 3300031727 Bacteria 2572
690 Ga0316578_10016176 3300031728 Bacteria 4031
691 Ga0316578_10030439 3300031728 Bacteria 3069
692 Ga0307516_10001135 3300031730 Bacteria 37117
693 Ga0307516_10002744 3300031730 Bacteria 23204
694 Ga0307516_10041766 3300031730 Bacteria 4555
695 Ga0307516_10107073 3300031730 Bacteria 2605
696 Ga0307516_10252112 3300031730 Bacteria 1459
697 Ga0307405_10001947 3300031731 Bacteria 8913
698 Ga0307405_10005216 3300031731 Bacteria 6240
699 Ga0307405_10005302 3300031731 Bacteria 6201
700 Ga0307405_10006582 3300031731 Bacteria 5727
701 Ga0307405_10021603 3300031731 Bacteria 3620
702 Ga0307405_10061224 3300031731 Bacteria 2378
703 Ga0307405_10120277 3300031731 Bacteria 1796
704 Ga0307405_10152741 3300031731 Bacteria 1625
705 Ga0307405_10161919 3300031731 Bacteria 1586
706 Ga0307405_10292523 3300031731 Bacteria 1232
707 Ga0307413_10012984 3300031824 Bacteria 4168
708 Ga0307413_10022081 3300031824 Bacteria 3422
709 Ga0307413_10029042 3300031824 Bacteria 3088
710 Ga0307413_10049993 3300031824 Bacteria 2509
711 Ga0307413_10132963 3300031824 Bacteria 1706
712 Ga0307518_10061743 3300031838 Bacteria 2721
713 Ga0307518_10127406 3300031838 Bacteria 1794
714 Ga0307410_10003801 3300031852 Bacteria 7663
715 Ga0307410_10018295 3300031852 Bacteria 4231
716 Ga0307410_10080922 3300031852 Bacteria 2280
717 Ga0307410_10098137 3300031852 Bacteria 2094
718 Ga0307410_10143926 3300031852 Bacteria 1767
719 Ga0307410_10155511 3300031852 Bacteria 1707
720 Ga0307410_10169418 3300031852 Bacteria 1644
721 Ga0307410_10210374 3300031852 Bacteria 1490
722 Ga0307406_10009972 3300031901 Bacteria 5343
723 Ga0307406_10035665 3300031901 Bacteria 3060
724 Ga0307406_10037822 3300031901 Bacteria 2983
725 Ga0307406_10075745 3300031901 Bacteria 2221
726 Ga0307406_10111177 3300031901 Bacteria 1887
727 Ga0307406_10113333 3300031901 Bacteria 1871
728 Ga0307406_10138700 3300031901 Bacteria 1718
729 Ga0307407_10005551 3300031903 Bacteria 5488
730 Ga0307407_10011209 3300031903 Bacteria 4256
731 Ga0307407_10013075 3300031903 Bacteria 4014
732 Ga0307407_10014581 3300031903 Bacteria 3855
733 Ga0307407_10035385 3300031903 Bacteria 2743
734 Ga0307407_10064675 3300031903 Bacteria 2150
735 Ga0307407_10067269 3300031903 Bacteria 2117
736 Ga0307407_10099217 3300031903 Bacteria 1804
737 Ga0307412_10005441 3300031911 Bacteria 7148
738 Ga0307412_10005716 3300031911 Bacteria 6992
739 Ga0307412_10020334 3300031911 Bacteria 4038
740 Ga0307412_10027769 3300031911 Bacteria 3533
741 Ga0307412_10029316 3300031911 Bacteria 3453
742 Ga0307412_10032183 3300031911 Bacteria 3320
743 Ga0307412_10057012 3300031911 Bacteria 2606
744 Ga0307412_10057960 3300031911 Bacteria 2588
745 Ga0307412_10103586 3300031911 Bacteria 2017
746 Ga0307409_100000140 3300031995 Bacteria 27131
747 Ga0307409_100005261 3300031995 Bacteria 7419
748 Ga0307409_100015896 3300031995 Bacteria 4958
749 Ga0307409_100037172 3300031995 Bacteria 3587
750 Ga0307409_100081305 3300031995 Bacteria 2618
751 Ga0307409_100084689 3300031995 Bacteria 2575
752 Ga0307409_100085190 3300031995 Bacteria 2568
753 Ga0307409_100091261 3300031995 Bacteria 2496
754 Ga0307409_100096551 3300031995 Bacteria 2438
755 Ga0307409_100178908 3300031995 Bacteria 1875
756 Ga0307409_100183742 3300031995 Bacteria 1853
757 Ga0307409_100203331 3300031995 Bacteria 1774
758 Ga0307409_100223510 3300031995 Bacteria 1701
759 Ga0307409_100254517 3300031995 Bacteria 1607
760 Ga0307409_100294322 3300031995 Bacteria 1507
761 Ga0307416_100001123 3300032002 Bacteria 14388
762 Ga0307416_100002858 3300032002 Bacteria 10049
763 Ga0307416_100003603 3300032002 Bacteria 9139
764 Ga0307416_100030957 3300032002 Bacteria 4022
765 Ga0307416_100037482 3300032002 Bacteria 3731
766 Ga0307416_100050843 3300032002 Bacteria 3306
767 Ga0307416_100055353 3300032002 Bacteria 3194
768 Ga0307416_100065276 3300032002 Bacteria 2990
769 Ga0307416_100066740 3300032002 Bacteria 2963
770 Ga0307416_100106711 3300032002 Bacteria 2456
771 Ga0307416_100115802 3300032002 Bacteria 2374
772 Ga0307416_100116160 3300032002 Bacteria 2371
773 Ga0307416_100320722 3300032002 Bacteria 1551
774 Ga0307416_100354412 3300032002 Bacteria 1486
775 Ga0307416_100370165 3300032002 Bacteria 1459
776 Ga0307414_10001749 3300032004 Bacteria 11266
777 Ga0307414_10044902 3300032004 Bacteria 3023
778 Ga0307414_10070104 3300032004 Bacteria 2523
779 Ga0307411_10054147 3300032005 Bacteria 2633
780 Ga0307411_10121065 3300032005 Bacteria 1893
781 Ga0307411_10314945 3300032005 Bacteria 1261
782 Ga0307415_100000073 3300032126 Bacteria 41825
783 Ga0307415_100001231 3300032126 Bacteria 11998
784 Ga0307415_100011722 3300032126 Bacteria 5032
785 Ga0307415_100015593 3300032126 Bacteria 4505
786 Ga0307415_100046044 3300032126 Bacteria 2928
787 Ga0307415_100054609 3300032126 Bacteria 2728
788 Ga0307415_100061596 3300032126 Bacteria 2598
789 Ga0307415_100063772 3300032126 Bacteria 2561
790 Ga0307415_100079489 3300032126 Bacteria 2336
791 Ga0307415_100086248 3300032126 Bacteria 2258
792 Ga0307415_100089877 3300032126 Bacteria 2220
793 Ga0307415_100129330 3300032126 Bacteria 1908
794 Ga0307415_100157080 3300032126 Bacteria 1758
795 Ga0307415_100160213 3300032126 Bacteria 1743
796 Ga0307415_100173232 3300032126 Bacteria 1685
797 Ga0307415_100196181 3300032126 Bacteria 1597
798 Ga0307415_100242207 3300032126 Bacteria 1459
799 Ga0316580_10001252 3300032139 Bacteria 6536
800 Ga0307507_10000013 3300033179 Bacteria 242708
801 Ga0307507_10024103 3300033179 Bacteria 6647
802 Ga0307507_10029206 3300033179 Bacteria 5852
803 Ga0307507_10062771 3300033179 Bacteria 3446
804 Ga0307510_10073722 3300033180 Bacteria 3379
805 Ga0307510_10074879 3300033180 Bacteria 3341
806 Ga0307510_10102648 3300033180 Bacteria 2641
807 Ga0373934_0020232 3300035086 Bacteria 2557
808 Ga0373940_0005350 3300035088 Bacteria 2774
809 Ga0373951_0000188 3300035091 Bacteria 22431
810 Ga0373923_0025570 3300035111 Bacteria 2341
811 Ga0373932_0034304 3300035112 Bacteria 1429
812 Ga0373936_0003793 3300035113 Bacteria 5691
813 Ga0373936_0041009 3300035113 Bacteria 1856
814 Ga0373953_0037406 3300035117 Bacteria 1915
815 Ga0373956_0007853 3300035119 Bacteria 4305
816 Ga0373957_0001687 3300035120 Bacteria 6054
817 Ga0373957_0010148 3300035120 Bacteria 3104
818 Ga0373955_0017592 3300035172 Bacteria 3540
819 Ga0373942_0000142 3300035207 Bacteria 17062
820 Ga0373962_0001245 3300035242 Bacteria 5967
821 Ga0316574_0001220 3300035398 Bacteria 11955
822 Ga0316574_0006452 3300035398 Bacteria 6345
823 Ga0316574_0088238 3300035398 Bacteria 1975
824 Ga0316574_0155552 3300035398 Bacteria 1473
825 Ga0316574_0163800 3300035398 Bacteria 1432
826 Ga0373924_0001204 3300035410 Bacteria 8296
827 Ga0373924_0002400 3300035410 Bacteria 6304
828 Ga0373924_0145237 3300035410 Bacteria 1036
829 Ga0373931_0000119 3300035691 Bacteria 35668
830 Ga0373931_0126712 3300035691 Bacteria 1465
831 Ga0373935_0015724 3300035692 Bacteria 4576
832 Ga0373935_0041638 3300035692 Bacteria 2886
833 Ga0373935_0175000 3300035692 Bacteria 1470
834 Ga0373935_0181124 3300035692 Bacteria 1447
835 Ga0373933_0003781 3300035724 Bacteria 8361
836 Ga0373933_0008354 3300035724 Bacteria 5653
837 Ga0373933_0032470 3300035724 Bacteria 3034
838 Ga0373937_0027530 3300036401 Bacteria 5140
839 Ga0373937_0046609 3300036401 Bacteria 3964
840 Ga0373937_0073144 3300036401 Bacteria 3162
841 Ga0373937_0155014 3300036401 Bacteria 2146
842 Ga0316582_0011020 3300036647 Bacteria 4985
843 Ga0316582_0034025 3300036647 Bacteria 3135
844 Ga0316582_0138888 3300036647 Bacteria 1637
845 Ga0316584_0000612 3300036712 Bacteria 19413
846 Ga0316584_0011150 3300036712 Bacteria 6309
847 Ga0316584_0045363 3300036712 Bacteria 3281
848 Ga0316584_0153131 3300036712 Bacteria 1716
849 Ga0316584_0235173 3300036712 Bacteria 1342
850 Ga0373925_0000006 3300037068 Bacteria 278942
851 Ga0373925_0067135 3300037068 Bacteria 2705
852 Ga0395899_0001199 3300037312 Bacteria 22794
853 Ga0395899_0100480 3300037312 Bacteria 2089
854 Ga0395899_0113067 3300037312 Bacteria 1950
855 Ga0395900_0007242 3300037418 Bacteria 11489
856 Ga0395900_0012677 3300037418 Bacteria 8619
857 Ga0395900_0042137 3300037418 Bacteria 4702
858 Ga0395900_0058323 3300037418 Bacteria 3974
859 Ga0395900_0118148 3300037418 Bacteria 2721
860 Ga0395900_0127319 3300037418 Bacteria 2611
861 Ga0395900_0137145 3300037418 Bacteria 2507
862 Ga0395900_0196973 3300037418 Bacteria 2040
863 Ga0395900_0258675 3300037418 Bacteria 1739
864 Ga0395900_0396075 3300037418 Bacteria 1346
865 Ga0395900_0439259 3300037418 Bacteria 1263
866 Ga0395898_0000256 3300037466 Bacteria 130878
867 Ga0395898_0001516 3300037466 Bacteria 32005
868 Ga0395898_0011157 3300037466 Bacteria 9356
869 Ga0395898_0014066 3300037466 Bacteria 8224
870 Ga0395898_0016808 3300037466 Bacteria 7474
871 Ga0395898_0023381 3300037466 Bacteria 6247
872 Ga0395898_0036404 3300037466 Bacteria 4886
873 Ga0395898_0040985 3300037466 Bacteria 4576
874 Ga0395898_0107358 3300037466 Bacteria 2677
875 Ga0395898_0110750 3300037466 Bacteria 2631
876 Ga0395898_0140127 3300037466 Bacteria 2315
877 Ga0395905_0250772 3300037471 Bacteria 1653
878 Ga0395905_0275209 3300037471 Bacteria 1569
879 Ga0436364_0053804 3300037853 Bacteria 3850
880 Ga0436364_0445774 3300037853 Bacteria 40627
881 Ga0436364_0497556 3300037853 Bacteria 8611
882 Ga0436364_0675155 3300037853 Bacteria 1280
883 Ga0436364_1106417 3300037853 Bacteria 6692
884 Ga0436364_1149812 3300037853 Bacteria 6020
885 Ga0436364_1484307 3300037853 Bacteria 11983
886 Ga0395901_0012535 3300038443 Bacteria 8602
887 Ga0395901_0016431 3300038443 Bacteria 7538
888 Ga0395901_0039183 3300038443 Bacteria 4903
889 Ga0395901_0042568 3300038443 Bacteria 4709
890 Ga0395901_0051841 3300038443 Bacteria 4265
891 Ga0395901_0065461 3300038443 Bacteria 3784
892 Ga0395901_0117736 3300038443 Bacteria 2791
893 Ga0395901_0215491 3300038443 Bacteria 2008
894 Ga0395901_0344436 3300038443 Bacteria 1539
895 Ga0395901_0360429 3300038443 Bacteria 1499
896 Ga0400485_14323 3300038735 Bacteria 58881
897 Ga0400488_04969 3300038741 Bacteria 3360
898 Ga0400486_06112 3300038742 Bacteria 40039
899 Ga0400483_078666 3300039062 Bacteria 3700
900 Ga0400483_237273 3300039062 Bacteria 4577
901 Ga0436365_0562669 3300039437 Bacteria 1533
902 Ga0436365_0726960 3300039437 Bacteria 31385
903 Ga0436365_0934847 3300039437 Bacteria 10390
904 Ga0436365_1425629 3300039437 Bacteria 6391
905 Ga0436365_1765450 3300039437 Bacteria 8334
906 Ga0436360_0336736 3300039438 Bacteria 3790
907 Ga0436361_0647809 3300039447 Bacteria 4529
908 Ga0436363_0456998 3300039450 Bacteria 3162
909 Ga0436363_1147919 3300039450 Bacteria 11712
910 Ga0436362_0329220 3300039453 Bacteria 4179
911 Ga0436362_0334792 3300039453 Bacteria 1537
912 Ga0439436_0001406 3300041404 Bacteria 6958
913 Ga0439436_0003882 3300041404 Bacteria 4579
914 Ga0439436_0007177 3300041404 Bacteria 3428
915 Ga0439438_009258 3300041405 Bacteria 3199
916 Ga0439439_0000608 3300041406 Bacteria 6295
917 Ga0439439_0001403 3300041406 Bacteria 4778
918 Ga0439439_0020682 3300041406 Bacteria 1637
919 Ga0439461_0022381 3300041410 Bacteria 1266
920 Ga0439466_0013894 3300041411 Bacteria 2941
921 Ga0439466_0015547 3300041411 Bacteria 2764
922 Ga0439465_0024574 3300041413 Bacteria 1899
923 Ga0451797_0576558 3300041453 Bacteria 2684
924 Ga0451853_0524125 3300041512 Bacteria 1484
925 Ga0439431_0001082 3300041997 Bacteria 5906
926 Ga0439433_0000011 3300041999 Bacteria 28299
927 Ga0439433_0001106 3300041999 Bacteria 5498
928 Ga0439433_0002150 3300041999 Bacteria 4150
929 Ga0439442_000100 3300042002 Bacteria 20967
930 Ga0439442_000105 3300042002 Bacteria 20773
931 Ga0439442_009117 3300042002 Bacteria 2005
932 Ga0439448_0001623 3300042005 Bacteria 5892
933 Ga0439448_0013630 3300042005 Bacteria 2444
934 Ga0439448_0025926 3300042005 Bacteria 1841
935 Ga0439432_000499 3300042006 Bacteria 14603
936 Ga0439449_0001339 3300042007 Bacteria 9654
937 Ga0439449_0001769 3300042007 Bacteria 8486
938 Ga0439449_0005285 3300042007 Bacteria 4951
939 Ga0439449_0008539 3300042007 Bacteria 3890
940 Ga0439449_0028145 3300042007 Bacteria 2095
941 Ga0439449_0036603 3300042007 Bacteria 1825
942 Ga0439449_0046534 3300042007 Bacteria 1607
943 Ga0439450_001186 3300042008 Bacteria 3743
944 Ga0439450_003476 3300042008 Bacteria 2607
945 Ga0439452_002706 3300042010 Bacteria 6426
946 Ga0439455_0000986 3300042012 Bacteria 4456
947 Ga0439457_000166 3300042014 Bacteria 17000
948 Ga0439457_001067 3300042014 Bacteria 8272
949 Ga0439457_012975 3300042014 Bacteria 1874
950 Ga0439462_0014847 3300042015 Bacteria 2004
951 Ga0439463_000211 3300042016 Bacteria 15803
952 Ga0439463_001385 3300042016 Bacteria 6445
953 Ga0439463_003518 3300042016 Bacteria 3958
954 Ga0450911_003799 3300042115 Bacteria 2586
955 Ga0450913_000164 3300042117 Bacteria 2156
956 Ga0450919_000414 3300042121 Bacteria 5243
957 Ga0450920_004056 3300042122 Bacteria 2563
958 Ga0450920_009768 3300042122 Bacteria 1770
959 Ga0450894_001280 3300042131 Bacteria 3675
960 Ga0450898_011488 3300042134 Bacteria 1450
961 Ga0450899_001054 3300042135 Bacteria 3128
962 Ga0450903_002809 3300042138 Bacteria 3056
963 Ga0450907_000086 3300042146 Bacteria 36840
964 Ga0450907_003667 3300042146 Bacteria 2710
965 Ga0439446_0007643 3300042156 Bacteria 2848
966 Ga0439458_0004260 3300042157 Bacteria 3302
967 Ga0439458_0030079 3300042157 Bacteria 1291
968 Ga0450909_000097 3300042185 Bacteria 8519
969 Ga0439434_0003039 3300042435 Bacteria 4920
970 Ga0439434_0006572 3300042435 Bacteria 3397
971 Ga0439434_0006796 3300042435 Bacteria 3342
972 Ga0439434_0013656 3300042435 Bacteria 2411
973 Ga0439434_0015655 3300042435 Bacteria 2261
974 Ga0439435_0002840 3300042436 Bacteria 3510
975 Ga0439464_0000089 3300042439 Bacteria 13293
976 Ga0439460_0001743 3300042461 Bacteria 5169
977 Ga0450918_004987 3300042531 Bacteria 2392
978 Ga0439440_0000033 3300042993 Bacteria 17433
979 Ga0466969_0013288 3300044656 Bacteria 4336
980 Ga0466969_0021485 3300044656 Bacteria 3336
981 Ga0466969_0037244 3300044656 Bacteria 2454
982 Ga0466972_0005469 3300044658 Bacteria 6363
983 Ga0466972_0026235 3300044658 Bacteria 2887
984 Ga0466972_0111265 3300044658 Bacteria 1294
985 Ga0466965_0000001 3300044683 Bacteria 317826
986 Ga0466965_0056046 3300044683 Bacteria 1962
987 Ga0466965_0070489 3300044683 Bacteria 1757
988 Ga0466965_0108721 3300044683 Bacteria 1424
989 Ga0466966_0001229 3300044684 Bacteria 16449
990 Ga0466966_0002669 3300044684 Bacteria 11689
991 Ga0466966_0010569 3300044684 Bacteria 6135
992 Ga0466966_0039987 3300044684 Bacteria 3018
993 Ga0466966_0084173 3300044684 Bacteria 1979
994 Ga0466966_0092457 3300044684 Bacteria 1877
995 Ga0466966_0104143 3300044684 Bacteria 1753
996 Ga0466966_0110201 3300044684 Bacteria 1697
997 Ga0466961_0000334 3300044693 Bacteria 30973
998 Ga0466961_0002146 3300044693 Bacteria 12261
999 Ga0466961_0018302 3300044693 Bacteria 4504
1000 Ga0466961_0018600 3300044693 Bacteria 4471
1001 Ga0466961_0041665 3300044693 Bacteria 2944
1002 Ga0466961_0057149 3300044693 Bacteria 2484
1003 Ga0466961_0098614 3300044693 Bacteria 1842
1004 Ga0466961_0155367 3300044693 Bacteria 1427
1005 Ga0466963_0000113 3300044694 Bacteria 29888
1006 Ga0466963_0032072 3300044694 Bacteria 3399
1007 Ga0466963_0041053 3300044694 Bacteria 3033
1008 Ga0466963_0044903 3300044694 Bacteria 2908
1009 Ga0466963_0063551 3300044694 Bacteria 2471
1010 Ga0466963_0069693 3300044694 Bacteria 2364
1011 Ga0466963_0116491 3300044694 Bacteria 1836
1012 Ga0466963_0127713 3300044694 Bacteria 1754
1013 Ga0466963_0151374 3300044694 Bacteria 1611
1014 Ga0466964_0003680 3300044706 Bacteria 5612
1015 Ga0466964_0019823 3300044706 Bacteria 2588
1016 Ga0466964_0069955 3300044706 Bacteria 1482
1017 Ga0466971_0000604 3300044719 Bacteria 14259
1018 Ga0466971_0028490 3300044719 Bacteria 2499
1019 Ga0466971_0060763 3300044719 Bacteria 1708
1020 Ga0466968_0009794 3300044735 Bacteria 3699
1021 Ga0466968_0009975 3300044735 Bacteria 3668
1022 Ga0466970_0004815 3300044765 Bacteria 6667
1023 Ga0466970_0005522 3300044765 Bacteria 6279
1024 Ga0466970_0005582 3300044765 Bacteria 6254
1025 Ga0466970_0028303 3300044765 Bacteria 2943
1026 Ga0466970_0050345 3300044765 Bacteria 2221
1027 Ga0466957_0003322 3300044842 Bacteria 8816
1028 Ga0466957_0005112 3300044842 Bacteria 7330
1029 Ga0466957_0031622 3300044842 Bacteria 3164
1030 Ga0466957_0058297 3300044842 Bacteria 2366
1031 Ga0466957_0145264 3300044842 Bacteria 1531
1032 Ga0466960_0003005 3300044901 Bacteria 6435
1033 Ga0466960_0008168 3300044901 Bacteria 4279
1034 Ga0466960_0016591 3300044901 Bacteria 3198
1035 Ga0466960_0020405 3300044901 Bacteria 2934
1036 Ga0466960_0048394 3300044901 Bacteria 2043
1037 Ga0466959_0000927 3300045049 Bacteria 17399
1038 Ga0466959_0001283 3300045049 Bacteria 15198
1039 Ga0466959_0001538 3300045049 Bacteria 14174
1040 Ga0466959_0002972 3300045049 Bacteria 10946
1041 Ga0466959_0010248 3300045049 Bacteria 6691
1042 Ga0466959_0019337 3300045049 Bacteria 5009
1043 Ga0466959_0025712 3300045049 Bacteria 4366
1044 Ga0466959_0059395 3300045049 Bacteria 2784
1045 Ga0466959_0073850 3300045049 Bacteria 2467
1046 Ga0466959_0125754 3300045049 Bacteria 1820
1047 Ga0466959_0164472 3300045049 Bacteria 1558
1048 Ga0451576_0158695 3300045051 Bacteria 2360
1049 Ga0466958_0001093 3300045836 Bacteria 12478
1050 Ga0466958_0009620 3300045836 Bacteria 5390
1051 Ga0466958_0010518 3300045836 Bacteria 5183
1052 Ga0466958_0012195 3300045836 Bacteria 4860
1053 Ga0466958_0016297 3300045836 Bacteria 4277
1054 Ga0466958_0022265 3300045836 Bacteria 3710
1055 Ga0466958_0045290 3300045836 Bacteria 2653
1056 Ga0466958_0045776 3300045836 Bacteria 2640
1057 Ga0466967_0007780 3300045976 Bacteria 7780
1058 Ga0466967_0008112 3300045976 Bacteria 7661
1059 Ga0466967_0010829 3300045976 Bacteria 6865
1060 Ga0466967_0014774 3300045976 Bacteria 6100
1061 Ga0466967_0031412 3300045976 Bacteria 4470
1062 Ga0466967_0033743 3300045976 Bacteria 4336
1063 Ga0466967_0036626 3300045976 Bacteria 4190
1064 Ga0466967_0049506 3300045976 Bacteria 3675
1065 Ga0466967_0072987 3300045976 Bacteria 3078
1066 Ga0466967_0132887 3300045976 Bacteria 2312
1067 Ga0466967_0226686 3300045976 Bacteria 1778
1068 Ga0466967_0259780 3300045976 Bacteria 1661
1069 Ga0466967_0386883 3300045976 Bacteria 1359
1070 Ga0466967_0514827 3300045976 Bacteria 1175
1071 Ga0495617_021032 3300046452 Bacteria 2204
1072 Ga0495627_012192 3300046453 Bacteria 3059
1073 Ga0495592_0058887 3300046454 Bacteria 2831
1074 Ga0495592_0078800 3300046454 Bacteria 2386
1075 Ga0495592_0120905 3300046454 Bacteria 1842
1076 Ga0495603_0001591 3300046455 Bacteria 13313
1077 Ga0495603_0029411 3300046455 Bacteria 3312
1078 Ga0495603_0093844 3300046455 Bacteria 1753
1079 Ga0495603_0128588 3300046455 Bacteria 1476
1080 Ga0495603_0152818 3300046455 Bacteria 1340
1081 Ga0495629_0000933 3300046459 Bacteria 23538
1082 Ga0495629_0018469 3300046459 Bacteria 4991
1083 Ga0495629_0018510 3300046459 Bacteria 4984
1084 Ga0495629_0020144 3300046459 Bacteria 4762
1085 Ga0495629_0036281 3300046459 Bacteria 3481
1086 Ga0495629_0063068 3300046459 Bacteria 2588
1087 Ga0495629_0248485 3300046459 Bacteria 1224
1088 Ga0495641_0002845 3300046461 Bacteria 13394
1089 Ga0495641_0006228 3300046461 Bacteria 7789
1090 Ga0495651_0019189 3300046462 Bacteria 5297
1091 Ga0495651_0023476 3300046462 Bacteria 4794
1092 Ga0495651_0075302 3300046462 Bacteria 2559
1093 Ga0495653_0043766 3300046463 Bacteria 3478
1094 Ga0495653_0045307 3300046463 Bacteria 3410
1095 Ga0495653_0052061 3300046463 Bacteria 3140
1096 Ga0495653_0085760 3300046463 Bacteria 2315
1097 Ga0495580_0001823 3300046472 Bacteria 18738
1098 Ga0495580_0019335 3300046472 Bacteria 5061
1099 Ga0495582_0001683 3300046473 Bacteria 12477
1100 Ga0495582_0008683 3300046473 Bacteria 5603
1101 Ga0495582_0080414 3300046473 Bacteria 1810
1102 Ga0495639_0004885 3300046475 Bacteria 5751
1103 Ga0495662_0000168 3300046476 Bacteria 25877
1104 Ga0495662_0000230 3300046476 Bacteria 23315
1105 Ga0495662_0009153 3300046476 Bacteria 4859
1106 Ga0495662_0010114 3300046476 Bacteria 4626
1107 Ga0495662_0010703 3300046476 Bacteria 4486
1108 Ga0495664_0001164 3300046477 Bacteria 13691
1109 Ga0495664_0003063 3300046477 Bacteria 9061
1110 Ga0495664_0003236 3300046477 Bacteria 8847
1111 Ga0495664_0011791 3300046477 Bacteria 4935
1112 Ga0495664_0166029 3300046477 Bacteria 1339
1113 Ga0495585_0005641 3300046492 Bacteria 7861
1114 Ga0495594_0000836 3300046499 Bacteria 15907
1115 Ga0495594_0003472 3300046499 Bacteria 8138
1116 Ga0495594_0052174 3300046499 Bacteria 2252
1117 Ga0495594_0117460 3300046499 Bacteria 1502
1118 Ga0495594_0119449 3300046499 Bacteria 1489
1119 Ga0495606_0002906 3300046507 Bacteria 18927
1120 Ga0495606_0003739 3300046507 Bacteria 15854
1121 Ga0495608_0008718 3300046511 Bacteria 7094
1122 Ga0495608_0019074 3300046511 Bacteria 4727
1123 Ga0495608_0149266 3300046511 Bacteria 1490
1124 Ga0495608_0196197 3300046511 Bacteria 1273
1125 Ga0495616_0064235 3300046513 Bacteria 1791
1126 Ga0495618_0039495 3300046514 Bacteria 2966
1127 Ga0495618_0127142 3300046514 Bacteria 1631
1128 Ga0495618_0131554 3300046514 Bacteria 1601
1129 Ga0495618_0170009 3300046514 Bacteria 1387
1130 Ga0495620_0014258 3300046515 Bacteria 4044
1131 Ga0495628_0025612 3300046516 Bacteria 4819
1132 Ga0495628_0027557 3300046516 Bacteria 4620
1133 Ga0495628_0029006 3300046516 Bacteria 4491
1134 Ga0495628_0083316 3300046516 Bacteria 2483
1135 Ga0495628_0089084 3300046516 Bacteria 2390
1136 Ga0495628_0109685 3300046516 Bacteria 2123
1137 Ga0495630_0118656 3300046517 Bacteria 2006
1138 Ga0495630_0138202 3300046517 Bacteria 1852
1139 Ga0495630_0239350 3300046517 Bacteria 1387
1140 Ga0495631_0020150 3300046518 Bacteria 3119
1141 Ga0495632_0105041 3300046519 Bacteria 1329
1142 Ga0495643_0046165 3300046522 Bacteria 2362
1143 Ga0495643_0056340 3300046522 Bacteria 2098
1144 Ga0495666_0011813 3300046526 Bacteria 4353
1145 Ga0495666_0077705 3300046526 Bacteria 1573
1146 Ga0495642_0029792 3300046528 Bacteria 2181
1147 Ga0495642_0031202 3300046528 Bacteria 2136
1148 Ga0495642_0031540 3300046528 Bacteria 2125
1149 Ga0495652_0003119 3300046529 Bacteria 16561
1150 Ga0495652_0027169 3300046529 Bacteria 5044
1151 Ga0495652_0032257 3300046529 Bacteria 4582
1152 Ga0495652_0075686 3300046529 Bacteria 2795
1153 Ga0495652_0130715 3300046529 Bacteria 1988
1154 Ga0495665_0002144 3300046531 Bacteria 10681
1155 Ga0495665_0012658 3300046531 Bacteria 4567
1156 Ga0495665_0023899 3300046531 Bacteria 3284
1157 Ga0495640_0014350 3300046533 Bacteria 5999
1158 Ga0495640_0017751 3300046533 Bacteria 5294
1159 Ga0495640_0059064 3300046533 Bacteria 2614
1160 Ga0495640_0061264 3300046533 Bacteria 2556
1161 Ga0495640_0087230 3300046533 Bacteria 2064
1162 Ga0495640_0087990 3300046533 Bacteria 2053
1163 Ga0495586_0003443 3300046535 Bacteria 8480
1164 Ga0495586_0022779 3300046535 Bacteria 3343
1165 Ga0495586_0036162 3300046535 Bacteria 2650
1166 Ga0495586_0058186 3300046535 Bacteria 2098
1167 Ga0495587_0005854 3300046536 Bacteria 8005
1168 Ga0495645_0012568 3300046543 Bacteria 5968
1169 Ga0495645_0021786 3300046543 Bacteria 4633
1170 Ga0495645_0086876 3300046543 Bacteria 2237
1171 Ga0495622_0005909 3300046557 Bacteria 5685
1172 Ga0495633_0005618 3300046558 Bacteria 7603
1173 Ga0495633_0022654 3300046558 Bacteria 3122
1174 Ga0495667_0006867 3300046559 Bacteria 7729
1175 Ga0495667_0049798 3300046559 Bacteria 2765
1176 Ga0495656_0012363 3300046615 Bacteria 3148
1177 Ga0495656_0036089 3300046615 Bacteria 2035
1178 Ga0495656_0092790 3300046615 Bacteria 1383
1179 Ga0495668_0000400 3300046616 Bacteria 56866
1180 Ga0495634_0004689 3300046642 Bacteria 10632
1181 Ga0495634_0009795 3300046642 Bacteria 7052
1182 Ga0495634_0043471 3300046642 Bacteria 3044
1183 Ga0495634_0131223 3300046642 Bacteria 1597
1184 Ga0495611_0028000 3300046648 Bacteria 2467
1185 Ga0495611_0051654 3300046648 Bacteria 1853
1186 Ga0495611_0066514 3300046648 Bacteria 1643
1187 Ga0495625_0002415 3300046660 Bacteria 20230
1188 Ga0495625_0007523 3300046660 Bacteria 9461
1189 Ga0495625_0038110 3300046660 Bacteria 3520
1190 Ga0495635_0000946 3300046663 Bacteria 19160
1191 Ga0495635_0009366 3300046663 Bacteria 6844
1192 Ga0495635_0075979 3300046663 Bacteria 2301
1193 Ga0495659_0082898 3300046664 Bacteria 1220
1194 Ga0495588_0018738 3300046674 Bacteria 3379
1195 Ga0495657_0002272 3300046675 Bacteria 16229
1196 Ga0495657_0003402 3300046675 Bacteria 12999
1197 Ga0495657_0011090 3300046675 Bacteria 6755
1198 Ga0495657_0047966 3300046675 Bacteria 2884
1199 Ga0495657_0050481 3300046675 Bacteria 2796
1200 Ga0495657_0061205 3300046675 Bacteria 2490
1201 Ga0495657_0089029 3300046675 Bacteria 1983
1202 Ga0495599_0006012 3300046678 Bacteria 7303
1203 Ga0495599_0159504 3300046678 Bacteria 1394
1204 Ga0495623_0012392 3300046679 Bacteria 5521
1205 Ga0495623_0033976 3300046679 Bacteria 3272
1206 Ga0495623_0063999 3300046679 Bacteria 2302
1207 Ga0495623_0170727 3300046679 Bacteria 1270
1208 Ga0495646_0000452 3300046680 Bacteria 21700
1209 Ga0495646_0007858 3300046680 Bacteria 6771
1210 Ga0495646_0009781 3300046680 Bacteria 6092
1211 Ga0495646_0052952 3300046680 Bacteria 2449
1212 Ga0495658_0007916 3300046683 Bacteria 5262
1213 Ga0495658_0039943 3300046683 Bacteria 2606
1214 Ga0495658_0087409 3300046683 Bacteria 1841
1215 Ga0495669_0016059 3300046684 Bacteria 3206
1216 Ga0495613_0003768 3300046689 Bacteria 11364
1217 Ga0495613_0017034 3300046689 Bacteria 5409
1218 Ga0495613_0018725 3300046689 Bacteria 5163
1219 Ga0495613_0186604 3300046689 Bacteria 1467
1220 Ga0495613_0202364 3300046689 Bacteria 1399
1221 Ga0495613_0252674 3300046689 Bacteria 1230
1222 Ga0495624_0008540 3300046690 Bacteria 7133
1223 Ga0495624_0015418 3300046690 Bacteria 5160
1224 Ga0495624_0068748 3300046690 Bacteria 2207
1225 Ga0495670_0002199 3300046691 Bacteria 9656
1226 Ga0495670_0002991 3300046691 Bacteria 8334
1227 Ga0495670_0077290 3300046691 Bacteria 1692
1228 Ga0495671_0049179 3300046692 Bacteria 2102
1229 Ga0495649_0025282 3300046694 Bacteria 3307
1230 Ga0495600_0013854 3300046809 Bacteria 5078
1231 Ga0495600_0033692 3300046809 Bacteria 3324
1232 Ga0495600_0073128 3300046809 Bacteria 2238
1233 Ga0495600_0112736 3300046809 Bacteria 1770
1234 Ga0495660_0053234 3300046810 Bacteria 2197
1235 Ga0495581_0002512 3300047315 Bacteria 10409
1236 Ga0495581_0004308 3300047315 Bacteria 8213
1237 Ga0495581_0032992 3300047315 Bacteria 2997
1238 Ga0495581_0058657 3300047315 Bacteria 2223
1239 Ga0495581_0098816 3300047315 Bacteria 1695
1240 Ga0495581_0138701 3300047315 Bacteria 1418
1241 Ga0495604_0001416 3300047317 Bacteria 19666
1242 Ga0495604_0002144 3300047317 Bacteria 15858
1243 Ga0495604_0005831 3300047317 Bacteria 9763
1244 Ga0495604_0014230 3300047317 Bacteria 6342
1245 Ga0495604_0165146 3300047317 Bacteria 1561
1246 Ga0495604_0192660 3300047317 Bacteria 1419
1247 Ga0495604_0201614 3300047317 Bacteria 1380
1248 Ga0495636_0002818 3300047318 Bacteria 6705
1249 Ga0495636_0061648 3300047318 Bacteria 1586
1250 Ga0495636_0079384 3300047318 Bacteria 1411
1251 Ga0495674_0018315 3300047319 Bacteria 6520
1252 Ga0495674_0061308 3300047319 Bacteria 3279
1253 Ga0495674_0102820 3300047319 Bacteria 2429
1254 Ga0495674_0156660 3300047319 Bacteria 1908
1255 Ga0495674_0192739 3300047319 Bacteria 1693
1256 Ga0495672_0004785 3300047320 Bacteria 10917
1257 Ga0495676_0023788 3300047321 Bacteria 5309
1258 Ga0495676_0072221 3300047321 Bacteria 2650
1259 Ga0495680_0006764 3300047322 Bacteria 10597
1260 Ga0495680_0011844 3300047322 Bacteria 7700
1261 Ga0495680_0017348 3300047322 Bacteria 6152
1262 Ga0495680_0022079 3300047322 Bacteria 5314
1263 Ga0495680_0026856 3300047322 Bacteria 4740
1264 Ga0495680_0213611 3300047322 Bacteria 1380
1265 Ga0495683_0023977 3300047323 Bacteria 3133
1266 Ga0495683_0045786 3300047323 Bacteria 2197
1267 Ga0495683_0053704 3300047323 Bacteria 2009
1268 Ga0495687_002815 3300047443 Bacteria 13420
1269 Ga0495687_006848 3300047443 Bacteria 6870
1270 Ga0495675_0002889 3300047444 Bacteria 10314
1271 Ga0495675_0004974 3300047444 Bacteria 8090
1272 Ga0495675_0006351 3300047444 Bacteria 7233
1273 Ga0495675_0014687 3300047444 Bacteria 4948
1274 Ga0495675_0021343 3300047444 Bacteria 4123
1275 Ga0495675_0023645 3300047444 Bacteria 3916
1276 Ga0495675_0046692 3300047444 Bacteria 2757
1277 Ga0495685_000982 3300047447 Bacteria 8653
1278 Ga0495685_020451 3300047447 Bacteria 2274
1279 Ga0495685_023255 3300047447 Bacteria 2133
1280 Ga0495685_024961 3300047447 Bacteria 2057
1281 Ga0495685_042339 3300047447 Bacteria 1554
1282 Ga0495681_0015753 3300047470 Bacteria 4268
1283 Ga0495681_0064671 3300047470 Bacteria 1674
1284 Ga0495681_0104454 3300047470 Bacteria 1234
1285 Ga0495681_0114760 3300047470 Bacteria 1162
1286 Ga0495684_0005403 3300047471 Bacteria 9945
1287 Ga0495684_0242685 3300047471 Bacteria 1313
1288 Ga0495686_0116420 3300047472 Bacteria 1597
1289 Ga0495593_0000443 3300047673 Bacteria 23177
1290 Ga0495593_0002560 3300047673 Bacteria 10915
1291 Ga0495593_0034279 3300047673 Bacteria 2762
1292 Ga0495593_0111386 3300047673 Bacteria 1397
1293 Ga0495602_0006880 3300048088 Bacteria 11952
1294 Ga0495602_0029227 3300048088 Bacteria 5255
1295 Ga0495602_0036142 3300048088 Bacteria 4600
1296 Ga0495602_0075673 3300048088 Bacteria 2856
1297 Ga0495602_0175671 3300048088 Bacteria 1657
1298 Ga0495602_0212854 3300048088 Bacteria 1465
1299 Ga0495614_0000332 3300048089 Bacteria 18664
1300 Ga0495614_0031915 3300048089 Bacteria 2267
1301 Ga0495614_0033535 3300048089 Bacteria 2209
1302 Ga0495626_0000107 3300048091 Bacteria 109694
1303 Ga0496100_0000230 3300048903 Bacteria 29721
1304 Ga0496100_0043820 3300048903 Bacteria 2863
1305 Ga0496100_0087974 3300048903 Bacteria 2113
1306 Ga0496100_0161740 3300048903 Bacteria 1605
1307 Ga0496100_0196657 3300048903 Bacteria 1467
1308 Ga0496101_0001323 3300048904 Bacteria 14832
1309 Ga0496101_0054973 3300048904 Bacteria 2874
1310 Ga0496101_0082071 3300048904 Bacteria 2386
1311 Ga0496102_0000197 3300048905 Bacteria 81788
1312 Ga0496102_0021041 3300048905 Bacteria 5769
1313 Ga0496102_0023849 3300048905 Bacteria 5438
1314 Ga0496102_0037590 3300048905 Bacteria 4367
1315 Ga0496102_0038480 3300048905 Bacteria 4316
1316 Ga0496102_0045644 3300048905 Bacteria 3978
1317 Ga0496102_0055745 3300048905 Bacteria 3604
1318 Ga0496102_0083131 3300048905 Bacteria 2954
1319 Ga0496102_0093081 3300048905 Bacteria 2792
1320 Ga0496102_0102067 3300048905 Bacteria 2666
1321 Ga0496102_0171358 3300048905 Bacteria 2043
1322 Ga0496103_0000567 3300048906 Bacteria 29330
1323 Ga0496103_0023676 3300048906 Bacteria 3704
1324 Ga0496103_0030514 3300048906 Bacteria 3281
1325 Ga0496103_0039662 3300048906 Bacteria 2894
1326 Ga0496103_0067538 3300048906 Bacteria 2233
1327 Ga0496104_0003320 3300048907 Bacteria 13884
1328 Ga0496104_0011409 3300048907 Bacteria 7956
1329 Ga0496104_0033704 3300048907 Bacteria 4773
1330 Ga0496104_0034546 3300048907 Bacteria 4716
1331 Ga0496104_0036380 3300048907 Bacteria 4602
1332 Ga0496104_0046580 3300048907 Bacteria 4083
1333 Ga0496104_0099606 3300048907 Bacteria 2782
1334 Ga0496104_0111162 3300048907 Bacteria 2627
1335 Ga0496104_0121872 3300048907 Bacteria 2504
1336 Ga0496104_0131900 3300048907 Bacteria 2400
1337 Ga0496104_0234151 3300048907 Bacteria 1748
1338 Ga0496104_0257471 3300048907 Bacteria 1658
1339 Ga0496105_0011926 3300048908 Bacteria 6882
1340 Ga0496105_0015275 3300048908 Bacteria 6116
1341 Ga0496105_0038966 3300048908 Bacteria 3916
1342 Ga0496105_0046991 3300048908 Bacteria 3562
1343 Ga0496105_0090132 3300048908 Bacteria 2533
1344 Ga0496105_0090865 3300048908 Bacteria 2522
1345 Ga0496105_0132441 3300048908 Bacteria 2055
1346 Ga0496105_0258066 3300048908 Bacteria 1410
1347 Ga0496106_0007408 3300048909 Bacteria 8109
1348 Ga0496106_0031548 3300048909 Bacteria 3949
1349 Ga0496106_0036550 3300048909 Bacteria 3674
1350 Ga0496106_0069881 3300048909 Bacteria 2681
1351 Ga0496106_0123434 3300048909 Bacteria 2026
1352 Ga0496106_0133453 3300048909 Bacteria 1948
1353 Ga0496107_0001318 3300048910 Bacteria 15224
1354 Ga0496107_0037188 3300048910 Bacteria 3493
1355 Ga0496107_0038003 3300048910 Bacteria 3456
1356 Ga0496107_0055606 3300048910 Bacteria 2858
1357 Ga0496107_0076169 3300048910 Bacteria 2443
1358 Ga0496107_0100298 3300048910 Bacteria 2122
1359 Ga0496107_0102047 3300048910 Bacteria 2103
1360 Ga0496108_0000323 3300048911 Bacteria 40586
1361 Ga0496108_0006496 3300048911 Bacteria 9485
1362 Ga0496108_0012803 3300048911 Bacteria 6831
1363 Ga0496108_0084950 3300048911 Bacteria 2686
1364 Ga0496108_0095629 3300048911 Bacteria 2529
1365 Ga0496108_0105015 3300048911 Bacteria 2411
1366 Ga0496108_0120317 3300048911 Bacteria 2251
1367 Ga0496108_0124866 3300048911 Bacteria 2209
1368 Ga0496108_0186921 3300048911 Bacteria 1795
1369 Ga0496109_0002523 3300048912 Bacteria 15351
1370 Ga0496109_0004862 3300048912 Bacteria 11217
1371 Ga0496109_0019246 3300048912 Bacteria 6016
1372 Ga0496109_0032372 3300048912 Bacteria 4700
1373 Ga0496109_0034824 3300048912 Bacteria 4538
1374 Ga0496109_0115425 3300048912 Bacteria 2498
1375 Ga0496109_0129255 3300048912 Bacteria 2357
1376 Ga0496109_0157565 3300048912 Bacteria 2127
1377 Ga0496109_0199461 3300048912 Bacteria 1881
1378 Ga0496109_0204079 3300048912 Bacteria 1858
1379 Ga0496109_0215218 3300048912 Bacteria 1807
1380 Ga0496109_0237679 3300048912 Bacteria 1714
1381 Ga0496109_0486189 3300048912 Bacteria 1165
1382 Ga0496110_0004803 3300048913 Bacteria 10526
1383 Ga0496110_0008247 3300048913 Bacteria 8376
1384 Ga0496110_0008548 3300048913 Bacteria 8242
1385 Ga0496110_0017679 3300048913 Bacteria 5963
1386 Ga0496110_0038743 3300048913 Bacteria 4149
1387 Ga0496110_0039302 3300048913 Bacteria 4120
1388 Ga0496110_0043146 3300048913 Bacteria 3938
1389 Ga0496110_0059470 3300048913 Bacteria 3368
1390 Ga0496110_0059635 3300048913 Bacteria 3364
1391 Ga0496110_0117426 3300048913 Bacteria 2395
1392 Ga0496110_0118881 3300048913 Bacteria 2380
1393 Ga0496110_0199315 3300048913 Bacteria 1818
1394 Ga0496111_0047322 3300048914 Bacteria 3097
1395 Ga0496111_0059520 3300048914 Bacteria 2768
1396 Ga0496111_0069275 3300048914 Bacteria 2565
1397 Ga0496111_0099236 3300048914 Bacteria 2139
1398 Ga0496111_0105774 3300048914 Bacteria 2071
1399 Ga0496111_0139751 3300048914 Bacteria 1794
1400 Ga0496111_0220146 3300048914 Bacteria 1410
1401 Ga0496112_0027019 3300048915 Bacteria 5532
1402 Ga0496112_0027336 3300048915 Bacteria 5500
1403 Ga0496112_0027513 3300048915 Bacteria 5483
1404 Ga0496112_0062948 3300048915 Bacteria 3660
1405 Ga0496112_0093772 3300048915 Bacteria 2972
1406 Ga0496112_0095368 3300048915 Bacteria 2945
1407 Ga0496112_0134082 3300048915 Bacteria 2447
1408 Ga0496112_0419569 3300048915 Bacteria 1277
1409 Ga0496113_0002025 3300048916 Bacteria 11636
1410 Ga0496113_0054965 3300048916 Bacteria 2983
1411 Ga0496113_0055383 3300048916 Bacteria 2973
1412 Ga0496113_0082918 3300048916 Bacteria 2460
1413 Ga0496113_0105761 3300048916 Bacteria 2185
1414 Ga0496113_0113680 3300048916 Bacteria 2110
1415 Ga0496113_0214923 3300048916 Bacteria 1531
1416 Ga0496113_0350872 3300048916 Bacteria 1184
1417 Ga0496114_0000312 3300048917 Bacteria 35518
1418 Ga0496114_0004399 3300048917 Bacteria 10926
1419 Ga0496114_0005039 3300048917 Bacteria 10305
1420 Ga0496114_0021136 3300048917 Bacteria 5292
1421 Ga0496114_0037163 3300048917 Bacteria 4027
1422 Ga0496114_0045642 3300048917 Bacteria 3641
1423 Ga0496114_0062739 3300048917 Bacteria 3110
1424 Ga0496114_0065970 3300048917 Bacteria 3034
1425 Ga0496114_0083702 3300048917 Bacteria 2699
1426 Ga0496114_0100408 3300048917 Bacteria 2469
1427 Ga0496114_0105861 3300048917 Bacteria 2406
1428 Ga0496114_0106305 3300048917 Bacteria 2401
1429 Ga0496114_0122375 3300048917 Bacteria 2239
1430 Ga0496114_0159674 3300048917 Bacteria 1959
1431 Ga0496115_0000958 3300048918 Bacteria 20936
1432 Ga0496115_0015306 3300048918 Bacteria 5817
1433 Ga0496115_0017500 3300048918 Bacteria 5482
1434 Ga0496115_0030420 3300048918 Bacteria 4248
1435 Ga0496115_0039635 3300048918 Bacteria 3742
1436 Ga0496115_0055631 3300048918 Bacteria 3178
1437 Ga0496115_0157271 3300048918 Bacteria 1877
1438 Ga0496116_0001814 3300048919 Bacteria 23129
1439 Ga0496117_0000160 3300048920 Bacteria 141709
1440 Ga0496117_0025274 3300048920 Bacteria 4673
1441 Ga0496117_0078466 3300048920 Bacteria 2180
1442 Ga0496118_0000391 3300048921 Bacteria 74169
1443 Ga0496118_0004280 3300048921 Bacteria 17078
1444 Ga0496118_0008436 3300048921 Bacteria 10655
1445 Ga0496118_0013776 3300048921 Bacteria 7621
1446 Ga0496118_0077813 3300048921 Bacteria 2351
1447 Ga0496119_0000585 3300048922 Bacteria 49239
1448 Ga0496119_0001388 3300048922 Bacteria 29376
1449 Ga0496119_0006896 3300048922 Bacteria 10369
1450 Ga0496119_0014398 3300048922 Bacteria 6194
1451 Ga0496119_0022637 3300048922 Bacteria 4489
1452 Ga0496120_0000664 3300048923 Bacteria 50585
1453 Ga0496120_0025613 3300048923 Bacteria 3658
1454 Ga0496121_0001733 3300048924 Bacteria 35614
1455 Ga0496121_0005283 3300048924 Bacteria 16634
1456 Ga0496121_0015399 3300048924 Bacteria 8015
1457 Ga0496121_0038881 3300048924 Bacteria 4203
1458 Ga0496122_0000420 3300048925 Bacteria 89921
1459 Ga0496123_0000241 3300048926 Bacteria 110078
1460 Ga0496123_0007065 3300048926 Bacteria 10675
1461 Ga0496124_0001389 3300048927 Bacteria 36286
1462 Ga0496124_0008501 3300048927 Bacteria 10721
1463 Ga0496124_0131795 3300048927 Bacteria 1985
1464 Ga0496124_0245039 3300048927 Bacteria 1330
1465 Ga0496125_0001823 3300048928 Bacteria 29442
1466 Ga0496125_0023204 3300048928 Bacteria 5734
1467 Ga0496125_0183937 3300048928 Bacteria 1388
1468 Ga0496126_0000003 3300048929 Bacteria 961576
1469 Ga0496126_0000007 3300048929 Bacteria 787364
1470 Ga0496126_0001780 3300048929 Bacteria 31816
1471 Ga0496126_0014094 3300048929 Bacteria 8096
1472 Ga0496126_0115230 3300048929 Bacteria 2337
1473 Ga0495678_033053 3300049459 Bacteria 2138
1474 Ga0501311_006970 3300049527 Bacteria 1290
1475 Ga0501316_002091 3300049532 Bacteria 1809
1476 Ga0501317_005953 3300049533 Bacteria 1325
1477 Ga0501317_006872 3300049533 Bacteria 1268
1478 Ga0501031_0005025 3300049568 Bacteria 8601
1479 Ga0501031_0017177 3300049568 Bacteria 4701
1480 Ga0501031_0017508 3300049568 Bacteria 4658
1481 Ga0501031_0035488 3300049568 Bacteria 3252
1482 Ga0501031_0177693 3300049568 Bacteria 1391
1483 Ga0501032_0000233 3300049569 Bacteria 46360
1484 Ga0501032_0001476 3300049569 Bacteria 18737
1485 Ga0501032_0005177 3300049569 Bacteria 9720
1486 Ga0501032_0028713 3300049569 Bacteria 3821
1487 Ga0501032_0030584 3300049569 Bacteria 3695
1488 Ga0501032_0032894 3300049569 Bacteria 3553
1489 Ga0501032_0123909 3300049569 Bacteria 1708
1490 Ga0501032_0134293 3300049569 Bacteria 1631
1491 Ga0501033_0000068 3300049570 Bacteria 98461
1492 Ga0501033_0001790 3300049570 Bacteria 18761
1493 Ga0501033_0003003 3300049570 Bacteria 14082
1494 Ga0501033_0024169 3300049570 Bacteria 4584
1495 Ga0501033_0028021 3300049570 Bacteria 4233
1496 Ga0501033_0036697 3300049570 Bacteria 3671
1497 Ga0501033_0043060 3300049570 Bacteria 3363
1498 Ga0501033_0043157 3300049570 Bacteria 3359
1499 Ga0501033_0048329 3300049570 Bacteria 3160
1500 Ga0501033_0072646 3300049570 Bacteria 2526
1501 Ga0501033_0160141 3300049570 Bacteria 1620
1502 Ga0501033_0210754 3300049570 Bacteria 1385
1503 Ga0501034_0000112 3300049571 Bacteria 150146
1504 Ga0501034_0000445 3300049571 Bacteria 68416
1505 Ga0501034_0006054 3300049571 Bacteria 13064
1506 Ga0501034_0007138 3300049571 Bacteria 11920
1507 Ga0501034_0010407 3300049571 Bacteria 9693
1508 Ga0501034_0012880 3300049571 Bacteria 8625
1509 Ga0501034_0014057 3300049571 Bacteria 8245
1510 Ga0501034_0015728 3300049571 Bacteria 7769
1511 Ga0501034_0016899 3300049571 Bacteria 7481
1512 Ga0501034_0026522 3300049571 Bacteria 5901
1513 Ga0501034_0030332 3300049571 Bacteria 5497
1514 Ga0501034_0045746 3300049571 Bacteria 4421
1515 Ga0501034_0061252 3300049571 Bacteria 3779
1516 Ga0501034_0069812 3300049571 Bacteria 3524
1517 Ga0501034_0076242 3300049571 Bacteria 3360
1518 Ga0501034_0134456 3300049571 Bacteria 2454
1519 Ga0501034_0142499 3300049571 Bacteria 2375
1520 Ga0501034_0198622 3300049571 Bacteria 1964
1521 Ga0501036_0000173 3300049572 Bacteria 42312
1522 Ga0501036_0000311 3300049572 Bacteria 33892
1523 Ga0501036_0003610 3300049572 Bacteria 12367
1524 Ga0501036_0008768 3300049572 Bacteria 8301
1525 Ga0501036_0008920 3300049572 Bacteria 8242
1526 Ga0501036_0029342 3300049572 Bacteria 4649
1527 Ga0501036_0043083 3300049572 Bacteria 3822
1528 Ga0501036_0043488 3300049572 Bacteria 3804
1529 Ga0501036_0056446 3300049572 Bacteria 3328
1530 Ga0501036_0065845 3300049572 Bacteria 3066
1531 Ga0501036_0112295 3300049572 Bacteria 2303
1532 Ga0501036_0222346 3300049572 Bacteria 1585
1533 Ga0501036_0258655 3300049572 Bacteria 1458
1534 Ga0501036_0280210 3300049572 Bacteria 1395
1535 Ga0501036_0383459 3300049572 Bacteria 1173
1536 Ga0501037_0003443 3300049573 Bacteria 11496
1537 Ga0501037_0006517 3300049573 Bacteria 8541
1538 Ga0501037_0027561 3300049573 Bacteria 4198
1539 Ga0501037_0062648 3300049573 Bacteria 2711
1540 Ga0501037_0074828 3300049573 Bacteria 2460
1541 Ga0501037_0085228 3300049573 Bacteria 2287
1542 Ga0501037_0087800 3300049573 Bacteria 2250
1543 Ga0501037_0096108 3300049573 Bacteria 2141
1544 Ga0501037_0118814 3300049573 Bacteria 1902
1545 Ga0501037_0118967 3300049573 Bacteria 1900
1546 Ga0501037_0154033 3300049573 Bacteria 1641
1547 Ga0501037_0171181 3300049573 Bacteria 1543
1548 Ga0501037_0217775 3300049573 Bacteria 1344
1549 Ga0501038_0001008 3300049574 Bacteria 25385
1550 Ga0501038_0003450 3300049574 Bacteria 14741
1551 Ga0501038_0014731 3300049574 Bacteria 7125
1552 Ga0501038_0017937 3300049574 Bacteria 6394
1553 Ga0501038_0018475 3300049574 Bacteria 6295
1554 Ga0501038_0022056 3300049574 Bacteria 5711
1555 Ga0501038_0022327 3300049574 Bacteria 5673
1556 Ga0501038_0024582 3300049574 Bacteria 5372
1557 Ga0501038_0033926 3300049574 Bacteria 4490
1558 Ga0501038_0037905 3300049574 Bacteria 4224
1559 Ga0501038_0100233 3300049574 Bacteria 2414
1560 Ga0501039_0000365 3300049575 Bacteria 32363
1561 Ga0501039_0001818 3300049575 Bacteria 15776
1562 Ga0501039_0002989 3300049575 Bacteria 12651
1563 Ga0501039_0022325 3300049575 Bacteria 4858
1564 Ga0501039_0047522 3300049575 Bacteria 3317
1565 Ga0501039_0055707 3300049575 Bacteria 3063
1566 Ga0501040_0000601 3300049576 Bacteria 21952
1567 Ga0501040_0003265 3300049576 Bacteria 10477
1568 Ga0501040_0005731 3300049576 Bacteria 8033
1569 Ga0501040_0010110 3300049576 Bacteria 6166
1570 Ga0501040_0024469 3300049576 Bacteria 4053
1571 Ga0501040_0030966 3300049576 Bacteria 3615
1572 Ga0501040_0034618 3300049576 Bacteria 3421
1573 Ga0501040_0046369 3300049576 Bacteria 2967
1574 Ga0501040_0167863 3300049576 Bacteria 1553
1575 Ga0501040_0169048 3300049576 Bacteria 1548
1576 Ga0501041_0000058 3300049577 Bacteria 40571
1577 Ga0501041_0003675 3300049577 Bacteria 8821
1578 Ga0501041_0007040 3300049577 Bacteria 6598
1579 Ga0501041_0035545 3300049577 Bacteria 3019
1580 Ga0501041_0047911 3300049577 Bacteria 2602
1581 Ga0501041_0089087 3300049577 Bacteria 1905
1582 Ga0501041_0126922 3300049577 Bacteria 1588
1583 Ga0501042_0000028 3300049578 Bacteria 47448
1584 Ga0501042_0001191 3300049578 Bacteria 15071
1585 Ga0501042_0002058 3300049578 Bacteria 12205
1586 Ga0501042_0002832 3300049578 Bacteria 10748
1587 Ga0501042_0018019 3300049578 Bacteria 4885
1588 Ga0501042_0052282 3300049578 Bacteria 2914
1589 Ga0501042_0069868 3300049578 Bacteria 2512
1590 Ga0501043_0002108 3300049579 Bacteria 16979
1591 Ga0501043_0003406 3300049579 Bacteria 13076
1592 Ga0501043_0003689 3300049579 Bacteria 12576
1593 Ga0501043_0006173 3300049579 Bacteria 9626
1594 Ga0501043_0006711 3300049579 Bacteria 9191
1595 Ga0501043_0122203 3300049579 Bacteria 2042
1596 Ga0501043_0166297 3300049579 Bacteria 1722
1597 Ga0501046_0000269 3300049580 Bacteria 52979
1598 Ga0501046_0002221 3300049580 Bacteria 18318
1599 Ga0501046_0011509 3300049580 Bacteria 7563
1600 Ga0501046_0014720 3300049580 Bacteria 6585
1601 Ga0501046_0019530 3300049580 Bacteria 5619
1602 Ga0501046_0033858 3300049580 Bacteria 4126
1603 Ga0501046_0138238 3300049580 Bacteria 1845
1604 Ga0501046_0205518 3300049580 Bacteria 1464
1605 Ga0501047_0001586 3300049581 Bacteria 22180
1606 Ga0501047_0001974 3300049581 Bacteria 19686
1607 Ga0501047_0002200 3300049581 Bacteria 18678
1608 Ga0501047_0006112 3300049581 Bacteria 11314
1609 Ga0501047_0033018 3300049581 Bacteria 4997
1610 Ga0501047_0039286 3300049581 Bacteria 4577
1611 Ga0501047_0063533 3300049581 Bacteria 3561
1612 Ga0501047_0063892 3300049581 Bacteria 3551
1613 Ga0501047_0064059 3300049581 Bacteria 3546
1614 Ga0501047_0066684 3300049581 Bacteria 3470
1615 Ga0501047_0140224 3300049581 Bacteria 2296
1616 Ga0501047_0209861 3300049581 Bacteria 1806
1617 Ga0501047_0324272 3300049581 Bacteria 1379
1618 Ga0501048_0000200 3300049582 Bacteria 39130
1619 Ga0501048_0000208 3300049582 Bacteria 38576
1620 Ga0501048_0005603 3300049582 Bacteria 9552
1621 Ga0501048_0007562 3300049582 Bacteria 8237
1622 Ga0501048_0008379 3300049582 Bacteria 7815
1623 Ga0501048_0202570 3300049582 Bacteria 1407
1624 Ga0501067_0007563 3300049583 Bacteria 6041
1625 Ga0501067_0032055 3300049583 Bacteria 2916
1626 Ga0501067_0039453 3300049583 Bacteria 2622
1627 Ga0501067_0044280 3300049583 Bacteria 2472
1628 Ga0501067_0048889 3300049583 Bacteria 2345
1629 Ga0501068_0000883 3300049584 Bacteria 15643
1630 Ga0501068_0002304 3300049584 Bacteria 10165
1631 Ga0501068_0005165 3300049584 Bacteria 7120
1632 Ga0501068_0043033 3300049584 Bacteria 2716
1633 Ga0501068_0094068 3300049584 Bacteria 1852
1634 Ga0501069_0000009 3300049585 Bacteria 175166
1635 Ga0501069_0000779 3300049585 Bacteria 14973
1636 Ga0501069_0003171 3300049585 Bacteria 8426
1637 Ga0501069_0010725 3300049585 Bacteria 4858
1638 Ga0501069_0011829 3300049585 Bacteria 4627
1639 Ga0501069_0019199 3300049585 Bacteria 3694
1640 Ga0501070_0000006 3300049586 Bacteria 226569
1641 Ga0501070_0000090 3300049586 Bacteria 77327
1642 Ga0501070_0000381 3300049586 Bacteria 40532
1643 Ga0501070_0002977 3300049586 Bacteria 14753
1644 Ga0501070_0003717 3300049586 Bacteria 13183
1645 Ga0501070_0004522 3300049586 Bacteria 11934
1646 Ga0501070_0005764 3300049586 Bacteria 10564
1647 Ga0501070_0007642 3300049586 Bacteria 9177
1648 Ga0501070_0020310 3300049586 Bacteria 5572
1649 Ga0501070_0067333 3300049586 Bacteria 2965
1650 Ga0501070_0072577 3300049586 Bacteria 2849
1651 Ga0501070_0072816 3300049586 Bacteria 2844
1652 Ga0501070_0076534 3300049586 Bacteria 2770
1653 Ga0501070_0076808 3300049586 Bacteria 2765
1654 Ga0501070_0098471 3300049586 Bacteria 2419
1655 Ga0501070_0111273 3300049586 Bacteria 2263
1656 Ga0501070_0123860 3300049586 Bacteria 2136
1657 Ga0501070_0263901 3300049586 Bacteria 1407
1658 Ga0501071_0001455 3300049587 Bacteria 13716
1659 Ga0501071_0002907 3300049587 Bacteria 10567
1660 Ga0501071_0003307 3300049587 Bacteria 10072
1661 Ga0501071_0008605 3300049587 Bacteria 6745
1662 Ga0501071_0009897 3300049587 Bacteria 6368
1663 Ga0501071_0018889 3300049587 Bacteria 4780
1664 Ga0501071_0075154 3300049587 Bacteria 2466
1665 Ga0501071_0162036 3300049587 Bacteria 1672
1666 Ga0501072_0000452 3300049588 Bacteria 29576
1667 Ga0501072_0000456 3300049588 Bacteria 29523
1668 Ga0501072_0001842 3300049588 Bacteria 15788
1669 Ga0501072_0005756 3300049588 Bacteria 9435
1670 Ga0501072_0008669 3300049588 Bacteria 7719
1671 Ga0501072_0017657 3300049588 Bacteria 5487
1672 Ga0501072_0092052 3300049588 Bacteria 2408
1673 Ga0501072_0134057 3300049588 Bacteria 1975
1674 Ga0501073_0002160 3300049589 Bacteria 14708
1675 Ga0501073_0003916 3300049589 Bacteria 11175
1676 Ga0501073_0008948 3300049589 Bacteria 7395
1677 Ga0501073_0083303 3300049589 Bacteria 2225
1678 Ga0501073_0093393 3300049589 Bacteria 2090
1679 Ga0501073_0103888 3300049589 Bacteria 1972
1680 Ga0501073_0115876 3300049589 Bacteria 1857
1681 Ga0501073_0131878 3300049589 Bacteria 1732
1682 Ga0501074_0000592 3300049590 Bacteria 22500
1683 Ga0501074_0001226 3300049590 Bacteria 16918
1684 Ga0501074_0001449 3300049590 Bacteria 15872
1685 Ga0501074_0001504 3300049590 Bacteria 15719
1686 Ga0501074_0001760 3300049590 Bacteria 14793
1687 Ga0501074_0002346 3300049590 Bacteria 13176
1688 Ga0501074_0010495 3300049590 Bacteria 6723
1689 Ga0501074_0014772 3300049590 Bacteria 5681
1690 Ga0501074_0027690 3300049590 Bacteria 4109
1691 Ga0501074_0046308 3300049590 Bacteria 3144
1692 Ga0501074_0081549 3300049590 Bacteria 2320
1693 Ga0501074_0107580 3300049590 Bacteria 1996
1694 Ga0501074_0122618 3300049590 Bacteria 1859
1695 Ga0501074_0329696 3300049590 Bacteria 1083
1696 Ga0501075_0002435 3300049591 Bacteria 12394
1697 Ga0501075_0003534 3300049591 Bacteria 10458
1698 Ga0501075_0006156 3300049591 Bacteria 8245
1699 Ga0501075_0009381 3300049591 Bacteria 6845
1700 Ga0501075_0025620 3300049591 Bacteria 4333
1701 Ga0501075_0079735 3300049591 Bacteria 2477
1702 Ga0501076_0000061 3300049592 Bacteria 53989
1703 Ga0501076_0003089 3300049592 Bacteria 11595
1704 Ga0501076_0005895 3300049592 Bacteria 8840
1705 Ga0501076_0036881 3300049592 Bacteria 3832
1706 Ga0501076_0055586 3300049592 Bacteria 3139
1707 Ga0501076_0088735 3300049592 Bacteria 2485
1708 Ga0501076_0325929 3300049592 Bacteria 1260
1709 Ga0501077_0000349 3300049593 Bacteria 27264
1710 Ga0501077_0018887 3300049593 Bacteria 4362
1711 Ga0501077_0028205 3300049593 Bacteria 3567
1712 Ga0501077_0108285 3300049593 Bacteria 1760
1713 Ga0501079_0000088 3300049741 Bacteria 44435
1714 Ga0501079_0000185 3300049741 Bacteria 35586
1715 Ga0501079_0000787 3300049741 Bacteria 21639
1716 Ga0501079_0003605 3300049741 Bacteria 11391
1717 Ga0501079_0008202 3300049741 Bacteria 7918
1718 Ga0501079_0015246 3300049741 Bacteria 5863
1719 Ga0501079_0044068 3300049741 Bacteria 3443
1720 Ga0501079_0048254 3300049741 Bacteria 3286
1721 Ga0501079_0090727 3300049741 Bacteria 2367
1722 Ga0501080_0000714 3300049742 Bacteria 26720
1723 Ga0501080_0005622 3300049742 Bacteria 11203
1724 Ga0501080_0014618 3300049742 Bacteria 7230
1725 Ga0501080_0022775 3300049742 Bacteria 5803
1726 Ga0501080_0033816 3300049742 Bacteria 4773
1727 Ga0501080_0034394 3300049742 Bacteria 4731
1728 Ga0501080_0035150 3300049742 Bacteria 4678
1729 Ga0501080_0039087 3300049742 Bacteria 4428
1730 Ga0501080_0050424 3300049742 Bacteria 3874
1731 Ga0501080_0056786 3300049742 Bacteria 3644
1732 Ga0501080_0130430 3300049742 Bacteria 2327
1733 Ga0501080_0278916 3300049742 Bacteria 1520
1734 Ga0501080_0285112 3300049742 Bacteria 1500
1735 Ga0501081_0000808 3300049743 Bacteria 18487
1736 Ga0501081_0001235 3300049743 Bacteria 15554
1737 Ga0501081_0014905 3300049743 Bacteria 5127
1738 Ga0501081_0025943 3300049743 Bacteria 3947
1739 Ga0501083_0000096 3300049744 Bacteria 59671
1740 Ga0501083_0006021 3300049744 Bacteria 8591
1741 Ga0501083_0006066 3300049744 Bacteria 8562
1742 Ga0501083_0009376 3300049744 Bacteria 6910
1743 Ga0501083_0012445 3300049744 Bacteria 5951
1744 Ga0501083_0049329 3300049744 Bacteria 2838
1745 Ga0501083_0092031 3300049744 Bacteria 2002
1746 Ga0501035_0007509 3300049822 Bacteria 10184
1747 Ga0501035_0009862 3300049822 Bacteria 8864
1748 Ga0501035_0021233 3300049822 Bacteria 5968
1749 Ga0501035_0041946 3300049822 Bacteria 4129
1750 Ga0501035_0054245 3300049822 Bacteria 3582
1751 Ga0501035_0057970 3300049822 Bacteria 3452
1752 Ga0501035_0059274 3300049822 Bacteria 3409
1753 Ga0501035_0061025 3300049822 Bacteria 3356
1754 Ga0501035_0068650 3300049822 Bacteria 3142
1755 Ga0501035_0110052 3300049822 Bacteria 2414
1756 Ga0501035_0122856 3300049822 Bacteria 2268
1757 Ga0501035_0135499 3300049822 Bacteria 2144
1758 Ga0501035_0157221 3300049822 Bacteria 1970
1759 Ga0501035_0184080 3300049822 Bacteria 1798
1760 Ga0501035_0275648 3300049822 Bacteria 1423
1761 Ga0501044_0000191 3300049823 Bacteria 77389
1762 Ga0501044_0000276 3300049823 Bacteria 65263
1763 Ga0501044_0002167 3300049823 Bacteria 22517
1764 Ga0501044_0003934 3300049823 Bacteria 16657
1765 Ga0501044_0007350 3300049823 Bacteria 12109
1766 Ga0501044_0021567 3300049823 Bacteria 6869
1767 Ga0501044_0038842 3300049823 Bacteria 4971
1768 Ga0501044_0079472 3300049823 Bacteria 3323
1769 Ga0501044_0093090 3300049823 Bacteria 3039
1770 Ga0501044_0097355 3300049823 Bacteria 2963
1771 Ga0501044_0133618 3300049823 Bacteria 2474
1772 Ga0501044_0136408 3300049823 Bacteria 2445
1773 Ga0501044_0155813 3300049823 Bacteria 2264
1774 Ga0501044_0156108 3300049823 Bacteria 2261
1775 Ga0501044_0168415 3300049823 Bacteria 2163
1776 Ga0501044_0214900 3300049823 Bacteria 1876
1777 Ga0501044_0244745 3300049823 Bacteria 1736
1778 Ga0501044_0304865 3300049823 Bacteria 1520
1779 Ga0501045_0000044 3300049824 Bacteria 54187
1780 Ga0501045_0000099 3300049824 Bacteria 42877
1781 Ga0501045_0002750 3300049824 Bacteria 12012
1782 Ga0501045_0003799 3300049824 Bacteria 10386
1783 Ga0501045_0008315 3300049824 Bacteria 7226
1784 Ga0501045_0013372 3300049824 Bacteria 5796
1785 Ga0501045_0018652 3300049824 Bacteria 4938
1786 Ga0501045_0023583 3300049824 Bacteria 4413
1787 Ga0501045_0047497 3300049824 Bacteria 3127
1788 Ga0501045_0061270 3300049824 Bacteria 2760
1789 Ga0501045_0104273 3300049824 Bacteria 2101
1790 Ga0501045_0191142 3300049824 Bacteria 1526
1791 nmdc:mga03683_8047_c1 3300050489 Bacteria 3690
1792 nmdc:mga03n38_113700_c1 3300050490 Bacteria 1322
1793 nmdc:mga03n38_4316_c1 3300050490 Bacteria 4691
1794 nmdc:mga00v17_51214_c1 3300050491 Bacteria 2511
1795 nmdc:mga00v17_9992_c1 3300050491 Bacteria 5162
1796 nmdc:mga0yw44_159042_c1 3300050492 Bacteria 1478
1797 nmdc:mga0yw44_27194_c1 3300050492 Bacteria 3274
1798 nmdc:mga0yw44_43386_c1 3300050492 Bacteria 2685
1799 nmdc:mga0yw44_64051_c1 3300050492 Bacteria 2262
1800 nmdc:mga0yw44_78387_c1 3300050492 Bacteria 2066
1801 nmdc:mga0yw44_87740_c1 3300050492 Bacteria 1961
1802 nmdc:mga06z11_13537_c1 3300050494 Bacteria 3586
1803 nmdc:mga06z11_17805_c1 3300050494 Bacteria 3233
1804 nmdc:mga06z11_51546_c1 3300050494 Bacteria 2108
1805 nmdc:mga06z11_5961_c1 3300050494 Bacteria 4923
1806 nmdc:mga04h51_10331_c1 3300050495 Bacteria 2561
1807 nmdc:mga04h51_5221_c1 3300050495 Bacteria 3297
1808 nmdc:mga07m45_107673_c1 3300050496 Bacteria 1604
1809 nmdc:mga07m45_21523_c1 3300050496 Bacteria 3512
1810 nmdc:mga05p37_1507_c1 3300050507 Bacteria 27071
1811 nmdc:mga05p37_153_c1 3300050507 Bacteria 65478
1812 nmdc:mga05p37_19739_c1 3300050507 Bacteria 8154
1813 nmdc:mga05p37_2500_c1 3300050507 Bacteria 21375
1814 nmdc:mga05p37_36897_c1 3300050507 Bacteria 5995
1815 nmdc:mga05p37_389220_c1 3300050507 Bacteria 1631
1816 nmdc:mga05p37_519_c1 3300050507 Bacteria 42633
1817 nmdc:mga09592_1439_c1 3300050508 Bacteria 19070
1818 nmdc:mga09592_40807_c1 3300050508 Bacteria 3900
1819 nmdc:mga09592_4_c1 3300050508 Bacteria 133185
1820 nmdc:mga09592_54533_c1 3300050508 Bacteria 3378
1821 nmdc:mga09592_6157_c1 3300050508 Bacteria 9764
1822 nmdc:mga0qj67_3_c2 3300050509 Bacteria 152036
1823 nmdc:mga0qj67_61677_c1 3300050509 Bacteria 2977
1824 nmdc:mga0qj67_6977_c1 3300050509 Bacteria 8318
1825 nmdc:mga0qj67_79776_c1 3300050509 Bacteria 2622
1826 nmdc:mga0qj67_9248_c1 3300050509 Bacteria 7325
1827 nmdc:mga0qj67_97743_c1 3300050509 Bacteria 2365
1828 nmdc:mga06r32_1153_c1 3300050510 Bacteria 23761
1829 nmdc:mga06r32_20179_c1 3300050510 Bacteria 6132
1830 nmdc:mga06r32_6093_c1 3300050510 Bacteria 10835
1831 nmdc:mga06r32_6_c2 3300050510 Bacteria 109995
1832 nmdc:mga06r32_7494_c1 3300050510 Bacteria 9814
1833 nmdc:mga06r32_791_c1 3300050510 Bacteria 28031
1834 nmdc:mga06r32_87415_c1 3300050510 Bacteria 3042
1835 nmdc:mga08y16_10989_c1 3300050511 Bacteria 9505
1836 nmdc:mga08y16_1109_c1 3300050511 Bacteria 26540
1837 nmdc:mga08y16_15537_c1 3300050511 Bacteria 8006
1838 nmdc:mga0n895_4859_c1 3300050512 Bacteria 11136
1839 nmdc:mga0rr50_103852_c1 3300050513 Bacteria 2237
1840 nmdc:mga0rr50_109975_c1 3300050513 Bacteria 2179
1841 nmdc:mga0rr50_1591_c1 3300050513 Bacteria 12523
1842 nmdc:mga0a205_1654_c1 3300050515 Bacteria 17980
1843 nmdc:mga0a205_171897_c1 3300050515 Bacteria 2063
1844 nmdc:mga0sz30_42436_c1 3300050516 Bacteria 1914
1845 Ga0495601_0023913 3300053077 Bacteria 3758
1846 Ga0495601_0031787 3300053077 Bacteria 3282
1847 Ga0495601_0036267 3300053077 Bacteria 3078
1848 Ga0495601_0082023 3300053077 Bacteria 2070
1849 Ga0495601_0128056 3300053077 Bacteria 1652
1850 Ga0495601_0181442 3300053077 Bacteria 1376
1851 Ga0495612_0001858 3300053078 Bacteria 8671
1852 Ga0495612_0007022 3300053078 Bacteria 4605
1853 Ga0500610_0002713 3300053079 Bacteria 6603
1854 Ga0495595_0002567 3300053084 Bacteria 7121
1855 Ga0495595_0013276 3300053084 Bacteria 3479
1856 Ga0495595_0093127 3300053084 Bacteria 1447
1857 Ga0495619_0010545 3300053085 Bacteria 5814
1858 Ga0495619_0018136 3300053085 Bacteria 4463
1859 Ga0495619_0052583 3300053085 Bacteria 2693
1860 Ga0495619_0069188 3300053085 Bacteria 2359
1861 Ga0495619_0105163 3300053085 Bacteria 1924
1862 Ga0495619_0111566 3300053085 Bacteria 1869
1863 Ga0500643_000341 3300053087 Bacteria 37015
1864 Ga0500643_000621 3300053087 Bacteria 24006
1865 Ga0500644_0000003 3300053088 Bacteria 199121
1866 Ga0500644_0014886 3300053088 Bacteria 2205
1867 Ga0500644_0047278 3300053088 Bacteria 1459
1868 Ga0500646_0000441 3300053090 Bacteria 12323
1869 Ga0500583_0027610 3300053092 Bacteria 2452
1870 Ga0500583_0092885 3300053092 Bacteria 1470
1871 Ga0500566_0000073 3300053094 Bacteria 48667
1872 Ga0500640_062360 3300053095 Bacteria 1613
1873 Ga0500650_0001215 3300053098 Bacteria 7569
1874 Ga0500650_0087862 3300053098 Bacteria 1455
1875 Ga0500654_087111 3300053099 Bacteria 1416
1876 Ga0500553_035850 3300053101 Bacteria 2456
1877 Ga0500556_0000028 3300053104 Bacteria 165503
1878 Ga0500556_0000394 3300053104 Bacteria 32021
1879 Ga0500556_0001874 3300053104 Bacteria 7560
1880 Ga0500560_021127 3300053107 Bacteria 1856
1881 Ga0500562_000178 3300053108 Bacteria 17460
1882 Ga0500580_065616 3300053113 Bacteria 1504
1883 Ga0500593_000225 3300053117 Bacteria 23341
1884 Ga0500652_001350 3300053131 Bacteria 7677
1885 Ga0500655_006799 3300053133 Bacteria 2059
1886 Ga0500559_0000648 3300053136 Bacteria 23461
1887 Ga0500559_0032730 3300053136 Bacteria 2235
1888 Ga0500561_0000434 3300053137 Bacteria 6815
1889 Ga0500568_0000009 3300053139 Bacteria 270298
1890 Ga0500568_0000043 3300053139 Bacteria 126766
1891 Ga0500568_0000223 3300053139 Bacteria 48626
1892 Ga0500568_0006232 3300053139 Bacteria 6020
1893 Ga0500573_0006057 3300053140 Bacteria 6515
1894 Ga0500573_0008740 3300053140 Bacteria 5591
1895 Ga0500573_0073893 3300053140 Bacteria 1942
1896 Ga0500573_0110950 3300053140 Bacteria 1534
1897 Ga0500573_0159190 3300053140 Bacteria 1230
1898 Ga0500577_0100319 3300053142 Bacteria 1182
1899 Ga0500579_054963 3300053143 Bacteria 2407
1900 Ga0500588_0000670 3300053146 Bacteria 5730
1901 Ga0500616_0000027 3300053153 Bacteria 441053
1902 Ga0500616_0000273 3300053153 Bacteria 77024
1903 Ga0500616_0000570 3300053153 Bacteria 45118
1904 Ga0500616_0006098 3300053153 Bacteria 7978
1905 Ga0500616_0038349 3300053153 Bacteria 2588
1906 Ga0500616_0056073 3300053153 Bacteria 2058
1907 Ga0500620_006012 3300053155 Bacteria 2866
1908 Ga0500624_012642 3300053157 Bacteria 1251
1909 Ga0500636_0071097 3300053177 Bacteria 2018
1910 Ga0501084_0000109 3300054114 Bacteria 61698
1911 Ga0501084_0001023 3300054114 Bacteria 21690
1912 Ga0501084_0002549 3300054114 Bacteria 14684
1913 Ga0501084_0007261 3300054114 Bacteria 9133
1914 Ga0501084_0008559 3300054114 Bacteria 8460
1915 Ga0501084_0014163 3300054114 Bacteria 6604
1916 Ga0501084_0023072 3300054114 Bacteria 5194
1917 Ga0501084_0068395 3300054114 Bacteria 2973
1918 Ga0501084_0107461 3300054114 Bacteria 2344
1919 Ga0501084_0115212 3300054114 Bacteria 2259
1920 Ga0501084_0148900 3300054114 Bacteria 1972
1921 Ga0587090_009055 3300059510 Bacteria 1351
1922 Ga0501082_0003253 3300060353 Bacteria 14176
1923 Ga0501082_0027102 3300060353 Bacteria 4937
1924 Ga0501082_0041255 3300060353 Bacteria 3979
1925 Ga0501082_0072107 3300060353 Bacteria 2975
1926 Ga0501082_0083044 3300060353 Bacteria 2764
1927 Ga0466962_0000051 3300061719 Bacteria 47373
1928 Ga0466962_0000057 3300061719 Bacteria 46351
1929 Ga0466962_0010819 3300061719 Bacteria 4386
1930 Ga0466962_0086439 3300061719 Bacteria 1501
1931 Ga0530510_0000204 3300061734 Bacteria 36725
1932 Ga0530510_0001129 3300061734 Bacteria 17745
1933 Ga0530510_0007848 3300061734 Bacteria 7443
1934 Ga0530510_0011566 3300061734 Bacteria 6194
1935 Ga0530510_0016065 3300061734 Bacteria 5292
1936 Ga0530510_0022473 3300061734 Bacteria 4493
1937 2501945014 2501939600 Bacteria 6907073
1938 2506864793 2506783011 Bacteria 5323186
1939 2508671422 2508501039 Bacteria 9978592
1940 2515494075 2515154088 Bacteria 5526283
1941 2515721370 2515154129 Bacteria 5584369
1942 2515755882 2515154137 Bacteria 5711575
1943 2516085498 2515154202 Bacteria 5471270
1944 2516089785 2515154203 Bacteria 5458536
1945 2517761769 2517572101 Bacteria 6884336
1946 2528202174 2527291627 Bacteria 5309833
1947 2528212776 2527291629 Bacteria 5267418
1948 2537898918 2537561592 Bacteria 4348607
1949 2546948574 2546825537 Bacteria 5389291
1950 2547408133 2547132111 Bacteria 8013147
1951 2554257852 2554235005 Bacteria 6457341
1952 2555229487 2554235227 Bacteria 3637389
1953 2579749817 2576861822 Bacteria 5004595
1954 2579854928 2579778521 Bacteria 7624758
1955 2585308805 2582581313 Bacteria 10042643
1956 2585313508 2582581314 Bacteria 11452267
1957 2587864081 2585428094 Bacteria 3604039
1958 2616695052 2616644814 Bacteria 11555299
1959 2616902174 2616644941 Bacteria 8510691
1960 2619853120 2619618881 Bacteria 7521104
1961 2620351088 2619619003 Bacteria 7619552
1962 2623586326 2622736626 Bacteria 7181580
1963 2626637206 2626541554 Bacteria 7741902
1964 2643764940 2643221548 Bacteria 8053412
1965 2643827418 2643221561 Bacteria 4984412
1966 2643849056 2643221566 Bacteria 3460379
1967 2643852419 2643221567 Bacteria 4163945
1968 2643891900 2643221576 Bacteria 5214352
1969 2643902616 2643221578 Bacteria 9213798
1970 2643942199 2643221587 Bacteria 7586415
1971 2643960952 2643221590 Bacteria 5214697
1972 2643995246 2643221597 Bacteria 3347721
1973 2644017180 2643221601 Bacteria 7493239
1974 2644031966 2643221604 Bacteria 5014917
1975 2644094016 2643221615 Bacteria 5487866
1976 2644100367 2643221617 Bacteria 5139111
1977 2644116774 2643221620 Bacteria 5134593
1978 2644136942 2643221624 Bacteria 4384879
1979 2644173859 2643221631 Bacteria 8168043
1980 2644228551 2643221641 Bacteria 4490190
1981 2644262289 2643221647 Bacteria 10741251
1982 2644323859 2643221657 Bacteria 5490246
1983 2644389865 2643221670 Bacteria 6497041
1984 2644404876 2643221673 Bacteria 9196637
1985 2644429282 2643221677 Bacteria 7584031
1986 2644437176 2643221678 Bacteria 9540101
1987 2644458294 2643221681 Bacteria 3707866
1988 2644461220 2643221682 Bacteria 6743283
1989 2644504884 2643221690 Bacteria 4654705
1990 2644527204 2643221694 Bacteria 4392972
1991 2644533755 2643221696 Bacteria 5431823
1992 2644610265 2643221711 Bacteria 4865335
1993 2644628915 2643221714 Bacteria 9015452
1994 2644667753 2643221722 Bacteria 4247614
1995 2645722438 2643221961 Bacteria 3919167
1996 2645725411 2643221962 Bacteria 3874254
1997 2655031501 2654587600 Bacteria 3911798
1998 2671837652 2671180195 Bacteria 9757215
1999 2676203036 2675902999 Bacteria 9438463
2000 2676484158 2675903059 Bacteria 8644972
2001 2686537920 2684623035 Bacteria 8032739
2002 2686542989 2684623036 Bacteria 5199090
2003 2689956382 2687453737 Bacteria 11203906
2004 2710603307 2710264753 Bacteria 5455564
2005 2740166019 2739367898 Bacteria 4367674
2006 2753269546 2751185782 Bacteria 11227053
2007 2768644748 2767802112 Bacteria 6465194
2008 2772641467 2772190715 Bacteria 6959372
2009 2774383792 2773857759 Bacteria 2963774
2010 2774847612 2773857921 Bacteria 9435764
2011 2774855808 2773857922 Bacteria 9757215
2012 2774866300 2773857924 Bacteria 5256821
2013 2774904883 2773857933 Bacteria 5818019
2014 2775658508 2775506735 Bacteria 4556596
2015 2784473033 2784132109 Bacteria 3141763
2016 2784588586 2784132148 Bacteria 8627943
2017 2785343281 2784746763 Bacteria 9783172
2018 2785369515 2784746768 Bacteria 10036182
2019 2786670619 2786546132 Bacteria 10419719
2020 2793979713 2791355406 Bacteria 11364898
2021 2804847037 2802429296 Bacteria 7227771
2022 2808830052 2808606357 Bacteria 4466944
2023 2808842074 2808606359 Bacteria 9866990
2024 2808851227 2808606360 Bacteria 4404006
2025 2808876248 2808606366 Bacteria 4415912
2026 2808894302 2808606370 Bacteria 4942454
2027 2808897751 2808606371 Bacteria 4251511
2028 2808920592 2808606375 Bacteria 9466072
2029 2809232198 2808606448 Bacteria 8656184
2030 2810363130 2808606700 Bacteria 3482157
2031 2811849064 2808606982 Bacteria 7791042
2032 2812318173 2811994871 Bacteria 4497550
2033 2812371666 2811994882 Bacteria 4688362
2034 2812480508 2811994917 Bacteria 7761064
2035 2816420874 2816332119 Bacteria 8120218
2036 2819667227 2818991458 Bacteria 4794049
2037 2819690559 2818991462 Bacteria 4320267
2038 2819695391 2818991463 Bacteria 7948711
2039 2819728129 2818991469 Bacteria 4644110
2040 2819741161 2818991472 Bacteria 10089953
2041 2827628670 2827628540 Bacteria 6858585
2042 2831937257 2831935698 Bacteria 5963223
2043 2832006611 2832004796 Bacteria 6538017
2044 2837187328 2837183177 Bacteria 4637169
2045 2837274720 2837268691 Bacteria 7850704
2046 2839988783 2839986021 Bacteria 3685650
2047 2844851726 2844849076 Bacteria 4091819
2048 2848552212 2848551377 Bacteria 3720646
2049 2852636654 2852635781 Bacteria 8251373
2050 2852678749 2852677369 Bacteria 3768884
2051 2855676551 2855670206 Bacteria 7120389
2052 2855683399 2855676851 Bacteria 7063653
2053 2855685128 2855683550 Bacteria 7134265
2054 2856860171 2856858025 Bacteria 7255264
2055 2857294985 2857288857 Bacteria 7189066
2056 2857481202 2857479173 Bacteria 2469263
2057 2857633465 2857632687 Bacteria 2448521
2058 2857712944 2857710386 Bacteria 3186771
2059 2857734272 2857733635 Bacteria 3532004
2060 2857740854 2857740372 Bacteria 4782044
2061 2858852149 2858848962 Bacteria 6963058
2062 2858872875 2858868258 Bacteria 7683772
2063 2858888335 2858882152 Bacteria 7230291
2064 2858893250 2858888857 Bacteria 7060307
2065 2858899093 2858895516 Bacteria 7378898
2066 2858905417 2858902515 Bacteria 7086037
2067 2862180154 2862178590 Bacteria 8583590
2068 2862285674 2862281513 Bacteria 9621493
2069 2862290636 2862290372 Bacteria 7471434
2070 2862384445 2862382967 Bacteria 10317375
2071 2862511796 2862507626 Bacteria 9425308
2072 2862579238 2862574272 Bacteria 10567477
2073 2862993449 2862993130 Bacteria 3860849
2074 2863404590 2863404153 Bacteria 9672205
2075 2866065722 2866065130 Bacteria 6518152
2076 2867304186 2867302475 Bacteria 7087181
2077 2867313513 2867312974 Bacteria 7058875
2078 2867322665 2867319477 Bacteria 7069771
2079 2867348799 2867346516 Bacteria 7608576
2080 2867371911 2867369537 Bacteria 6501581
2081 2867435889 2867428634 Bacteria 9590268
2082 2867480596 2867475112 Bacteria 6909112
2083 2867509187 2867507094 Bacteria 6506033
2084 2868094032 2868088558 Bacteria 7609351
2085 2869055292 2869048445 Bacteria 6875584
2086 2869062571 2869061728 Bacteria 7112407
2087 2869074566 2869068681 Bacteria 7205615
2088 2870622451 2870622029 Bacteria 3643329
2089 2870803312 2870801768 Bacteria 2710986
2090 2870805355 2870804320 Bacteria 2552467
2091 2873155713 2873151551 Bacteria 8625867
2092 2875395764 2875391855 Bacteria 7600475
2093 2877681096 2877676314 Bacteria 9512378
2094 2880493979 2880489317 Bacteria 7096270
2095 2880498361 2880495981 Bacteria 7340502
2096 2884996753 2884994152 Bacteria 4492978
2097 2887446937 2887443736 Bacteria 4426037
2098 2887483645 2887478801 Bacteria 8972725
2099 2891401264 2891395885 Bacteria 9251614
2100 2895888156 2895880812 Bacteria 11255272
2101 2904501535 2904497146 Bacteria 4731781
2102 2904778167 2904776348 Bacteria 4658726
2103 2905928653 2905926851 Bacteria 4423176
2104 2910813480 2910809715 Bacteria 4982797
2105 2912719939 2912715099 Bacteria 9460473
2106 2912724331 2912723979 Bacteria 8557534
2107 2912760801 2912757875 Bacteria 7940295
2108 2918505620 2918501144 Bacteria 8668083
2109 2919035543 2919034639 Bacteria 4763403
2110 2919054615 2919051321 Bacteria 4210889
2111 2919060213 2919059106 Bacteria 4991624
2112 2919395334 2919391150 Bacteria 4884741
2113 2919469497 2919468124 Bacteria 9133025
2114 2919539239 2919538618 Bacteria 4677069
2115 2920883334 2920879853 Bacteria 4216831
2116 2929220391 2929219909 Bacteria 6984360
2117 2929226946 2929226422 Bacteria 7248583
2118 2932427827 2932426870 Bacteria 4547726
2119 2932434482 2932431166 Bacteria 4215299
2120 2933418599 2933418574 Bacteria 4476724
2121 2935393401 2935390628 Bacteria 7043367
2122 2935410757 2935409751 Bacteria 4179611
2123 2939599352 2939598168 Bacteria 4687164
2124 2939650273 2939647034 Bacteria 4681660
2125 2939659169 2939657138 Bacteria 3740283
2126 2939677693 2939674588 Bacteria 4844420
2127 2945920274 2945916053 Bacteria 4555517
2128 2945923865 2945920336 Bacteria 4501603
2129 2945944473 2945941187 Bacteria 4682474
2130 2945957335 2945956166 Bacteria 5110334
2131 2945958695 2945956166 Bacteria 5110334
2132 2946003365 2946003308 Bacteria 3857229
2133 2946040391 2946037020 Bacteria 4900426
2134 2946048858 2946045630 Bacteria 8527308
2135 2946063991 2946059875 Bacteria 4386623
2136 2946067751 2946064051 Bacteria 8957905
2137 2946075930 2946072368 Bacteria 8999607
2138 2947229215 2947224130 Bacteria 9938529
2139 2954001656 2953998280 Bacteria 4812144
2140 2954007394 2954002825 Bacteria 9173742
2141 2954386225 2954380949 Bacteria 10050426
2142 2954676941 2954673503 Bacteria 9685905
2143 2954687217 2954682443 Bacteria 9862841
2144 2954696863 2954691527 Bacteria 10720516
2145 2954705273 2954701450 Bacteria 10834262
2146 2954716236 2954711539 Bacteria 10867210
2147 2954726178 2954721474 Bacteria 10456478
2148 2954735632 2954731030 Bacteria 10243860
2149 2954745104 2954740390 Bacteria 10229294
2150 2954754487 2954749733 Bacteria 10366972
2151 2954764077 2954759201 Bacteria 9358192
2152 2964328617 2964326757 Bacteria 3290868
2153 2966601630 2966598605 Bacteria 7676064
2154 2974303822 2974302888 Bacteria 4369871
2155 2984579265 2984576629 Bacteria 4248407
2156 2990060746 2990059506 Bacteria 9321252
2157 2990090532 2990088156 Bacteria 6657676
2158 2990259842 2990256926 Bacteria 4252839
2159 2996223380 2996221748 Bacteria 6799777
2160 2997457816 2997451912 Bacteria 8492419
2161 2997600395 2997600082 Bacteria 9896405
2162 3001890363 3001889506 Bacteria 2975194
2163 3006325033 3006321560 Bacteria 8247479
2164 3006398368 3006393351 Bacteria 6615579
2165 3006428717 3006425503 Bacteria 6491253
2166 3006491969 3006486233 Bacteria 8157040
2167 3006500775 3006493962 Bacteria 8825450
2168 637877412 637000116 Bacteria 5433628
2169 649810872 649633069 Bacteria 6962533
2170 8001788181 8001781756 Bacteria 9586736
2171 8002776324 8002775197 Bacteria 10728764
2172 8002784515 8002784119 Bacteria 9788632
2173 8003835786 8003830390 Bacteria 6541657
2174 8003857612 8003856774 Bacteria 7675274
2175 8003878195 8003870546 Bacteria 7396674
2176 8004022429 8004021418 Bacteria 4313954
2177 8008567283 8008558824 Bacteria 10610750
2178 8008578873 8008574985 Bacteria 7815457
2179 8023630165 8023623736 Bacteria 8593882
2180 8025417710 8025413630 Bacteria 7014048
2181 8025480347 8025478263 Bacteria 8209203
2182 8025538022 8025530807 Bacteria 8495698
2183 8045834438 8045830549 Bacteria 4444727
2184 8047714256 8047710418 Bacteria 11023148
2185 8047898090 8047893842 Bacteria 11723082
2186 8048136806 8048127548 Bacteria 11053136
2187 8048360803 8048356638 Bacteria 11044339
2188 8048375053 8048369669 Bacteria 11666822
2189 8048383153 8048379754 Bacteria 11877923
2190 8048412732 8048406513 Bacteria 8936924
2191 8054109716 8054107350 Bacteria 5022511
2192 8054166059 8054160619 Bacteria 7783213
2193 8054609836 8054609563 Bacteria 5170090
2194 8054710070 8054704163 Bacteria 7247792
2195 8054728285 8054727385 Bacteria 7558670
2196 8054735324 8054734606 Bacteria 6947278
2197 8054913814 8054913762 Bacteria 7713009
2198 8054921054 8054920844 Bacteria 7068637
2199 8055161321 8055157932 Bacteria 6429399
2200 8055414138 8055412473 Bacteria 6257500
2201 8056039218 8056037122 Bacteria 3854319
2202 8056057885 8056054917 Bacteria 5736694
2203 8056452984 8056447290 Bacteria 7680491
2204 8056837710 8056829672 Bacteria 9045328
2205 Ga0070658_10003010
2206 LJQas_1001827
2207 JGI24740J21852_10012278
2208 JGI24740J21852_10024718
2209 JGI24739J22299_10004610
2210 JGI24737J22298_10005964
2211 JGI24737J22298_10050458
2212 JGI24735J21928_10005250
2213 JGI24735J21928_10035354
2214 JGI24738J21930_10011549
2215 JGI24738J21930_10020922
2216 JGI25164J39214_1000508
2217 JGI25152J39213_1000323
2218 JGI25406J46586_10006250
2219 JGI25406J46586_10027794
2220 rootH1_10000474
2221 JGI25407J50210_10001412
2222 JGI25407J50210_10007122
2223 Ga0006562J51391_1027612
2224 Ga0006562J51391_1027614
2225 Ga0006562J51391_1047252
2226 Ga0006562J51391_1054242
2227 Ga0006562J51391_1124095
2228 Ga0055539_1000005
2229 Ga0055532_1007097
2230 JGI25405J52794_10017243
2231 Ga0070658_10001049
2232 Ga0070658_10001184
2233 Ga0070658_10001244
2234 Ga0070658_10029880
2235 Ga0070658_10067351
2236 Ga0070658_10077960
2237 Ga0070658_10137783
2238 Ga0070658_10215687
2239 Ga0070676_10036896
2240 Ga0070683_100009639
2241 Ga0070683_100020537
2242 Ga0070683_100022815
2243 Ga0070683_100051863
2244 Ga0070683_100177871
2245 Ga0070683_100410443
2246 Ga0068869_100023696
2247 Ga0068869_100239303
2248 Ga0068869_100310161
2249 Ga0070680_100004871
2250 Ga0070680_100021665
2251 Ga0070680_100102504
2252 Ga0070682_100011844
2253 Ga0070682_100024609
2254 Ga0070682_100139847
2255 Ga0068868_100117287
2256 Ga0070660_100066881
2257 Ga0070660_100187500
2258 Ga0070660_100351238
2259 Ga0070661_100051362
2260 Ga0070661_100086714
2261 Ga0070661_100094069
2262 Ga0070661_100271339
2263 Ga0070692_10025969
2264 Ga0070692_10078446
2265 Ga0070668_100000183
2266 Ga0070675_100001049
2267 Ga0070675_100028678
2268 Ga0070674_100019612
2269 Ga0070674_100136724
2270 Ga0070688_100109479
2271 Ga0070659_100000331
2272 Ga0070659_100007388
2273 Ga0070659_100009022
2274 Ga0070659_100010310
2275 Ga0070659_100076338
2276 Ga0070659_100120684
2277 Ga0070659_100179332
2278 Ga0070667_100002049
2279 Ga0070709_10001322
2280 Ga0070709_10160270
2281 Ga0070709_10191751
2282 Ga0070714_100003654
2283 Ga0070714_100004246
2284 Ga0070714_100016064
2285 Ga0070714_100029830
2286 Ga0070714_100046660
2287 Ga0070714_100059039
2288 Ga0070714_100092360
2289 Ga0070714_100158003
2290 Ga0070714_100356968
2291 Ga0070713_100042937
2292 Ga0070713_100047895
2293 Ga0070713_100139419
2294 Ga0070710_10001003
2295 Ga0070710_10002233
2296 Ga0070710_10002612
2297 Ga0070710_10036922
2298 Ga0070711_100010024
2299 Ga0070711_100064623
2300 Ga0070711_100096095
2301 Ga0070711_100174880
2302 Ga0070700_100005333
2303 Ga0070700_100010186
2304 Ga0070663_100024148
2305 Ga0070663_100040245
2306 Ga0070663_100157716
2307 Ga0070678_100019785
2308 Ga0070678_100140937
2309 Ga0070678_100229439
2310 Ga0070662_100007273
2311 Ga0070662_100015432
2312 Ga0070681_10003004
2313 Ga0070681_10041744
2314 Ga0070681_10043431
2315 Ga0070681_10074174
2316 Ga0068867_100008050
2317 Ga0070706_100004341
2318 Ga0070706_100070700
2319 Ga0070707_100069853
2320 Ga0070707_100178664
2321 Ga0070707_100332979
2322 Ga0070698_100002205
2323 Ga0070698_100010603
2324 Ga0070698_100036593
2325 Ga0070679_100003703
2326 Ga0070679_100012146
2327 Ga0070679_100013183
2328 Ga0070679_100055836
2329 Ga0070679_100087398
2330 Ga0070684_100032029
2331 Ga0070684_100053278
2332 Ga0070684_100067991
2333 Ga0070684_100099709
2334 Ga0070684_100130315
2335 Ga0068853_100064870
2336 Ga0068853_100147353
2337 Ga0070672_100008591
2338 Ga0070695_100005591
2339 Ga0070665_100002967
2340 Ga0070665_100064400
2341 Ga0070665_100101717
2342 Ga0070665_100130858
2343 Ga0070704_100041196
2344 Ga0068855_100001428
2345 Ga0068855_100079030
2346 Ga0070664_100023722
2347 Ga0068857_100007045
2348 Ga0068857_100013000
2349 Ga0068857_100187880
2350 Ga0068857_100207577
2351 Ga0068854_100015333
2352 Ga0068856_100076027
2353 Ga0068856_100197911
2354 Ga0070702_100004888
2355 Ga0068852_100020429
2356 Ga0068859_100000067
2357 Ga0068859_100039334
2358 Ga0068859_100047695
2359 Ga0068859_100350487
2360 Ga0068861_100029657
2361 Ga0068861_100102696
2362 Ga0068861_100118255
2363 Ga0068851_10000025
2364 Ga0068870_10036993
2365 Ga0068863_100004056
2366 Ga0068863_100024933
2367 Ga0068863_100224579
2368 Ga0068863_100247885
2369 Ga0068858_100000001
2370 Ga0068858_100000073
2371 Ga0068858_100022212
2372 Ga0068860_100000160
2373 Ga0068860_100185576
2374 Ga0068860_100379660
2375 Ga0068862_100000061
2376 Ga0068862_100000131
2377 Ga0081455_10000159
2378 Ga0081455_10001413
2379 Ga0081455_10003874
2380 Ga0081455_10006383
2381 Ga0081455_10020441
2382 Ga0081455_10020874
2383 Ga0081455_10043153
2384 Ga0081455_10043453
2385 Ga0081455_10103941
2386 Ga0081455_10126898
2387 Ga0081538_10001163
2388 Ga0081538_10001523
2389 Ga0081538_10002152
2390 Ga0081538_10007077
2391 Ga0081538_10035352
2392 Ga0081538_10044152
2393 Ga0081540_1002855
2394 Ga0081540_1030633
2395 Ga0081540_1039207
2396 Ga0081539_10000205
2397 Ga0081539_10001811
2398 Ga0081539_10003373
2399 Ga0081539_10003816
2400 Ga0081539_10008555
2401 Ga0081539_10009590
2402 Ga0081539_10036960
2403 Ga0070717_10012997
2404 Ga0070717_10016221
2405 Ga0070717_10033577
2406 Ga0070717_10198024
2407 Ga0075365_10000486
2408 Ga0075365_10014721
2409 Ga0075365_10033347
2410 Ga0075365_10034752
2411 Ga0075365_10056700
2412 Ga0075365_10056989
2413 Ga0075365_10062852
2414 Ga0075365_10129814
2415 Ga0075368_10000878
2416 Ga0075363_100008537
2417 Ga0075363_100012931
2418 Ga0075363_100023615
2419 Ga0075363_100043142
2420 Ga0075363_100104540
2421 Ga0075363_100105059
2422 Ga0075363_100111867
2423 Ga0075364_10001480
2424 Ga0075364_10002322
2425 Ga0075364_10004050
2426 Ga0075364_10011600
2427 Ga0075432_10002641
2428 Ga0070716_100000703
2429 Ga0070716_100006125
2430 Ga0070712_100002734
2431 Ga0070712_100320632
2432 Ga0075362_10000684
2433 Ga0075367_10006299
2434 Ga0075367_10009909
2435 Ga0075367_10050343
2436 Ga0075367_10059194
2437 Ga0075367_10074734
2438 Ga0075367_10093752
2439 Ga0075369_10009130
2440 Ga0075370_10007490
2441 Ga0075370_10007584
2442 Ga0075428_100000389
2443 Ga0075428_100004341
2444 Ga0075428_100007979
2445 Ga0075428_100011245
2446 Ga0075428_100021756
2447 Ga0075428_100316310
2448 Ga0075430_100010091
2449 Ga0075430_100012981
2450 Ga0075430_100015263
2451 Ga0075430_100091383
2452 Ga0075431_100004396
2453 Ga0075431_100006800
2454 Ga0075431_100009948
2455 Ga0075431_100018477
2456 Ga0075431_100020488
2457 Ga0075431_100026181
2458 Ga0075431_100047653
2459 Ga0075431_100366333
2460 Ga0075431_100451928
2461 Ga0075433_10020188
2462 Ga0075434_100038493
2463 Ga0075429_100000908
2464 Ga0075429_100013442
2465 Ga0075429_100017753
2466 Ga0075429_100096524
2467 Ga0075429_100188247
2468 Ga0068865_100018317
2469 Ga0075436_100030029
2470 Ga0097620_100000067
2471 Ga0097620_100039334
2472 Ga0097620_100047694
2473 Ga0097620_100350465
2474 Ga0075435_100004795
2475 Ga0075435_100048185
2476 Ga0075435_100185124
2477 Ga0105251_10003753
2478 Ga0105251_10003783
2479 Ga0105244_10001928
2480 Ga0105244_10012472
2481 Ga0105250_10043082
2482 Ga0105240_10042031
2483 Ga0111539_10005032
2484 Ga0111539_10005100
2485 Ga0111539_10010425
2486 Ga0111539_10017829
2487 Ga0111539_10110689
2488 Ga0111539_10348652
2489 Ga0105245_10004977
2490 Ga0105245_10006307
2491 Ga0105245_10067457
2492 Ga0105245_10107343
2493 Ga0105245_10172357
2494 Ga0105245_10178526
2495 Ga0105245_10200160
2496 Ga0105247_10000024
2497 Ga0105247_10000078
2498 Ga0105247_10009918
2499 Ga0105247_10076014
2500 Ga0114129_10000039
2501 Ga0114129_10000131
2502 Ga0114129_10000932
2503 Ga0114129_10002109
2504 Ga0114129_10048876
2505 Ga0114129_10281097
2506 Ga0114129_10336013
2507 Ga0105243_10029942
2508 Ga0105243_10036949
2509 Ga0105243_10040731
2510 Ga0105243_10072185
2511 Ga0105243_10396929
2512 Ga0105241_10021369
2513 Ga0105242_10041626
2514 Ga0105248_10000055
2515 Ga0105248_10000082
2516 Ga0105248_10000529
2517 Ga0105248_10004955
2518 Ga0105248_10009087
2519 Ga0105248_10019185
2520 Ga0105248_10165622
2521 Ga0105248_10623057
2522 Ga0105237_10000308
2523 Ga0105237_10016427
2524 Ga0105238_10008834
2525 Ga0105238_10369110
2526 Ga0105249_10000031
2527 Ga0105249_10001144
2528 Ga0105249_10018272
2529 Ga0105249_10136450
2530 Ga0105249_10164022
2531 Ga0105239_10007263
2532 Ga0105239_10008306
2533 Ga0105239_10118655
2534 Ga0105239_10433460
2535 Ga0105246_10001132
2536 Ga0105246_10002305
2537 Ga0105246_10002378
2538 Ga0105246_10032742
2539 Ga0105246_10034427
2540 Ga0105246_10187408
2541 Ga0157371_10027112
2542 Ga0157370_10025167
2543 Ga0157370_10026798
2544 Ga0157370_10139184
2545 Ga0157369_10000422
2546 Ga0157369_10001067
2547 Ga0157369_10001126
2548 Ga0157369_10006480
2549 Ga0157369_10028541
2550 Ga0157369_10038886
2551 Ga0157369_10045621
2552 Ga0157369_10052990
2553 Ga0157369_10082912
2554 Ga0157369_10154305
2555 Ga0157369_10177108
2556 Ga0171462_1004
2557 Ga0157374_10424739
2558 Ga0163162_10022417
2559 Ga0163162_10055426
2560 Ga0163162_10108128
2561 Ga0157372_10003775
2562 Ga0157372_10073291
2563 Ga0157372_10094569
2564 Ga0157372_10121930
2565 Ga0157372_10202469
2566 Ga0157372_10289668
2567 Ga0157372_10426996
2568 Ga0157375_10004628
2569 Ga0157375_10028843
2570 Ga0157375_10109120
2571 Ga0157375_10185198
2572 Ga0157375_10195676
2573 Ga0157375_10361725
2574 Ga0163163_10014442
2575 Ga0163163_10032958
2576 Ga0163163_10112269
2577 Ga0163163_10141673
2578 Ga0163163_10471369
2579 Ga0157380_10117172
2580 Ga0182008_10041266
2581 Ga0182008_10050302
2582 Ga0157377_10012796
2583 Ga0157377_10044816
2584 Ga0157379_10000059
2585 Ga0157379_10000289
2586 Ga0157379_10002960
2587 Ga0157379_10012749
2588 Ga0182007_10031963
2589 Ga0182007_10038282
2590 Ga0163161_10037148
2591 Ga0197907_10031078
2592 Ga0197907_10410903
2593 Ga0206356_10755570
2594 Ga0206356_11644942
2595 Ga0206351_10447535
2596 Ga0206350_10967704
2597 Ga0206354_10323126
2598 Ga0206354_10773930
2599 Ga0206354_10785617
2600 Ga0206354_11275952
2601 Ga0206354_11281303
2602 Ga0206353_10110127
2603 Ga0206353_10404455
2604 Ga0206353_10623844
2605 Ga0206353_10717728
2606 Ga0206353_11446185
2607 Ga0206353_11629272
2608 Ga0206353_12032015
2609 Ga0213876_10015875
2610 Ga0213876_10032087
2611 Ga0213875_10009163
2612 Ga0213875_10009179
2613 Ga0213875_10016007
2614 Ga0213875_10030369
2615 Ga0224712_10001604
2616 Ga0224712_10016756
2617 Ga0209563_100349
2618 Ga0209129_1000109
2619 Ga0209025_1000984
2620 Ga0207426_1017639
2621 Ga0209051_1001258
2622 Ga0207697_10004003
2623 Ga0207656_10000001
2624 Ga0207696_1018500
2625 Ga0207655_1008569
2626 Ga0207655_1008906
2627 Ga0207655_1022210
2628 Ga0207713_1029743
2629 Ga0207682_10005812
2630 Ga0207692_10000890
2631 Ga0207692_10002582
2632 Ga0207692_10004306
2633 Ga0207642_10038384
2634 Ga0207710_10000022
2635 Ga0207710_10000045
2636 Ga0207710_10000249
2637 Ga0207710_10060310
2638 Ga0207688_10008035
2639 Ga0207647_10018358
2640 Ga0207647_10031102
2641 Ga0207647_10038168
2642 Ga0207685_10102201
2643 Ga0207699_10000452
2644 Ga0207699_10018969
2645 Ga0207699_10063482
2646 Ga0207699_10113570
2647 Ga0207645_10000233
2648 Ga0207645_10030709
2649 Ga0207643_10005573
2650 Ga0207705_10001165
2651 Ga0207705_10002204
2652 Ga0207705_10008166
2653 Ga0207705_10137202
2654 Ga0207684_10026114
2655 Ga0207654_10011007
2656 Ga0207707_10000376
2657 Ga0207707_10010705
2658 Ga0207707_10054680
2659 Ga0207707_10056837
2660 Ga0207695_10005783
2661 Ga0207695_10216505
2662 Ga0207671_10000001
2663 Ga0207671_10000216
2664 Ga0207671_10007161
2665 Ga0207693_10000318
2666 Ga0207693_10002107
2667 Ga0207693_10009636
2668 Ga0207693_10169868
2669 Ga0207663_10136242
2670 Ga0207663_10177271
2671 Ga0207663_10260913
2672 Ga0207660_10000754
2673 Ga0207660_10017022
2674 Ga0207660_10071902
2675 Ga0207660_10243374
2676 Ga0207662_10011022
2677 Ga0207657_10001578
2678 Ga0207657_10025004
2679 Ga0207657_10049197
2680 Ga0207657_10072049
2681 Ga0207657_10133726
2682 Ga0207649_10006873
2683 Ga0207652_10000591
2684 Ga0207652_10004252
2685 Ga0207652_10032574
2686 Ga0207652_10067633
2687 Ga0207652_10119121
2688 Ga0207652_10202293
2689 Ga0207646_10437409
2690 Ga0207681_10004026
2691 Ga0207694_10000052
2692 Ga0207694_10002482
2693 Ga0207694_10334333
2694 Ga0207650_10143136
2695 Ga0207659_10021801
2696 Ga0207659_10023126
2697 Ga0207687_10015080
2698 Ga0207687_10055033
2699 Ga0207687_10127963
2700 Ga0207687_10152794
2701 Ga0207700_10000250
2702 Ga0207700_10006774
2703 Ga0207700_10017655
2704 Ga0207700_10055708
2705 Ga0207700_10235875
2706 Ga0207664_10003365
2707 Ga0207664_10010336
2708 Ga0207664_10047601
2709 Ga0207664_10054835
2710 Ga0207664_10061277
2711 Ga0207664_10096040
2712 Ga0207664_10125022
2713 Ga0207664_10255118
2714 Ga0207664_10350152
2715 Ga0207644_10026394
2716 Ga0207690_10057057
2717 Ga0207706_10031749
2718 Ga0207706_10079844
2719 Ga0207709_10008158
2720 Ga0207709_10025391
2721 Ga0207709_10107809
2722 Ga0207669_10004037
2723 Ga0207669_10086815
2724 Ga0207669_10105698
2725 Ga0207704_10102974
2726 Ga0207665_10006709
2727 Ga0207665_10017534
2728 Ga0207665_10102803
2729 Ga0207691_10008796
2730 Ga0207691_10015983
2731 Ga0207691_10106923
2732 Ga0207691_10160805
2733 Ga0207711_10000030
2734 Ga0207711_10000537
2735 Ga0207711_10000984
2736 Ga0207711_10143468
2737 Ga0207711_10180524
2738 Ga0207711_10185668
2739 Ga0207689_10005246
2740 Ga0207689_10015663
2741 Ga0207689_10225787
2742 Ga0207661_10049543
2743 Ga0207661_10065411
2744 Ga0207661_10108019
2745 Ga0207661_10268776
2746 Ga0207661_10312331
2747 Ga0207679_10005355
2748 Ga0207667_10140104
2749 Ga0207712_10000029
2750 Ga0207712_10166044
2751 Ga0207668_10000831
2752 Ga0207640_10097971
2753 Ga0207658_10001194
2754 Ga0207677_10004264
2755 Ga0207677_10084079
2756 Ga0207703_10000007
2757 Ga0207703_10000025
2758 Ga0207703_10027058
2759 Ga0207703_10113321
2760 Ga0207703_10158718
2761 Ga0207703_10223235
2762 Ga0207639_10111830
2763 Ga0207678_10006441
2764 Ga0207678_10046758
2765 Ga0207708_10001321
2766 Ga0207702_10065625
2767 Ga0207702_10068786
2768 Ga0207702_10252232
2769 Ga0207641_10003684
2770 Ga0207641_10097909
2771 Ga0207648_10007694
2772 Ga0207676_10208312
2773 Ga0207674_10006951
2774 Ga0207674_10009685
2775 Ga0207674_10015743
2776 Ga0207674_10074159
2777 Ga0207675_100004867
2778 Ga0207675_100025855
2779 Ga0207675_100028903
2780 Ga0207675_100094919
2781 Ga0207675_100169101
2782 Ga0207683_10021922
2783 Ga0207683_10024767
2784 Ga0207683_10116141
2785 Ga0207683_10136562
2786 Ga0207683_10155475
2787 Ga0207698_10002488
2788 Ga0209813_10011294
2789 Ga0209813_10017570
2790 Ga0207428_10001881
2791 Ga0207428_10007432
2792 Ga0207428_10011894
2793 Ga0207428_10059544
2794 Ga0268266_10003905
2795 Ga0268266_10028674
2796 Ga0268266_10111773
2797 Ga0268266_10406801
2798 Ga0268265_10000040
2799 Ga0268265_10000721
2800 Ga0268264_10000017
2801 Ga0268264_10280490
2802 Ga0265337_1000015
2803 Ga0265326_10006985
2804 Ga0265319_1003575
2805 Ga0265334_10000328
2806 Ga0265334_10002545
2807 Ga0265318_10004466
2808 Ga0265318_10025592
2809 Ga0265318_10049013
2810 Ga0265323_10028082
2811 Ga0265322_10020887
2812 Ga0265336_10018156
2813 Ga0307517_10089007
2814 Ga0307515_10000379
2815 Ga0307515_10000732
2816 Ga0307515_10033054
2817 Ga0307515_10038784
2818 Ga0307515_10221688
2819 Ga0265338_10000073
2820 Ga0265338_10000767
2821 Ga0265338_10005370
2822 Ga0265338_10008838
2823 Ga0265338_10029943
2824 Ga0265324_10006721
2825 Ga0307511_10002182
2826 Ga0307511_10070493
2827 Ga0307512_10003334
2828 Ga0307512_10005672
2829 Ga0307512_10009307
2830 Ga0307512_10017588
2831 Ga0316181_1197229
2832 Ga0265320_10005644
2833 Ga0265320_10006011
2834 Ga0265320_10008148
2835 Ga0265325_10001073
2836 Ga0265325_10022527
2837 Ga0265325_10024264
2838 Ga0265340_10000565
2839 Ga0265340_10002581
2840 Ga0265339_10002688
2841 Ga0265339_10009462
2842 Ga0265339_10033756
2843 Ga0265339_10076679
2844 Ga0265327_10000001
2845 Ga0265327_10001602
2846 Ga0265327_10017868
2847 Ga0265327_10028282
2848 Ga0265327_10039390
2849 Ga0265316_10029288
2850 Ga0265316_10048500
2851 Ga0307513_10000163
2852 Ga0307513_10002467
2853 Ga0307513_10009749
2854 Ga0307513_10012802
2855 Ga0307509_10004994
2856 Ga0307509_10033071
2857 Ga0307509_10059047
2858 Ga0307509_10124736
2859 Ga0307408_100004432
2860 Ga0307408_100005591
2861 Ga0307408_100008967
2862 Ga0307408_100010273
2863 Ga0307408_100012300
2864 Ga0307408_100014274
2865 Ga0307408_100071569
2866 Ga0307408_100101821
2867 Ga0307408_100103867
2868 Ga0307408_100114861
2869 Ga0307408_100160846
2870 Ga0307408_100201203
2871 Ga0265313_10000614
2872 Ga0265313_10028421
2873 Ga0307508_10002053
2874 Ga0307508_10005976
2875 Ga0307508_10018562
2876 Ga0307508_10094044
2877 Ga0307508_10118451
2878 Ga0307508_10267593
2879 Ga0307514_10001479
2880 Ga0307514_10008804
2881 Ga0307514_10016383
2882 Ga0307514_10113967
2883 Ga0316575_10001935
2884 Ga0316579_10000014
2885 Ga0316579_10020088
2886 Ga0265314_10008595
2887 Ga0265314_10020900
2888 Ga0265314_10066870
2889 Ga0265314_10132830
2890 Ga0316576_10022075
2891 Ga0316576_10032808
2892 Ga0316576_10035603
2893 Ga0316576_10070794
2894 Ga0316578_10016176
2895 Ga0316578_10030439
2896 Ga0307516_10001135
2897 Ga0307516_10002744
2898 Ga0307516_10041766
2899 Ga0307516_10107073
2900 Ga0307516_10252112
2901 Ga0307405_10001947
2902 Ga0307405_10005216
2903 Ga0307405_10005302
2904 Ga0307405_10006582
2905 Ga0307405_10021603
2906 Ga0307405_10061224
2907 Ga0307405_10120277
2908 Ga0307405_10152741
2909 Ga0307405_10161919
2910 Ga0307405_10292523
2911 Ga0307413_10012984
2912 Ga0307413_10022081
2913 Ga0307413_10029042
2914 Ga0307413_10049993
2915 Ga0307413_10132963
2916 Ga0307518_10061743
2917 Ga0307518_10127406
2918 Ga0307410_10003801
2919 Ga0307410_10018295
2920 Ga0307410_10080922
2921 Ga0307410_10098137
2922 Ga0307410_10143926
2923 Ga0307410_10155511
2924 Ga0307410_10169418
2925 Ga0307410_10210374
2926 Ga0307406_10009972
2927 Ga0307406_10035665
2928 Ga0307406_10037822
2929 Ga0307406_10075745
2930 Ga0307406_10111177
2931 Ga0307406_10113333
2932 Ga0307406_10138700
2933 Ga0307407_10005551
2934 Ga0307407_10011209
2935 Ga0307407_10013075
2936 Ga0307407_10014581
2937 Ga0307407_10035385
2938 Ga0307407_10064675
2939 Ga0307407_10067269
2940 Ga0307407_10099217
2941 Ga0307412_10005441
2942 Ga0307412_10005716
2943 Ga0307412_10020334
2944 Ga0307412_10027769
2945 Ga0307412_10029316
2946 Ga0307412_10032183
2947 Ga0307412_10057012
2948 Ga0307412_10057960
2949 Ga0307412_10103586
2950 Ga0307409_100000140
2951 Ga0307409_100005261
2952 Ga0307409_100015896
2953 Ga0307409_100037172
2954 Ga0307409_100081305
2955 Ga0307409_100084689
2956 Ga0307409_100085190
2957 Ga0307409_100091261
2958 Ga0307409_100096551
2959 Ga0307409_100178908
2960 Ga0307409_100183742
2961 Ga0307409_100203331
2962 Ga0307409_100223510
2963 Ga0307409_100254517
2964 Ga0307409_100294322
2965 Ga0307416_100001123
2966 Ga0307416_100002858
2967 Ga0307416_100003603
2968 Ga0307416_100030957
2969 Ga0307416_100037482
2970 Ga0307416_100050843
2971 Ga0307416_100055353
2972 Ga0307416_100065276
2973 Ga0307416_100066740
2974 Ga0307416_100106711
2975 Ga0307416_100115802
2976 Ga0307416_100116160
2977 Ga0307416_100320722
2978 Ga0307416_100354412
2979 Ga0307416_100370165
2980 Ga0307414_10001749
2981 Ga0307414_10044902
2982 Ga0307414_10070104
2983 Ga0307411_10054147
2984 Ga0307411_10121065
2985 Ga0307411_10314945
2986 Ga0307415_100000073
2987 Ga0307415_100001231
2988 Ga0307415_100011722
2989 Ga0307415_100015593
2990 Ga0307415_100046044
2991 Ga0307415_100054609
2992 Ga0307415_100061596
2993 Ga0307415_100063772
2994 Ga0307415_100079489
2995 Ga0307415_100086248
2996 Ga0307415_100089877
2997 Ga0307415_100129330
2998 Ga0307415_100157080
2999 Ga0307415_100160213
3000 Ga0307415_100173232
3001 Ga0307415_100196181
3002 Ga0307415_100242207
3003 Ga0316580_10001252
3004 Ga0307507_10000013
3005 Ga0307507_10024103
3006 Ga0307507_10029206
3007 Ga0307507_10062771
3008 Ga0307510_10073722
3009 Ga0307510_10074879
3010 Ga0307510_10102648
3011 Ga0373934_0020232
3012 Ga0373940_0005350
3013 Ga0373951_0000188
3014 Ga0373923_0025570
3015 Ga0373932_0034304
3016 Ga0373936_0003793
3017 Ga0373936_0041009
3018 Ga0373953_0037406
3019 Ga0373956_0007853
3020 Ga0373957_0001687
3021 Ga0373957_0010148
3022 Ga0373955_0017592
3023 Ga0373942_0000142
3024 Ga0373962_0001245
3025 Ga0316574_0001220
3026 Ga0316574_0006452
3027 Ga0316574_0088238
3028 Ga0316574_0155552
3029 Ga0316574_0163800
3030 Ga0373924_0001204
3031 Ga0373924_0002400
3032 Ga0373924_0145237
3033 Ga0373931_0000119
3034 Ga0373931_0126712
3035 Ga0373935_0015724
3036 Ga0373935_0041638
3037 Ga0373935_0175000
3038 Ga0373935_0181124
3039 Ga0373933_0003781
3040 Ga0373933_0008354
3041 Ga0373933_0032470
3042 Ga0373937_0027530
3043 Ga0373937_0046609
3044 Ga0373937_0073144
3045 Ga0373937_0155014
3046 Ga0316582_0011020
3047 Ga0316582_0034025
3048 Ga0316582_0138888
3049 Ga0316584_0000612
3050 Ga0316584_0011150
3051 Ga0316584_0045363
3052 Ga0316584_0153131
3053 Ga0316584_0235173
3054 Ga0373925_0000006
3055 Ga0373925_0067135
3056 Ga0395899_0001199
3057 Ga0395899_0100480
3058 Ga0395899_0113067
3059 Ga0395900_0007242
3060 Ga0395900_0012677
3061 Ga0395900_0042137
3062 Ga0395900_0058323
3063 Ga0395900_0118148
3064 Ga0395900_0127319
3065 Ga0395900_0137145
3066 Ga0395900_0196973
3067 Ga0395900_0258675
3068 Ga0395900_0396075
3069 Ga0395900_0439259
3070 Ga0395898_0000256
3071 Ga0395898_0001516
3072 Ga0395898_0011157
3073 Ga0395898_0014066
3074 Ga0395898_0016808
3075 Ga0395898_0023381
3076 Ga0395898_0036404
3077 Ga0395898_0040985
3078 Ga0395898_0107358
3079 Ga0395898_0110750
3080 Ga0395898_0140127
3081 Ga0395905_0250772
3082 Ga0395905_0275209
3083 Ga0436364_0053804
3084 Ga0436364_0445774
3085 Ga0436364_0497556
3086 Ga0436364_0675155
3087 Ga0436364_1106417
3088 Ga0436364_1149812
3089 Ga0436364_1484307
3090 Ga0395901_0012535
3091 Ga0395901_0016431
3092 Ga0395901_0039183
3093 Ga0395901_0042568
3094 Ga0395901_0051841
3095 Ga0395901_0065461
3096 Ga0395901_0117736
3097 Ga0395901_0215491
3098 Ga0395901_0344436
3099 Ga0395901_0360429
3100 Ga0400485_14323
3101 Ga0400488_04969
3102 Ga0400486_06112
3103 Ga0400483_078666
3104 Ga0400483_237273
3105 Ga0436365_0562669
3106 Ga0436365_0726960
3107 Ga0436365_0934847
3108 Ga0436365_1425629
3109 Ga0436365_1765450
3110 Ga0436360_0336736
3111 Ga0436361_0647809
3112 Ga0436363_0456998
3113 Ga0436363_1147919
3114 Ga0436362_0329220
3115 Ga0436362_0334792
3116 Ga0439436_0001406
3117 Ga0439436_0003882
3118 Ga0439436_0007177
3119 Ga0439438_009258
3120 Ga0439439_0000608
3121 Ga0439439_0001403
3122 Ga0439439_0020682
3123 Ga0439461_0022381
3124 Ga0439466_0013894
3125 Ga0439466_0015547
3126 Ga0439465_0024574
3127 Ga0451797_0576558
3128 Ga0451853_0524125
3129 Ga0439431_0001082
3130 Ga0439433_0000011
3131 Ga0439433_0001106
3132 Ga0439433_0002150
3133 Ga0439442_000100
3134 Ga0439442_000105
3135 Ga0439442_009117
3136 Ga0439448_0001623
3137 Ga0439448_0013630
3138 Ga0439448_0025926
3139 Ga0439432_000499
3140 Ga0439449_0001339
3141 Ga0439449_0001769
3142 Ga0439449_0005285
3143 Ga0439449_0008539
3144 Ga0439449_0028145
3145 Ga0439449_0036603
3146 Ga0439449_0046534
3147 Ga0439450_001186
3148 Ga0439450_003476
3149 Ga0439452_002706
3150 Ga0439455_0000986
3151 Ga0439457_000166
3152 Ga0439457_001067
3153 Ga0439457_012975
3154 Ga0439462_0014847
3155 Ga0439463_000211
3156 Ga0439463_001385
3157 Ga0439463_003518
3158 Ga0450911_003799
3159 Ga0450913_000164
3160 Ga0450919_000414
3161 Ga0450920_004056
3162 Ga0450920_009768
3163 Ga0450894_001280
3164 Ga0450898_011488
3165 Ga0450899_001054
3166 Ga0450903_002809
3167 Ga0450907_000086
3168 Ga0450907_003667
3169 Ga0439446_0007643
3170 Ga0439458_0004260
3171 Ga0439458_0030079
3172 Ga0450909_000097
3173 Ga0439434_0003039
3174 Ga0439434_0006572
3175 Ga0439434_0006796
3176 Ga0439434_0013656
3177 Ga0439434_0015655
3178 Ga0439435_0002840
3179 Ga0439464_0000089
3180 Ga0439460_0001743
3181 Ga0450918_004987
3182 Ga0439440_0000033
3183 Ga0466969_0013288
3184 Ga0466969_0021485
3185 Ga0466969_0037244
3186 Ga0466972_0005469
3187 Ga0466972_0026235
3188 Ga0466972_0111265
3189 Ga0466965_0000001
3190 Ga0466965_0056046
3191 Ga0466965_0070489
3192 Ga0466965_0108721
3193 Ga0466966_0001229
3194 Ga0466966_0002669
3195 Ga0466966_0010569
3196 Ga0466966_0039987
3197 Ga0466966_0084173
3198 Ga0466966_0092457
3199 Ga0466966_0104143
3200 Ga0466966_0110201
3201 Ga0466961_0000334
3202 Ga0466961_0002146
3203 Ga0466961_0018302
3204 Ga0466961_0018600
3205 Ga0466961_0041665
3206 Ga0466961_0057149
3207 Ga0466961_0098614
3208 Ga0466961_0155367
3209 Ga0466963_0000113
3210 Ga0466963_0032072
3211 Ga0466963_0041053
3212 Ga0466963_0044903
3213 Ga0466963_0063551
3214 Ga0466963_0069693
3215 Ga0466963_0116491
3216 Ga0466963_0127713
3217 Ga0466963_0151374
3218 Ga0466964_0003680
3219 Ga0466964_0019823
3220 Ga0466964_0069955
3221 Ga0466971_0000604
3222 Ga0466971_0028490
3223 Ga0466971_0060763
3224 Ga0466968_0009794
3225 Ga0466968_0009975
3226 Ga0466970_0004815
3227 Ga0466970_0005522
3228 Ga0466970_0005582
3229 Ga0466970_0028303
3230 Ga0466970_0050345
3231 Ga0466957_0003322
3232 Ga0466957_0005112
3233 Ga0466957_0031622
3234 Ga0466957_0058297
3235 Ga0466957_0145264
3236 Ga0466960_0003005
3237 Ga0466960_0008168
3238 Ga0466960_0016591
3239 Ga0466960_0020405
3240 Ga0466960_0048394
3241 Ga0466959_0000927
3242 Ga0466959_0001283
3243 Ga0466959_0001538
3244 Ga0466959_0002972
3245 Ga0466959_0010248
3246 Ga0466959_0019337
3247 Ga0466959_0025712
3248 Ga0466959_0059395
3249 Ga0466959_0073850
3250 Ga0466959_0125754
3251 Ga0466959_0164472
3252 Ga0451576_0158695
3253 Ga0466958_0001093
3254 Ga0466958_0009620
3255 Ga0466958_0010518
3256 Ga0466958_0012195
3257 Ga0466958_0016297
3258 Ga0466958_0022265
3259 Ga0466958_0045290
3260 Ga0466958_0045776
3261 Ga0466967_0007780
3262 Ga0466967_0008112
3263 Ga0466967_0010829
3264 Ga0466967_0014774
3265 Ga0466967_0031412
3266 Ga0466967_0033743
3267 Ga0466967_0036626
3268 Ga0466967_0049506
3269 Ga0466967_0072987
3270 Ga0466967_0132887
3271 Ga0466967_0226686
3272 Ga0466967_0259780
3273 Ga0466967_0386883
3274 Ga0466967_0514827
3275 Ga0495617_021032
3276 Ga0495627_012192
3277 Ga0495592_0058887
3278 Ga0495592_0078800
3279 Ga0495592_0120905
3280 Ga0495603_0001591
3281 Ga0495603_0029411
3282 Ga0495603_0093844
3283 Ga0495603_0128588
3284 Ga0495603_0152818
3285 Ga0495629_0000933
3286 Ga0495629_0018469
3287 Ga0495629_0018510
3288 Ga0495629_0020144
3289 Ga0495629_0036281
3290 Ga0495629_0063068
3291 Ga0495629_0248485
3292 Ga0495641_0002845
3293 Ga0495641_0006228
3294 Ga0495651_0019189
3295 Ga0495651_0023476
3296 Ga0495651_0075302
3297 Ga0495653_0043766
3298 Ga0495653_0045307
3299 Ga0495653_0052061
3300 Ga0495653_0085760
3301 Ga0495580_0001823
3302 Ga0495580_0019335
3303 Ga0495582_0001683
3304 Ga0495582_0008683
3305 Ga0495582_0080414
3306 Ga0495639_0004885
3307 Ga0495662_0000168
3308 Ga0495662_0000230
3309 Ga0495662_0009153
3310 Ga0495662_0010114
3311 Ga0495662_0010703
3312 Ga0495664_0001164
3313 Ga0495664_0003063
3314 Ga0495664_0003236
3315 Ga0495664_0011791
3316 Ga0495664_0166029
3317 Ga0495585_0005641
3318 Ga0495594_0000836
3319 Ga0495594_0003472
3320 Ga0495594_0052174
3321 Ga0495594_0117460
3322 Ga0495594_0119449
3323 Ga0495606_0002906
3324 Ga0495606_0003739
3325 Ga0495608_0008718
3326 Ga0495608_0019074
3327 Ga0495608_0149266
3328 Ga0495608_0196197
3329 Ga0495616_0064235
3330 Ga0495618_0039495
3331 Ga0495618_0127142
3332 Ga0495618_0131554
3333 Ga0495618_0170009
3334 Ga0495620_0014258
3335 Ga0495628_0025612
3336 Ga0495628_0027557
3337 Ga0495628_0029006
3338 Ga0495628_0083316
3339 Ga0495628_0089084
3340 Ga0495628_0109685
3341 Ga0495630_0118656
3342 Ga0495630_0138202
3343 Ga0495630_0239350
3344 Ga0495631_0020150
3345 Ga0495632_0105041
3346 Ga0495643_0046165
3347 Ga0495643_0056340
3348 Ga0495666_0011813
3349 Ga0495666_0077705
3350 Ga0495642_0029792
3351 Ga0495642_0031202
3352 Ga0495642_0031540
3353 Ga0495652_0003119
3354 Ga0495652_0027169
3355 Ga0495652_0032257
3356 Ga0495652_0075686
3357 Ga0495652_0130715
3358 Ga0495665_0002144
3359 Ga0495665_0012658
3360 Ga0495665_0023899
3361 Ga0495640_0014350
3362 Ga0495640_0017751
3363 Ga0495640_0059064
3364 Ga0495640_0061264
3365 Ga0495640_0087230
3366 Ga0495640_0087990
3367 Ga0495586_0003443
3368 Ga0495586_0022779
3369 Ga0495586_0036162
3370 Ga0495586_0058186
3371 Ga0495587_0005854
3372 Ga0495645_0012568
3373 Ga0495645_0021786
3374 Ga0495645_0086876
3375 Ga0495622_0005909
3376 Ga0495633_0005618
3377 Ga0495633_0022654
3378 Ga0495667_0006867
3379 Ga0495667_0049798
3380 Ga0495656_0012363
3381 Ga0495656_0036089
3382 Ga0495656_0092790
3383 Ga0495668_0000400
3384 Ga0495634_0004689
3385 Ga0495634_0009795
3386 Ga0495634_0043471
3387 Ga0495634_0131223
3388 Ga0495611_0028000
3389 Ga0495611_0051654
3390 Ga0495611_0066514
3391 Ga0495625_0002415
3392 Ga0495625_0007523
3393 Ga0495625_0038110
3394 Ga0495635_0000946
3395 Ga0495635_0009366
3396 Ga0495635_0075979
3397 Ga0495659_0082898
3398 Ga0495588_0018738
3399 Ga0495657_0002272
3400 Ga0495657_0003402
3401 Ga0495657_0011090
3402 Ga0495657_0047966
3403 Ga0495657_0050481
3404 Ga0495657_0061205
3405 Ga0495657_0089029
3406 Ga0495599_0006012
3407 Ga0495599_0159504
3408 Ga0495623_0012392
3409 Ga0495623_0033976
3410 Ga0495623_0063999
3411 Ga0495623_0170727
3412 Ga0495646_0000452
3413 Ga0495646_0007858
3414 Ga0495646_0009781
3415 Ga0495646_0052952
3416 Ga0495658_0007916
3417 Ga0495658_0039943
3418 Ga0495658_0087409
3419 Ga0495669_0016059
3420 Ga0495613_0003768
3421 Ga0495613_0017034
3422 Ga0495613_0018725
3423 Ga0495613_0186604
3424 Ga0495613_0202364
3425 Ga0495613_0252674
3426 Ga0495624_0008540
3427 Ga0495624_0015418
3428 Ga0495624_0068748
3429 Ga0495670_0002199
3430 Ga0495670_0002991
3431 Ga0495670_0077290
3432 Ga0495671_0049179
3433 Ga0495649_0025282
3434 Ga0495600_0013854
3435 Ga0495600_0033692
3436 Ga0495600_0073128
3437 Ga0495600_0112736
3438 Ga0495660_0053234
3439 Ga0495581_0002512
3440 Ga0495581_0004308
3441 Ga0495581_0032992
3442 Ga0495581_0058657
3443 Ga0495581_0098816
3444 Ga0495581_0138701
3445 Ga0495604_0001416
3446 Ga0495604_0002144
3447 Ga0495604_0005831
3448 Ga0495604_0014230
3449 Ga0495604_0165146
3450 Ga0495604_0192660
3451 Ga0495604_0201614
3452 Ga0495636_0002818
3453 Ga0495636_0061648
3454 Ga0495636_0079384
3455 Ga0495674_0018315
3456 Ga0495674_0061308
3457 Ga0495674_0102820
3458 Ga0495674_0156660
3459 Ga0495674_0192739
3460 Ga0495672_0004785
3461 Ga0495676_0023788
3462 Ga0495676_0072221
3463 Ga0495680_0006764
3464 Ga0495680_0011844
3465 Ga0495680_0017348
3466 Ga0495680_0022079
3467 Ga0495680_0026856
3468 Ga0495680_0213611
3469 Ga0495683_0023977
3470 Ga0495683_0045786
3471 Ga0495683_0053704
3472 Ga0495687_002815
3473 Ga0495687_006848
3474 Ga0495675_0002889
3475 Ga0495675_0004974
3476 Ga0495675_0006351
3477 Ga0495675_0014687
3478 Ga0495675_0021343
3479 Ga0495675_0023645
3480 Ga0495675_0046692
3481 Ga0495685_000982
3482 Ga0495685_020451
3483 Ga0495685_023255
3484 Ga0495685_024961
3485 Ga0495685_042339
3486 Ga0495681_0015753
3487 Ga0495681_0064671
3488 Ga0495681_0104454
3489 Ga0495681_0114760
3490 Ga0495684_0005403
3491 Ga0495684_0242685
3492 Ga0495686_0116420
3493 Ga0495593_0000443
3494 Ga0495593_0002560
3495 Ga0495593_0034279
3496 Ga0495593_0111386
3497 Ga0495602_0006880
3498 Ga0495602_0029227
3499 Ga0495602_0036142
3500 Ga0495602_0075673
3501 Ga0495602_0175671
3502 Ga0495602_0212854
3503 Ga0495614_0000332
3504 Ga0495614_0031915
3505 Ga0495614_0033535
3506 Ga0495626_0000107
3507 Ga0496100_0000230
3508 Ga0496100_0043820
3509 Ga0496100_0087974
3510 Ga0496100_0161740
3511 Ga0496100_0196657
3512 Ga0496101_0001323
3513 Ga0496101_0054973
3514 Ga0496101_0082071
3515 Ga0496102_0000197
3516 Ga0496102_0021041
3517 Ga0496102_0023849
3518 Ga0496102_0037590
3519 Ga0496102_0038480
3520 Ga0496102_0045644
3521 Ga0496102_0055745
3522 Ga0496102_0083131
3523 Ga0496102_0093081
3524 Ga0496102_0102067
3525 Ga0496102_0171358
3526 Ga0496103_0000567
3527 Ga0496103_0023676
3528 Ga0496103_0030514
3529 Ga0496103_0039662
3530 Ga0496103_0067538
3531 Ga0496104_0003320
3532 Ga0496104_0011409
3533 Ga0496104_0033704
3534 Ga0496104_0034546
3535 Ga0496104_0036380
3536 Ga0496104_0046580
3537 Ga0496104_0099606
3538 Ga0496104_0111162
3539 Ga0496104_0121872
3540 Ga0496104_0131900
3541 Ga0496104_0234151
3542 Ga0496104_0257471
3543 Ga0496105_0011926
3544 Ga0496105_0015275
3545 Ga0496105_0038966
3546 Ga0496105_0046991
3547 Ga0496105_0090132
3548 Ga0496105_0090865
3549 Ga0496105_0132441
3550 Ga0496105_0258066
3551 Ga0496106_0007408
3552 Ga0496106_0031548
3553 Ga0496106_0036550
3554 Ga0496106_0069881
3555 Ga0496106_0123434
3556 Ga0496106_0133453
3557 Ga0496107_0001318
3558 Ga0496107_0037188
3559 Ga0496107_0038003
3560 Ga0496107_0055606
3561 Ga0496107_0076169
3562 Ga0496107_0100298
3563 Ga0496107_0102047
3564 Ga0496108_0000323
3565 Ga0496108_0006496
3566 Ga0496108_0012803
3567 Ga0496108_0084950
3568 Ga0496108_0095629
3569 Ga0496108_0105015
3570 Ga0496108_0120317
3571 Ga0496108_0124866
3572 Ga0496108_0186921
3573 Ga0496109_0002523
3574 Ga0496109_0004862
3575 Ga0496109_0019246
3576 Ga0496109_0032372
3577 Ga0496109_0034824
3578 Ga0496109_0115425
3579 Ga0496109_0129255
3580 Ga0496109_0157565
3581 Ga0496109_0199461
3582 Ga0496109_0204079
3583 Ga0496109_0215218
3584 Ga0496109_0237679
3585 Ga0496109_0486189
3586 Ga0496110_0004803
3587 Ga0496110_0008247
3588 Ga0496110_0008548
3589 Ga0496110_0017679
3590 Ga0496110_0038743
3591 Ga0496110_0039302
3592 Ga0496110_0043146
3593 Ga0496110_0059470
3594 Ga0496110_0059635
3595 Ga0496110_0117426
3596 Ga0496110_0118881
3597 Ga0496110_0199315
3598 Ga0496111_0047322
3599 Ga0496111_0059520
3600 Ga0496111_0069275
3601 Ga0496111_0099236
3602 Ga0496111_0105774
3603 Ga0496111_0139751
3604 Ga0496111_0220146
3605 Ga0496112_0027019
3606 Ga0496112_0027336
3607 Ga0496112_0027513
3608 Ga0496112_0062948
3609 Ga0496112_0093772
3610 Ga0496112_0095368
3611 Ga0496112_0134082
3612 Ga0496112_0419569
3613 Ga0496113_0002025
3614 Ga0496113_0054965
3615 Ga0496113_0055383
3616 Ga0496113_0082918
3617 Ga0496113_0105761
3618 Ga0496113_0113680
3619 Ga0496113_0214923
3620 Ga0496113_0350872
3621 Ga0496114_0000312
3622 Ga0496114_0004399
3623 Ga0496114_0005039
3624 Ga0496114_0021136
3625 Ga0496114_0037163
3626 Ga0496114_0045642
3627 Ga0496114_0062739
3628 Ga0496114_0065970
3629 Ga0496114_0083702
3630 Ga0496114_0100408
3631 Ga0496114_0105861
3632 Ga0496114_0106305
3633 Ga0496114_0122375
3634 Ga0496114_0159674
3635 Ga0496115_0000958
3636 Ga0496115_0015306
3637 Ga0496115_0017500
3638 Ga0496115_0030420
3639 Ga0496115_0039635
3640 Ga0496115_0055631
3641 Ga0496115_0157271
3642 Ga0496116_0001814
3643 Ga0496117_0000160
3644 Ga0496117_0025274
3645 Ga0496117_0078466
3646 Ga0496118_0000391
3647 Ga0496118_0004280
3648 Ga0496118_0008436
3649 Ga0496118_0013776
3650 Ga0496118_0077813
3651 Ga0496119_0000585
3652 Ga0496119_0001388
3653 Ga0496119_0006896
3654 Ga0496119_0014398
3655 Ga0496119_0022637
3656 Ga0496120_0000664
3657 Ga0496120_0025613
3658 Ga0496121_0001733
3659 Ga0496121_0005283
3660 Ga0496121_0015399
3661 Ga0496121_0038881
3662 Ga0496122_0000420
3663 Ga0496123_0000241
3664 Ga0496123_0007065
3665 Ga0496124_0001389
3666 Ga0496124_0008501
3667 Ga0496124_0131795
3668 Ga0496124_0245039
3669 Ga0496125_0001823
3670 Ga0496125_0023204
3671 Ga0496125_0183937
3672 Ga0496126_0000003
3673 Ga0496126_0000007
3674 Ga0496126_0001780
3675 Ga0496126_0014094
3676 Ga0496126_0115230
3677 Ga0495678_033053
3678 Ga0501311_006970
3679 Ga0501316_002091
3680 Ga0501317_005953
3681 Ga0501317_006872
3682 Ga0501031_0005025
3683 Ga0501031_0017177
3684 Ga0501031_0017508
3685 Ga0501031_0035488
3686 Ga0501031_0177693
3687 Ga0501032_0000233
3688 Ga0501032_0001476
3689 Ga0501032_0005177
3690 Ga0501032_0028713
3691 Ga0501032_0030584
3692 Ga0501032_0032894
3693 Ga0501032_0123909
3694 Ga0501032_0134293
3695 Ga0501033_0000068
3696 Ga0501033_0001790
3697 Ga0501033_0003003
3698 Ga0501033_0024169
3699 Ga0501033_0028021
3700 Ga0501033_0036697
3701 Ga0501033_0043060
3702 Ga0501033_0043157
3703 Ga0501033_0048329
3704 Ga0501033_0072646
3705 Ga0501033_0160141
3706 Ga0501033_0210754
3707 Ga0501034_0000112
3708 Ga0501034_0000445
3709 Ga0501034_0006054
3710 Ga0501034_0007138
3711 Ga0501034_0010407
3712 Ga0501034_0012880
3713 Ga0501034_0014057
3714 Ga0501034_0015728
3715 Ga0501034_0016899
3716 Ga0501034_0026522
3717 Ga0501034_0030332
3718 Ga0501034_0045746
3719 Ga0501034_0061252
3720 Ga0501034_0069812
3721 Ga0501034_0076242
3722 Ga0501034_0134456
3723 Ga0501034_0142499
3724 Ga0501034_0198622
3725 Ga0501036_0000173
3726 Ga0501036_0000311
3727 Ga0501036_0003610
3728 Ga0501036_0008768
3729 Ga0501036_0008920
3730 Ga0501036_0029342
3731 Ga0501036_0043083
3732 Ga0501036_0043488
3733 Ga0501036_0056446
3734 Ga0501036_0065845
3735 Ga0501036_0112295
3736 Ga0501036_0222346
3737 Ga0501036_0258655
3738 Ga0501036_0280210
3739 Ga0501036_0383459
3740 Ga0501037_0003443
3741 Ga0501037_0006517
3742 Ga0501037_0027561
3743 Ga0501037_0062648
3744 Ga0501037_0074828
3745 Ga0501037_0085228
3746 Ga0501037_0087800
3747 Ga0501037_0096108
3748 Ga0501037_0118814
3749 Ga0501037_0118967
3750 Ga0501037_0154033
3751 Ga0501037_0171181
3752 Ga0501037_0217775
3753 Ga0501038_0001008
3754 Ga0501038_0003450
3755 Ga0501038_0014731
3756 Ga0501038_0017937
3757 Ga0501038_0018475
3758 Ga0501038_0022056
3759 Ga0501038_0022327
3760 Ga0501038_0024582
3761 Ga0501038_0033926
3762 Ga0501038_0037905
3763 Ga0501038_0100233
3764 Ga0501039_0000365
3765 Ga0501039_0001818
3766 Ga0501039_0002989
3767 Ga0501039_0022325
3768 Ga0501039_0047522
3769 Ga0501039_0055707
3770 Ga0501040_0000601
3771 Ga0501040_0003265
3772 Ga0501040_0005731
3773 Ga0501040_0010110
3774 Ga0501040_0024469
3775 Ga0501040_0030966
3776 Ga0501040_0034618
3777 Ga0501040_0046369
3778 Ga0501040_0167863
3779 Ga0501040_0169048
3780 Ga0501041_0000058
3781 Ga0501041_0003675
3782 Ga0501041_0007040
3783 Ga0501041_0035545
3784 Ga0501041_0047911
3785 Ga0501041_0089087
3786 Ga0501041_0126922
3787 Ga0501042_0000028
3788 Ga0501042_0001191
3789 Ga0501042_0002058
3790 Ga0501042_0002832
3791 Ga0501042_0018019
3792 Ga0501042_0052282
3793 Ga0501042_0069868
3794 Ga0501043_0002108
3795 Ga0501043_0003406
3796 Ga0501043_0003689
3797 Ga0501043_0006173
3798 Ga0501043_0006711
3799 Ga0501043_0122203
3800 Ga0501043_0166297
3801 Ga0501046_0000269
3802 Ga0501046_0002221
3803 Ga0501046_0011509
3804 Ga0501046_0014720
3805 Ga0501046_0019530
3806 Ga0501046_0033858
3807 Ga0501046_0138238
3808 Ga0501046_0205518
3809 Ga0501047_0001586
3810 Ga0501047_0001974
3811 Ga0501047_0002200
3812 Ga0501047_0006112
3813 Ga0501047_0033018
3814 Ga0501047_0039286
3815 Ga0501047_0063533
3816 Ga0501047_0063892
3817 Ga0501047_0064059
3818 Ga0501047_0066684
3819 Ga0501047_0140224
3820 Ga0501047_0209861
3821 Ga0501047_0324272
3822 Ga0501048_0000200
3823 Ga0501048_0000208
3824 Ga0501048_0005603
3825 Ga0501048_0007562
3826 Ga0501048_0008379
3827 Ga0501048_0202570
3828 Ga0501067_0007563
3829 Ga0501067_0032055
3830 Ga0501067_0039453
3831 Ga0501067_0044280
3832 Ga0501067_0048889
3833 Ga0501068_0000883
3834 Ga0501068_0002304
3835 Ga0501068_0005165
3836 Ga0501068_0043033
3837 Ga0501068_0094068
3838 Ga0501069_0000009
3839 Ga0501069_0000779
3840 Ga0501069_0003171
3841 Ga0501069_0010725
3842 Ga0501069_0011829
3843 Ga0501069_0019199
3844 Ga0501070_0000006
3845 Ga0501070_0000090
3846 Ga0501070_0000381
3847 Ga0501070_0002977
3848 Ga0501070_0003717
3849 Ga0501070_0004522
3850 Ga0501070_0005764
3851 Ga0501070_0007642
3852 Ga0501070_0020310
3853 Ga0501070_0067333
3854 Ga0501070_0072577
3855 Ga0501070_0072816
3856 Ga0501070_0076534
3857 Ga0501070_0076808
3858 Ga0501070_0098471
3859 Ga0501070_0111273
3860 Ga0501070_0123860
3861 Ga0501070_0263901
3862 Ga0501071_0001455
3863 Ga0501071_0002907
3864 Ga0501071_0003307
3865 Ga0501071_0008605
3866 Ga0501071_0009897
3867 Ga0501071_0018889
3868 Ga0501071_0075154
3869 Ga0501071_0162036
3870 Ga0501072_0000452
3871 Ga0501072_0000456
3872 Ga0501072_0001842
3873 Ga0501072_0005756
3874 Ga0501072_0008669
3875 Ga0501072_0017657
3876 Ga0501072_0092052
3877 Ga0501072_0134057
3878 Ga0501073_0002160
3879 Ga0501073_0003916
3880 Ga0501073_0008948
3881 Ga0501073_0083303
3882 Ga0501073_0093393
3883 Ga0501073_0103888
3884 Ga0501073_0115876
3885 Ga0501073_0131878
3886 Ga0501074_0000592
3887 Ga0501074_0001226
3888 Ga0501074_0001449
3889 Ga0501074_0001504
3890 Ga0501074_0001760
3891 Ga0501074_0002346
3892 Ga0501074_0010495
3893 Ga0501074_0014772
3894 Ga0501074_0027690
3895 Ga0501074_0046308
3896 Ga0501074_0081549
3897 Ga0501074_0107580
3898 Ga0501074_0122618
3899 Ga0501074_0329696
3900 Ga0501075_0002435
3901 Ga0501075_0003534
3902 Ga0501075_0006156
3903 Ga0501075_0009381
3904 Ga0501075_0025620
3905 Ga0501075_0079735
3906 Ga0501076_0000061
3907 Ga0501076_0003089
3908 Ga0501076_0005895
3909 Ga0501076_0036881
3910 Ga0501076_0055586
3911 Ga0501076_0088735
3912 Ga0501076_0325929
3913 Ga0501077_0000349
3914 Ga0501077_0018887
3915 Ga0501077_0028205
3916 Ga0501077_0108285
3917 Ga0501079_0000088
3918 Ga0501079_0000185
3919 Ga0501079_0000787
3920 Ga0501079_0003605
3921 Ga0501079_0008202
3922 Ga0501079_0015246
3923 Ga0501079_0044068
3924 Ga0501079_0048254
3925 Ga0501079_0090727
3926 Ga0501080_0000714
3927 Ga0501080_0005622
3928 Ga0501080_0014618
3929 Ga0501080_0022775
3930 Ga0501080_0033816
3931 Ga0501080_0034394
3932 Ga0501080_0035150
3933 Ga0501080_0039087
3934 Ga0501080_0050424
3935 Ga0501080_0056786
3936 Ga0501080_0130430
3937 Ga0501080_0278916
3938 Ga0501080_0285112
3939 Ga0501081_0000808
3940 Ga0501081_0001235
3941 Ga0501081_0014905
3942 Ga0501081_0025943
3943 Ga0501083_0000096
3944 Ga0501083_0006021
3945 Ga0501083_0006066
3946 Ga0501083_0009376
3947 Ga0501083_0012445
3948 Ga0501083_0049329
3949 Ga0501083_0092031
3950 Ga0501035_0007509
3951 Ga0501035_0009862
3952 Ga0501035_0021233
3953 Ga0501035_0041946
3954 Ga0501035_0054245
3955 Ga0501035_0057970
3956 Ga0501035_0059274
3957 Ga0501035_0061025
3958 Ga0501035_0068650
3959 Ga0501035_0110052
3960 Ga0501035_0122856
3961 Ga0501035_0135499
3962 Ga0501035_0157221
3963 Ga0501035_0184080
3964 Ga0501035_0275648
3965 Ga0501044_0000191
3966 Ga0501044_0000276
3967 Ga0501044_0002167
3968 Ga0501044_0003934
3969 Ga0501044_0007350
3970 Ga0501044_0021567
3971 Ga0501044_0038842
3972 Ga0501044_0079472
3973 Ga0501044_0093090
3974 Ga0501044_0097355
3975 Ga0501044_0133618
3976 Ga0501044_0136408
3977 Ga0501044_0155813
3978 Ga0501044_0156108
3979 Ga0501044_0168415
3980 Ga0501044_0214900
3981 Ga0501044_0244745
3982 Ga0501044_0304865
3983 Ga0501045_0000044
3984 Ga0501045_0000099
3985 Ga0501045_0002750
3986 Ga0501045_0003799
3987 Ga0501045_0008315
3988 Ga0501045_0013372
3989 Ga0501045_0018652
3990 Ga0501045_0023583
3991 Ga0501045_0047497
3992 Ga0501045_0061270
3993 Ga0501045_0104273
3994 Ga0501045_0191142
3995 nmdc:mga03683_8047_c1
3996 nmdc:mga03n38_113700_c1
3997 nmdc:mga03n38_4316_c1
3998 nmdc:mga00v17_51214_c1
3999 nmdc:mga00v17_9992_c1
4000 nmdc:mga0yw44_159042_c1
4001 nmdc:mga0yw44_27194_c1
4002 nmdc:mga0yw44_43386_c1
4003 nmdc:mga0yw44_64051_c1
4004 nmdc:mga0yw44_78387_c1
4005 nmdc:mga0yw44_87740_c1
4006 nmdc:mga06z11_13537_c1
4007 nmdc:mga06z11_17805_c1
4008 nmdc:mga06z11_51546_c1
4009 nmdc:mga06z11_5961_c1
4010 nmdc:mga04h51_10331_c1
4011 nmdc:mga04h51_5221_c1
4012 nmdc:mga07m45_107673_c1
4013 nmdc:mga07m45_21523_c1
4014 nmdc:mga05p37_1507_c1
4015 nmdc:mga05p37_153_c1
4016 nmdc:mga05p37_19739_c1
4017 nmdc:mga05p37_2500_c1
4018 nmdc:mga05p37_36897_c1
4019 nmdc:mga05p37_389220_c1
4020 nmdc:mga05p37_519_c1
4021 nmdc:mga09592_1439_c1
4022 nmdc:mga09592_40807_c1
4023 nmdc:mga09592_4_c1
4024 nmdc:mga09592_54533_c1
4025 nmdc:mga09592_6157_c1
4026 nmdc:mga0qj67_3_c2
4027 nmdc:mga0qj67_61677_c1
4028 nmdc:mga0qj67_6977_c1
4029 nmdc:mga0qj67_79776_c1
4030 nmdc:mga0qj67_9248_c1
4031 nmdc:mga0qj67_97743_c1
4032 nmdc:mga06r32_1153_c1
4033 nmdc:mga06r32_20179_c1
4034 nmdc:mga06r32_6093_c1
4035 nmdc:mga06r32_6_c2
4036 nmdc:mga06r32_7494_c1
4037 nmdc:mga06r32_791_c1
4038 nmdc:mga06r32_87415_c1
4039 nmdc:mga08y16_10989_c1
4040 nmdc:mga08y16_1109_c1
4041 nmdc:mga08y16_15537_c1
4042 nmdc:mga0n895_4859_c1
4043 nmdc:mga0rr50_103852_c1
4044 nmdc:mga0rr50_109975_c1
4045 nmdc:mga0rr50_1591_c1
4046 nmdc:mga0a205_1654_c1
4047 nmdc:mga0a205_171897_c1
4048 nmdc:mga0sz30_42436_c1
4049 Ga0495601_0023913
4050 Ga0495601_0031787
4051 Ga0495601_0036267
4052 Ga0495601_0082023
4053 Ga0495601_0128056
4054 Ga0495601_0181442
4055 Ga0495612_0001858
4056 Ga0495612_0007022
4057 Ga0500610_0002713
4058 Ga0495595_0002567
4059 Ga0495595_0013276
4060 Ga0495595_0093127
4061 Ga0495619_0010545
4062 Ga0495619_0018136
4063 Ga0495619_0052583
4064 Ga0495619_0069188
4065 Ga0495619_0105163
4066 Ga0495619_0111566
4067 Ga0500643_000341
4068 Ga0500643_000621
4069 Ga0500644_0000003
4070 Ga0500644_0014886
4071 Ga0500644_0047278
4072 Ga0500646_0000441
4073 Ga0500583_0027610
4074 Ga0500583_0092885
4075 Ga0500566_0000073
4076 Ga0500640_062360
4077 Ga0500650_0001215
4078 Ga0500650_0087862
4079 Ga0500654_087111
4080 Ga0500553_035850
4081 Ga0500556_0000028
4082 Ga0500556_0000394
4083 Ga0500556_0001874
4084 Ga0500560_021127
4085 Ga0500562_000178
4086 Ga0500580_065616
4087 Ga0500593_000225
4088 Ga0500652_001350
4089 Ga0500655_006799
4090 Ga0500559_0000648
4091 Ga0500559_0032730
4092 Ga0500561_0000434
4093 Ga0500568_0000009
4094 Ga0500568_0000043
4095 Ga0500568_0000223
4096 Ga0500568_0006232
4097 Ga0500573_0006057
4098 Ga0500573_0008740
4099 Ga0500573_0073893
4100 Ga0500573_0110950
4101 Ga0500573_0159190
4102 Ga0500577_0100319
4103 Ga0500579_054963
4104 Ga0500588_0000670
4105 Ga0500616_0000027
4106 Ga0500616_0000273
4107 Ga0500616_0000570
4108 Ga0500616_0006098
4109 Ga0500616_0038349
4110 Ga0500616_0056073
4111 Ga0500620_006012
4112 Ga0500624_012642
4113 Ga0500636_0071097
4114 Ga0501084_0000109
4115 Ga0501084_0001023
4116 Ga0501084_0002549
4117 Ga0501084_0007261
4118 Ga0501084_0008559
4119 Ga0501084_0014163
4120 Ga0501084_0023072
4121 Ga0501084_0068395
4122 Ga0501084_0107461
4123 Ga0501084_0115212
4124 Ga0501084_0148900
4125 Ga0587090_009055
4126 Ga0501082_0003253
4127 Ga0501082_0027102
4128 Ga0501082_0041255
4129 Ga0501082_0072107
4130 Ga0501082_0083044
4131 Ga0466962_0000051
4132 Ga0466962_0000057
4133 Ga0466962_0010819
4134 Ga0466962_0086439
4135 Ga0530510_0000204
4136 Ga0530510_0001129
4137 Ga0530510_0007848
4138 Ga0530510_0011566
4139 Ga0530510_0016065
4140 Ga0530510_0022473
4141 2501945014
4142 2506864793
4143 2508671422
4144 2515494075
4145 2515721370
4146 2515755882
4147 2516085498
4148 2516089785
4149 2517761769
4150 2528202174
4151 2528212776
4152 2537898918
4153 2546948574
4154 2547408133
4155 2554257852
4156 2555229487
4157 2579749817
4158 2579854928
4159 2585308805
4160 2585313508
4161 2587864081
4162 2616695052
4163 2616902174
4164 2619853120
4165 2620351088
4166 2623586326
4167 2626637206
4168 2643764940
4169 2643827418
4170 2643849056
4171 2643852419
4172 2643891900
4173 2643902616
4174 2643942199
4175 2643960952
4176 2643995246
4177 2644017180
4178 2644031966
4179 2644094016
4180 2644100367
4181 2644116774
4182 2644136942
4183 2644173859
4184 2644228551
4185 2644262289
4186 2644323859
4187 2644389865
4188 2644404876
4189 2644429282
4190 2644437176
4191 2644458294
4192 2644461220
4193 2644504884
4194 2644527204
4195 2644533755
4196 2644610265
4197 2644628915
4198 2644667753
4199 2645722438
4200 2645725411
4201 2655031501
4202 2671837652
4203 2676203036
4204 2676484158
4205 2686537920
4206 2686542989
4207 2689956382
4208 2710603307
4209 2740166019
4210 2753269546
4211 2768644748
4212 2772641467
4213 2774383792
4214 2774847612
4215 2774855808
4216 2774866300
4217 2774904883
4218 2775658508
4219 2784473033
4220 2784588586
4221 2785343281
4222 2785369515
4223 2786670619
4224 2793979713
4225 2804847037
4226 2808830052
4227 2808842074
4228 2808851227
4229 2808876248
4230 2808894302
4231 2808897751
4232 2808920592
4233 2809232198
4234 2810363130
4235 2811849064
4236 2812318173
4237 2812371666
4238 2812480508
4239 2816420874
4240 2819667227
4241 2819690559
4242 2819695391
4243 2819728129
4244 2819741161
4245 2827628670
4246 2831937257
4247 2832006611
4248 2837187328
4249 2837274720
4250 2839988783
4251 2844851726
4252 2848552212
4253 2852636654
4254 2852678749
4255 2855676551
4256 2855683399
4257 2855685128
4258 2856860171
4259 2857294985
4260 2857481202
4261 2857633465
4262 2857712944
4263 2857734272
4264 2857740854
4265 2858852149
4266 2858872875
4267 2858888335
4268 2858893250
4269 2858899093
4270 2858905417
4271 2862180154
4272 2862285674
4273 2862290636
4274 2862384445
4275 2862511796
4276 2862579238
4277 2862993449
4278 2863404590
4279 2866065722
4280 2867304186
4281 2867313513
4282 2867322665
4283 2867348799
4284 2867371911
4285 2867435889
4286 2867480596
4287 2867509187
4288 2868094032
4289 2869055292
4290 2869062571
4291 2869074566
4292 2870622451
4293 2870803312
4294 2870805355
4295 2873155713
4296 2875395764
4297 2877681096
4298 2880493979
4299 2880498361
4300 2884996753
4301 2887446937
4302 2887483645
4303 2891401264
4304 2895888156
4305 2904501535
4306 2904778167
4307 2905928653
4308 2910813480
4309 2912719939
4310 2912724331
4311 2912760801
4312 2918505620
4313 2919035543
4314 2919054615
4315 2919060213
4316 2919395334
4317 2919469497
4318 2919539239
4319 2920883334
4320 2929220391
4321 2929226946
4322 2932427827
4323 2932434482
4324 2933418599
4325 2935393401
4326 2935410757
4327 2939599352
4328 2939650273
4329 2939659169
4330 2939677693
4331 2945920274
4332 2945923865
4333 2945944473
4334 2945957335
4335 2945958695
4336 2946003365
4337 2946040391
4338 2946048858
4339 2946063991
4340 2946067751
4341 2946075930
4342 2947229215
4343 2954001656
4344 2954007394
4345 2954386225
4346 2954676941
4347 2954687217
4348 2954696863
4349 2954705273
4350 2954716236
4351 2954726178
4352 2954735632
4353 2954745104
4354 2954754487
4355 2954764077
4356 2964328617
4357 2966601630
4358 2974303822
4359 2984579265
4360 2990060746
4361 2990090532
4362 2990259842
4363 2996223380
4364 2997457816
4365 2997600395
4366 3001890363
4367 3006325033
4368 3006398368
4369 3006428717
4370 3006491969
4371 3006500775
4372 637877412
4373 649810872
4374 8001788181
4375 8002776324
4376 8002784515
4377 8003835786
4378 8003857612
4379 8003878195
4380 8004022429
4381 8008567283
4382 8008578873
4383 8023630165
4384 8025417710
4385 8025480347
4386 8025538022
4387 8045834438
4388 8047714256
4389 8047898090
4390 8048136806
4391 8048360803
4392 8048375053
4393 8048383153
4394 8048412732
4395 8054109716
4396 8054166059
4397 8054609836
4398 8054710070
4399 8054728285
4400 8054735324
4401 8054913814
4402 8054921054
4403 8055161321
4404 8055414138
4405 8056039218
4406 8056057885
4407 8056452984
4408 8056837710

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00266

Aminotran_5

Aminotransferase class-V

90

408

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vom-assembly1.cif.gz_B structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis 0.9886 5 374
2fyf-assembly1.cif.gz_B structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis 0.9871 5 374
3vom-assembly1.cif.gz_B structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis 0.986 5 374
2fyf-assembly1.cif.gz_B structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis 0.9818 5 374
3ffr-assembly1.cif.gz_A-2 crystal structure of a phosphoserine aminotransferase serc (chu_0995) from cytophaga hutchinsonii atcc 33406 at 1.75 a resolution 0.9178 15 369
ID Description Score Start End Superfamily
af_P9WQ73_272_376_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 1.003 270 374 3.90.1150.10
af_P9WQ73_272_376_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9931 270 374 3.90.1150.10
af_P9WQ73_31_269_3.20.10.10 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9874 28 266 3.20.10.10
af_P9WQ73_31_269_3.20.10.10 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9751 28 266 3.20.10.10
3qm2B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9117 270 373 3.90.1150.10
ID Description Score Start End GO Terms
AF-A0A7W0LQJ6-F1-model_v4 Phosphoserine transaminase 1.003 277 373
AF-A0A6G3V8F1-F1-model_v4 deleted 0.9981 254 374
AF-A0A3C1P2Y0-F1-model_v4 Phosphoserine transaminase 0.9977 276 373
AF-A0A257NJ30-F1-model_v4 Phosphoserine aminotransferase 0.9963 175 374 GO:0004760
GO:0005777
GO:0008453
GO:0019265
AF-A0A6J7BGE6-F1-model_v4 Unannotated protein 0.9958 266 374

Map