F496547
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2204 | 807 | 4408 | 375 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10003010|Ga0070658_1000301013 |
| Length | 447 |
| Sequence | MLCSDSHSESQQSDPITACSGRLPRPDCPGQDTDQRHQPTPRRRLSARPAIIEHTGSVADSSELITKREFSVTDAPKIEIPANLKPSDGRFGAGPSKIRPESVAALAASSAGYLGTSHRRPAVKNVVGKVRAGLTQLFNLPDGYEVVLGNGGATAFWDIATFNLIRERSQHLNFGEFSSKFAAAAKAAPFLADPSVIKSDPGTHPLPRAEAGIDAYALTHNETSTGVMMPIKRVQGADDGALVLVDATSGAGGLPVDVNETDVYYFSPQKCFASDGGLWLGLFSPAAIERVAQIKESGRWIPTSYDLTTAIDNSRLDQTYNTPALVTLWLLADQLDWMNSNGGLQFTTSRTADSAQRLYTWAEKTDYTTPYVTDADKRSNVIGTIDFDDAIDAEQVAKTLRANGILDTEPYRKLGRNQLRIAMFPAIDPADVEALTACIDYVVAKLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 13 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 14 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 74 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 75 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 76 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 77 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 83 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 86 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 87 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 133 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 134 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 208 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 212 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 213 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 214 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 217 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 218 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 220 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 221 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 224 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 225 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 226 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 227 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 228 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 229 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 230 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 231 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 232 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 233 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 234 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 235 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 236 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 237 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 238 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 239 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 240 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 241 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 242 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 243 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 244 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 245 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 246 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 247 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 248 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 249 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 250 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 251 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 252 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 253 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 254 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 255 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 256 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 257 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 258 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 259 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 260 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 262 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 263 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 264 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 265 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 266 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 268 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 269 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 270 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 271 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 272 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 273 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 274 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 275 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 276 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 278 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 279 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 280 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 281 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 282 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 283 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 284 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 285 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 286 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 287 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 288 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 289 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 290 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 291 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 292 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 293 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 294 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 295 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 296 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 297 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 298 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 299 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 300 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 301 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 302 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 303 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 304 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 305 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 306 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 307 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 308 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 309 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 310 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 311 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 312 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 313 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 314 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 315 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 316 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 317 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 318 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 319 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 320 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 321 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 322 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 323 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 324 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 325 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 326 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 327 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 328 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 329 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 330 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 331 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 332 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 333 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 334 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 335 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 336 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 337 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 338 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 339 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 340 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 341 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 342 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 343 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 344 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 345 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 346 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 347 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 348 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 349 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 425 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 426 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 427 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 428 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 429 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 430 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 431 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 432 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 433 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 434 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 435 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 436 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 437 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 438 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 439 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 440 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 441 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 442 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 443 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 444 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 445 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 446 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 447 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 448 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 449 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 450 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 451 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 457 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 458 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 461 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 462 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 463 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 464 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 465 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 469 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 470 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 479 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 482 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 484 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 488 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 489 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 490 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 491 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 492 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 493 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 494 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 495 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 496 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 497 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 498 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 499 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 500 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 501 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 502 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 504 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 507 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 510 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 511 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 512 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 513 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 514 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 515 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 516 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 517 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 518 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 519 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 520 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 521 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 522 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 523 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 524 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 525 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 526 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 527 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 528 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 529 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 530 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 531 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 532 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 533 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 534 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 535 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 536 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 537 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 538 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 539 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 540 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 541 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 542 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 543 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 544 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 545 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 546 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 547 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 548 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 549 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 550 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 551 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 552 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 553 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 554 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 555 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 556 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 557 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 558 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 559 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 560 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 561 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 562 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 563 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 564 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 565 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 566 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 567 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 568 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 569 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 570 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 571 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 572 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 573 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 574 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 575 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 576 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 577 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 578 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 579 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 580 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 581 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 582 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 583 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 584 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 585 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 586 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 587 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 588 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 589 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 590 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 591 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 592 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 593 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 594 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 595 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 596 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 597 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 598 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 599 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 600 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 601 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 602 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 603 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 604 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 605 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 606 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 607 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 608 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 609 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 610 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 611 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 612 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 613 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 614 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 615 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 616 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 617 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 618 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 619 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 620 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 621 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 622 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 623 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 624 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 625 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 626 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 627 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 628 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 629 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 630 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 631 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 632 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 633 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 634 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 635 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 636 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 637 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 638 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 639 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 640 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 641 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 642 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 643 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 644 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 645 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 646 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 647 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 648 | 2837183177 | Egibacter rhizosphaerae EGI 80759 | Isolate | Unclassified |
| 649 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 650 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 651 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 652 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 653 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 654 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 655 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 656 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 657 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 658 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 659 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 660 | 2857479173 | Micrococcus sp. R-74225 | Isolate | Unclassified |
| 661 | 2857632687 | Micrococcus sp. R-73081 | Isolate | Unclassified |
| 662 | 2857710386 | Brevibacterium sp. R-73093 | Isolate | Unclassified |
| 663 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 664 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 665 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 666 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 667 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 668 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 669 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 670 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 671 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 672 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 673 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 674 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 675 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 676 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 677 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 678 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 679 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 680 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 681 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 682 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 683 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 684 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 685 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 686 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 687 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 688 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 689 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 690 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 691 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 692 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 693 | 2870801768 | Micrococcus endophyticus DSM 17945 | Isolate | Unclassified |
| 694 | 2870804320 | Micrococcus yunnanensis DSM 21948 | Isolate | Unclassified |
| 695 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 696 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 697 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 698 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 699 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 700 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 701 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 702 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 703 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 704 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 705 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 706 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 707 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 708 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 709 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 710 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 711 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 712 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 713 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 714 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 715 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 716 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 717 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 718 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 719 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 720 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 721 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 722 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 723 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 724 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 725 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 726 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 727 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 728 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 729 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 730 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 731 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 732 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 733 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 734 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 735 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 736 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 737 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 738 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 739 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 740 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 741 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 742 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 743 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 744 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 745 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 746 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 747 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 748 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 749 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 750 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 751 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 752 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 753 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 754 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 755 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 756 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 757 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 758 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 759 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 760 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 761 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 762 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 763 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 764 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 765 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 766 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 767 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 768 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 769 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 770 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 771 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 772 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 773 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 774 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 775 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
| 776 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 777 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 778 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 779 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 780 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 781 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 782 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 783 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 784 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 785 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 786 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 787 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 788 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 789 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 790 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 791 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 792 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 793 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 794 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 795 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 796 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 797 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 798 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 799 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 800 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 801 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 802 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
| 803 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 804 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 805 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
| 806 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 807 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.48 |
| Metatranscriptomes | 1.36 |
| Isolates | 12.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.09 |
| Bulb | 0 |
| Endosphere | 4.95 |
| Nodule | 1.5 |
| Rhizoplane | 6.26 |
| Rhizosphere | 76.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10003010 | 3300005327 | Bacteria | 13946 |
| 2 | LJQas_1001827 | 3300000549 | Bacteria | 3107 |
| 3 | JGI24740J21852_10012278 | 3300001979 | Bacteria | 3234 |
| 4 | JGI24740J21852_10024718 | 3300001979 | Bacteria | 2035 |
| 5 | JGI24739J22299_10004610 | 3300001989 | Bacteria | 5271 |
| 6 | JGI24737J22298_10005964 | 3300001990 | Bacteria | 4184 |
| 7 | JGI24737J22298_10050458 | 3300001990 | Bacteria | 1264 |
| 8 | JGI24735J21928_10005250 | 3300002067 | Bacteria | 4303 |
| 9 | JGI24735J21928_10035354 | 3300002067 | Bacteria | 1469 |
| 10 | JGI24738J21930_10011549 | 3300002075 | Bacteria | 1940 |
| 11 | JGI24738J21930_10020922 | 3300002075 | Bacteria | 1359 |
| 12 | JGI25164J39214_1000508 | 3300002772 | Bacteria | 18811 |
| 13 | JGI25152J39213_1000323 | 3300002773 | Bacteria | 30643 |
| 14 | JGI25406J46586_10006250 | 3300003203 | Bacteria | 5498 |
| 15 | JGI25406J46586_10027794 | 3300003203 | Bacteria | 2164 |
| 16 | rootH1_10000474 | 3300003316 | Bacteria | 6566 |
| 17 | JGI25407J50210_10001412 | 3300003373 | Bacteria | 5445 |
| 18 | JGI25407J50210_10007122 | 3300003373 | Bacteria | 2798 |
| 19 | Ga0006562J51391_1027612 | 3300003578 | Bacteria | 3990 |
| 20 | Ga0006562J51391_1027614 | 3300003578 | Bacteria | 5600 |
| 21 | Ga0006562J51391_1047252 | 3300003578 | Bacteria | 6850 |
| 22 | Ga0006562J51391_1054242 | 3300003578 | Bacteria | 3200 |
| 23 | Ga0006562J51391_1124095 | 3300003578 | Bacteria | 3207 |
| 24 | Ga0055539_1000005 | 3300003752 | Bacteria | 609598 |
| 25 | Ga0055532_1007097 | 3300003758 | Bacteria | 1460 |
| 26 | JGI25405J52794_10017243 | 3300003911 | Bacteria | 1432 |
| 27 | Ga0070658_10001049 | 3300005327 | Bacteria | 23614 |
| 28 | Ga0070658_10001184 | 3300005327 | Bacteria | 22310 |
| 29 | Ga0070658_10001244 | 3300005327 | Bacteria | 21827 |
| 30 | Ga0070658_10029880 | 3300005327 | Bacteria | 4378 |
| 31 | Ga0070658_10067351 | 3300005327 | Bacteria | 2925 |
| 32 | Ga0070658_10077960 | 3300005327 | Bacteria | 2718 |
| 33 | Ga0070658_10137783 | 3300005327 | Bacteria | 2037 |
| 34 | Ga0070658_10215687 | 3300005327 | Bacteria | 1622 |
| 35 | Ga0070676_10036896 | 3300005328 | Bacteria | 2816 |
| 36 | Ga0070683_100009639 | 3300005329 | Bacteria | 8263 |
| 37 | Ga0070683_100020537 | 3300005329 | Bacteria | 5877 |
| 38 | Ga0070683_100022815 | 3300005329 | Bacteria | 5598 |
| 39 | Ga0070683_100051863 | 3300005329 | Bacteria | 3799 |
| 40 | Ga0070683_100177871 | 3300005329 | Bacteria | 2020 |
| 41 | Ga0070683_100410443 | 3300005329 | Bacteria | 1292 |
| 42 | Ga0068869_100023696 | 3300005334 | Bacteria | 4245 |
| 43 | Ga0068869_100239303 | 3300005334 | Bacteria | 1446 |
| 44 | Ga0068869_100310161 | 3300005334 | Bacteria | 1277 |
| 45 | Ga0070680_100004871 | 3300005336 | Bacteria | 10107 |
| 46 | Ga0070680_100021665 | 3300005336 | Bacteria | 5110 |
| 47 | Ga0070680_100102504 | 3300005336 | Bacteria | 2377 |
| 48 | Ga0070682_100011844 | 3300005337 | Bacteria | 4988 |
| 49 | Ga0070682_100024609 | 3300005337 | Bacteria | 3585 |
| 50 | Ga0070682_100139847 | 3300005337 | Bacteria | 1649 |
| 51 | Ga0068868_100117287 | 3300005338 | Bacteria | 2169 |
| 52 | Ga0070660_100066881 | 3300005339 | Bacteria | 2799 |
| 53 | Ga0070660_100187500 | 3300005339 | Bacteria | 1675 |
| 54 | Ga0070660_100351238 | 3300005339 | Bacteria | 1214 |
| 55 | Ga0070661_100051362 | 3300005344 | Bacteria | 3017 |
| 56 | Ga0070661_100086714 | 3300005344 | Bacteria | 2315 |
| 57 | Ga0070661_100094069 | 3300005344 | Bacteria | 2221 |
| 58 | Ga0070661_100271339 | 3300005344 | Bacteria | 1314 |
| 59 | Ga0070692_10025969 | 3300005345 | Bacteria | 2892 |
| 60 | Ga0070692_10078446 | 3300005345 | Bacteria | 1773 |
| 61 | Ga0070668_100000183 | 3300005347 | Bacteria | 40650 |
| 62 | Ga0070675_100001049 | 3300005354 | Bacteria | 19919 |
| 63 | Ga0070675_100028678 | 3300005354 | Bacteria | 4481 |
| 64 | Ga0070674_100019612 | 3300005356 | Bacteria | 4299 |
| 65 | Ga0070674_100136724 | 3300005356 | Bacteria | 1834 |
| 66 | Ga0070688_100109479 | 3300005365 | Bacteria | 1835 |
| 67 | Ga0070659_100000331 | 3300005366 | Bacteria | 36451 |
| 68 | Ga0070659_100007388 | 3300005366 | Bacteria | 7983 |
| 69 | Ga0070659_100009022 | 3300005366 | Bacteria | 7314 |
| 70 | Ga0070659_100010310 | 3300005366 | Bacteria | 6872 |
| 71 | Ga0070659_100076338 | 3300005366 | Bacteria | 2672 |
| 72 | Ga0070659_100120684 | 3300005366 | Bacteria | 2123 |
| 73 | Ga0070659_100179332 | 3300005366 | Bacteria | 1738 |
| 74 | Ga0070667_100002049 | 3300005367 | Bacteria | 17842 |
| 75 | Ga0070709_10001322 | 3300005434 | Bacteria | 13497 |
| 76 | Ga0070709_10160270 | 3300005434 | Bacteria | 1563 |
| 77 | Ga0070709_10191751 | 3300005434 | Bacteria | 1442 |
| 78 | Ga0070714_100003654 | 3300005435 | Bacteria | 11518 |
| 79 | Ga0070714_100004246 | 3300005435 | Bacteria | 10794 |
| 80 | Ga0070714_100016064 | 3300005435 | Bacteria | 6034 |
| 81 | Ga0070714_100029830 | 3300005435 | Bacteria | 4537 |
| 82 | Ga0070714_100046660 | 3300005435 | Bacteria | 3676 |
| 83 | Ga0070714_100059039 | 3300005435 | Bacteria | 3288 |
| 84 | Ga0070714_100092360 | 3300005435 | Bacteria | 2653 |
| 85 | Ga0070714_100158003 | 3300005435 | Bacteria | 2048 |
| 86 | Ga0070714_100356968 | 3300005435 | Bacteria | 1373 |
| 87 | Ga0070713_100042937 | 3300005436 | Bacteria | 3693 |
| 88 | Ga0070713_100047895 | 3300005436 | Bacteria | 3516 |
| 89 | Ga0070713_100139419 | 3300005436 | Bacteria | 2146 |
| 90 | Ga0070710_10001003 | 3300005437 | Bacteria | 13427 |
| 91 | Ga0070710_10002233 | 3300005437 | Bacteria | 9158 |
| 92 | Ga0070710_10002612 | 3300005437 | Bacteria | 8563 |
| 93 | Ga0070710_10036922 | 3300005437 | Bacteria | 2674 |
| 94 | Ga0070711_100010024 | 3300005439 | Bacteria | 5847 |
| 95 | Ga0070711_100064623 | 3300005439 | Bacteria | 2557 |
| 96 | Ga0070711_100096095 | 3300005439 | Bacteria | 2146 |
| 97 | Ga0070711_100174880 | 3300005439 | Bacteria | 1639 |
| 98 | Ga0070700_100005333 | 3300005441 | Bacteria | 6800 |
| 99 | Ga0070700_100010186 | 3300005441 | Bacteria | 5184 |
| 100 | Ga0070663_100024148 | 3300005455 | Bacteria | 4086 |
| 101 | Ga0070663_100040245 | 3300005455 | Bacteria | 3271 |
| 102 | Ga0070663_100157716 | 3300005455 | Bacteria | 1745 |
| 103 | Ga0070678_100019785 | 3300005456 | Bacteria | 4400 |
| 104 | Ga0070678_100140937 | 3300005456 | Bacteria | 1929 |
| 105 | Ga0070678_100229439 | 3300005456 | Bacteria | 1547 |
| 106 | Ga0070662_100007273 | 3300005457 | Bacteria | 7174 |
| 107 | Ga0070662_100015432 | 3300005457 | Bacteria | 5117 |
| 108 | Ga0070681_10003004 | 3300005458 | Bacteria | 15654 |
| 109 | Ga0070681_10041744 | 3300005458 | Bacteria | 4599 |
| 110 | Ga0070681_10043431 | 3300005458 | Bacteria | 4503 |
| 111 | Ga0070681_10074174 | 3300005458 | Bacteria | 3364 |
| 112 | Ga0068867_100008050 | 3300005459 | Bacteria | 7449 |
| 113 | Ga0070706_100004341 | 3300005467 | Bacteria | 13715 |
| 114 | Ga0070706_100070700 | 3300005467 | Bacteria | 3228 |
| 115 | Ga0070707_100069853 | 3300005468 | Bacteria | 3382 |
| 116 | Ga0070707_100178664 | 3300005468 | Bacteria | 2069 |
| 117 | Ga0070707_100332979 | 3300005468 | Bacteria | 1475 |
| 118 | Ga0070698_100002205 | 3300005471 | Bacteria | 21598 |
| 119 | Ga0070698_100010603 | 3300005471 | Bacteria | 9817 |
| 120 | Ga0070698_100036593 | 3300005471 | Bacteria | 5068 |
| 121 | Ga0070679_100003703 | 3300005530 | Bacteria | 14009 |
| 122 | Ga0070679_100012146 | 3300005530 | Bacteria | 8227 |
| 123 | Ga0070679_100013183 | 3300005530 | Bacteria | 7914 |
| 124 | Ga0070679_100055836 | 3300005530 | Bacteria | 3934 |
| 125 | Ga0070679_100087398 | 3300005530 | Bacteria | 3104 |
| 126 | Ga0070684_100032029 | 3300005535 | Bacteria | 4478 |
| 127 | Ga0070684_100053278 | 3300005535 | Bacteria | 3521 |
| 128 | Ga0070684_100067991 | 3300005535 | Bacteria | 3130 |
| 129 | Ga0070684_100099709 | 3300005535 | Bacteria | 2593 |
| 130 | Ga0070684_100130315 | 3300005535 | Bacteria | 2268 |
| 131 | Ga0068853_100064870 | 3300005539 | Bacteria | 3168 |
| 132 | Ga0068853_100147353 | 3300005539 | Bacteria | 2116 |
| 133 | Ga0070672_100008591 | 3300005543 | Bacteria | 6993 |
| 134 | Ga0070695_100005591 | 3300005545 | Bacteria | 7402 |
| 135 | Ga0070665_100002967 | 3300005548 | Bacteria | 18327 |
| 136 | Ga0070665_100064400 | 3300005548 | Bacteria | 3676 |
| 137 | Ga0070665_100101717 | 3300005548 | Bacteria | 2878 |
| 138 | Ga0070665_100130858 | 3300005548 | Bacteria | 2512 |
| 139 | Ga0070704_100041196 | 3300005549 | Bacteria | 3186 |
| 140 | Ga0068855_100001428 | 3300005563 | Bacteria | 29696 |
| 141 | Ga0068855_100079030 | 3300005563 | Bacteria | 3816 |
| 142 | Ga0070664_100023722 | 3300005564 | Bacteria | 5066 |
| 143 | Ga0068857_100007045 | 3300005577 | Bacteria | 9679 |
| 144 | Ga0068857_100013000 | 3300005577 | Bacteria | 7252 |
| 145 | Ga0068857_100187880 | 3300005577 | Bacteria | 1881 |
| 146 | Ga0068857_100207577 | 3300005577 | Bacteria | 1787 |
| 147 | Ga0068854_100015333 | 3300005578 | Bacteria | 5074 |
| 148 | Ga0068856_100076027 | 3300005614 | Bacteria | 3327 |
| 149 | Ga0068856_100197911 | 3300005614 | Bacteria | 2024 |
| 150 | Ga0070702_100004888 | 3300005615 | Bacteria | 6171 |
| 151 | Ga0068852_100020429 | 3300005616 | Bacteria | 5267 |
| 152 | Ga0068859_100000067 | 3300005617 | Bacteria | 98013 |
| 153 | Ga0068859_100039334 | 3300005617 | Bacteria | 4744 |
| 154 | Ga0068859_100047695 | 3300005617 | Bacteria | 4304 |
| 155 | Ga0068859_100350487 | 3300005617 | Bacteria | 1571 |
| 156 | Ga0068861_100029657 | 3300005719 | Bacteria | 4003 |
| 157 | Ga0068861_100102696 | 3300005719 | Bacteria | 2277 |
| 158 | Ga0068861_100118255 | 3300005719 | Bacteria | 2134 |
| 159 | Ga0068851_10000025 | 3300005834 | Bacteria | 123782 |
| 160 | Ga0068870_10036993 | 3300005840 | Bacteria | 2514 |
| 161 | Ga0068863_100004056 | 3300005841 | Bacteria | 14461 |
| 162 | Ga0068863_100024933 | 3300005841 | Bacteria | 5704 |
| 163 | Ga0068863_100224579 | 3300005841 | Bacteria | 1810 |
| 164 | Ga0068863_100247885 | 3300005841 | Bacteria | 1720 |
| 165 | Ga0068858_100000001 | 3300005842 | Bacteria | 417735 |
| 166 | Ga0068858_100000073 | 3300005842 | Bacteria | 104882 |
| 167 | Ga0068858_100022212 | 3300005842 | Bacteria | 5925 |
| 168 | Ga0068860_100000160 | 3300005843 | Bacteria | 110266 |
| 169 | Ga0068860_100185576 | 3300005843 | Bacteria | 2011 |
| 170 | Ga0068860_100379660 | 3300005843 | Bacteria | 1395 |
| 171 | Ga0068862_100000061 | 3300005844 | Bacteria | 129972 |
| 172 | Ga0068862_100000131 | 3300005844 | Bacteria | 87720 |
| 173 | Ga0081455_10000159 | 3300005937 | Bacteria | 82220 |
| 174 | Ga0081455_10001413 | 3300005937 | Bacteria | 29717 |
| 175 | Ga0081455_10003874 | 3300005937 | Bacteria | 17047 |
| 176 | Ga0081455_10006383 | 3300005937 | Bacteria | 12657 |
| 177 | Ga0081455_10020441 | 3300005937 | Bacteria | 6233 |
| 178 | Ga0081455_10020874 | 3300005937 | Bacteria | 6156 |
| 179 | Ga0081455_10043153 | 3300005937 | Bacteria | 3949 |
| 180 | Ga0081455_10043453 | 3300005937 | Bacteria | 3930 |
| 181 | Ga0081455_10103941 | 3300005937 | Bacteria | 2273 |
| 182 | Ga0081455_10126898 | 3300005937 | Bacteria | 2000 |
| 183 | Ga0081538_10001163 | 3300005981 | Bacteria | 27775 |
| 184 | Ga0081538_10001523 | 3300005981 | Bacteria | 23782 |
| 185 | Ga0081538_10002152 | 3300005981 | Bacteria | 19604 |
| 186 | Ga0081538_10007077 | 3300005981 | Bacteria | 9748 |
| 187 | Ga0081538_10035352 | 3300005981 | Bacteria | 3284 |
| 188 | Ga0081538_10044152 | 3300005981 | Bacteria | 2784 |
| 189 | Ga0081540_1002855 | 3300005983 | Bacteria | 13990 |
| 190 | Ga0081540_1030633 | 3300005983 | Bacteria | 2976 |
| 191 | Ga0081540_1039207 | 3300005983 | Bacteria | 2486 |
| 192 | Ga0081539_10000205 | 3300005985 | Bacteria | 137262 |
| 193 | Ga0081539_10001811 | 3300005985 | Bacteria | 33775 |
| 194 | Ga0081539_10003373 | 3300005985 | Bacteria | 19777 |
| 195 | Ga0081539_10003816 | 3300005985 | Bacteria | 17715 |
| 196 | Ga0081539_10008555 | 3300005985 | Bacteria | 8857 |
| 197 | Ga0081539_10009590 | 3300005985 | Bacteria | 8046 |
| 198 | Ga0081539_10036960 | 3300005985 | Bacteria | 2915 |
| 199 | Ga0070717_10012997 | 3300006028 | Bacteria | 6359 |
| 200 | Ga0070717_10016221 | 3300006028 | Bacteria | 5772 |
| 201 | Ga0070717_10033577 | 3300006028 | Bacteria | 4140 |
| 202 | Ga0070717_10198024 | 3300006028 | Bacteria | 1758 |
| 203 | Ga0075365_10000486 | 3300006038 | Bacteria | 15093 |
| 204 | Ga0075365_10014721 | 3300006038 | Bacteria | 4710 |
| 205 | Ga0075365_10033347 | 3300006038 | Bacteria | 3317 |
| 206 | Ga0075365_10034752 | 3300006038 | Bacteria | 3257 |
| 207 | Ga0075365_10056700 | 3300006038 | Bacteria | 2605 |
| 208 | Ga0075365_10056989 | 3300006038 | Bacteria | 2599 |
| 209 | Ga0075365_10062852 | 3300006038 | Bacteria | 2484 |
| 210 | Ga0075365_10129814 | 3300006038 | Bacteria | 1744 |
| 211 | Ga0075368_10000878 | 3300006042 | Bacteria | 9319 |
| 212 | Ga0075363_100008537 | 3300006048 | Bacteria | 4776 |
| 213 | Ga0075363_100012931 | 3300006048 | Bacteria | 4031 |
| 214 | Ga0075363_100023615 | 3300006048 | Bacteria | 3119 |
| 215 | Ga0075363_100043142 | 3300006048 | Bacteria | 2385 |
| 216 | Ga0075363_100104540 | 3300006048 | Bacteria | 1570 |
| 217 | Ga0075363_100105059 | 3300006048 | Bacteria | 1566 |
| 218 | Ga0075363_100111867 | 3300006048 | Bacteria | 1518 |
| 219 | Ga0075364_10001480 | 3300006051 | Bacteria | 12798 |
| 220 | Ga0075364_10002322 | 3300006051 | Bacteria | 10666 |
| 221 | Ga0075364_10004050 | 3300006051 | Bacteria | 8418 |
| 222 | Ga0075364_10011600 | 3300006051 | Bacteria | 5357 |
| 223 | Ga0075432_10002641 | 3300006058 | Bacteria | 5980 |
| 224 | Ga0070716_100000703 | 3300006173 | Bacteria | 14262 |
| 225 | Ga0070716_100006125 | 3300006173 | Bacteria | 5867 |
| 226 | Ga0070712_100002734 | 3300006175 | Bacteria | 10892 |
| 227 | Ga0070712_100320632 | 3300006175 | Bacteria | 1260 |
| 228 | Ga0075362_10000684 | 3300006177 | Bacteria | 10015 |
| 229 | Ga0075367_10006299 | 3300006178 | Bacteria | 5982 |
| 230 | Ga0075367_10009909 | 3300006178 | Bacteria | 4992 |
| 231 | Ga0075367_10050343 | 3300006178 | Bacteria | 2459 |
| 232 | Ga0075367_10059194 | 3300006178 | Bacteria | 2280 |
| 233 | Ga0075367_10074734 | 3300006178 | Bacteria | 2043 |
| 234 | Ga0075367_10093752 | 3300006178 | Bacteria | 1829 |
| 235 | Ga0075369_10009130 | 3300006186 | Bacteria | 3842 |
| 236 | Ga0075370_10007490 | 3300006353 | Bacteria | 5562 |
| 237 | Ga0075370_10007584 | 3300006353 | Bacteria | 5532 |
| 238 | Ga0075428_100000389 | 3300006844 | Bacteria | 43497 |
| 239 | Ga0075428_100004341 | 3300006844 | Bacteria | 15638 |
| 240 | Ga0075428_100007979 | 3300006844 | Bacteria | 11744 |
| 241 | Ga0075428_100011245 | 3300006844 | Bacteria | 9961 |
| 242 | Ga0075428_100021756 | 3300006844 | Bacteria | 7100 |
| 243 | Ga0075428_100316310 | 3300006844 | Bacteria | 1678 |
| 244 | Ga0075430_100010091 | 3300006846 | Bacteria | 7992 |
| 245 | Ga0075430_100012981 | 3300006846 | Bacteria | 7100 |
| 246 | Ga0075430_100015263 | 3300006846 | Bacteria | 6540 |
| 247 | Ga0075430_100091383 | 3300006846 | Bacteria | 2545 |
| 248 | Ga0075431_100004396 | 3300006847 | Bacteria | 13822 |
| 249 | Ga0075431_100006800 | 3300006847 | Bacteria | 11360 |
| 250 | Ga0075431_100009948 | 3300006847 | Bacteria | 9553 |
| 251 | Ga0075431_100018477 | 3300006847 | Bacteria | 7100 |
| 252 | Ga0075431_100020488 | 3300006847 | Bacteria | 6755 |
| 253 | Ga0075431_100026181 | 3300006847 | Bacteria | 5983 |
| 254 | Ga0075431_100047653 | 3300006847 | Bacteria | 4418 |
| 255 | Ga0075431_100366333 | 3300006847 | Bacteria | 1447 |
| 256 | Ga0075431_100451928 | 3300006847 | Bacteria | 1280 |
| 257 | Ga0075433_10020188 | 3300006852 | Bacteria | 5565 |
| 258 | Ga0075434_100038493 | 3300006871 | Bacteria | 4736 |
| 259 | Ga0075429_100000908 | 3300006880 | Bacteria | 23437 |
| 260 | Ga0075429_100013442 | 3300006880 | Bacteria | 7100 |
| 261 | Ga0075429_100017753 | 3300006880 | Bacteria | 6153 |
| 262 | Ga0075429_100096524 | 3300006880 | Bacteria | 2578 |
| 263 | Ga0075429_100188247 | 3300006880 | Bacteria | 1809 |
| 264 | Ga0068865_100018317 | 3300006881 | Bacteria | 4516 |
| 265 | Ga0075436_100030029 | 3300006914 | Bacteria | 3740 |
| 266 | Ga0097620_100000067 | 3300006931 | Bacteria | 98013 |
| 267 | Ga0097620_100039334 | 3300006931 | Bacteria | 4744 |
| 268 | Ga0097620_100047694 | 3300006931 | Bacteria | 4304 |
| 269 | Ga0097620_100350465 | 3300006931 | Bacteria | 1571 |
| 270 | Ga0075435_100004795 | 3300007076 | Bacteria | 9351 |
| 271 | Ga0075435_100048185 | 3300007076 | Bacteria | 3423 |
| 272 | Ga0075435_100185124 | 3300007076 | Bacteria | 1761 |
| 273 | Ga0105251_10003753 | 3300009011 | Bacteria | 10872 |
| 274 | Ga0105251_10003783 | 3300009011 | Bacteria | 10816 |
| 275 | Ga0105244_10001928 | 3300009036 | Bacteria | 16123 |
| 276 | Ga0105244_10012472 | 3300009036 | Bacteria | 5019 |
| 277 | Ga0105250_10043082 | 3300009092 | Bacteria | 1809 |
| 278 | Ga0105240_10042031 | 3300009093 | Bacteria | 5827 |
| 279 | Ga0111539_10005032 | 3300009094 | Bacteria | 17184 |
| 280 | Ga0111539_10005100 | 3300009094 | Bacteria | 17037 |
| 281 | Ga0111539_10010425 | 3300009094 | Bacteria | 11695 |
| 282 | Ga0111539_10017829 | 3300009094 | Bacteria | 8791 |
| 283 | Ga0111539_10110689 | 3300009094 | Bacteria | 3222 |
| 284 | Ga0111539_10348652 | 3300009094 | Bacteria | 1723 |
| 285 | Ga0105245_10004977 | 3300009098 | Bacteria | 11683 |
| 286 | Ga0105245_10006307 | 3300009098 | Bacteria | 10438 |
| 287 | Ga0105245_10067457 | 3300009098 | Bacteria | 3240 |
| 288 | Ga0105245_10107343 | 3300009098 | Bacteria | 2592 |
| 289 | Ga0105245_10172357 | 3300009098 | Bacteria | 2061 |
| 290 | Ga0105245_10178526 | 3300009098 | Bacteria | 2027 |
| 291 | Ga0105245_10200160 | 3300009098 | Bacteria | 1918 |
| 292 | Ga0105247_10000024 | 3300009101 | Bacteria | 210946 |
| 293 | Ga0105247_10000078 | 3300009101 | Bacteria | 110404 |
| 294 | Ga0105247_10009918 | 3300009101 | Bacteria | 5769 |
| 295 | Ga0105247_10076014 | 3300009101 | Bacteria | 2108 |
| 296 | Ga0114129_10000039 | 3300009147 | Bacteria | 108531 |
| 297 | Ga0114129_10000131 | 3300009147 | Bacteria | 76741 |
| 298 | Ga0114129_10000932 | 3300009147 | Bacteria | 38196 |
| 299 | Ga0114129_10002109 | 3300009147 | Bacteria | 27389 |
| 300 | Ga0114129_10048876 | 3300009147 | Bacteria | 5945 |
| 301 | Ga0114129_10281097 | 3300009147 | Bacteria | 2224 |
| 302 | Ga0114129_10336013 | 3300009147 | Bacteria | 2005 |
| 303 | Ga0105243_10029942 | 3300009148 | Bacteria | 4189 |
| 304 | Ga0105243_10036949 | 3300009148 | Bacteria | 3793 |
| 305 | Ga0105243_10040731 | 3300009148 | Bacteria | 3630 |
| 306 | Ga0105243_10072185 | 3300009148 | Bacteria | 2793 |
| 307 | Ga0105243_10396929 | 3300009148 | Bacteria | 1280 |
| 308 | Ga0105241_10021369 | 3300009174 | Bacteria | 4784 |
| 309 | Ga0105242_10041626 | 3300009176 | Bacteria | 3706 |
| 310 | Ga0105248_10000055 | 3300009177 | Bacteria | 141968 |
| 311 | Ga0105248_10000082 | 3300009177 | Bacteria | 110759 |
| 312 | Ga0105248_10000529 | 3300009177 | Bacteria | 43587 |
| 313 | Ga0105248_10004955 | 3300009177 | Bacteria | 14715 |
| 314 | Ga0105248_10009087 | 3300009177 | Bacteria | 10930 |
| 315 | Ga0105248_10019185 | 3300009177 | Bacteria | 7565 |
| 316 | Ga0105248_10165622 | 3300009177 | Bacteria | 2492 |
| 317 | Ga0105248_10623057 | 3300009177 | Bacteria | 1217 |
| 318 | Ga0105237_10000308 | 3300009545 | Bacteria | 67971 |
| 319 | Ga0105237_10016427 | 3300009545 | Bacteria | 7690 |
| 320 | Ga0105238_10008834 | 3300009551 | Bacteria | 10078 |
| 321 | Ga0105238_10369110 | 3300009551 | Bacteria | 1425 |
| 322 | Ga0105249_10000031 | 3300009553 | Bacteria | 220006 |
| 323 | Ga0105249_10001144 | 3300009553 | Bacteria | 23483 |
| 324 | Ga0105249_10018272 | 3300009553 | Bacteria | 6233 |
| 325 | Ga0105249_10136450 | 3300009553 | Bacteria | 2348 |
| 326 | Ga0105249_10164022 | 3300009553 | Bacteria | 2150 |
| 327 | Ga0105239_10007263 | 3300010375 | Bacteria | 12726 |
| 328 | Ga0105239_10008306 | 3300010375 | Bacteria | 11834 |
| 329 | Ga0105239_10118655 | 3300010375 | Bacteria | 2936 |
| 330 | Ga0105239_10433460 | 3300010375 | Bacteria | 1490 |
| 331 | Ga0105246_10001132 | 3300011119 | Bacteria | 15464 |
| 332 | Ga0105246_10002305 | 3300011119 | Bacteria | 11521 |
| 333 | Ga0105246_10002378 | 3300011119 | Bacteria | 11346 |
| 334 | Ga0105246_10032742 | 3300011119 | Bacteria | 3450 |
| 335 | Ga0105246_10034427 | 3300011119 | Bacteria | 3375 |
| 336 | Ga0105246_10187408 | 3300011119 | Bacteria | 1598 |
| 337 | Ga0157371_10027112 | 3300013102 | Bacteria | 4158 |
| 338 | Ga0157370_10025167 | 3300013104 | Bacteria | 5891 |
| 339 | Ga0157370_10026798 | 3300013104 | Bacteria | 5685 |
| 340 | Ga0157370_10139184 | 3300013104 | Bacteria | 2262 |
| 341 | Ga0157369_10000422 | 3300013105 | Bacteria | 56065 |
| 342 | Ga0157369_10001067 | 3300013105 | Bacteria | 34384 |
| 343 | Ga0157369_10001126 | 3300013105 | Bacteria | 33440 |
| 344 | Ga0157369_10006480 | 3300013105 | Bacteria | 13565 |
| 345 | Ga0157369_10028541 | 3300013105 | Bacteria | 6176 |
| 346 | Ga0157369_10038886 | 3300013105 | Bacteria | 5200 |
| 347 | Ga0157369_10045621 | 3300013105 | Bacteria | 4765 |
| 348 | Ga0157369_10052990 | 3300013105 | Bacteria | 4387 |
| 349 | Ga0157369_10082912 | 3300013105 | Bacteria | 3430 |
| 350 | Ga0157369_10154305 | 3300013105 | Bacteria | 2426 |
| 351 | Ga0157369_10177108 | 3300013105 | Bacteria | 2245 |
| 352 | Ga0171462_1004 | 3300013250 | Bacteria | 678877 |
| 353 | Ga0157374_10424739 | 3300013296 | Bacteria | 1328 |
| 354 | Ga0163162_10022417 | 3300013306 | Bacteria | 6222 |
| 355 | Ga0163162_10055426 | 3300013306 | Bacteria | 3991 |
| 356 | Ga0163162_10108128 | 3300013306 | Bacteria | 2877 |
| 357 | Ga0157372_10003775 | 3300013307 | Bacteria | 16262 |
| 358 | Ga0157372_10073291 | 3300013307 | Bacteria | 3860 |
| 359 | Ga0157372_10094569 | 3300013307 | Bacteria | 3403 |
| 360 | Ga0157372_10121930 | 3300013307 | Bacteria | 2995 |
| 361 | Ga0157372_10202469 | 3300013307 | Bacteria | 2300 |
| 362 | Ga0157372_10289668 | 3300013307 | Bacteria | 1904 |
| 363 | Ga0157372_10426996 | 3300013307 | Bacteria | 1545 |
| 364 | Ga0157375_10004628 | 3300013308 | Bacteria | 11955 |
| 365 | Ga0157375_10028843 | 3300013308 | Bacteria | 5210 |
| 366 | Ga0157375_10109120 | 3300013308 | Bacteria | 2863 |
| 367 | Ga0157375_10185198 | 3300013308 | Bacteria | 2235 |
| 368 | Ga0157375_10195676 | 3300013308 | Bacteria | 2177 |
| 369 | Ga0157375_10361725 | 3300013308 | Bacteria | 1617 |
| 370 | Ga0163163_10014442 | 3300014325 | Bacteria | 7260 |
| 371 | Ga0163163_10032958 | 3300014325 | Bacteria | 5007 |
| 372 | Ga0163163_10112269 | 3300014325 | Bacteria | 2755 |
| 373 | Ga0163163_10141673 | 3300014325 | Bacteria | 2447 |
| 374 | Ga0163163_10471369 | 3300014325 | Bacteria | 1316 |
| 375 | Ga0157380_10117172 | 3300014326 | Bacteria | 2249 |
| 376 | Ga0182008_10041266 | 3300014497 | Bacteria | 2302 |
| 377 | Ga0182008_10050302 | 3300014497 | Bacteria | 2068 |
| 378 | Ga0157377_10012796 | 3300014745 | Bacteria | 4229 |
| 379 | Ga0157377_10044816 | 3300014745 | Bacteria | 2468 |
| 380 | Ga0157379_10000059 | 3300014968 | Bacteria | 69772 |
| 381 | Ga0157379_10000289 | 3300014968 | Bacteria | 39807 |
| 382 | Ga0157379_10002960 | 3300014968 | Bacteria | 14328 |
| 383 | Ga0157379_10012749 | 3300014968 | Bacteria | 7351 |
| 384 | Ga0182007_10031963 | 3300015262 | Bacteria | 1790 |
| 385 | Ga0182007_10038282 | 3300015262 | Bacteria | 1609 |
| 386 | Ga0163161_10037148 | 3300017792 | Bacteria | 3491 |
| 387 | Ga0197907_10031078 | 3300020069 | Bacteria | 1463 |
| 388 | Ga0197907_10410903 | 3300020069 | Bacteria | 1533 |
| 389 | Ga0206356_10755570 | 3300020070 | Bacteria | 2682 |
| 390 | Ga0206356_11644942 | 3300020070 | Bacteria | 2159 |
| 391 | Ga0206351_10447535 | 3300020077 | Bacteria | 1379 |
| 392 | Ga0206350_10967704 | 3300020080 | Bacteria | 1845 |
| 393 | Ga0206354_10323126 | 3300020081 | Bacteria | 1739 |
| 394 | Ga0206354_10773930 | 3300020081 | Bacteria | 3591 |
| 395 | Ga0206354_10785617 | 3300020081 | Bacteria | 2774 |
| 396 | Ga0206354_11275952 | 3300020081 | Bacteria | 1408 |
| 397 | Ga0206354_11281303 | 3300020081 | Bacteria | 13672 |
| 398 | Ga0206353_10110127 | 3300020082 | Bacteria | 2191 |
| 399 | Ga0206353_10404455 | 3300020082 | Bacteria | 11000 |
| 400 | Ga0206353_10623844 | 3300020082 | Bacteria | 2051 |
| 401 | Ga0206353_10717728 | 3300020082 | Bacteria | 1262 |
| 402 | Ga0206353_11446185 | 3300020082 | Bacteria | 1892 |
| 403 | Ga0206353_11629272 | 3300020082 | Bacteria | 1691 |
| 404 | Ga0206353_12032015 | 3300020082 | Bacteria | 2710 |
| 405 | Ga0213876_10015875 | 3300021384 | Bacteria | 3985 |
| 406 | Ga0213876_10032087 | 3300021384 | Bacteria | 2771 |
| 407 | Ga0213875_10009163 | 3300021388 | Bacteria | 5025 |
| 408 | Ga0213875_10009179 | 3300021388 | Bacteria | 5019 |
| 409 | Ga0213875_10016007 | 3300021388 | Bacteria | 3641 |
| 410 | Ga0213875_10030369 | 3300021388 | Bacteria | 2558 |
| 411 | Ga0224712_10001604 | 3300022467 | Bacteria | 5304 |
| 412 | Ga0224712_10016756 | 3300022467 | Bacteria | 2414 |
| 413 | Ga0209563_100349 | 3300025230 | Bacteria | 17553 |
| 414 | Ga0209129_1000109 | 3300025258 | Bacteria | 153068 |
| 415 | Ga0209025_1000984 | 3300025294 | Bacteria | 42427 |
| 416 | Ga0207426_1017639 | 3300025302 | Bacteria | 2532 |
| 417 | Ga0209051_1001258 | 3300025303 | Bacteria | 22641 |
| 418 | Ga0207697_10004003 | 3300025315 | Bacteria | 7142 |
| 419 | Ga0207656_10000001 | 3300025321 | Bacteria | 1323684 |
| 420 | Ga0207696_1018500 | 3300025711 | Bacteria | 2285 |
| 421 | Ga0207655_1008569 | 3300025728 | Bacteria | 6473 |
| 422 | Ga0207655_1008906 | 3300025728 | Bacteria | 6303 |
| 423 | Ga0207655_1022210 | 3300025728 | Bacteria | 3190 |
| 424 | Ga0207713_1029743 | 3300025735 | Bacteria | 2441 |
| 425 | Ga0207682_10005812 | 3300025893 | Bacteria | 4999 |
| 426 | Ga0207692_10000890 | 3300025898 | Bacteria | 10798 |
| 427 | Ga0207692_10002582 | 3300025898 | Bacteria | 6961 |
| 428 | Ga0207692_10004306 | 3300025898 | Bacteria | 5628 |
| 429 | Ga0207642_10038384 | 3300025899 | Bacteria | 2072 |
| 430 | Ga0207710_10000022 | 3300025900 | Bacteria | 335632 |
| 431 | Ga0207710_10000045 | 3300025900 | Bacteria | 210957 |
| 432 | Ga0207710_10000249 | 3300025900 | Bacteria | 45249 |
| 433 | Ga0207710_10060310 | 3300025900 | Bacteria | 1719 |
| 434 | Ga0207688_10008035 | 3300025901 | Bacteria | 5741 |
| 435 | Ga0207647_10018358 | 3300025904 | Bacteria | 4734 |
| 436 | Ga0207647_10031102 | 3300025904 | Bacteria | 3437 |
| 437 | Ga0207647_10038168 | 3300025904 | Bacteria | 3039 |
| 438 | Ga0207685_10102201 | 3300025905 | Bacteria | 1227 |
| 439 | Ga0207699_10000452 | 3300025906 | Bacteria | 20998 |
| 440 | Ga0207699_10018969 | 3300025906 | Bacteria | 3656 |
| 441 | Ga0207699_10063482 | 3300025906 | Bacteria | 2231 |
| 442 | Ga0207699_10113570 | 3300025906 | Bacteria | 1740 |
| 443 | Ga0207645_10000233 | 3300025907 | Bacteria | 46095 |
| 444 | Ga0207645_10030709 | 3300025907 | Bacteria | 3462 |
| 445 | Ga0207643_10005573 | 3300025908 | Bacteria | 6728 |
| 446 | Ga0207705_10001165 | 3300025909 | Bacteria | 21410 |
| 447 | Ga0207705_10002204 | 3300025909 | Bacteria | 15064 |
| 448 | Ga0207705_10008166 | 3300025909 | Bacteria | 7664 |
| 449 | Ga0207705_10137202 | 3300025909 | Bacteria | 1824 |
| 450 | Ga0207684_10026114 | 3300025910 | Bacteria | 4977 |
| 451 | Ga0207654_10011007 | 3300025911 | Bacteria | 4603 |
| 452 | Ga0207707_10000376 | 3300025912 | Bacteria | 46648 |
| 453 | Ga0207707_10010705 | 3300025912 | Bacteria | 7969 |
| 454 | Ga0207707_10054680 | 3300025912 | Bacteria | 3475 |
| 455 | Ga0207707_10056837 | 3300025912 | Bacteria | 3405 |
| 456 | Ga0207695_10005783 | 3300025913 | Bacteria | 16280 |
| 457 | Ga0207695_10216505 | 3300025913 | Bacteria | 1824 |
| 458 | Ga0207671_10000001 | 3300025914 | Bacteria | 1318881 |
| 459 | Ga0207671_10000216 | 3300025914 | Bacteria | 86159 |
| 460 | Ga0207671_10007161 | 3300025914 | Bacteria | 9727 |
| 461 | Ga0207693_10000318 | 3300025915 | Bacteria | 44789 |
| 462 | Ga0207693_10002107 | 3300025915 | Bacteria | 17358 |
| 463 | Ga0207693_10009636 | 3300025915 | Bacteria | 7865 |
| 464 | Ga0207693_10169868 | 3300025915 | Bacteria | 1717 |
| 465 | Ga0207663_10136242 | 3300025916 | Bacteria | 1704 |
| 466 | Ga0207663_10177271 | 3300025916 | Bacteria | 1519 |
| 467 | Ga0207663_10260913 | 3300025916 | Bacteria | 1279 |
| 468 | Ga0207660_10000754 | 3300025917 | Bacteria | 21515 |
| 469 | Ga0207660_10017022 | 3300025917 | Bacteria | 4822 |
| 470 | Ga0207660_10071902 | 3300025917 | Bacteria | 2518 |
| 471 | Ga0207660_10243374 | 3300025917 | Bacteria | 1418 |
| 472 | Ga0207662_10011022 | 3300025918 | Bacteria | 5002 |
| 473 | Ga0207657_10001578 | 3300025919 | Bacteria | 24478 |
| 474 | Ga0207657_10025004 | 3300025919 | Bacteria | 5517 |
| 475 | Ga0207657_10049197 | 3300025919 | Bacteria | 3676 |
| 476 | Ga0207657_10072049 | 3300025919 | Bacteria | 2924 |
| 477 | Ga0207657_10133726 | 3300025919 | Bacteria | 2031 |
| 478 | Ga0207649_10006873 | 3300025920 | Bacteria | 6182 |
| 479 | Ga0207652_10000591 | 3300025921 | Bacteria | 36343 |
| 480 | Ga0207652_10004252 | 3300025921 | Bacteria | 11682 |
| 481 | Ga0207652_10032574 | 3300025921 | Bacteria | 4384 |
| 482 | Ga0207652_10067633 | 3300025921 | Bacteria | 3098 |
| 483 | Ga0207652_10119121 | 3300025921 | Bacteria | 2348 |
| 484 | Ga0207652_10202293 | 3300025921 | Bacteria | 1787 |
| 485 | Ga0207646_10437409 | 3300025922 | Bacteria | 1180 |
| 486 | Ga0207681_10004026 | 3300025923 | Bacteria | 9117 |
| 487 | Ga0207694_10000052 | 3300025924 | Bacteria | 157700 |
| 488 | Ga0207694_10002482 | 3300025924 | Bacteria | 15012 |
| 489 | Ga0207694_10334333 | 3300025924 | Bacteria | 1252 |
| 490 | Ga0207650_10143136 | 3300025925 | Bacteria | 1881 |
| 491 | Ga0207659_10021801 | 3300025926 | Bacteria | 4260 |
| 492 | Ga0207659_10023126 | 3300025926 | Bacteria | 4145 |
| 493 | Ga0207687_10015080 | 3300025927 | Bacteria | 5061 |
| 494 | Ga0207687_10055033 | 3300025927 | Bacteria | 2786 |
| 495 | Ga0207687_10127963 | 3300025927 | Bacteria | 1910 |
| 496 | Ga0207687_10152794 | 3300025927 | Bacteria | 1763 |
| 497 | Ga0207700_10000250 | 3300025928 | Bacteria | 32146 |
| 498 | Ga0207700_10006774 | 3300025928 | Bacteria | 6962 |
| 499 | Ga0207700_10017655 | 3300025928 | Bacteria | 4771 |
| 500 | Ga0207700_10055708 | 3300025928 | Bacteria | 2972 |
| 501 | Ga0207700_10235875 | 3300025928 | Bacteria | 1557 |
| 502 | Ga0207664_10003365 | 3300025929 | Bacteria | 10634 |
| 503 | Ga0207664_10010336 | 3300025929 | Bacteria | 6592 |
| 504 | Ga0207664_10047601 | 3300025929 | Bacteria | 3370 |
| 505 | Ga0207664_10054835 | 3300025929 | Bacteria | 3160 |
| 506 | Ga0207664_10061277 | 3300025929 | Bacteria | 3001 |
| 507 | Ga0207664_10096040 | 3300025929 | Bacteria | 2439 |
| 508 | Ga0207664_10125022 | 3300025929 | Bacteria | 2158 |
| 509 | Ga0207664_10255118 | 3300025929 | Bacteria | 1532 |
| 510 | Ga0207664_10350152 | 3300025929 | Bacteria | 1307 |
| 511 | Ga0207644_10026394 | 3300025931 | Bacteria | 4002 |
| 512 | Ga0207690_10057057 | 3300025932 | Bacteria | 2637 |
| 513 | Ga0207706_10031749 | 3300025933 | Bacteria | 4703 |
| 514 | Ga0207706_10079844 | 3300025933 | Bacteria | 2877 |
| 515 | Ga0207709_10008158 | 3300025935 | Bacteria | 5800 |
| 516 | Ga0207709_10025391 | 3300025935 | Bacteria | 3391 |
| 517 | Ga0207709_10107809 | 3300025935 | Bacteria | 1856 |
| 518 | Ga0207669_10004037 | 3300025937 | Bacteria | 6424 |
| 519 | Ga0207669_10086815 | 3300025937 | Bacteria | 2024 |
| 520 | Ga0207669_10105698 | 3300025937 | Bacteria | 1873 |
| 521 | Ga0207704_10102974 | 3300025938 | Bacteria | 1908 |
| 522 | Ga0207665_10006709 | 3300025939 | Bacteria | 7634 |
| 523 | Ga0207665_10017534 | 3300025939 | Bacteria | 4706 |
| 524 | Ga0207665_10102803 | 3300025939 | Bacteria | 1997 |
| 525 | Ga0207691_10008796 | 3300025940 | Bacteria | 9683 |
| 526 | Ga0207691_10015983 | 3300025940 | Bacteria | 7130 |
| 527 | Ga0207691_10106923 | 3300025940 | Bacteria | 2491 |
| 528 | Ga0207691_10160805 | 3300025940 | Bacteria | 1970 |
| 529 | Ga0207711_10000030 | 3300025941 | Bacteria | 206250 |
| 530 | Ga0207711_10000537 | 3300025941 | Bacteria | 38776 |
| 531 | Ga0207711_10000984 | 3300025941 | Bacteria | 27321 |
| 532 | Ga0207711_10143468 | 3300025941 | Bacteria | 2150 |
| 533 | Ga0207711_10180524 | 3300025941 | Bacteria | 1919 |
| 534 | Ga0207711_10185668 | 3300025941 | Bacteria | 1893 |
| 535 | Ga0207689_10005246 | 3300025942 | Bacteria | 11627 |
| 536 | Ga0207689_10015663 | 3300025942 | Bacteria | 6420 |
| 537 | Ga0207689_10225787 | 3300025942 | Bacteria | 1548 |
| 538 | Ga0207661_10049543 | 3300025944 | Bacteria | 3343 |
| 539 | Ga0207661_10065411 | 3300025944 | Bacteria | 2951 |
| 540 | Ga0207661_10108019 | 3300025944 | Bacteria | 2348 |
| 541 | Ga0207661_10268776 | 3300025944 | Bacteria | 1521 |
| 542 | Ga0207661_10312331 | 3300025944 | Bacteria | 1411 |
| 543 | Ga0207679_10005355 | 3300025945 | Bacteria | 8044 |
| 544 | Ga0207667_10140104 | 3300025949 | Bacteria | 2490 |
| 545 | Ga0207712_10000029 | 3300025961 | Bacteria | 220014 |
| 546 | Ga0207712_10166044 | 3300025961 | Bacteria | 1721 |
| 547 | Ga0207668_10000831 | 3300025972 | Bacteria | 18686 |
| 548 | Ga0207640_10097971 | 3300025981 | Bacteria | 2048 |
| 549 | Ga0207658_10001194 | 3300025986 | Bacteria | 20724 |
| 550 | Ga0207677_10004264 | 3300026023 | Bacteria | 7647 |
| 551 | Ga0207677_10084079 | 3300026023 | Bacteria | 2293 |
| 552 | Ga0207703_10000007 | 3300026035 | Bacteria | 418220 |
| 553 | Ga0207703_10000025 | 3300026035 | Bacteria | 214692 |
| 554 | Ga0207703_10027058 | 3300026035 | Bacteria | 4517 |
| 555 | Ga0207703_10113321 | 3300026035 | Bacteria | 2317 |
| 556 | Ga0207703_10158718 | 3300026035 | Bacteria | 1979 |
| 557 | Ga0207703_10223235 | 3300026035 | Bacteria | 1686 |
| 558 | Ga0207639_10111830 | 3300026041 | Bacteria | 2227 |
| 559 | Ga0207678_10006441 | 3300026067 | Bacteria | 10414 |
| 560 | Ga0207678_10046758 | 3300026067 | Bacteria | 3743 |
| 561 | Ga0207708_10001321 | 3300026075 | Bacteria | 18631 |
| 562 | Ga0207702_10065625 | 3300026078 | Bacteria | 3109 |
| 563 | Ga0207702_10068786 | 3300026078 | Bacteria | 3043 |
| 564 | Ga0207702_10252232 | 3300026078 | Bacteria | 1657 |
| 565 | Ga0207641_10003684 | 3300026088 | Bacteria | 13499 |
| 566 | Ga0207641_10097909 | 3300026088 | Bacteria | 2579 |
| 567 | Ga0207648_10007694 | 3300026089 | Bacteria | 10542 |
| 568 | Ga0207676_10208312 | 3300026095 | Bacteria | 1733 |
| 569 | Ga0207674_10006951 | 3300026116 | Bacteria | 13248 |
| 570 | Ga0207674_10009685 | 3300026116 | Bacteria | 10983 |
| 571 | Ga0207674_10015743 | 3300026116 | Bacteria | 8296 |
| 572 | Ga0207674_10074159 | 3300026116 | Bacteria | 3415 |
| 573 | Ga0207675_100004867 | 3300026118 | Bacteria | 12941 |
| 574 | Ga0207675_100025855 | 3300026118 | Bacteria | 5461 |
| 575 | Ga0207675_100028903 | 3300026118 | Bacteria | 5165 |
| 576 | Ga0207675_100094919 | 3300026118 | Bacteria | 2806 |
| 577 | Ga0207675_100169101 | 3300026118 | Bacteria | 2089 |
| 578 | Ga0207683_10021922 | 3300026121 | Bacteria | 5480 |
| 579 | Ga0207683_10024767 | 3300026121 | Bacteria | 5170 |
| 580 | Ga0207683_10116141 | 3300026121 | Bacteria | 2399 |
| 581 | Ga0207683_10136562 | 3300026121 | Bacteria | 2207 |
| 582 | Ga0207683_10155475 | 3300026121 | Bacteria | 2065 |
| 583 | Ga0207698_10002488 | 3300026142 | Bacteria | 10926 |
| 584 | Ga0209813_10011294 | 3300027866 | Bacteria | 2331 |
| 585 | Ga0209813_10017570 | 3300027866 | Bacteria | 1965 |
| 586 | Ga0207428_10001881 | 3300027907 | Bacteria | 21371 |
| 587 | Ga0207428_10007432 | 3300027907 | Bacteria | 9990 |
| 588 | Ga0207428_10011894 | 3300027907 | Bacteria | 7664 |
| 589 | Ga0207428_10059544 | 3300027907 | Bacteria | 3028 |
| 590 | Ga0268266_10003905 | 3300028379 | Bacteria | 14494 |
| 591 | Ga0268266_10028674 | 3300028379 | Bacteria | 4731 |
| 592 | Ga0268266_10111773 | 3300028379 | Bacteria | 2421 |
| 593 | Ga0268266_10406801 | 3300028379 | Bacteria | 1288 |
| 594 | Ga0268265_10000040 | 3300028380 | Bacteria | 194156 |
| 595 | Ga0268265_10000721 | 3300028380 | Bacteria | 32446 |
| 596 | Ga0268264_10000017 | 3300028381 | Bacteria | 498037 |
| 597 | Ga0268264_10280490 | 3300028381 | Bacteria | 1560 |
| 598 | Ga0265337_1000015 | 3300028556 | Bacteria | 80871 |
| 599 | Ga0265326_10006985 | 3300028558 | Bacteria | 3479 |
| 600 | Ga0265319_1003575 | 3300028563 | Bacteria | 8064 |
| 601 | Ga0265334_10000328 | 3300028573 | Bacteria | 25639 |
| 602 | Ga0265334_10002545 | 3300028573 | Bacteria | 8514 |
| 603 | Ga0265318_10004466 | 3300028577 | Bacteria | 6774 |
| 604 | Ga0265318_10025592 | 3300028577 | Bacteria | 2329 |
| 605 | Ga0265318_10049013 | 3300028577 | Bacteria | 1590 |
| 606 | Ga0265323_10028082 | 3300028653 | Bacteria | 2110 |
| 607 | Ga0265322_10020887 | 3300028654 | Bacteria | 1876 |
| 608 | Ga0265336_10018156 | 3300028666 | Bacteria | 2282 |
| 609 | Ga0307517_10089007 | 3300028786 | Bacteria | 2546 |
| 610 | Ga0307515_10000379 | 3300028794 | Bacteria | 108548 |
| 611 | Ga0307515_10000732 | 3300028794 | Bacteria | 75720 |
| 612 | Ga0307515_10033054 | 3300028794 | Bacteria | 8536 |
| 613 | Ga0307515_10038784 | 3300028794 | Bacteria | 7604 |
| 614 | Ga0307515_10221688 | 3300028794 | Bacteria | 1707 |
| 615 | Ga0265338_10000073 | 3300028800 | Bacteria | 181521 |
| 616 | Ga0265338_10000767 | 3300028800 | Bacteria | 54778 |
| 617 | Ga0265338_10005370 | 3300028800 | Bacteria | 16751 |
| 618 | Ga0265338_10008838 | 3300028800 | Bacteria | 12154 |
| 619 | Ga0265338_10029943 | 3300028800 | Bacteria | 5381 |
| 620 | Ga0265324_10006721 | 3300029957 | Bacteria | 4750 |
| 621 | Ga0307511_10002182 | 3300030521 | Bacteria | 20560 |
| 622 | Ga0307511_10070493 | 3300030521 | Bacteria | 2559 |
| 623 | Ga0307512_10003334 | 3300030522 | Bacteria | 18844 |
| 624 | Ga0307512_10005672 | 3300030522 | Bacteria | 12892 |
| 625 | Ga0307512_10009307 | 3300030522 | Bacteria | 9474 |
| 626 | Ga0307512_10017588 | 3300030522 | Bacteria | 6552 |
| 627 | Ga0316181_1197229 | 3300030744 | Bacteria | 3084 |
| 628 | Ga0265320_10005644 | 3300031240 | Bacteria | 7993 |
| 629 | Ga0265320_10006011 | 3300031240 | Bacteria | 7714 |
| 630 | Ga0265320_10008148 | 3300031240 | Bacteria | 6437 |
| 631 | Ga0265325_10001073 | 3300031241 | Bacteria | 19703 |
| 632 | Ga0265325_10022527 | 3300031241 | Bacteria | 3450 |
| 633 | Ga0265325_10024264 | 3300031241 | Bacteria | 3301 |
| 634 | Ga0265340_10000565 | 3300031247 | Bacteria | 20551 |
| 635 | Ga0265340_10002581 | 3300031247 | Bacteria | 10284 |
| 636 | Ga0265339_10002688 | 3300031249 | Bacteria | 12643 |
| 637 | Ga0265339_10009462 | 3300031249 | Bacteria | 6127 |
| 638 | Ga0265339_10033756 | 3300031249 | Bacteria | 2879 |
| 639 | Ga0265339_10076679 | 3300031249 | Bacteria | 1772 |
| 640 | Ga0265327_10000001 | 3300031251 | Bacteria | 894475 |
| 641 | Ga0265327_10001602 | 3300031251 | Bacteria | 27454 |
| 642 | Ga0265327_10017868 | 3300031251 | Bacteria | 4424 |
| 643 | Ga0265327_10028282 | 3300031251 | Bacteria | 3211 |
| 644 | Ga0265327_10039390 | 3300031251 | Bacteria | 2567 |
| 645 | Ga0265316_10029288 | 3300031344 | Bacteria | 4529 |
| 646 | Ga0265316_10048500 | 3300031344 | Bacteria | 3351 |
| 647 | Ga0307513_10000163 | 3300031456 | Bacteria | 95775 |
| 648 | Ga0307513_10002467 | 3300031456 | Bacteria | 25604 |
| 649 | Ga0307513_10009749 | 3300031456 | Bacteria | 12129 |
| 650 | Ga0307513_10012802 | 3300031456 | Bacteria | 10329 |
| 651 | Ga0307509_10004994 | 3300031507 | Bacteria | 18718 |
| 652 | Ga0307509_10033071 | 3300031507 | Bacteria | 5694 |
| 653 | Ga0307509_10059047 | 3300031507 | Bacteria | 4059 |
| 654 | Ga0307509_10124736 | 3300031507 | Bacteria | 2544 |
| 655 | Ga0307408_100004432 | 3300031548 | Bacteria | 9530 |
| 656 | Ga0307408_100005591 | 3300031548 | Bacteria | 8404 |
| 657 | Ga0307408_100008967 | 3300031548 | Bacteria | 6608 |
| 658 | Ga0307408_100010273 | 3300031548 | Bacteria | 6175 |
| 659 | Ga0307408_100012300 | 3300031548 | Bacteria | 5666 |
| 660 | Ga0307408_100014274 | 3300031548 | Bacteria | 5277 |
| 661 | Ga0307408_100071569 | 3300031548 | Bacteria | 2564 |
| 662 | Ga0307408_100101821 | 3300031548 | Bacteria | 2189 |
| 663 | Ga0307408_100103867 | 3300031548 | Bacteria | 2170 |
| 664 | Ga0307408_100114861 | 3300031548 | Bacteria | 2075 |
| 665 | Ga0307408_100160846 | 3300031548 | Bacteria | 1783 |
| 666 | Ga0307408_100201203 | 3300031548 | Bacteria | 1612 |
| 667 | Ga0265313_10000614 | 3300031595 | Bacteria | 36958 |
| 668 | Ga0265313_10028421 | 3300031595 | Bacteria | 2907 |
| 669 | Ga0307508_10002053 | 3300031616 | Bacteria | 21741 |
| 670 | Ga0307508_10005976 | 3300031616 | Bacteria | 11480 |
| 671 | Ga0307508_10018562 | 3300031616 | Bacteria | 6321 |
| 672 | Ga0307508_10094044 | 3300031616 | Bacteria | 2588 |
| 673 | Ga0307508_10118451 | 3300031616 | Bacteria | 2249 |
| 674 | Ga0307508_10267593 | 3300031616 | Bacteria | 1303 |
| 675 | Ga0307514_10001479 | 3300031649 | Bacteria | 28450 |
| 676 | Ga0307514_10008804 | 3300031649 | Bacteria | 8542 |
| 677 | Ga0307514_10016383 | 3300031649 | Bacteria | 6106 |
| 678 | Ga0307514_10113967 | 3300031649 | Bacteria | 1906 |
| 679 | Ga0316575_10001935 | 3300031665 | Bacteria | 6851 |
| 680 | Ga0316579_10000014 | 3300031691 | Bacteria | 39927 |
| 681 | Ga0316579_10020088 | 3300031691 | Bacteria | 2957 |
| 682 | Ga0265314_10008595 | 3300031711 | Bacteria | 8732 |
| 683 | Ga0265314_10020900 | 3300031711 | Bacteria | 5046 |
| 684 | Ga0265314_10066870 | 3300031711 | Bacteria | 2423 |
| 685 | Ga0265314_10132830 | 3300031711 | Bacteria | 1550 |
| 686 | Ga0316576_10022075 | 3300031727 | Bacteria | 4415 |
| 687 | Ga0316576_10032808 | 3300031727 | Bacteria | 3692 |
| 688 | Ga0316576_10035603 | 3300031727 | Bacteria | 3554 |
| 689 | Ga0316576_10070794 | 3300031727 | Bacteria | 2572 |
| 690 | Ga0316578_10016176 | 3300031728 | Bacteria | 4031 |
| 691 | Ga0316578_10030439 | 3300031728 | Bacteria | 3069 |
| 692 | Ga0307516_10001135 | 3300031730 | Bacteria | 37117 |
| 693 | Ga0307516_10002744 | 3300031730 | Bacteria | 23204 |
| 694 | Ga0307516_10041766 | 3300031730 | Bacteria | 4555 |
| 695 | Ga0307516_10107073 | 3300031730 | Bacteria | 2605 |
| 696 | Ga0307516_10252112 | 3300031730 | Bacteria | 1459 |
| 697 | Ga0307405_10001947 | 3300031731 | Bacteria | 8913 |
| 698 | Ga0307405_10005216 | 3300031731 | Bacteria | 6240 |
| 699 | Ga0307405_10005302 | 3300031731 | Bacteria | 6201 |
| 700 | Ga0307405_10006582 | 3300031731 | Bacteria | 5727 |
| 701 | Ga0307405_10021603 | 3300031731 | Bacteria | 3620 |
| 702 | Ga0307405_10061224 | 3300031731 | Bacteria | 2378 |
| 703 | Ga0307405_10120277 | 3300031731 | Bacteria | 1796 |
| 704 | Ga0307405_10152741 | 3300031731 | Bacteria | 1625 |
| 705 | Ga0307405_10161919 | 3300031731 | Bacteria | 1586 |
| 706 | Ga0307405_10292523 | 3300031731 | Bacteria | 1232 |
| 707 | Ga0307413_10012984 | 3300031824 | Bacteria | 4168 |
| 708 | Ga0307413_10022081 | 3300031824 | Bacteria | 3422 |
| 709 | Ga0307413_10029042 | 3300031824 | Bacteria | 3088 |
| 710 | Ga0307413_10049993 | 3300031824 | Bacteria | 2509 |
| 711 | Ga0307413_10132963 | 3300031824 | Bacteria | 1706 |
| 712 | Ga0307518_10061743 | 3300031838 | Bacteria | 2721 |
| 713 | Ga0307518_10127406 | 3300031838 | Bacteria | 1794 |
| 714 | Ga0307410_10003801 | 3300031852 | Bacteria | 7663 |
| 715 | Ga0307410_10018295 | 3300031852 | Bacteria | 4231 |
| 716 | Ga0307410_10080922 | 3300031852 | Bacteria | 2280 |
| 717 | Ga0307410_10098137 | 3300031852 | Bacteria | 2094 |
| 718 | Ga0307410_10143926 | 3300031852 | Bacteria | 1767 |
| 719 | Ga0307410_10155511 | 3300031852 | Bacteria | 1707 |
| 720 | Ga0307410_10169418 | 3300031852 | Bacteria | 1644 |
| 721 | Ga0307410_10210374 | 3300031852 | Bacteria | 1490 |
| 722 | Ga0307406_10009972 | 3300031901 | Bacteria | 5343 |
| 723 | Ga0307406_10035665 | 3300031901 | Bacteria | 3060 |
| 724 | Ga0307406_10037822 | 3300031901 | Bacteria | 2983 |
| 725 | Ga0307406_10075745 | 3300031901 | Bacteria | 2221 |
| 726 | Ga0307406_10111177 | 3300031901 | Bacteria | 1887 |
| 727 | Ga0307406_10113333 | 3300031901 | Bacteria | 1871 |
| 728 | Ga0307406_10138700 | 3300031901 | Bacteria | 1718 |
| 729 | Ga0307407_10005551 | 3300031903 | Bacteria | 5488 |
| 730 | Ga0307407_10011209 | 3300031903 | Bacteria | 4256 |
| 731 | Ga0307407_10013075 | 3300031903 | Bacteria | 4014 |
| 732 | Ga0307407_10014581 | 3300031903 | Bacteria | 3855 |
| 733 | Ga0307407_10035385 | 3300031903 | Bacteria | 2743 |
| 734 | Ga0307407_10064675 | 3300031903 | Bacteria | 2150 |
| 735 | Ga0307407_10067269 | 3300031903 | Bacteria | 2117 |
| 736 | Ga0307407_10099217 | 3300031903 | Bacteria | 1804 |
| 737 | Ga0307412_10005441 | 3300031911 | Bacteria | 7148 |
| 738 | Ga0307412_10005716 | 3300031911 | Bacteria | 6992 |
| 739 | Ga0307412_10020334 | 3300031911 | Bacteria | 4038 |
| 740 | Ga0307412_10027769 | 3300031911 | Bacteria | 3533 |
| 741 | Ga0307412_10029316 | 3300031911 | Bacteria | 3453 |
| 742 | Ga0307412_10032183 | 3300031911 | Bacteria | 3320 |
| 743 | Ga0307412_10057012 | 3300031911 | Bacteria | 2606 |
| 744 | Ga0307412_10057960 | 3300031911 | Bacteria | 2588 |
| 745 | Ga0307412_10103586 | 3300031911 | Bacteria | 2017 |
| 746 | Ga0307409_100000140 | 3300031995 | Bacteria | 27131 |
| 747 | Ga0307409_100005261 | 3300031995 | Bacteria | 7419 |
| 748 | Ga0307409_100015896 | 3300031995 | Bacteria | 4958 |
| 749 | Ga0307409_100037172 | 3300031995 | Bacteria | 3587 |
| 750 | Ga0307409_100081305 | 3300031995 | Bacteria | 2618 |
| 751 | Ga0307409_100084689 | 3300031995 | Bacteria | 2575 |
| 752 | Ga0307409_100085190 | 3300031995 | Bacteria | 2568 |
| 753 | Ga0307409_100091261 | 3300031995 | Bacteria | 2496 |
| 754 | Ga0307409_100096551 | 3300031995 | Bacteria | 2438 |
| 755 | Ga0307409_100178908 | 3300031995 | Bacteria | 1875 |
| 756 | Ga0307409_100183742 | 3300031995 | Bacteria | 1853 |
| 757 | Ga0307409_100203331 | 3300031995 | Bacteria | 1774 |
| 758 | Ga0307409_100223510 | 3300031995 | Bacteria | 1701 |
| 759 | Ga0307409_100254517 | 3300031995 | Bacteria | 1607 |
| 760 | Ga0307409_100294322 | 3300031995 | Bacteria | 1507 |
| 761 | Ga0307416_100001123 | 3300032002 | Bacteria | 14388 |
| 762 | Ga0307416_100002858 | 3300032002 | Bacteria | 10049 |
| 763 | Ga0307416_100003603 | 3300032002 | Bacteria | 9139 |
| 764 | Ga0307416_100030957 | 3300032002 | Bacteria | 4022 |
| 765 | Ga0307416_100037482 | 3300032002 | Bacteria | 3731 |
| 766 | Ga0307416_100050843 | 3300032002 | Bacteria | 3306 |
| 767 | Ga0307416_100055353 | 3300032002 | Bacteria | 3194 |
| 768 | Ga0307416_100065276 | 3300032002 | Bacteria | 2990 |
| 769 | Ga0307416_100066740 | 3300032002 | Bacteria | 2963 |
| 770 | Ga0307416_100106711 | 3300032002 | Bacteria | 2456 |
| 771 | Ga0307416_100115802 | 3300032002 | Bacteria | 2374 |
| 772 | Ga0307416_100116160 | 3300032002 | Bacteria | 2371 |
| 773 | Ga0307416_100320722 | 3300032002 | Bacteria | 1551 |
| 774 | Ga0307416_100354412 | 3300032002 | Bacteria | 1486 |
| 775 | Ga0307416_100370165 | 3300032002 | Bacteria | 1459 |
| 776 | Ga0307414_10001749 | 3300032004 | Bacteria | 11266 |
| 777 | Ga0307414_10044902 | 3300032004 | Bacteria | 3023 |
| 778 | Ga0307414_10070104 | 3300032004 | Bacteria | 2523 |
| 779 | Ga0307411_10054147 | 3300032005 | Bacteria | 2633 |
| 780 | Ga0307411_10121065 | 3300032005 | Bacteria | 1893 |
| 781 | Ga0307411_10314945 | 3300032005 | Bacteria | 1261 |
| 782 | Ga0307415_100000073 | 3300032126 | Bacteria | 41825 |
| 783 | Ga0307415_100001231 | 3300032126 | Bacteria | 11998 |
| 784 | Ga0307415_100011722 | 3300032126 | Bacteria | 5032 |
| 785 | Ga0307415_100015593 | 3300032126 | Bacteria | 4505 |
| 786 | Ga0307415_100046044 | 3300032126 | Bacteria | 2928 |
| 787 | Ga0307415_100054609 | 3300032126 | Bacteria | 2728 |
| 788 | Ga0307415_100061596 | 3300032126 | Bacteria | 2598 |
| 789 | Ga0307415_100063772 | 3300032126 | Bacteria | 2561 |
| 790 | Ga0307415_100079489 | 3300032126 | Bacteria | 2336 |
| 791 | Ga0307415_100086248 | 3300032126 | Bacteria | 2258 |
| 792 | Ga0307415_100089877 | 3300032126 | Bacteria | 2220 |
| 793 | Ga0307415_100129330 | 3300032126 | Bacteria | 1908 |
| 794 | Ga0307415_100157080 | 3300032126 | Bacteria | 1758 |
| 795 | Ga0307415_100160213 | 3300032126 | Bacteria | 1743 |
| 796 | Ga0307415_100173232 | 3300032126 | Bacteria | 1685 |
| 797 | Ga0307415_100196181 | 3300032126 | Bacteria | 1597 |
| 798 | Ga0307415_100242207 | 3300032126 | Bacteria | 1459 |
| 799 | Ga0316580_10001252 | 3300032139 | Bacteria | 6536 |
| 800 | Ga0307507_10000013 | 3300033179 | Bacteria | 242708 |
| 801 | Ga0307507_10024103 | 3300033179 | Bacteria | 6647 |
| 802 | Ga0307507_10029206 | 3300033179 | Bacteria | 5852 |
| 803 | Ga0307507_10062771 | 3300033179 | Bacteria | 3446 |
| 804 | Ga0307510_10073722 | 3300033180 | Bacteria | 3379 |
| 805 | Ga0307510_10074879 | 3300033180 | Bacteria | 3341 |
| 806 | Ga0307510_10102648 | 3300033180 | Bacteria | 2641 |
| 807 | Ga0373934_0020232 | 3300035086 | Bacteria | 2557 |
| 808 | Ga0373940_0005350 | 3300035088 | Bacteria | 2774 |
| 809 | Ga0373951_0000188 | 3300035091 | Bacteria | 22431 |
| 810 | Ga0373923_0025570 | 3300035111 | Bacteria | 2341 |
| 811 | Ga0373932_0034304 | 3300035112 | Bacteria | 1429 |
| 812 | Ga0373936_0003793 | 3300035113 | Bacteria | 5691 |
| 813 | Ga0373936_0041009 | 3300035113 | Bacteria | 1856 |
| 814 | Ga0373953_0037406 | 3300035117 | Bacteria | 1915 |
| 815 | Ga0373956_0007853 | 3300035119 | Bacteria | 4305 |
| 816 | Ga0373957_0001687 | 3300035120 | Bacteria | 6054 |
| 817 | Ga0373957_0010148 | 3300035120 | Bacteria | 3104 |
| 818 | Ga0373955_0017592 | 3300035172 | Bacteria | 3540 |
| 819 | Ga0373942_0000142 | 3300035207 | Bacteria | 17062 |
| 820 | Ga0373962_0001245 | 3300035242 | Bacteria | 5967 |
| 821 | Ga0316574_0001220 | 3300035398 | Bacteria | 11955 |
| 822 | Ga0316574_0006452 | 3300035398 | Bacteria | 6345 |
| 823 | Ga0316574_0088238 | 3300035398 | Bacteria | 1975 |
| 824 | Ga0316574_0155552 | 3300035398 | Bacteria | 1473 |
| 825 | Ga0316574_0163800 | 3300035398 | Bacteria | 1432 |
| 826 | Ga0373924_0001204 | 3300035410 | Bacteria | 8296 |
| 827 | Ga0373924_0002400 | 3300035410 | Bacteria | 6304 |
| 828 | Ga0373924_0145237 | 3300035410 | Bacteria | 1036 |
| 829 | Ga0373931_0000119 | 3300035691 | Bacteria | 35668 |
| 830 | Ga0373931_0126712 | 3300035691 | Bacteria | 1465 |
| 831 | Ga0373935_0015724 | 3300035692 | Bacteria | 4576 |
| 832 | Ga0373935_0041638 | 3300035692 | Bacteria | 2886 |
| 833 | Ga0373935_0175000 | 3300035692 | Bacteria | 1470 |
| 834 | Ga0373935_0181124 | 3300035692 | Bacteria | 1447 |
| 835 | Ga0373933_0003781 | 3300035724 | Bacteria | 8361 |
| 836 | Ga0373933_0008354 | 3300035724 | Bacteria | 5653 |
| 837 | Ga0373933_0032470 | 3300035724 | Bacteria | 3034 |
| 838 | Ga0373937_0027530 | 3300036401 | Bacteria | 5140 |
| 839 | Ga0373937_0046609 | 3300036401 | Bacteria | 3964 |
| 840 | Ga0373937_0073144 | 3300036401 | Bacteria | 3162 |
| 841 | Ga0373937_0155014 | 3300036401 | Bacteria | 2146 |
| 842 | Ga0316582_0011020 | 3300036647 | Bacteria | 4985 |
| 843 | Ga0316582_0034025 | 3300036647 | Bacteria | 3135 |
| 844 | Ga0316582_0138888 | 3300036647 | Bacteria | 1637 |
| 845 | Ga0316584_0000612 | 3300036712 | Bacteria | 19413 |
| 846 | Ga0316584_0011150 | 3300036712 | Bacteria | 6309 |
| 847 | Ga0316584_0045363 | 3300036712 | Bacteria | 3281 |
| 848 | Ga0316584_0153131 | 3300036712 | Bacteria | 1716 |
| 849 | Ga0316584_0235173 | 3300036712 | Bacteria | 1342 |
| 850 | Ga0373925_0000006 | 3300037068 | Bacteria | 278942 |
| 851 | Ga0373925_0067135 | 3300037068 | Bacteria | 2705 |
| 852 | Ga0395899_0001199 | 3300037312 | Bacteria | 22794 |
| 853 | Ga0395899_0100480 | 3300037312 | Bacteria | 2089 |
| 854 | Ga0395899_0113067 | 3300037312 | Bacteria | 1950 |
| 855 | Ga0395900_0007242 | 3300037418 | Bacteria | 11489 |
| 856 | Ga0395900_0012677 | 3300037418 | Bacteria | 8619 |
| 857 | Ga0395900_0042137 | 3300037418 | Bacteria | 4702 |
| 858 | Ga0395900_0058323 | 3300037418 | Bacteria | 3974 |
| 859 | Ga0395900_0118148 | 3300037418 | Bacteria | 2721 |
| 860 | Ga0395900_0127319 | 3300037418 | Bacteria | 2611 |
| 861 | Ga0395900_0137145 | 3300037418 | Bacteria | 2507 |
| 862 | Ga0395900_0196973 | 3300037418 | Bacteria | 2040 |
| 863 | Ga0395900_0258675 | 3300037418 | Bacteria | 1739 |
| 864 | Ga0395900_0396075 | 3300037418 | Bacteria | 1346 |
| 865 | Ga0395900_0439259 | 3300037418 | Bacteria | 1263 |
| 866 | Ga0395898_0000256 | 3300037466 | Bacteria | 130878 |
| 867 | Ga0395898_0001516 | 3300037466 | Bacteria | 32005 |
| 868 | Ga0395898_0011157 | 3300037466 | Bacteria | 9356 |
| 869 | Ga0395898_0014066 | 3300037466 | Bacteria | 8224 |
| 870 | Ga0395898_0016808 | 3300037466 | Bacteria | 7474 |
| 871 | Ga0395898_0023381 | 3300037466 | Bacteria | 6247 |
| 872 | Ga0395898_0036404 | 3300037466 | Bacteria | 4886 |
| 873 | Ga0395898_0040985 | 3300037466 | Bacteria | 4576 |
| 874 | Ga0395898_0107358 | 3300037466 | Bacteria | 2677 |
| 875 | Ga0395898_0110750 | 3300037466 | Bacteria | 2631 |
| 876 | Ga0395898_0140127 | 3300037466 | Bacteria | 2315 |
| 877 | Ga0395905_0250772 | 3300037471 | Bacteria | 1653 |
| 878 | Ga0395905_0275209 | 3300037471 | Bacteria | 1569 |
| 879 | Ga0436364_0053804 | 3300037853 | Bacteria | 3850 |
| 880 | Ga0436364_0445774 | 3300037853 | Bacteria | 40627 |
| 881 | Ga0436364_0497556 | 3300037853 | Bacteria | 8611 |
| 882 | Ga0436364_0675155 | 3300037853 | Bacteria | 1280 |
| 883 | Ga0436364_1106417 | 3300037853 | Bacteria | 6692 |
| 884 | Ga0436364_1149812 | 3300037853 | Bacteria | 6020 |
| 885 | Ga0436364_1484307 | 3300037853 | Bacteria | 11983 |
| 886 | Ga0395901_0012535 | 3300038443 | Bacteria | 8602 |
| 887 | Ga0395901_0016431 | 3300038443 | Bacteria | 7538 |
| 888 | Ga0395901_0039183 | 3300038443 | Bacteria | 4903 |
| 889 | Ga0395901_0042568 | 3300038443 | Bacteria | 4709 |
| 890 | Ga0395901_0051841 | 3300038443 | Bacteria | 4265 |
| 891 | Ga0395901_0065461 | 3300038443 | Bacteria | 3784 |
| 892 | Ga0395901_0117736 | 3300038443 | Bacteria | 2791 |
| 893 | Ga0395901_0215491 | 3300038443 | Bacteria | 2008 |
| 894 | Ga0395901_0344436 | 3300038443 | Bacteria | 1539 |
| 895 | Ga0395901_0360429 | 3300038443 | Bacteria | 1499 |
| 896 | Ga0400485_14323 | 3300038735 | Bacteria | 58881 |
| 897 | Ga0400488_04969 | 3300038741 | Bacteria | 3360 |
| 898 | Ga0400486_06112 | 3300038742 | Bacteria | 40039 |
| 899 | Ga0400483_078666 | 3300039062 | Bacteria | 3700 |
| 900 | Ga0400483_237273 | 3300039062 | Bacteria | 4577 |
| 901 | Ga0436365_0562669 | 3300039437 | Bacteria | 1533 |
| 902 | Ga0436365_0726960 | 3300039437 | Bacteria | 31385 |
| 903 | Ga0436365_0934847 | 3300039437 | Bacteria | 10390 |
| 904 | Ga0436365_1425629 | 3300039437 | Bacteria | 6391 |
| 905 | Ga0436365_1765450 | 3300039437 | Bacteria | 8334 |
| 906 | Ga0436360_0336736 | 3300039438 | Bacteria | 3790 |
| 907 | Ga0436361_0647809 | 3300039447 | Bacteria | 4529 |
| 908 | Ga0436363_0456998 | 3300039450 | Bacteria | 3162 |
| 909 | Ga0436363_1147919 | 3300039450 | Bacteria | 11712 |
| 910 | Ga0436362_0329220 | 3300039453 | Bacteria | 4179 |
| 911 | Ga0436362_0334792 | 3300039453 | Bacteria | 1537 |
| 912 | Ga0439436_0001406 | 3300041404 | Bacteria | 6958 |
| 913 | Ga0439436_0003882 | 3300041404 | Bacteria | 4579 |
| 914 | Ga0439436_0007177 | 3300041404 | Bacteria | 3428 |
| 915 | Ga0439438_009258 | 3300041405 | Bacteria | 3199 |
| 916 | Ga0439439_0000608 | 3300041406 | Bacteria | 6295 |
| 917 | Ga0439439_0001403 | 3300041406 | Bacteria | 4778 |
| 918 | Ga0439439_0020682 | 3300041406 | Bacteria | 1637 |
| 919 | Ga0439461_0022381 | 3300041410 | Bacteria | 1266 |
| 920 | Ga0439466_0013894 | 3300041411 | Bacteria | 2941 |
| 921 | Ga0439466_0015547 | 3300041411 | Bacteria | 2764 |
| 922 | Ga0439465_0024574 | 3300041413 | Bacteria | 1899 |
| 923 | Ga0451797_0576558 | 3300041453 | Bacteria | 2684 |
| 924 | Ga0451853_0524125 | 3300041512 | Bacteria | 1484 |
| 925 | Ga0439431_0001082 | 3300041997 | Bacteria | 5906 |
| 926 | Ga0439433_0000011 | 3300041999 | Bacteria | 28299 |
| 927 | Ga0439433_0001106 | 3300041999 | Bacteria | 5498 |
| 928 | Ga0439433_0002150 | 3300041999 | Bacteria | 4150 |
| 929 | Ga0439442_000100 | 3300042002 | Bacteria | 20967 |
| 930 | Ga0439442_000105 | 3300042002 | Bacteria | 20773 |
| 931 | Ga0439442_009117 | 3300042002 | Bacteria | 2005 |
| 932 | Ga0439448_0001623 | 3300042005 | Bacteria | 5892 |
| 933 | Ga0439448_0013630 | 3300042005 | Bacteria | 2444 |
| 934 | Ga0439448_0025926 | 3300042005 | Bacteria | 1841 |
| 935 | Ga0439432_000499 | 3300042006 | Bacteria | 14603 |
| 936 | Ga0439449_0001339 | 3300042007 | Bacteria | 9654 |
| 937 | Ga0439449_0001769 | 3300042007 | Bacteria | 8486 |
| 938 | Ga0439449_0005285 | 3300042007 | Bacteria | 4951 |
| 939 | Ga0439449_0008539 | 3300042007 | Bacteria | 3890 |
| 940 | Ga0439449_0028145 | 3300042007 | Bacteria | 2095 |
| 941 | Ga0439449_0036603 | 3300042007 | Bacteria | 1825 |
| 942 | Ga0439449_0046534 | 3300042007 | Bacteria | 1607 |
| 943 | Ga0439450_001186 | 3300042008 | Bacteria | 3743 |
| 944 | Ga0439450_003476 | 3300042008 | Bacteria | 2607 |
| 945 | Ga0439452_002706 | 3300042010 | Bacteria | 6426 |
| 946 | Ga0439455_0000986 | 3300042012 | Bacteria | 4456 |
| 947 | Ga0439457_000166 | 3300042014 | Bacteria | 17000 |
| 948 | Ga0439457_001067 | 3300042014 | Bacteria | 8272 |
| 949 | Ga0439457_012975 | 3300042014 | Bacteria | 1874 |
| 950 | Ga0439462_0014847 | 3300042015 | Bacteria | 2004 |
| 951 | Ga0439463_000211 | 3300042016 | Bacteria | 15803 |
| 952 | Ga0439463_001385 | 3300042016 | Bacteria | 6445 |
| 953 | Ga0439463_003518 | 3300042016 | Bacteria | 3958 |
| 954 | Ga0450911_003799 | 3300042115 | Bacteria | 2586 |
| 955 | Ga0450913_000164 | 3300042117 | Bacteria | 2156 |
| 956 | Ga0450919_000414 | 3300042121 | Bacteria | 5243 |
| 957 | Ga0450920_004056 | 3300042122 | Bacteria | 2563 |
| 958 | Ga0450920_009768 | 3300042122 | Bacteria | 1770 |
| 959 | Ga0450894_001280 | 3300042131 | Bacteria | 3675 |
| 960 | Ga0450898_011488 | 3300042134 | Bacteria | 1450 |
| 961 | Ga0450899_001054 | 3300042135 | Bacteria | 3128 |
| 962 | Ga0450903_002809 | 3300042138 | Bacteria | 3056 |
| 963 | Ga0450907_000086 | 3300042146 | Bacteria | 36840 |
| 964 | Ga0450907_003667 | 3300042146 | Bacteria | 2710 |
| 965 | Ga0439446_0007643 | 3300042156 | Bacteria | 2848 |
| 966 | Ga0439458_0004260 | 3300042157 | Bacteria | 3302 |
| 967 | Ga0439458_0030079 | 3300042157 | Bacteria | 1291 |
| 968 | Ga0450909_000097 | 3300042185 | Bacteria | 8519 |
| 969 | Ga0439434_0003039 | 3300042435 | Bacteria | 4920 |
| 970 | Ga0439434_0006572 | 3300042435 | Bacteria | 3397 |
| 971 | Ga0439434_0006796 | 3300042435 | Bacteria | 3342 |
| 972 | Ga0439434_0013656 | 3300042435 | Bacteria | 2411 |
| 973 | Ga0439434_0015655 | 3300042435 | Bacteria | 2261 |
| 974 | Ga0439435_0002840 | 3300042436 | Bacteria | 3510 |
| 975 | Ga0439464_0000089 | 3300042439 | Bacteria | 13293 |
| 976 | Ga0439460_0001743 | 3300042461 | Bacteria | 5169 |
| 977 | Ga0450918_004987 | 3300042531 | Bacteria | 2392 |
| 978 | Ga0439440_0000033 | 3300042993 | Bacteria | 17433 |
| 979 | Ga0466969_0013288 | 3300044656 | Bacteria | 4336 |
| 980 | Ga0466969_0021485 | 3300044656 | Bacteria | 3336 |
| 981 | Ga0466969_0037244 | 3300044656 | Bacteria | 2454 |
| 982 | Ga0466972_0005469 | 3300044658 | Bacteria | 6363 |
| 983 | Ga0466972_0026235 | 3300044658 | Bacteria | 2887 |
| 984 | Ga0466972_0111265 | 3300044658 | Bacteria | 1294 |
| 985 | Ga0466965_0000001 | 3300044683 | Bacteria | 317826 |
| 986 | Ga0466965_0056046 | 3300044683 | Bacteria | 1962 |
| 987 | Ga0466965_0070489 | 3300044683 | Bacteria | 1757 |
| 988 | Ga0466965_0108721 | 3300044683 | Bacteria | 1424 |
| 989 | Ga0466966_0001229 | 3300044684 | Bacteria | 16449 |
| 990 | Ga0466966_0002669 | 3300044684 | Bacteria | 11689 |
| 991 | Ga0466966_0010569 | 3300044684 | Bacteria | 6135 |
| 992 | Ga0466966_0039987 | 3300044684 | Bacteria | 3018 |
| 993 | Ga0466966_0084173 | 3300044684 | Bacteria | 1979 |
| 994 | Ga0466966_0092457 | 3300044684 | Bacteria | 1877 |
| 995 | Ga0466966_0104143 | 3300044684 | Bacteria | 1753 |
| 996 | Ga0466966_0110201 | 3300044684 | Bacteria | 1697 |
| 997 | Ga0466961_0000334 | 3300044693 | Bacteria | 30973 |
| 998 | Ga0466961_0002146 | 3300044693 | Bacteria | 12261 |
| 999 | Ga0466961_0018302 | 3300044693 | Bacteria | 4504 |
| 1000 | Ga0466961_0018600 | 3300044693 | Bacteria | 4471 |
| 1001 | Ga0466961_0041665 | 3300044693 | Bacteria | 2944 |
| 1002 | Ga0466961_0057149 | 3300044693 | Bacteria | 2484 |
| 1003 | Ga0466961_0098614 | 3300044693 | Bacteria | 1842 |
| 1004 | Ga0466961_0155367 | 3300044693 | Bacteria | 1427 |
| 1005 | Ga0466963_0000113 | 3300044694 | Bacteria | 29888 |
| 1006 | Ga0466963_0032072 | 3300044694 | Bacteria | 3399 |
| 1007 | Ga0466963_0041053 | 3300044694 | Bacteria | 3033 |
| 1008 | Ga0466963_0044903 | 3300044694 | Bacteria | 2908 |
| 1009 | Ga0466963_0063551 | 3300044694 | Bacteria | 2471 |
| 1010 | Ga0466963_0069693 | 3300044694 | Bacteria | 2364 |
| 1011 | Ga0466963_0116491 | 3300044694 | Bacteria | 1836 |
| 1012 | Ga0466963_0127713 | 3300044694 | Bacteria | 1754 |
| 1013 | Ga0466963_0151374 | 3300044694 | Bacteria | 1611 |
| 1014 | Ga0466964_0003680 | 3300044706 | Bacteria | 5612 |
| 1015 | Ga0466964_0019823 | 3300044706 | Bacteria | 2588 |
| 1016 | Ga0466964_0069955 | 3300044706 | Bacteria | 1482 |
| 1017 | Ga0466971_0000604 | 3300044719 | Bacteria | 14259 |
| 1018 | Ga0466971_0028490 | 3300044719 | Bacteria | 2499 |
| 1019 | Ga0466971_0060763 | 3300044719 | Bacteria | 1708 |
| 1020 | Ga0466968_0009794 | 3300044735 | Bacteria | 3699 |
| 1021 | Ga0466968_0009975 | 3300044735 | Bacteria | 3668 |
| 1022 | Ga0466970_0004815 | 3300044765 | Bacteria | 6667 |
| 1023 | Ga0466970_0005522 | 3300044765 | Bacteria | 6279 |
| 1024 | Ga0466970_0005582 | 3300044765 | Bacteria | 6254 |
| 1025 | Ga0466970_0028303 | 3300044765 | Bacteria | 2943 |
| 1026 | Ga0466970_0050345 | 3300044765 | Bacteria | 2221 |
| 1027 | Ga0466957_0003322 | 3300044842 | Bacteria | 8816 |
| 1028 | Ga0466957_0005112 | 3300044842 | Bacteria | 7330 |
| 1029 | Ga0466957_0031622 | 3300044842 | Bacteria | 3164 |
| 1030 | Ga0466957_0058297 | 3300044842 | Bacteria | 2366 |
| 1031 | Ga0466957_0145264 | 3300044842 | Bacteria | 1531 |
| 1032 | Ga0466960_0003005 | 3300044901 | Bacteria | 6435 |
| 1033 | Ga0466960_0008168 | 3300044901 | Bacteria | 4279 |
| 1034 | Ga0466960_0016591 | 3300044901 | Bacteria | 3198 |
| 1035 | Ga0466960_0020405 | 3300044901 | Bacteria | 2934 |
| 1036 | Ga0466960_0048394 | 3300044901 | Bacteria | 2043 |
| 1037 | Ga0466959_0000927 | 3300045049 | Bacteria | 17399 |
| 1038 | Ga0466959_0001283 | 3300045049 | Bacteria | 15198 |
| 1039 | Ga0466959_0001538 | 3300045049 | Bacteria | 14174 |
| 1040 | Ga0466959_0002972 | 3300045049 | Bacteria | 10946 |
| 1041 | Ga0466959_0010248 | 3300045049 | Bacteria | 6691 |
| 1042 | Ga0466959_0019337 | 3300045049 | Bacteria | 5009 |
| 1043 | Ga0466959_0025712 | 3300045049 | Bacteria | 4366 |
| 1044 | Ga0466959_0059395 | 3300045049 | Bacteria | 2784 |
| 1045 | Ga0466959_0073850 | 3300045049 | Bacteria | 2467 |
| 1046 | Ga0466959_0125754 | 3300045049 | Bacteria | 1820 |
| 1047 | Ga0466959_0164472 | 3300045049 | Bacteria | 1558 |
| 1048 | Ga0451576_0158695 | 3300045051 | Bacteria | 2360 |
| 1049 | Ga0466958_0001093 | 3300045836 | Bacteria | 12478 |
| 1050 | Ga0466958_0009620 | 3300045836 | Bacteria | 5390 |
| 1051 | Ga0466958_0010518 | 3300045836 | Bacteria | 5183 |
| 1052 | Ga0466958_0012195 | 3300045836 | Bacteria | 4860 |
| 1053 | Ga0466958_0016297 | 3300045836 | Bacteria | 4277 |
| 1054 | Ga0466958_0022265 | 3300045836 | Bacteria | 3710 |
| 1055 | Ga0466958_0045290 | 3300045836 | Bacteria | 2653 |
| 1056 | Ga0466958_0045776 | 3300045836 | Bacteria | 2640 |
| 1057 | Ga0466967_0007780 | 3300045976 | Bacteria | 7780 |
| 1058 | Ga0466967_0008112 | 3300045976 | Bacteria | 7661 |
| 1059 | Ga0466967_0010829 | 3300045976 | Bacteria | 6865 |
| 1060 | Ga0466967_0014774 | 3300045976 | Bacteria | 6100 |
| 1061 | Ga0466967_0031412 | 3300045976 | Bacteria | 4470 |
| 1062 | Ga0466967_0033743 | 3300045976 | Bacteria | 4336 |
| 1063 | Ga0466967_0036626 | 3300045976 | Bacteria | 4190 |
| 1064 | Ga0466967_0049506 | 3300045976 | Bacteria | 3675 |
| 1065 | Ga0466967_0072987 | 3300045976 | Bacteria | 3078 |
| 1066 | Ga0466967_0132887 | 3300045976 | Bacteria | 2312 |
| 1067 | Ga0466967_0226686 | 3300045976 | Bacteria | 1778 |
| 1068 | Ga0466967_0259780 | 3300045976 | Bacteria | 1661 |
| 1069 | Ga0466967_0386883 | 3300045976 | Bacteria | 1359 |
| 1070 | Ga0466967_0514827 | 3300045976 | Bacteria | 1175 |
| 1071 | Ga0495617_021032 | 3300046452 | Bacteria | 2204 |
| 1072 | Ga0495627_012192 | 3300046453 | Bacteria | 3059 |
| 1073 | Ga0495592_0058887 | 3300046454 | Bacteria | 2831 |
| 1074 | Ga0495592_0078800 | 3300046454 | Bacteria | 2386 |
| 1075 | Ga0495592_0120905 | 3300046454 | Bacteria | 1842 |
| 1076 | Ga0495603_0001591 | 3300046455 | Bacteria | 13313 |
| 1077 | Ga0495603_0029411 | 3300046455 | Bacteria | 3312 |
| 1078 | Ga0495603_0093844 | 3300046455 | Bacteria | 1753 |
| 1079 | Ga0495603_0128588 | 3300046455 | Bacteria | 1476 |
| 1080 | Ga0495603_0152818 | 3300046455 | Bacteria | 1340 |
| 1081 | Ga0495629_0000933 | 3300046459 | Bacteria | 23538 |
| 1082 | Ga0495629_0018469 | 3300046459 | Bacteria | 4991 |
| 1083 | Ga0495629_0018510 | 3300046459 | Bacteria | 4984 |
| 1084 | Ga0495629_0020144 | 3300046459 | Bacteria | 4762 |
| 1085 | Ga0495629_0036281 | 3300046459 | Bacteria | 3481 |
| 1086 | Ga0495629_0063068 | 3300046459 | Bacteria | 2588 |
| 1087 | Ga0495629_0248485 | 3300046459 | Bacteria | 1224 |
| 1088 | Ga0495641_0002845 | 3300046461 | Bacteria | 13394 |
| 1089 | Ga0495641_0006228 | 3300046461 | Bacteria | 7789 |
| 1090 | Ga0495651_0019189 | 3300046462 | Bacteria | 5297 |
| 1091 | Ga0495651_0023476 | 3300046462 | Bacteria | 4794 |
| 1092 | Ga0495651_0075302 | 3300046462 | Bacteria | 2559 |
| 1093 | Ga0495653_0043766 | 3300046463 | Bacteria | 3478 |
| 1094 | Ga0495653_0045307 | 3300046463 | Bacteria | 3410 |
| 1095 | Ga0495653_0052061 | 3300046463 | Bacteria | 3140 |
| 1096 | Ga0495653_0085760 | 3300046463 | Bacteria | 2315 |
| 1097 | Ga0495580_0001823 | 3300046472 | Bacteria | 18738 |
| 1098 | Ga0495580_0019335 | 3300046472 | Bacteria | 5061 |
| 1099 | Ga0495582_0001683 | 3300046473 | Bacteria | 12477 |
| 1100 | Ga0495582_0008683 | 3300046473 | Bacteria | 5603 |
| 1101 | Ga0495582_0080414 | 3300046473 | Bacteria | 1810 |
| 1102 | Ga0495639_0004885 | 3300046475 | Bacteria | 5751 |
| 1103 | Ga0495662_0000168 | 3300046476 | Bacteria | 25877 |
| 1104 | Ga0495662_0000230 | 3300046476 | Bacteria | 23315 |
| 1105 | Ga0495662_0009153 | 3300046476 | Bacteria | 4859 |
| 1106 | Ga0495662_0010114 | 3300046476 | Bacteria | 4626 |
| 1107 | Ga0495662_0010703 | 3300046476 | Bacteria | 4486 |
| 1108 | Ga0495664_0001164 | 3300046477 | Bacteria | 13691 |
| 1109 | Ga0495664_0003063 | 3300046477 | Bacteria | 9061 |
| 1110 | Ga0495664_0003236 | 3300046477 | Bacteria | 8847 |
| 1111 | Ga0495664_0011791 | 3300046477 | Bacteria | 4935 |
| 1112 | Ga0495664_0166029 | 3300046477 | Bacteria | 1339 |
| 1113 | Ga0495585_0005641 | 3300046492 | Bacteria | 7861 |
| 1114 | Ga0495594_0000836 | 3300046499 | Bacteria | 15907 |
| 1115 | Ga0495594_0003472 | 3300046499 | Bacteria | 8138 |
| 1116 | Ga0495594_0052174 | 3300046499 | Bacteria | 2252 |
| 1117 | Ga0495594_0117460 | 3300046499 | Bacteria | 1502 |
| 1118 | Ga0495594_0119449 | 3300046499 | Bacteria | 1489 |
| 1119 | Ga0495606_0002906 | 3300046507 | Bacteria | 18927 |
| 1120 | Ga0495606_0003739 | 3300046507 | Bacteria | 15854 |
| 1121 | Ga0495608_0008718 | 3300046511 | Bacteria | 7094 |
| 1122 | Ga0495608_0019074 | 3300046511 | Bacteria | 4727 |
| 1123 | Ga0495608_0149266 | 3300046511 | Bacteria | 1490 |
| 1124 | Ga0495608_0196197 | 3300046511 | Bacteria | 1273 |
| 1125 | Ga0495616_0064235 | 3300046513 | Bacteria | 1791 |
| 1126 | Ga0495618_0039495 | 3300046514 | Bacteria | 2966 |
| 1127 | Ga0495618_0127142 | 3300046514 | Bacteria | 1631 |
| 1128 | Ga0495618_0131554 | 3300046514 | Bacteria | 1601 |
| 1129 | Ga0495618_0170009 | 3300046514 | Bacteria | 1387 |
| 1130 | Ga0495620_0014258 | 3300046515 | Bacteria | 4044 |
| 1131 | Ga0495628_0025612 | 3300046516 | Bacteria | 4819 |
| 1132 | Ga0495628_0027557 | 3300046516 | Bacteria | 4620 |
| 1133 | Ga0495628_0029006 | 3300046516 | Bacteria | 4491 |
| 1134 | Ga0495628_0083316 | 3300046516 | Bacteria | 2483 |
| 1135 | Ga0495628_0089084 | 3300046516 | Bacteria | 2390 |
| 1136 | Ga0495628_0109685 | 3300046516 | Bacteria | 2123 |
| 1137 | Ga0495630_0118656 | 3300046517 | Bacteria | 2006 |
| 1138 | Ga0495630_0138202 | 3300046517 | Bacteria | 1852 |
| 1139 | Ga0495630_0239350 | 3300046517 | Bacteria | 1387 |
| 1140 | Ga0495631_0020150 | 3300046518 | Bacteria | 3119 |
| 1141 | Ga0495632_0105041 | 3300046519 | Bacteria | 1329 |
| 1142 | Ga0495643_0046165 | 3300046522 | Bacteria | 2362 |
| 1143 | Ga0495643_0056340 | 3300046522 | Bacteria | 2098 |
| 1144 | Ga0495666_0011813 | 3300046526 | Bacteria | 4353 |
| 1145 | Ga0495666_0077705 | 3300046526 | Bacteria | 1573 |
| 1146 | Ga0495642_0029792 | 3300046528 | Bacteria | 2181 |
| 1147 | Ga0495642_0031202 | 3300046528 | Bacteria | 2136 |
| 1148 | Ga0495642_0031540 | 3300046528 | Bacteria | 2125 |
| 1149 | Ga0495652_0003119 | 3300046529 | Bacteria | 16561 |
| 1150 | Ga0495652_0027169 | 3300046529 | Bacteria | 5044 |
| 1151 | Ga0495652_0032257 | 3300046529 | Bacteria | 4582 |
| 1152 | Ga0495652_0075686 | 3300046529 | Bacteria | 2795 |
| 1153 | Ga0495652_0130715 | 3300046529 | Bacteria | 1988 |
| 1154 | Ga0495665_0002144 | 3300046531 | Bacteria | 10681 |
| 1155 | Ga0495665_0012658 | 3300046531 | Bacteria | 4567 |
| 1156 | Ga0495665_0023899 | 3300046531 | Bacteria | 3284 |
| 1157 | Ga0495640_0014350 | 3300046533 | Bacteria | 5999 |
| 1158 | Ga0495640_0017751 | 3300046533 | Bacteria | 5294 |
| 1159 | Ga0495640_0059064 | 3300046533 | Bacteria | 2614 |
| 1160 | Ga0495640_0061264 | 3300046533 | Bacteria | 2556 |
| 1161 | Ga0495640_0087230 | 3300046533 | Bacteria | 2064 |
| 1162 | Ga0495640_0087990 | 3300046533 | Bacteria | 2053 |
| 1163 | Ga0495586_0003443 | 3300046535 | Bacteria | 8480 |
| 1164 | Ga0495586_0022779 | 3300046535 | Bacteria | 3343 |
| 1165 | Ga0495586_0036162 | 3300046535 | Bacteria | 2650 |
| 1166 | Ga0495586_0058186 | 3300046535 | Bacteria | 2098 |
| 1167 | Ga0495587_0005854 | 3300046536 | Bacteria | 8005 |
| 1168 | Ga0495645_0012568 | 3300046543 | Bacteria | 5968 |
| 1169 | Ga0495645_0021786 | 3300046543 | Bacteria | 4633 |
| 1170 | Ga0495645_0086876 | 3300046543 | Bacteria | 2237 |
| 1171 | Ga0495622_0005909 | 3300046557 | Bacteria | 5685 |
| 1172 | Ga0495633_0005618 | 3300046558 | Bacteria | 7603 |
| 1173 | Ga0495633_0022654 | 3300046558 | Bacteria | 3122 |
| 1174 | Ga0495667_0006867 | 3300046559 | Bacteria | 7729 |
| 1175 | Ga0495667_0049798 | 3300046559 | Bacteria | 2765 |
| 1176 | Ga0495656_0012363 | 3300046615 | Bacteria | 3148 |
| 1177 | Ga0495656_0036089 | 3300046615 | Bacteria | 2035 |
| 1178 | Ga0495656_0092790 | 3300046615 | Bacteria | 1383 |
| 1179 | Ga0495668_0000400 | 3300046616 | Bacteria | 56866 |
| 1180 | Ga0495634_0004689 | 3300046642 | Bacteria | 10632 |
| 1181 | Ga0495634_0009795 | 3300046642 | Bacteria | 7052 |
| 1182 | Ga0495634_0043471 | 3300046642 | Bacteria | 3044 |
| 1183 | Ga0495634_0131223 | 3300046642 | Bacteria | 1597 |
| 1184 | Ga0495611_0028000 | 3300046648 | Bacteria | 2467 |
| 1185 | Ga0495611_0051654 | 3300046648 | Bacteria | 1853 |
| 1186 | Ga0495611_0066514 | 3300046648 | Bacteria | 1643 |
| 1187 | Ga0495625_0002415 | 3300046660 | Bacteria | 20230 |
| 1188 | Ga0495625_0007523 | 3300046660 | Bacteria | 9461 |
| 1189 | Ga0495625_0038110 | 3300046660 | Bacteria | 3520 |
| 1190 | Ga0495635_0000946 | 3300046663 | Bacteria | 19160 |
| 1191 | Ga0495635_0009366 | 3300046663 | Bacteria | 6844 |
| 1192 | Ga0495635_0075979 | 3300046663 | Bacteria | 2301 |
| 1193 | Ga0495659_0082898 | 3300046664 | Bacteria | 1220 |
| 1194 | Ga0495588_0018738 | 3300046674 | Bacteria | 3379 |
| 1195 | Ga0495657_0002272 | 3300046675 | Bacteria | 16229 |
| 1196 | Ga0495657_0003402 | 3300046675 | Bacteria | 12999 |
| 1197 | Ga0495657_0011090 | 3300046675 | Bacteria | 6755 |
| 1198 | Ga0495657_0047966 | 3300046675 | Bacteria | 2884 |
| 1199 | Ga0495657_0050481 | 3300046675 | Bacteria | 2796 |
| 1200 | Ga0495657_0061205 | 3300046675 | Bacteria | 2490 |
| 1201 | Ga0495657_0089029 | 3300046675 | Bacteria | 1983 |
| 1202 | Ga0495599_0006012 | 3300046678 | Bacteria | 7303 |
| 1203 | Ga0495599_0159504 | 3300046678 | Bacteria | 1394 |
| 1204 | Ga0495623_0012392 | 3300046679 | Bacteria | 5521 |
| 1205 | Ga0495623_0033976 | 3300046679 | Bacteria | 3272 |
| 1206 | Ga0495623_0063999 | 3300046679 | Bacteria | 2302 |
| 1207 | Ga0495623_0170727 | 3300046679 | Bacteria | 1270 |
| 1208 | Ga0495646_0000452 | 3300046680 | Bacteria | 21700 |
| 1209 | Ga0495646_0007858 | 3300046680 | Bacteria | 6771 |
| 1210 | Ga0495646_0009781 | 3300046680 | Bacteria | 6092 |
| 1211 | Ga0495646_0052952 | 3300046680 | Bacteria | 2449 |
| 1212 | Ga0495658_0007916 | 3300046683 | Bacteria | 5262 |
| 1213 | Ga0495658_0039943 | 3300046683 | Bacteria | 2606 |
| 1214 | Ga0495658_0087409 | 3300046683 | Bacteria | 1841 |
| 1215 | Ga0495669_0016059 | 3300046684 | Bacteria | 3206 |
| 1216 | Ga0495613_0003768 | 3300046689 | Bacteria | 11364 |
| 1217 | Ga0495613_0017034 | 3300046689 | Bacteria | 5409 |
| 1218 | Ga0495613_0018725 | 3300046689 | Bacteria | 5163 |
| 1219 | Ga0495613_0186604 | 3300046689 | Bacteria | 1467 |
| 1220 | Ga0495613_0202364 | 3300046689 | Bacteria | 1399 |
| 1221 | Ga0495613_0252674 | 3300046689 | Bacteria | 1230 |
| 1222 | Ga0495624_0008540 | 3300046690 | Bacteria | 7133 |
| 1223 | Ga0495624_0015418 | 3300046690 | Bacteria | 5160 |
| 1224 | Ga0495624_0068748 | 3300046690 | Bacteria | 2207 |
| 1225 | Ga0495670_0002199 | 3300046691 | Bacteria | 9656 |
| 1226 | Ga0495670_0002991 | 3300046691 | Bacteria | 8334 |
| 1227 | Ga0495670_0077290 | 3300046691 | Bacteria | 1692 |
| 1228 | Ga0495671_0049179 | 3300046692 | Bacteria | 2102 |
| 1229 | Ga0495649_0025282 | 3300046694 | Bacteria | 3307 |
| 1230 | Ga0495600_0013854 | 3300046809 | Bacteria | 5078 |
| 1231 | Ga0495600_0033692 | 3300046809 | Bacteria | 3324 |
| 1232 | Ga0495600_0073128 | 3300046809 | Bacteria | 2238 |
| 1233 | Ga0495600_0112736 | 3300046809 | Bacteria | 1770 |
| 1234 | Ga0495660_0053234 | 3300046810 | Bacteria | 2197 |
| 1235 | Ga0495581_0002512 | 3300047315 | Bacteria | 10409 |
| 1236 | Ga0495581_0004308 | 3300047315 | Bacteria | 8213 |
| 1237 | Ga0495581_0032992 | 3300047315 | Bacteria | 2997 |
| 1238 | Ga0495581_0058657 | 3300047315 | Bacteria | 2223 |
| 1239 | Ga0495581_0098816 | 3300047315 | Bacteria | 1695 |
| 1240 | Ga0495581_0138701 | 3300047315 | Bacteria | 1418 |
| 1241 | Ga0495604_0001416 | 3300047317 | Bacteria | 19666 |
| 1242 | Ga0495604_0002144 | 3300047317 | Bacteria | 15858 |
| 1243 | Ga0495604_0005831 | 3300047317 | Bacteria | 9763 |
| 1244 | Ga0495604_0014230 | 3300047317 | Bacteria | 6342 |
| 1245 | Ga0495604_0165146 | 3300047317 | Bacteria | 1561 |
| 1246 | Ga0495604_0192660 | 3300047317 | Bacteria | 1419 |
| 1247 | Ga0495604_0201614 | 3300047317 | Bacteria | 1380 |
| 1248 | Ga0495636_0002818 | 3300047318 | Bacteria | 6705 |
| 1249 | Ga0495636_0061648 | 3300047318 | Bacteria | 1586 |
| 1250 | Ga0495636_0079384 | 3300047318 | Bacteria | 1411 |
| 1251 | Ga0495674_0018315 | 3300047319 | Bacteria | 6520 |
| 1252 | Ga0495674_0061308 | 3300047319 | Bacteria | 3279 |
| 1253 | Ga0495674_0102820 | 3300047319 | Bacteria | 2429 |
| 1254 | Ga0495674_0156660 | 3300047319 | Bacteria | 1908 |
| 1255 | Ga0495674_0192739 | 3300047319 | Bacteria | 1693 |
| 1256 | Ga0495672_0004785 | 3300047320 | Bacteria | 10917 |
| 1257 | Ga0495676_0023788 | 3300047321 | Bacteria | 5309 |
| 1258 | Ga0495676_0072221 | 3300047321 | Bacteria | 2650 |
| 1259 | Ga0495680_0006764 | 3300047322 | Bacteria | 10597 |
| 1260 | Ga0495680_0011844 | 3300047322 | Bacteria | 7700 |
| 1261 | Ga0495680_0017348 | 3300047322 | Bacteria | 6152 |
| 1262 | Ga0495680_0022079 | 3300047322 | Bacteria | 5314 |
| 1263 | Ga0495680_0026856 | 3300047322 | Bacteria | 4740 |
| 1264 | Ga0495680_0213611 | 3300047322 | Bacteria | 1380 |
| 1265 | Ga0495683_0023977 | 3300047323 | Bacteria | 3133 |
| 1266 | Ga0495683_0045786 | 3300047323 | Bacteria | 2197 |
| 1267 | Ga0495683_0053704 | 3300047323 | Bacteria | 2009 |
| 1268 | Ga0495687_002815 | 3300047443 | Bacteria | 13420 |
| 1269 | Ga0495687_006848 | 3300047443 | Bacteria | 6870 |
| 1270 | Ga0495675_0002889 | 3300047444 | Bacteria | 10314 |
| 1271 | Ga0495675_0004974 | 3300047444 | Bacteria | 8090 |
| 1272 | Ga0495675_0006351 | 3300047444 | Bacteria | 7233 |
| 1273 | Ga0495675_0014687 | 3300047444 | Bacteria | 4948 |
| 1274 | Ga0495675_0021343 | 3300047444 | Bacteria | 4123 |
| 1275 | Ga0495675_0023645 | 3300047444 | Bacteria | 3916 |
| 1276 | Ga0495675_0046692 | 3300047444 | Bacteria | 2757 |
| 1277 | Ga0495685_000982 | 3300047447 | Bacteria | 8653 |
| 1278 | Ga0495685_020451 | 3300047447 | Bacteria | 2274 |
| 1279 | Ga0495685_023255 | 3300047447 | Bacteria | 2133 |
| 1280 | Ga0495685_024961 | 3300047447 | Bacteria | 2057 |
| 1281 | Ga0495685_042339 | 3300047447 | Bacteria | 1554 |
| 1282 | Ga0495681_0015753 | 3300047470 | Bacteria | 4268 |
| 1283 | Ga0495681_0064671 | 3300047470 | Bacteria | 1674 |
| 1284 | Ga0495681_0104454 | 3300047470 | Bacteria | 1234 |
| 1285 | Ga0495681_0114760 | 3300047470 | Bacteria | 1162 |
| 1286 | Ga0495684_0005403 | 3300047471 | Bacteria | 9945 |
| 1287 | Ga0495684_0242685 | 3300047471 | Bacteria | 1313 |
| 1288 | Ga0495686_0116420 | 3300047472 | Bacteria | 1597 |
| 1289 | Ga0495593_0000443 | 3300047673 | Bacteria | 23177 |
| 1290 | Ga0495593_0002560 | 3300047673 | Bacteria | 10915 |
| 1291 | Ga0495593_0034279 | 3300047673 | Bacteria | 2762 |
| 1292 | Ga0495593_0111386 | 3300047673 | Bacteria | 1397 |
| 1293 | Ga0495602_0006880 | 3300048088 | Bacteria | 11952 |
| 1294 | Ga0495602_0029227 | 3300048088 | Bacteria | 5255 |
| 1295 | Ga0495602_0036142 | 3300048088 | Bacteria | 4600 |
| 1296 | Ga0495602_0075673 | 3300048088 | Bacteria | 2856 |
| 1297 | Ga0495602_0175671 | 3300048088 | Bacteria | 1657 |
| 1298 | Ga0495602_0212854 | 3300048088 | Bacteria | 1465 |
| 1299 | Ga0495614_0000332 | 3300048089 | Bacteria | 18664 |
| 1300 | Ga0495614_0031915 | 3300048089 | Bacteria | 2267 |
| 1301 | Ga0495614_0033535 | 3300048089 | Bacteria | 2209 |
| 1302 | Ga0495626_0000107 | 3300048091 | Bacteria | 109694 |
| 1303 | Ga0496100_0000230 | 3300048903 | Bacteria | 29721 |
| 1304 | Ga0496100_0043820 | 3300048903 | Bacteria | 2863 |
| 1305 | Ga0496100_0087974 | 3300048903 | Bacteria | 2113 |
| 1306 | Ga0496100_0161740 | 3300048903 | Bacteria | 1605 |
| 1307 | Ga0496100_0196657 | 3300048903 | Bacteria | 1467 |
| 1308 | Ga0496101_0001323 | 3300048904 | Bacteria | 14832 |
| 1309 | Ga0496101_0054973 | 3300048904 | Bacteria | 2874 |
| 1310 | Ga0496101_0082071 | 3300048904 | Bacteria | 2386 |
| 1311 | Ga0496102_0000197 | 3300048905 | Bacteria | 81788 |
| 1312 | Ga0496102_0021041 | 3300048905 | Bacteria | 5769 |
| 1313 | Ga0496102_0023849 | 3300048905 | Bacteria | 5438 |
| 1314 | Ga0496102_0037590 | 3300048905 | Bacteria | 4367 |
| 1315 | Ga0496102_0038480 | 3300048905 | Bacteria | 4316 |
| 1316 | Ga0496102_0045644 | 3300048905 | Bacteria | 3978 |
| 1317 | Ga0496102_0055745 | 3300048905 | Bacteria | 3604 |
| 1318 | Ga0496102_0083131 | 3300048905 | Bacteria | 2954 |
| 1319 | Ga0496102_0093081 | 3300048905 | Bacteria | 2792 |
| 1320 | Ga0496102_0102067 | 3300048905 | Bacteria | 2666 |
| 1321 | Ga0496102_0171358 | 3300048905 | Bacteria | 2043 |
| 1322 | Ga0496103_0000567 | 3300048906 | Bacteria | 29330 |
| 1323 | Ga0496103_0023676 | 3300048906 | Bacteria | 3704 |
| 1324 | Ga0496103_0030514 | 3300048906 | Bacteria | 3281 |
| 1325 | Ga0496103_0039662 | 3300048906 | Bacteria | 2894 |
| 1326 | Ga0496103_0067538 | 3300048906 | Bacteria | 2233 |
| 1327 | Ga0496104_0003320 | 3300048907 | Bacteria | 13884 |
| 1328 | Ga0496104_0011409 | 3300048907 | Bacteria | 7956 |
| 1329 | Ga0496104_0033704 | 3300048907 | Bacteria | 4773 |
| 1330 | Ga0496104_0034546 | 3300048907 | Bacteria | 4716 |
| 1331 | Ga0496104_0036380 | 3300048907 | Bacteria | 4602 |
| 1332 | Ga0496104_0046580 | 3300048907 | Bacteria | 4083 |
| 1333 | Ga0496104_0099606 | 3300048907 | Bacteria | 2782 |
| 1334 | Ga0496104_0111162 | 3300048907 | Bacteria | 2627 |
| 1335 | Ga0496104_0121872 | 3300048907 | Bacteria | 2504 |
| 1336 | Ga0496104_0131900 | 3300048907 | Bacteria | 2400 |
| 1337 | Ga0496104_0234151 | 3300048907 | Bacteria | 1748 |
| 1338 | Ga0496104_0257471 | 3300048907 | Bacteria | 1658 |
| 1339 | Ga0496105_0011926 | 3300048908 | Bacteria | 6882 |
| 1340 | Ga0496105_0015275 | 3300048908 | Bacteria | 6116 |
| 1341 | Ga0496105_0038966 | 3300048908 | Bacteria | 3916 |
| 1342 | Ga0496105_0046991 | 3300048908 | Bacteria | 3562 |
| 1343 | Ga0496105_0090132 | 3300048908 | Bacteria | 2533 |
| 1344 | Ga0496105_0090865 | 3300048908 | Bacteria | 2522 |
| 1345 | Ga0496105_0132441 | 3300048908 | Bacteria | 2055 |
| 1346 | Ga0496105_0258066 | 3300048908 | Bacteria | 1410 |
| 1347 | Ga0496106_0007408 | 3300048909 | Bacteria | 8109 |
| 1348 | Ga0496106_0031548 | 3300048909 | Bacteria | 3949 |
| 1349 | Ga0496106_0036550 | 3300048909 | Bacteria | 3674 |
| 1350 | Ga0496106_0069881 | 3300048909 | Bacteria | 2681 |
| 1351 | Ga0496106_0123434 | 3300048909 | Bacteria | 2026 |
| 1352 | Ga0496106_0133453 | 3300048909 | Bacteria | 1948 |
| 1353 | Ga0496107_0001318 | 3300048910 | Bacteria | 15224 |
| 1354 | Ga0496107_0037188 | 3300048910 | Bacteria | 3493 |
| 1355 | Ga0496107_0038003 | 3300048910 | Bacteria | 3456 |
| 1356 | Ga0496107_0055606 | 3300048910 | Bacteria | 2858 |
| 1357 | Ga0496107_0076169 | 3300048910 | Bacteria | 2443 |
| 1358 | Ga0496107_0100298 | 3300048910 | Bacteria | 2122 |
| 1359 | Ga0496107_0102047 | 3300048910 | Bacteria | 2103 |
| 1360 | Ga0496108_0000323 | 3300048911 | Bacteria | 40586 |
| 1361 | Ga0496108_0006496 | 3300048911 | Bacteria | 9485 |
| 1362 | Ga0496108_0012803 | 3300048911 | Bacteria | 6831 |
| 1363 | Ga0496108_0084950 | 3300048911 | Bacteria | 2686 |
| 1364 | Ga0496108_0095629 | 3300048911 | Bacteria | 2529 |
| 1365 | Ga0496108_0105015 | 3300048911 | Bacteria | 2411 |
| 1366 | Ga0496108_0120317 | 3300048911 | Bacteria | 2251 |
| 1367 | Ga0496108_0124866 | 3300048911 | Bacteria | 2209 |
| 1368 | Ga0496108_0186921 | 3300048911 | Bacteria | 1795 |
| 1369 | Ga0496109_0002523 | 3300048912 | Bacteria | 15351 |
| 1370 | Ga0496109_0004862 | 3300048912 | Bacteria | 11217 |
| 1371 | Ga0496109_0019246 | 3300048912 | Bacteria | 6016 |
| 1372 | Ga0496109_0032372 | 3300048912 | Bacteria | 4700 |
| 1373 | Ga0496109_0034824 | 3300048912 | Bacteria | 4538 |
| 1374 | Ga0496109_0115425 | 3300048912 | Bacteria | 2498 |
| 1375 | Ga0496109_0129255 | 3300048912 | Bacteria | 2357 |
| 1376 | Ga0496109_0157565 | 3300048912 | Bacteria | 2127 |
| 1377 | Ga0496109_0199461 | 3300048912 | Bacteria | 1881 |
| 1378 | Ga0496109_0204079 | 3300048912 | Bacteria | 1858 |
| 1379 | Ga0496109_0215218 | 3300048912 | Bacteria | 1807 |
| 1380 | Ga0496109_0237679 | 3300048912 | Bacteria | 1714 |
| 1381 | Ga0496109_0486189 | 3300048912 | Bacteria | 1165 |
| 1382 | Ga0496110_0004803 | 3300048913 | Bacteria | 10526 |
| 1383 | Ga0496110_0008247 | 3300048913 | Bacteria | 8376 |
| 1384 | Ga0496110_0008548 | 3300048913 | Bacteria | 8242 |
| 1385 | Ga0496110_0017679 | 3300048913 | Bacteria | 5963 |
| 1386 | Ga0496110_0038743 | 3300048913 | Bacteria | 4149 |
| 1387 | Ga0496110_0039302 | 3300048913 | Bacteria | 4120 |
| 1388 | Ga0496110_0043146 | 3300048913 | Bacteria | 3938 |
| 1389 | Ga0496110_0059470 | 3300048913 | Bacteria | 3368 |
| 1390 | Ga0496110_0059635 | 3300048913 | Bacteria | 3364 |
| 1391 | Ga0496110_0117426 | 3300048913 | Bacteria | 2395 |
| 1392 | Ga0496110_0118881 | 3300048913 | Bacteria | 2380 |
| 1393 | Ga0496110_0199315 | 3300048913 | Bacteria | 1818 |
| 1394 | Ga0496111_0047322 | 3300048914 | Bacteria | 3097 |
| 1395 | Ga0496111_0059520 | 3300048914 | Bacteria | 2768 |
| 1396 | Ga0496111_0069275 | 3300048914 | Bacteria | 2565 |
| 1397 | Ga0496111_0099236 | 3300048914 | Bacteria | 2139 |
| 1398 | Ga0496111_0105774 | 3300048914 | Bacteria | 2071 |
| 1399 | Ga0496111_0139751 | 3300048914 | Bacteria | 1794 |
| 1400 | Ga0496111_0220146 | 3300048914 | Bacteria | 1410 |
| 1401 | Ga0496112_0027019 | 3300048915 | Bacteria | 5532 |
| 1402 | Ga0496112_0027336 | 3300048915 | Bacteria | 5500 |
| 1403 | Ga0496112_0027513 | 3300048915 | Bacteria | 5483 |
| 1404 | Ga0496112_0062948 | 3300048915 | Bacteria | 3660 |
| 1405 | Ga0496112_0093772 | 3300048915 | Bacteria | 2972 |
| 1406 | Ga0496112_0095368 | 3300048915 | Bacteria | 2945 |
| 1407 | Ga0496112_0134082 | 3300048915 | Bacteria | 2447 |
| 1408 | Ga0496112_0419569 | 3300048915 | Bacteria | 1277 |
| 1409 | Ga0496113_0002025 | 3300048916 | Bacteria | 11636 |
| 1410 | Ga0496113_0054965 | 3300048916 | Bacteria | 2983 |
| 1411 | Ga0496113_0055383 | 3300048916 | Bacteria | 2973 |
| 1412 | Ga0496113_0082918 | 3300048916 | Bacteria | 2460 |
| 1413 | Ga0496113_0105761 | 3300048916 | Bacteria | 2185 |
| 1414 | Ga0496113_0113680 | 3300048916 | Bacteria | 2110 |
| 1415 | Ga0496113_0214923 | 3300048916 | Bacteria | 1531 |
| 1416 | Ga0496113_0350872 | 3300048916 | Bacteria | 1184 |
| 1417 | Ga0496114_0000312 | 3300048917 | Bacteria | 35518 |
| 1418 | Ga0496114_0004399 | 3300048917 | Bacteria | 10926 |
| 1419 | Ga0496114_0005039 | 3300048917 | Bacteria | 10305 |
| 1420 | Ga0496114_0021136 | 3300048917 | Bacteria | 5292 |
| 1421 | Ga0496114_0037163 | 3300048917 | Bacteria | 4027 |
| 1422 | Ga0496114_0045642 | 3300048917 | Bacteria | 3641 |
| 1423 | Ga0496114_0062739 | 3300048917 | Bacteria | 3110 |
| 1424 | Ga0496114_0065970 | 3300048917 | Bacteria | 3034 |
| 1425 | Ga0496114_0083702 | 3300048917 | Bacteria | 2699 |
| 1426 | Ga0496114_0100408 | 3300048917 | Bacteria | 2469 |
| 1427 | Ga0496114_0105861 | 3300048917 | Bacteria | 2406 |
| 1428 | Ga0496114_0106305 | 3300048917 | Bacteria | 2401 |
| 1429 | Ga0496114_0122375 | 3300048917 | Bacteria | 2239 |
| 1430 | Ga0496114_0159674 | 3300048917 | Bacteria | 1959 |
| 1431 | Ga0496115_0000958 | 3300048918 | Bacteria | 20936 |
| 1432 | Ga0496115_0015306 | 3300048918 | Bacteria | 5817 |
| 1433 | Ga0496115_0017500 | 3300048918 | Bacteria | 5482 |
| 1434 | Ga0496115_0030420 | 3300048918 | Bacteria | 4248 |
| 1435 | Ga0496115_0039635 | 3300048918 | Bacteria | 3742 |
| 1436 | Ga0496115_0055631 | 3300048918 | Bacteria | 3178 |
| 1437 | Ga0496115_0157271 | 3300048918 | Bacteria | 1877 |
| 1438 | Ga0496116_0001814 | 3300048919 | Bacteria | 23129 |
| 1439 | Ga0496117_0000160 | 3300048920 | Bacteria | 141709 |
| 1440 | Ga0496117_0025274 | 3300048920 | Bacteria | 4673 |
| 1441 | Ga0496117_0078466 | 3300048920 | Bacteria | 2180 |
| 1442 | Ga0496118_0000391 | 3300048921 | Bacteria | 74169 |
| 1443 | Ga0496118_0004280 | 3300048921 | Bacteria | 17078 |
| 1444 | Ga0496118_0008436 | 3300048921 | Bacteria | 10655 |
| 1445 | Ga0496118_0013776 | 3300048921 | Bacteria | 7621 |
| 1446 | Ga0496118_0077813 | 3300048921 | Bacteria | 2351 |
| 1447 | Ga0496119_0000585 | 3300048922 | Bacteria | 49239 |
| 1448 | Ga0496119_0001388 | 3300048922 | Bacteria | 29376 |
| 1449 | Ga0496119_0006896 | 3300048922 | Bacteria | 10369 |
| 1450 | Ga0496119_0014398 | 3300048922 | Bacteria | 6194 |
| 1451 | Ga0496119_0022637 | 3300048922 | Bacteria | 4489 |
| 1452 | Ga0496120_0000664 | 3300048923 | Bacteria | 50585 |
| 1453 | Ga0496120_0025613 | 3300048923 | Bacteria | 3658 |
| 1454 | Ga0496121_0001733 | 3300048924 | Bacteria | 35614 |
| 1455 | Ga0496121_0005283 | 3300048924 | Bacteria | 16634 |
| 1456 | Ga0496121_0015399 | 3300048924 | Bacteria | 8015 |
| 1457 | Ga0496121_0038881 | 3300048924 | Bacteria | 4203 |
| 1458 | Ga0496122_0000420 | 3300048925 | Bacteria | 89921 |
| 1459 | Ga0496123_0000241 | 3300048926 | Bacteria | 110078 |
| 1460 | Ga0496123_0007065 | 3300048926 | Bacteria | 10675 |
| 1461 | Ga0496124_0001389 | 3300048927 | Bacteria | 36286 |
| 1462 | Ga0496124_0008501 | 3300048927 | Bacteria | 10721 |
| 1463 | Ga0496124_0131795 | 3300048927 | Bacteria | 1985 |
| 1464 | Ga0496124_0245039 | 3300048927 | Bacteria | 1330 |
| 1465 | Ga0496125_0001823 | 3300048928 | Bacteria | 29442 |
| 1466 | Ga0496125_0023204 | 3300048928 | Bacteria | 5734 |
| 1467 | Ga0496125_0183937 | 3300048928 | Bacteria | 1388 |
| 1468 | Ga0496126_0000003 | 3300048929 | Bacteria | 961576 |
| 1469 | Ga0496126_0000007 | 3300048929 | Bacteria | 787364 |
| 1470 | Ga0496126_0001780 | 3300048929 | Bacteria | 31816 |
| 1471 | Ga0496126_0014094 | 3300048929 | Bacteria | 8096 |
| 1472 | Ga0496126_0115230 | 3300048929 | Bacteria | 2337 |
| 1473 | Ga0495678_033053 | 3300049459 | Bacteria | 2138 |
| 1474 | Ga0501311_006970 | 3300049527 | Bacteria | 1290 |
| 1475 | Ga0501316_002091 | 3300049532 | Bacteria | 1809 |
| 1476 | Ga0501317_005953 | 3300049533 | Bacteria | 1325 |
| 1477 | Ga0501317_006872 | 3300049533 | Bacteria | 1268 |
| 1478 | Ga0501031_0005025 | 3300049568 | Bacteria | 8601 |
| 1479 | Ga0501031_0017177 | 3300049568 | Bacteria | 4701 |
| 1480 | Ga0501031_0017508 | 3300049568 | Bacteria | 4658 |
| 1481 | Ga0501031_0035488 | 3300049568 | Bacteria | 3252 |
| 1482 | Ga0501031_0177693 | 3300049568 | Bacteria | 1391 |
| 1483 | Ga0501032_0000233 | 3300049569 | Bacteria | 46360 |
| 1484 | Ga0501032_0001476 | 3300049569 | Bacteria | 18737 |
| 1485 | Ga0501032_0005177 | 3300049569 | Bacteria | 9720 |
| 1486 | Ga0501032_0028713 | 3300049569 | Bacteria | 3821 |
| 1487 | Ga0501032_0030584 | 3300049569 | Bacteria | 3695 |
| 1488 | Ga0501032_0032894 | 3300049569 | Bacteria | 3553 |
| 1489 | Ga0501032_0123909 | 3300049569 | Bacteria | 1708 |
| 1490 | Ga0501032_0134293 | 3300049569 | Bacteria | 1631 |
| 1491 | Ga0501033_0000068 | 3300049570 | Bacteria | 98461 |
| 1492 | Ga0501033_0001790 | 3300049570 | Bacteria | 18761 |
| 1493 | Ga0501033_0003003 | 3300049570 | Bacteria | 14082 |
| 1494 | Ga0501033_0024169 | 3300049570 | Bacteria | 4584 |
| 1495 | Ga0501033_0028021 | 3300049570 | Bacteria | 4233 |
| 1496 | Ga0501033_0036697 | 3300049570 | Bacteria | 3671 |
| 1497 | Ga0501033_0043060 | 3300049570 | Bacteria | 3363 |
| 1498 | Ga0501033_0043157 | 3300049570 | Bacteria | 3359 |
| 1499 | Ga0501033_0048329 | 3300049570 | Bacteria | 3160 |
| 1500 | Ga0501033_0072646 | 3300049570 | Bacteria | 2526 |
| 1501 | Ga0501033_0160141 | 3300049570 | Bacteria | 1620 |
| 1502 | Ga0501033_0210754 | 3300049570 | Bacteria | 1385 |
| 1503 | Ga0501034_0000112 | 3300049571 | Bacteria | 150146 |
| 1504 | Ga0501034_0000445 | 3300049571 | Bacteria | 68416 |
| 1505 | Ga0501034_0006054 | 3300049571 | Bacteria | 13064 |
| 1506 | Ga0501034_0007138 | 3300049571 | Bacteria | 11920 |
| 1507 | Ga0501034_0010407 | 3300049571 | Bacteria | 9693 |
| 1508 | Ga0501034_0012880 | 3300049571 | Bacteria | 8625 |
| 1509 | Ga0501034_0014057 | 3300049571 | Bacteria | 8245 |
| 1510 | Ga0501034_0015728 | 3300049571 | Bacteria | 7769 |
| 1511 | Ga0501034_0016899 | 3300049571 | Bacteria | 7481 |
| 1512 | Ga0501034_0026522 | 3300049571 | Bacteria | 5901 |
| 1513 | Ga0501034_0030332 | 3300049571 | Bacteria | 5497 |
| 1514 | Ga0501034_0045746 | 3300049571 | Bacteria | 4421 |
| 1515 | Ga0501034_0061252 | 3300049571 | Bacteria | 3779 |
| 1516 | Ga0501034_0069812 | 3300049571 | Bacteria | 3524 |
| 1517 | Ga0501034_0076242 | 3300049571 | Bacteria | 3360 |
| 1518 | Ga0501034_0134456 | 3300049571 | Bacteria | 2454 |
| 1519 | Ga0501034_0142499 | 3300049571 | Bacteria | 2375 |
| 1520 | Ga0501034_0198622 | 3300049571 | Bacteria | 1964 |
| 1521 | Ga0501036_0000173 | 3300049572 | Bacteria | 42312 |
| 1522 | Ga0501036_0000311 | 3300049572 | Bacteria | 33892 |
| 1523 | Ga0501036_0003610 | 3300049572 | Bacteria | 12367 |
| 1524 | Ga0501036_0008768 | 3300049572 | Bacteria | 8301 |
| 1525 | Ga0501036_0008920 | 3300049572 | Bacteria | 8242 |
| 1526 | Ga0501036_0029342 | 3300049572 | Bacteria | 4649 |
| 1527 | Ga0501036_0043083 | 3300049572 | Bacteria | 3822 |
| 1528 | Ga0501036_0043488 | 3300049572 | Bacteria | 3804 |
| 1529 | Ga0501036_0056446 | 3300049572 | Bacteria | 3328 |
| 1530 | Ga0501036_0065845 | 3300049572 | Bacteria | 3066 |
| 1531 | Ga0501036_0112295 | 3300049572 | Bacteria | 2303 |
| 1532 | Ga0501036_0222346 | 3300049572 | Bacteria | 1585 |
| 1533 | Ga0501036_0258655 | 3300049572 | Bacteria | 1458 |
| 1534 | Ga0501036_0280210 | 3300049572 | Bacteria | 1395 |
| 1535 | Ga0501036_0383459 | 3300049572 | Bacteria | 1173 |
| 1536 | Ga0501037_0003443 | 3300049573 | Bacteria | 11496 |
| 1537 | Ga0501037_0006517 | 3300049573 | Bacteria | 8541 |
| 1538 | Ga0501037_0027561 | 3300049573 | Bacteria | 4198 |
| 1539 | Ga0501037_0062648 | 3300049573 | Bacteria | 2711 |
| 1540 | Ga0501037_0074828 | 3300049573 | Bacteria | 2460 |
| 1541 | Ga0501037_0085228 | 3300049573 | Bacteria | 2287 |
| 1542 | Ga0501037_0087800 | 3300049573 | Bacteria | 2250 |
| 1543 | Ga0501037_0096108 | 3300049573 | Bacteria | 2141 |
| 1544 | Ga0501037_0118814 | 3300049573 | Bacteria | 1902 |
| 1545 | Ga0501037_0118967 | 3300049573 | Bacteria | 1900 |
| 1546 | Ga0501037_0154033 | 3300049573 | Bacteria | 1641 |
| 1547 | Ga0501037_0171181 | 3300049573 | Bacteria | 1543 |
| 1548 | Ga0501037_0217775 | 3300049573 | Bacteria | 1344 |
| 1549 | Ga0501038_0001008 | 3300049574 | Bacteria | 25385 |
| 1550 | Ga0501038_0003450 | 3300049574 | Bacteria | 14741 |
| 1551 | Ga0501038_0014731 | 3300049574 | Bacteria | 7125 |
| 1552 | Ga0501038_0017937 | 3300049574 | Bacteria | 6394 |
| 1553 | Ga0501038_0018475 | 3300049574 | Bacteria | 6295 |
| 1554 | Ga0501038_0022056 | 3300049574 | Bacteria | 5711 |
| 1555 | Ga0501038_0022327 | 3300049574 | Bacteria | 5673 |
| 1556 | Ga0501038_0024582 | 3300049574 | Bacteria | 5372 |
| 1557 | Ga0501038_0033926 | 3300049574 | Bacteria | 4490 |
| 1558 | Ga0501038_0037905 | 3300049574 | Bacteria | 4224 |
| 1559 | Ga0501038_0100233 | 3300049574 | Bacteria | 2414 |
| 1560 | Ga0501039_0000365 | 3300049575 | Bacteria | 32363 |
| 1561 | Ga0501039_0001818 | 3300049575 | Bacteria | 15776 |
| 1562 | Ga0501039_0002989 | 3300049575 | Bacteria | 12651 |
| 1563 | Ga0501039_0022325 | 3300049575 | Bacteria | 4858 |
| 1564 | Ga0501039_0047522 | 3300049575 | Bacteria | 3317 |
| 1565 | Ga0501039_0055707 | 3300049575 | Bacteria | 3063 |
| 1566 | Ga0501040_0000601 | 3300049576 | Bacteria | 21952 |
| 1567 | Ga0501040_0003265 | 3300049576 | Bacteria | 10477 |
| 1568 | Ga0501040_0005731 | 3300049576 | Bacteria | 8033 |
| 1569 | Ga0501040_0010110 | 3300049576 | Bacteria | 6166 |
| 1570 | Ga0501040_0024469 | 3300049576 | Bacteria | 4053 |
| 1571 | Ga0501040_0030966 | 3300049576 | Bacteria | 3615 |
| 1572 | Ga0501040_0034618 | 3300049576 | Bacteria | 3421 |
| 1573 | Ga0501040_0046369 | 3300049576 | Bacteria | 2967 |
| 1574 | Ga0501040_0167863 | 3300049576 | Bacteria | 1553 |
| 1575 | Ga0501040_0169048 | 3300049576 | Bacteria | 1548 |
| 1576 | Ga0501041_0000058 | 3300049577 | Bacteria | 40571 |
| 1577 | Ga0501041_0003675 | 3300049577 | Bacteria | 8821 |
| 1578 | Ga0501041_0007040 | 3300049577 | Bacteria | 6598 |
| 1579 | Ga0501041_0035545 | 3300049577 | Bacteria | 3019 |
| 1580 | Ga0501041_0047911 | 3300049577 | Bacteria | 2602 |
| 1581 | Ga0501041_0089087 | 3300049577 | Bacteria | 1905 |
| 1582 | Ga0501041_0126922 | 3300049577 | Bacteria | 1588 |
| 1583 | Ga0501042_0000028 | 3300049578 | Bacteria | 47448 |
| 1584 | Ga0501042_0001191 | 3300049578 | Bacteria | 15071 |
| 1585 | Ga0501042_0002058 | 3300049578 | Bacteria | 12205 |
| 1586 | Ga0501042_0002832 | 3300049578 | Bacteria | 10748 |
| 1587 | Ga0501042_0018019 | 3300049578 | Bacteria | 4885 |
| 1588 | Ga0501042_0052282 | 3300049578 | Bacteria | 2914 |
| 1589 | Ga0501042_0069868 | 3300049578 | Bacteria | 2512 |
| 1590 | Ga0501043_0002108 | 3300049579 | Bacteria | 16979 |
| 1591 | Ga0501043_0003406 | 3300049579 | Bacteria | 13076 |
| 1592 | Ga0501043_0003689 | 3300049579 | Bacteria | 12576 |
| 1593 | Ga0501043_0006173 | 3300049579 | Bacteria | 9626 |
| 1594 | Ga0501043_0006711 | 3300049579 | Bacteria | 9191 |
| 1595 | Ga0501043_0122203 | 3300049579 | Bacteria | 2042 |
| 1596 | Ga0501043_0166297 | 3300049579 | Bacteria | 1722 |
| 1597 | Ga0501046_0000269 | 3300049580 | Bacteria | 52979 |
| 1598 | Ga0501046_0002221 | 3300049580 | Bacteria | 18318 |
| 1599 | Ga0501046_0011509 | 3300049580 | Bacteria | 7563 |
| 1600 | Ga0501046_0014720 | 3300049580 | Bacteria | 6585 |
| 1601 | Ga0501046_0019530 | 3300049580 | Bacteria | 5619 |
| 1602 | Ga0501046_0033858 | 3300049580 | Bacteria | 4126 |
| 1603 | Ga0501046_0138238 | 3300049580 | Bacteria | 1845 |
| 1604 | Ga0501046_0205518 | 3300049580 | Bacteria | 1464 |
| 1605 | Ga0501047_0001586 | 3300049581 | Bacteria | 22180 |
| 1606 | Ga0501047_0001974 | 3300049581 | Bacteria | 19686 |
| 1607 | Ga0501047_0002200 | 3300049581 | Bacteria | 18678 |
| 1608 | Ga0501047_0006112 | 3300049581 | Bacteria | 11314 |
| 1609 | Ga0501047_0033018 | 3300049581 | Bacteria | 4997 |
| 1610 | Ga0501047_0039286 | 3300049581 | Bacteria | 4577 |
| 1611 | Ga0501047_0063533 | 3300049581 | Bacteria | 3561 |
| 1612 | Ga0501047_0063892 | 3300049581 | Bacteria | 3551 |
| 1613 | Ga0501047_0064059 | 3300049581 | Bacteria | 3546 |
| 1614 | Ga0501047_0066684 | 3300049581 | Bacteria | 3470 |
| 1615 | Ga0501047_0140224 | 3300049581 | Bacteria | 2296 |
| 1616 | Ga0501047_0209861 | 3300049581 | Bacteria | 1806 |
| 1617 | Ga0501047_0324272 | 3300049581 | Bacteria | 1379 |
| 1618 | Ga0501048_0000200 | 3300049582 | Bacteria | 39130 |
| 1619 | Ga0501048_0000208 | 3300049582 | Bacteria | 38576 |
| 1620 | Ga0501048_0005603 | 3300049582 | Bacteria | 9552 |
| 1621 | Ga0501048_0007562 | 3300049582 | Bacteria | 8237 |
| 1622 | Ga0501048_0008379 | 3300049582 | Bacteria | 7815 |
| 1623 | Ga0501048_0202570 | 3300049582 | Bacteria | 1407 |
| 1624 | Ga0501067_0007563 | 3300049583 | Bacteria | 6041 |
| 1625 | Ga0501067_0032055 | 3300049583 | Bacteria | 2916 |
| 1626 | Ga0501067_0039453 | 3300049583 | Bacteria | 2622 |
| 1627 | Ga0501067_0044280 | 3300049583 | Bacteria | 2472 |
| 1628 | Ga0501067_0048889 | 3300049583 | Bacteria | 2345 |
| 1629 | Ga0501068_0000883 | 3300049584 | Bacteria | 15643 |
| 1630 | Ga0501068_0002304 | 3300049584 | Bacteria | 10165 |
| 1631 | Ga0501068_0005165 | 3300049584 | Bacteria | 7120 |
| 1632 | Ga0501068_0043033 | 3300049584 | Bacteria | 2716 |
| 1633 | Ga0501068_0094068 | 3300049584 | Bacteria | 1852 |
| 1634 | Ga0501069_0000009 | 3300049585 | Bacteria | 175166 |
| 1635 | Ga0501069_0000779 | 3300049585 | Bacteria | 14973 |
| 1636 | Ga0501069_0003171 | 3300049585 | Bacteria | 8426 |
| 1637 | Ga0501069_0010725 | 3300049585 | Bacteria | 4858 |
| 1638 | Ga0501069_0011829 | 3300049585 | Bacteria | 4627 |
| 1639 | Ga0501069_0019199 | 3300049585 | Bacteria | 3694 |
| 1640 | Ga0501070_0000006 | 3300049586 | Bacteria | 226569 |
| 1641 | Ga0501070_0000090 | 3300049586 | Bacteria | 77327 |
| 1642 | Ga0501070_0000381 | 3300049586 | Bacteria | 40532 |
| 1643 | Ga0501070_0002977 | 3300049586 | Bacteria | 14753 |
| 1644 | Ga0501070_0003717 | 3300049586 | Bacteria | 13183 |
| 1645 | Ga0501070_0004522 | 3300049586 | Bacteria | 11934 |
| 1646 | Ga0501070_0005764 | 3300049586 | Bacteria | 10564 |
| 1647 | Ga0501070_0007642 | 3300049586 | Bacteria | 9177 |
| 1648 | Ga0501070_0020310 | 3300049586 | Bacteria | 5572 |
| 1649 | Ga0501070_0067333 | 3300049586 | Bacteria | 2965 |
| 1650 | Ga0501070_0072577 | 3300049586 | Bacteria | 2849 |
| 1651 | Ga0501070_0072816 | 3300049586 | Bacteria | 2844 |
| 1652 | Ga0501070_0076534 | 3300049586 | Bacteria | 2770 |
| 1653 | Ga0501070_0076808 | 3300049586 | Bacteria | 2765 |
| 1654 | Ga0501070_0098471 | 3300049586 | Bacteria | 2419 |
| 1655 | Ga0501070_0111273 | 3300049586 | Bacteria | 2263 |
| 1656 | Ga0501070_0123860 | 3300049586 | Bacteria | 2136 |
| 1657 | Ga0501070_0263901 | 3300049586 | Bacteria | 1407 |
| 1658 | Ga0501071_0001455 | 3300049587 | Bacteria | 13716 |
| 1659 | Ga0501071_0002907 | 3300049587 | Bacteria | 10567 |
| 1660 | Ga0501071_0003307 | 3300049587 | Bacteria | 10072 |
| 1661 | Ga0501071_0008605 | 3300049587 | Bacteria | 6745 |
| 1662 | Ga0501071_0009897 | 3300049587 | Bacteria | 6368 |
| 1663 | Ga0501071_0018889 | 3300049587 | Bacteria | 4780 |
| 1664 | Ga0501071_0075154 | 3300049587 | Bacteria | 2466 |
| 1665 | Ga0501071_0162036 | 3300049587 | Bacteria | 1672 |
| 1666 | Ga0501072_0000452 | 3300049588 | Bacteria | 29576 |
| 1667 | Ga0501072_0000456 | 3300049588 | Bacteria | 29523 |
| 1668 | Ga0501072_0001842 | 3300049588 | Bacteria | 15788 |
| 1669 | Ga0501072_0005756 | 3300049588 | Bacteria | 9435 |
| 1670 | Ga0501072_0008669 | 3300049588 | Bacteria | 7719 |
| 1671 | Ga0501072_0017657 | 3300049588 | Bacteria | 5487 |
| 1672 | Ga0501072_0092052 | 3300049588 | Bacteria | 2408 |
| 1673 | Ga0501072_0134057 | 3300049588 | Bacteria | 1975 |
| 1674 | Ga0501073_0002160 | 3300049589 | Bacteria | 14708 |
| 1675 | Ga0501073_0003916 | 3300049589 | Bacteria | 11175 |
| 1676 | Ga0501073_0008948 | 3300049589 | Bacteria | 7395 |
| 1677 | Ga0501073_0083303 | 3300049589 | Bacteria | 2225 |
| 1678 | Ga0501073_0093393 | 3300049589 | Bacteria | 2090 |
| 1679 | Ga0501073_0103888 | 3300049589 | Bacteria | 1972 |
| 1680 | Ga0501073_0115876 | 3300049589 | Bacteria | 1857 |
| 1681 | Ga0501073_0131878 | 3300049589 | Bacteria | 1732 |
| 1682 | Ga0501074_0000592 | 3300049590 | Bacteria | 22500 |
| 1683 | Ga0501074_0001226 | 3300049590 | Bacteria | 16918 |
| 1684 | Ga0501074_0001449 | 3300049590 | Bacteria | 15872 |
| 1685 | Ga0501074_0001504 | 3300049590 | Bacteria | 15719 |
| 1686 | Ga0501074_0001760 | 3300049590 | Bacteria | 14793 |
| 1687 | Ga0501074_0002346 | 3300049590 | Bacteria | 13176 |
| 1688 | Ga0501074_0010495 | 3300049590 | Bacteria | 6723 |
| 1689 | Ga0501074_0014772 | 3300049590 | Bacteria | 5681 |
| 1690 | Ga0501074_0027690 | 3300049590 | Bacteria | 4109 |
| 1691 | Ga0501074_0046308 | 3300049590 | Bacteria | 3144 |
| 1692 | Ga0501074_0081549 | 3300049590 | Bacteria | 2320 |
| 1693 | Ga0501074_0107580 | 3300049590 | Bacteria | 1996 |
| 1694 | Ga0501074_0122618 | 3300049590 | Bacteria | 1859 |
| 1695 | Ga0501074_0329696 | 3300049590 | Bacteria | 1083 |
| 1696 | Ga0501075_0002435 | 3300049591 | Bacteria | 12394 |
| 1697 | Ga0501075_0003534 | 3300049591 | Bacteria | 10458 |
| 1698 | Ga0501075_0006156 | 3300049591 | Bacteria | 8245 |
| 1699 | Ga0501075_0009381 | 3300049591 | Bacteria | 6845 |
| 1700 | Ga0501075_0025620 | 3300049591 | Bacteria | 4333 |
| 1701 | Ga0501075_0079735 | 3300049591 | Bacteria | 2477 |
| 1702 | Ga0501076_0000061 | 3300049592 | Bacteria | 53989 |
| 1703 | Ga0501076_0003089 | 3300049592 | Bacteria | 11595 |
| 1704 | Ga0501076_0005895 | 3300049592 | Bacteria | 8840 |
| 1705 | Ga0501076_0036881 | 3300049592 | Bacteria | 3832 |
| 1706 | Ga0501076_0055586 | 3300049592 | Bacteria | 3139 |
| 1707 | Ga0501076_0088735 | 3300049592 | Bacteria | 2485 |
| 1708 | Ga0501076_0325929 | 3300049592 | Bacteria | 1260 |
| 1709 | Ga0501077_0000349 | 3300049593 | Bacteria | 27264 |
| 1710 | Ga0501077_0018887 | 3300049593 | Bacteria | 4362 |
| 1711 | Ga0501077_0028205 | 3300049593 | Bacteria | 3567 |
| 1712 | Ga0501077_0108285 | 3300049593 | Bacteria | 1760 |
| 1713 | Ga0501079_0000088 | 3300049741 | Bacteria | 44435 |
| 1714 | Ga0501079_0000185 | 3300049741 | Bacteria | 35586 |
| 1715 | Ga0501079_0000787 | 3300049741 | Bacteria | 21639 |
| 1716 | Ga0501079_0003605 | 3300049741 | Bacteria | 11391 |
| 1717 | Ga0501079_0008202 | 3300049741 | Bacteria | 7918 |
| 1718 | Ga0501079_0015246 | 3300049741 | Bacteria | 5863 |
| 1719 | Ga0501079_0044068 | 3300049741 | Bacteria | 3443 |
| 1720 | Ga0501079_0048254 | 3300049741 | Bacteria | 3286 |
| 1721 | Ga0501079_0090727 | 3300049741 | Bacteria | 2367 |
| 1722 | Ga0501080_0000714 | 3300049742 | Bacteria | 26720 |
| 1723 | Ga0501080_0005622 | 3300049742 | Bacteria | 11203 |
| 1724 | Ga0501080_0014618 | 3300049742 | Bacteria | 7230 |
| 1725 | Ga0501080_0022775 | 3300049742 | Bacteria | 5803 |
| 1726 | Ga0501080_0033816 | 3300049742 | Bacteria | 4773 |
| 1727 | Ga0501080_0034394 | 3300049742 | Bacteria | 4731 |
| 1728 | Ga0501080_0035150 | 3300049742 | Bacteria | 4678 |
| 1729 | Ga0501080_0039087 | 3300049742 | Bacteria | 4428 |
| 1730 | Ga0501080_0050424 | 3300049742 | Bacteria | 3874 |
| 1731 | Ga0501080_0056786 | 3300049742 | Bacteria | 3644 |
| 1732 | Ga0501080_0130430 | 3300049742 | Bacteria | 2327 |
| 1733 | Ga0501080_0278916 | 3300049742 | Bacteria | 1520 |
| 1734 | Ga0501080_0285112 | 3300049742 | Bacteria | 1500 |
| 1735 | Ga0501081_0000808 | 3300049743 | Bacteria | 18487 |
| 1736 | Ga0501081_0001235 | 3300049743 | Bacteria | 15554 |
| 1737 | Ga0501081_0014905 | 3300049743 | Bacteria | 5127 |
| 1738 | Ga0501081_0025943 | 3300049743 | Bacteria | 3947 |
| 1739 | Ga0501083_0000096 | 3300049744 | Bacteria | 59671 |
| 1740 | Ga0501083_0006021 | 3300049744 | Bacteria | 8591 |
| 1741 | Ga0501083_0006066 | 3300049744 | Bacteria | 8562 |
| 1742 | Ga0501083_0009376 | 3300049744 | Bacteria | 6910 |
| 1743 | Ga0501083_0012445 | 3300049744 | Bacteria | 5951 |
| 1744 | Ga0501083_0049329 | 3300049744 | Bacteria | 2838 |
| 1745 | Ga0501083_0092031 | 3300049744 | Bacteria | 2002 |
| 1746 | Ga0501035_0007509 | 3300049822 | Bacteria | 10184 |
| 1747 | Ga0501035_0009862 | 3300049822 | Bacteria | 8864 |
| 1748 | Ga0501035_0021233 | 3300049822 | Bacteria | 5968 |
| 1749 | Ga0501035_0041946 | 3300049822 | Bacteria | 4129 |
| 1750 | Ga0501035_0054245 | 3300049822 | Bacteria | 3582 |
| 1751 | Ga0501035_0057970 | 3300049822 | Bacteria | 3452 |
| 1752 | Ga0501035_0059274 | 3300049822 | Bacteria | 3409 |
| 1753 | Ga0501035_0061025 | 3300049822 | Bacteria | 3356 |
| 1754 | Ga0501035_0068650 | 3300049822 | Bacteria | 3142 |
| 1755 | Ga0501035_0110052 | 3300049822 | Bacteria | 2414 |
| 1756 | Ga0501035_0122856 | 3300049822 | Bacteria | 2268 |
| 1757 | Ga0501035_0135499 | 3300049822 | Bacteria | 2144 |
| 1758 | Ga0501035_0157221 | 3300049822 | Bacteria | 1970 |
| 1759 | Ga0501035_0184080 | 3300049822 | Bacteria | 1798 |
| 1760 | Ga0501035_0275648 | 3300049822 | Bacteria | 1423 |
| 1761 | Ga0501044_0000191 | 3300049823 | Bacteria | 77389 |
| 1762 | Ga0501044_0000276 | 3300049823 | Bacteria | 65263 |
| 1763 | Ga0501044_0002167 | 3300049823 | Bacteria | 22517 |
| 1764 | Ga0501044_0003934 | 3300049823 | Bacteria | 16657 |
| 1765 | Ga0501044_0007350 | 3300049823 | Bacteria | 12109 |
| 1766 | Ga0501044_0021567 | 3300049823 | Bacteria | 6869 |
| 1767 | Ga0501044_0038842 | 3300049823 | Bacteria | 4971 |
| 1768 | Ga0501044_0079472 | 3300049823 | Bacteria | 3323 |
| 1769 | Ga0501044_0093090 | 3300049823 | Bacteria | 3039 |
| 1770 | Ga0501044_0097355 | 3300049823 | Bacteria | 2963 |
| 1771 | Ga0501044_0133618 | 3300049823 | Bacteria | 2474 |
| 1772 | Ga0501044_0136408 | 3300049823 | Bacteria | 2445 |
| 1773 | Ga0501044_0155813 | 3300049823 | Bacteria | 2264 |
| 1774 | Ga0501044_0156108 | 3300049823 | Bacteria | 2261 |
| 1775 | Ga0501044_0168415 | 3300049823 | Bacteria | 2163 |
| 1776 | Ga0501044_0214900 | 3300049823 | Bacteria | 1876 |
| 1777 | Ga0501044_0244745 | 3300049823 | Bacteria | 1736 |
| 1778 | Ga0501044_0304865 | 3300049823 | Bacteria | 1520 |
| 1779 | Ga0501045_0000044 | 3300049824 | Bacteria | 54187 |
| 1780 | Ga0501045_0000099 | 3300049824 | Bacteria | 42877 |
| 1781 | Ga0501045_0002750 | 3300049824 | Bacteria | 12012 |
| 1782 | Ga0501045_0003799 | 3300049824 | Bacteria | 10386 |
| 1783 | Ga0501045_0008315 | 3300049824 | Bacteria | 7226 |
| 1784 | Ga0501045_0013372 | 3300049824 | Bacteria | 5796 |
| 1785 | Ga0501045_0018652 | 3300049824 | Bacteria | 4938 |
| 1786 | Ga0501045_0023583 | 3300049824 | Bacteria | 4413 |
| 1787 | Ga0501045_0047497 | 3300049824 | Bacteria | 3127 |
| 1788 | Ga0501045_0061270 | 3300049824 | Bacteria | 2760 |
| 1789 | Ga0501045_0104273 | 3300049824 | Bacteria | 2101 |
| 1790 | Ga0501045_0191142 | 3300049824 | Bacteria | 1526 |
| 1791 | nmdc:mga03683_8047_c1 | 3300050489 | Bacteria | 3690 |
| 1792 | nmdc:mga03n38_113700_c1 | 3300050490 | Bacteria | 1322 |
| 1793 | nmdc:mga03n38_4316_c1 | 3300050490 | Bacteria | 4691 |
| 1794 | nmdc:mga00v17_51214_c1 | 3300050491 | Bacteria | 2511 |
| 1795 | nmdc:mga00v17_9992_c1 | 3300050491 | Bacteria | 5162 |
| 1796 | nmdc:mga0yw44_159042_c1 | 3300050492 | Bacteria | 1478 |
| 1797 | nmdc:mga0yw44_27194_c1 | 3300050492 | Bacteria | 3274 |
| 1798 | nmdc:mga0yw44_43386_c1 | 3300050492 | Bacteria | 2685 |
| 1799 | nmdc:mga0yw44_64051_c1 | 3300050492 | Bacteria | 2262 |
| 1800 | nmdc:mga0yw44_78387_c1 | 3300050492 | Bacteria | 2066 |
| 1801 | nmdc:mga0yw44_87740_c1 | 3300050492 | Bacteria | 1961 |
| 1802 | nmdc:mga06z11_13537_c1 | 3300050494 | Bacteria | 3586 |
| 1803 | nmdc:mga06z11_17805_c1 | 3300050494 | Bacteria | 3233 |
| 1804 | nmdc:mga06z11_51546_c1 | 3300050494 | Bacteria | 2108 |
| 1805 | nmdc:mga06z11_5961_c1 | 3300050494 | Bacteria | 4923 |
| 1806 | nmdc:mga04h51_10331_c1 | 3300050495 | Bacteria | 2561 |
| 1807 | nmdc:mga04h51_5221_c1 | 3300050495 | Bacteria | 3297 |
| 1808 | nmdc:mga07m45_107673_c1 | 3300050496 | Bacteria | 1604 |
| 1809 | nmdc:mga07m45_21523_c1 | 3300050496 | Bacteria | 3512 |
| 1810 | nmdc:mga05p37_1507_c1 | 3300050507 | Bacteria | 27071 |
| 1811 | nmdc:mga05p37_153_c1 | 3300050507 | Bacteria | 65478 |
| 1812 | nmdc:mga05p37_19739_c1 | 3300050507 | Bacteria | 8154 |
| 1813 | nmdc:mga05p37_2500_c1 | 3300050507 | Bacteria | 21375 |
| 1814 | nmdc:mga05p37_36897_c1 | 3300050507 | Bacteria | 5995 |
| 1815 | nmdc:mga05p37_389220_c1 | 3300050507 | Bacteria | 1631 |
| 1816 | nmdc:mga05p37_519_c1 | 3300050507 | Bacteria | 42633 |
| 1817 | nmdc:mga09592_1439_c1 | 3300050508 | Bacteria | 19070 |
| 1818 | nmdc:mga09592_40807_c1 | 3300050508 | Bacteria | 3900 |
| 1819 | nmdc:mga09592_4_c1 | 3300050508 | Bacteria | 133185 |
| 1820 | nmdc:mga09592_54533_c1 | 3300050508 | Bacteria | 3378 |
| 1821 | nmdc:mga09592_6157_c1 | 3300050508 | Bacteria | 9764 |
| 1822 | nmdc:mga0qj67_3_c2 | 3300050509 | Bacteria | 152036 |
| 1823 | nmdc:mga0qj67_61677_c1 | 3300050509 | Bacteria | 2977 |
| 1824 | nmdc:mga0qj67_6977_c1 | 3300050509 | Bacteria | 8318 |
| 1825 | nmdc:mga0qj67_79776_c1 | 3300050509 | Bacteria | 2622 |
| 1826 | nmdc:mga0qj67_9248_c1 | 3300050509 | Bacteria | 7325 |
| 1827 | nmdc:mga0qj67_97743_c1 | 3300050509 | Bacteria | 2365 |
| 1828 | nmdc:mga06r32_1153_c1 | 3300050510 | Bacteria | 23761 |
| 1829 | nmdc:mga06r32_20179_c1 | 3300050510 | Bacteria | 6132 |
| 1830 | nmdc:mga06r32_6093_c1 | 3300050510 | Bacteria | 10835 |
| 1831 | nmdc:mga06r32_6_c2 | 3300050510 | Bacteria | 109995 |
| 1832 | nmdc:mga06r32_7494_c1 | 3300050510 | Bacteria | 9814 |
| 1833 | nmdc:mga06r32_791_c1 | 3300050510 | Bacteria | 28031 |
| 1834 | nmdc:mga06r32_87415_c1 | 3300050510 | Bacteria | 3042 |
| 1835 | nmdc:mga08y16_10989_c1 | 3300050511 | Bacteria | 9505 |
| 1836 | nmdc:mga08y16_1109_c1 | 3300050511 | Bacteria | 26540 |
| 1837 | nmdc:mga08y16_15537_c1 | 3300050511 | Bacteria | 8006 |
| 1838 | nmdc:mga0n895_4859_c1 | 3300050512 | Bacteria | 11136 |
| 1839 | nmdc:mga0rr50_103852_c1 | 3300050513 | Bacteria | 2237 |
| 1840 | nmdc:mga0rr50_109975_c1 | 3300050513 | Bacteria | 2179 |
| 1841 | nmdc:mga0rr50_1591_c1 | 3300050513 | Bacteria | 12523 |
| 1842 | nmdc:mga0a205_1654_c1 | 3300050515 | Bacteria | 17980 |
| 1843 | nmdc:mga0a205_171897_c1 | 3300050515 | Bacteria | 2063 |
| 1844 | nmdc:mga0sz30_42436_c1 | 3300050516 | Bacteria | 1914 |
| 1845 | Ga0495601_0023913 | 3300053077 | Bacteria | 3758 |
| 1846 | Ga0495601_0031787 | 3300053077 | Bacteria | 3282 |
| 1847 | Ga0495601_0036267 | 3300053077 | Bacteria | 3078 |
| 1848 | Ga0495601_0082023 | 3300053077 | Bacteria | 2070 |
| 1849 | Ga0495601_0128056 | 3300053077 | Bacteria | 1652 |
| 1850 | Ga0495601_0181442 | 3300053077 | Bacteria | 1376 |
| 1851 | Ga0495612_0001858 | 3300053078 | Bacteria | 8671 |
| 1852 | Ga0495612_0007022 | 3300053078 | Bacteria | 4605 |
| 1853 | Ga0500610_0002713 | 3300053079 | Bacteria | 6603 |
| 1854 | Ga0495595_0002567 | 3300053084 | Bacteria | 7121 |
| 1855 | Ga0495595_0013276 | 3300053084 | Bacteria | 3479 |
| 1856 | Ga0495595_0093127 | 3300053084 | Bacteria | 1447 |
| 1857 | Ga0495619_0010545 | 3300053085 | Bacteria | 5814 |
| 1858 | Ga0495619_0018136 | 3300053085 | Bacteria | 4463 |
| 1859 | Ga0495619_0052583 | 3300053085 | Bacteria | 2693 |
| 1860 | Ga0495619_0069188 | 3300053085 | Bacteria | 2359 |
| 1861 | Ga0495619_0105163 | 3300053085 | Bacteria | 1924 |
| 1862 | Ga0495619_0111566 | 3300053085 | Bacteria | 1869 |
| 1863 | Ga0500643_000341 | 3300053087 | Bacteria | 37015 |
| 1864 | Ga0500643_000621 | 3300053087 | Bacteria | 24006 |
| 1865 | Ga0500644_0000003 | 3300053088 | Bacteria | 199121 |
| 1866 | Ga0500644_0014886 | 3300053088 | Bacteria | 2205 |
| 1867 | Ga0500644_0047278 | 3300053088 | Bacteria | 1459 |
| 1868 | Ga0500646_0000441 | 3300053090 | Bacteria | 12323 |
| 1869 | Ga0500583_0027610 | 3300053092 | Bacteria | 2452 |
| 1870 | Ga0500583_0092885 | 3300053092 | Bacteria | 1470 |
| 1871 | Ga0500566_0000073 | 3300053094 | Bacteria | 48667 |
| 1872 | Ga0500640_062360 | 3300053095 | Bacteria | 1613 |
| 1873 | Ga0500650_0001215 | 3300053098 | Bacteria | 7569 |
| 1874 | Ga0500650_0087862 | 3300053098 | Bacteria | 1455 |
| 1875 | Ga0500654_087111 | 3300053099 | Bacteria | 1416 |
| 1876 | Ga0500553_035850 | 3300053101 | Bacteria | 2456 |
| 1877 | Ga0500556_0000028 | 3300053104 | Bacteria | 165503 |
| 1878 | Ga0500556_0000394 | 3300053104 | Bacteria | 32021 |
| 1879 | Ga0500556_0001874 | 3300053104 | Bacteria | 7560 |
| 1880 | Ga0500560_021127 | 3300053107 | Bacteria | 1856 |
| 1881 | Ga0500562_000178 | 3300053108 | Bacteria | 17460 |
| 1882 | Ga0500580_065616 | 3300053113 | Bacteria | 1504 |
| 1883 | Ga0500593_000225 | 3300053117 | Bacteria | 23341 |
| 1884 | Ga0500652_001350 | 3300053131 | Bacteria | 7677 |
| 1885 | Ga0500655_006799 | 3300053133 | Bacteria | 2059 |
| 1886 | Ga0500559_0000648 | 3300053136 | Bacteria | 23461 |
| 1887 | Ga0500559_0032730 | 3300053136 | Bacteria | 2235 |
| 1888 | Ga0500561_0000434 | 3300053137 | Bacteria | 6815 |
| 1889 | Ga0500568_0000009 | 3300053139 | Bacteria | 270298 |
| 1890 | Ga0500568_0000043 | 3300053139 | Bacteria | 126766 |
| 1891 | Ga0500568_0000223 | 3300053139 | Bacteria | 48626 |
| 1892 | Ga0500568_0006232 | 3300053139 | Bacteria | 6020 |
| 1893 | Ga0500573_0006057 | 3300053140 | Bacteria | 6515 |
| 1894 | Ga0500573_0008740 | 3300053140 | Bacteria | 5591 |
| 1895 | Ga0500573_0073893 | 3300053140 | Bacteria | 1942 |
| 1896 | Ga0500573_0110950 | 3300053140 | Bacteria | 1534 |
| 1897 | Ga0500573_0159190 | 3300053140 | Bacteria | 1230 |
| 1898 | Ga0500577_0100319 | 3300053142 | Bacteria | 1182 |
| 1899 | Ga0500579_054963 | 3300053143 | Bacteria | 2407 |
| 1900 | Ga0500588_0000670 | 3300053146 | Bacteria | 5730 |
| 1901 | Ga0500616_0000027 | 3300053153 | Bacteria | 441053 |
| 1902 | Ga0500616_0000273 | 3300053153 | Bacteria | 77024 |
| 1903 | Ga0500616_0000570 | 3300053153 | Bacteria | 45118 |
| 1904 | Ga0500616_0006098 | 3300053153 | Bacteria | 7978 |
| 1905 | Ga0500616_0038349 | 3300053153 | Bacteria | 2588 |
| 1906 | Ga0500616_0056073 | 3300053153 | Bacteria | 2058 |
| 1907 | Ga0500620_006012 | 3300053155 | Bacteria | 2866 |
| 1908 | Ga0500624_012642 | 3300053157 | Bacteria | 1251 |
| 1909 | Ga0500636_0071097 | 3300053177 | Bacteria | 2018 |
| 1910 | Ga0501084_0000109 | 3300054114 | Bacteria | 61698 |
| 1911 | Ga0501084_0001023 | 3300054114 | Bacteria | 21690 |
| 1912 | Ga0501084_0002549 | 3300054114 | Bacteria | 14684 |
| 1913 | Ga0501084_0007261 | 3300054114 | Bacteria | 9133 |
| 1914 | Ga0501084_0008559 | 3300054114 | Bacteria | 8460 |
| 1915 | Ga0501084_0014163 | 3300054114 | Bacteria | 6604 |
| 1916 | Ga0501084_0023072 | 3300054114 | Bacteria | 5194 |
| 1917 | Ga0501084_0068395 | 3300054114 | Bacteria | 2973 |
| 1918 | Ga0501084_0107461 | 3300054114 | Bacteria | 2344 |
| 1919 | Ga0501084_0115212 | 3300054114 | Bacteria | 2259 |
| 1920 | Ga0501084_0148900 | 3300054114 | Bacteria | 1972 |
| 1921 | Ga0587090_009055 | 3300059510 | Bacteria | 1351 |
| 1922 | Ga0501082_0003253 | 3300060353 | Bacteria | 14176 |
| 1923 | Ga0501082_0027102 | 3300060353 | Bacteria | 4937 |
| 1924 | Ga0501082_0041255 | 3300060353 | Bacteria | 3979 |
| 1925 | Ga0501082_0072107 | 3300060353 | Bacteria | 2975 |
| 1926 | Ga0501082_0083044 | 3300060353 | Bacteria | 2764 |
| 1927 | Ga0466962_0000051 | 3300061719 | Bacteria | 47373 |
| 1928 | Ga0466962_0000057 | 3300061719 | Bacteria | 46351 |
| 1929 | Ga0466962_0010819 | 3300061719 | Bacteria | 4386 |
| 1930 | Ga0466962_0086439 | 3300061719 | Bacteria | 1501 |
| 1931 | Ga0530510_0000204 | 3300061734 | Bacteria | 36725 |
| 1932 | Ga0530510_0001129 | 3300061734 | Bacteria | 17745 |
| 1933 | Ga0530510_0007848 | 3300061734 | Bacteria | 7443 |
| 1934 | Ga0530510_0011566 | 3300061734 | Bacteria | 6194 |
| 1935 | Ga0530510_0016065 | 3300061734 | Bacteria | 5292 |
| 1936 | Ga0530510_0022473 | 3300061734 | Bacteria | 4493 |
| 1937 | 2501945014 | 2501939600 | Bacteria | 6907073 |
| 1938 | 2506864793 | 2506783011 | Bacteria | 5323186 |
| 1939 | 2508671422 | 2508501039 | Bacteria | 9978592 |
| 1940 | 2515494075 | 2515154088 | Bacteria | 5526283 |
| 1941 | 2515721370 | 2515154129 | Bacteria | 5584369 |
| 1942 | 2515755882 | 2515154137 | Bacteria | 5711575 |
| 1943 | 2516085498 | 2515154202 | Bacteria | 5471270 |
| 1944 | 2516089785 | 2515154203 | Bacteria | 5458536 |
| 1945 | 2517761769 | 2517572101 | Bacteria | 6884336 |
| 1946 | 2528202174 | 2527291627 | Bacteria | 5309833 |
| 1947 | 2528212776 | 2527291629 | Bacteria | 5267418 |
| 1948 | 2537898918 | 2537561592 | Bacteria | 4348607 |
| 1949 | 2546948574 | 2546825537 | Bacteria | 5389291 |
| 1950 | 2547408133 | 2547132111 | Bacteria | 8013147 |
| 1951 | 2554257852 | 2554235005 | Bacteria | 6457341 |
| 1952 | 2555229487 | 2554235227 | Bacteria | 3637389 |
| 1953 | 2579749817 | 2576861822 | Bacteria | 5004595 |
| 1954 | 2579854928 | 2579778521 | Bacteria | 7624758 |
| 1955 | 2585308805 | 2582581313 | Bacteria | 10042643 |
| 1956 | 2585313508 | 2582581314 | Bacteria | 11452267 |
| 1957 | 2587864081 | 2585428094 | Bacteria | 3604039 |
| 1958 | 2616695052 | 2616644814 | Bacteria | 11555299 |
| 1959 | 2616902174 | 2616644941 | Bacteria | 8510691 |
| 1960 | 2619853120 | 2619618881 | Bacteria | 7521104 |
| 1961 | 2620351088 | 2619619003 | Bacteria | 7619552 |
| 1962 | 2623586326 | 2622736626 | Bacteria | 7181580 |
| 1963 | 2626637206 | 2626541554 | Bacteria | 7741902 |
| 1964 | 2643764940 | 2643221548 | Bacteria | 8053412 |
| 1965 | 2643827418 | 2643221561 | Bacteria | 4984412 |
| 1966 | 2643849056 | 2643221566 | Bacteria | 3460379 |
| 1967 | 2643852419 | 2643221567 | Bacteria | 4163945 |
| 1968 | 2643891900 | 2643221576 | Bacteria | 5214352 |
| 1969 | 2643902616 | 2643221578 | Bacteria | 9213798 |
| 1970 | 2643942199 | 2643221587 | Bacteria | 7586415 |
| 1971 | 2643960952 | 2643221590 | Bacteria | 5214697 |
| 1972 | 2643995246 | 2643221597 | Bacteria | 3347721 |
| 1973 | 2644017180 | 2643221601 | Bacteria | 7493239 |
| 1974 | 2644031966 | 2643221604 | Bacteria | 5014917 |
| 1975 | 2644094016 | 2643221615 | Bacteria | 5487866 |
| 1976 | 2644100367 | 2643221617 | Bacteria | 5139111 |
| 1977 | 2644116774 | 2643221620 | Bacteria | 5134593 |
| 1978 | 2644136942 | 2643221624 | Bacteria | 4384879 |
| 1979 | 2644173859 | 2643221631 | Bacteria | 8168043 |
| 1980 | 2644228551 | 2643221641 | Bacteria | 4490190 |
| 1981 | 2644262289 | 2643221647 | Bacteria | 10741251 |
| 1982 | 2644323859 | 2643221657 | Bacteria | 5490246 |
| 1983 | 2644389865 | 2643221670 | Bacteria | 6497041 |
| 1984 | 2644404876 | 2643221673 | Bacteria | 9196637 |
| 1985 | 2644429282 | 2643221677 | Bacteria | 7584031 |
| 1986 | 2644437176 | 2643221678 | Bacteria | 9540101 |
| 1987 | 2644458294 | 2643221681 | Bacteria | 3707866 |
| 1988 | 2644461220 | 2643221682 | Bacteria | 6743283 |
| 1989 | 2644504884 | 2643221690 | Bacteria | 4654705 |
| 1990 | 2644527204 | 2643221694 | Bacteria | 4392972 |
| 1991 | 2644533755 | 2643221696 | Bacteria | 5431823 |
| 1992 | 2644610265 | 2643221711 | Bacteria | 4865335 |
| 1993 | 2644628915 | 2643221714 | Bacteria | 9015452 |
| 1994 | 2644667753 | 2643221722 | Bacteria | 4247614 |
| 1995 | 2645722438 | 2643221961 | Bacteria | 3919167 |
| 1996 | 2645725411 | 2643221962 | Bacteria | 3874254 |
| 1997 | 2655031501 | 2654587600 | Bacteria | 3911798 |
| 1998 | 2671837652 | 2671180195 | Bacteria | 9757215 |
| 1999 | 2676203036 | 2675902999 | Bacteria | 9438463 |
| 2000 | 2676484158 | 2675903059 | Bacteria | 8644972 |
| 2001 | 2686537920 | 2684623035 | Bacteria | 8032739 |
| 2002 | 2686542989 | 2684623036 | Bacteria | 5199090 |
| 2003 | 2689956382 | 2687453737 | Bacteria | 11203906 |
| 2004 | 2710603307 | 2710264753 | Bacteria | 5455564 |
| 2005 | 2740166019 | 2739367898 | Bacteria | 4367674 |
| 2006 | 2753269546 | 2751185782 | Bacteria | 11227053 |
| 2007 | 2768644748 | 2767802112 | Bacteria | 6465194 |
| 2008 | 2772641467 | 2772190715 | Bacteria | 6959372 |
| 2009 | 2774383792 | 2773857759 | Bacteria | 2963774 |
| 2010 | 2774847612 | 2773857921 | Bacteria | 9435764 |
| 2011 | 2774855808 | 2773857922 | Bacteria | 9757215 |
| 2012 | 2774866300 | 2773857924 | Bacteria | 5256821 |
| 2013 | 2774904883 | 2773857933 | Bacteria | 5818019 |
| 2014 | 2775658508 | 2775506735 | Bacteria | 4556596 |
| 2015 | 2784473033 | 2784132109 | Bacteria | 3141763 |
| 2016 | 2784588586 | 2784132148 | Bacteria | 8627943 |
| 2017 | 2785343281 | 2784746763 | Bacteria | 9783172 |
| 2018 | 2785369515 | 2784746768 | Bacteria | 10036182 |
| 2019 | 2786670619 | 2786546132 | Bacteria | 10419719 |
| 2020 | 2793979713 | 2791355406 | Bacteria | 11364898 |
| 2021 | 2804847037 | 2802429296 | Bacteria | 7227771 |
| 2022 | 2808830052 | 2808606357 | Bacteria | 4466944 |
| 2023 | 2808842074 | 2808606359 | Bacteria | 9866990 |
| 2024 | 2808851227 | 2808606360 | Bacteria | 4404006 |
| 2025 | 2808876248 | 2808606366 | Bacteria | 4415912 |
| 2026 | 2808894302 | 2808606370 | Bacteria | 4942454 |
| 2027 | 2808897751 | 2808606371 | Bacteria | 4251511 |
| 2028 | 2808920592 | 2808606375 | Bacteria | 9466072 |
| 2029 | 2809232198 | 2808606448 | Bacteria | 8656184 |
| 2030 | 2810363130 | 2808606700 | Bacteria | 3482157 |
| 2031 | 2811849064 | 2808606982 | Bacteria | 7791042 |
| 2032 | 2812318173 | 2811994871 | Bacteria | 4497550 |
| 2033 | 2812371666 | 2811994882 | Bacteria | 4688362 |
| 2034 | 2812480508 | 2811994917 | Bacteria | 7761064 |
| 2035 | 2816420874 | 2816332119 | Bacteria | 8120218 |
| 2036 | 2819667227 | 2818991458 | Bacteria | 4794049 |
| 2037 | 2819690559 | 2818991462 | Bacteria | 4320267 |
| 2038 | 2819695391 | 2818991463 | Bacteria | 7948711 |
| 2039 | 2819728129 | 2818991469 | Bacteria | 4644110 |
| 2040 | 2819741161 | 2818991472 | Bacteria | 10089953 |
| 2041 | 2827628670 | 2827628540 | Bacteria | 6858585 |
| 2042 | 2831937257 | 2831935698 | Bacteria | 5963223 |
| 2043 | 2832006611 | 2832004796 | Bacteria | 6538017 |
| 2044 | 2837187328 | 2837183177 | Bacteria | 4637169 |
| 2045 | 2837274720 | 2837268691 | Bacteria | 7850704 |
| 2046 | 2839988783 | 2839986021 | Bacteria | 3685650 |
| 2047 | 2844851726 | 2844849076 | Bacteria | 4091819 |
| 2048 | 2848552212 | 2848551377 | Bacteria | 3720646 |
| 2049 | 2852636654 | 2852635781 | Bacteria | 8251373 |
| 2050 | 2852678749 | 2852677369 | Bacteria | 3768884 |
| 2051 | 2855676551 | 2855670206 | Bacteria | 7120389 |
| 2052 | 2855683399 | 2855676851 | Bacteria | 7063653 |
| 2053 | 2855685128 | 2855683550 | Bacteria | 7134265 |
| 2054 | 2856860171 | 2856858025 | Bacteria | 7255264 |
| 2055 | 2857294985 | 2857288857 | Bacteria | 7189066 |
| 2056 | 2857481202 | 2857479173 | Bacteria | 2469263 |
| 2057 | 2857633465 | 2857632687 | Bacteria | 2448521 |
| 2058 | 2857712944 | 2857710386 | Bacteria | 3186771 |
| 2059 | 2857734272 | 2857733635 | Bacteria | 3532004 |
| 2060 | 2857740854 | 2857740372 | Bacteria | 4782044 |
| 2061 | 2858852149 | 2858848962 | Bacteria | 6963058 |
| 2062 | 2858872875 | 2858868258 | Bacteria | 7683772 |
| 2063 | 2858888335 | 2858882152 | Bacteria | 7230291 |
| 2064 | 2858893250 | 2858888857 | Bacteria | 7060307 |
| 2065 | 2858899093 | 2858895516 | Bacteria | 7378898 |
| 2066 | 2858905417 | 2858902515 | Bacteria | 7086037 |
| 2067 | 2862180154 | 2862178590 | Bacteria | 8583590 |
| 2068 | 2862285674 | 2862281513 | Bacteria | 9621493 |
| 2069 | 2862290636 | 2862290372 | Bacteria | 7471434 |
| 2070 | 2862384445 | 2862382967 | Bacteria | 10317375 |
| 2071 | 2862511796 | 2862507626 | Bacteria | 9425308 |
| 2072 | 2862579238 | 2862574272 | Bacteria | 10567477 |
| 2073 | 2862993449 | 2862993130 | Bacteria | 3860849 |
| 2074 | 2863404590 | 2863404153 | Bacteria | 9672205 |
| 2075 | 2866065722 | 2866065130 | Bacteria | 6518152 |
| 2076 | 2867304186 | 2867302475 | Bacteria | 7087181 |
| 2077 | 2867313513 | 2867312974 | Bacteria | 7058875 |
| 2078 | 2867322665 | 2867319477 | Bacteria | 7069771 |
| 2079 | 2867348799 | 2867346516 | Bacteria | 7608576 |
| 2080 | 2867371911 | 2867369537 | Bacteria | 6501581 |
| 2081 | 2867435889 | 2867428634 | Bacteria | 9590268 |
| 2082 | 2867480596 | 2867475112 | Bacteria | 6909112 |
| 2083 | 2867509187 | 2867507094 | Bacteria | 6506033 |
| 2084 | 2868094032 | 2868088558 | Bacteria | 7609351 |
| 2085 | 2869055292 | 2869048445 | Bacteria | 6875584 |
| 2086 | 2869062571 | 2869061728 | Bacteria | 7112407 |
| 2087 | 2869074566 | 2869068681 | Bacteria | 7205615 |
| 2088 | 2870622451 | 2870622029 | Bacteria | 3643329 |
| 2089 | 2870803312 | 2870801768 | Bacteria | 2710986 |
| 2090 | 2870805355 | 2870804320 | Bacteria | 2552467 |
| 2091 | 2873155713 | 2873151551 | Bacteria | 8625867 |
| 2092 | 2875395764 | 2875391855 | Bacteria | 7600475 |
| 2093 | 2877681096 | 2877676314 | Bacteria | 9512378 |
| 2094 | 2880493979 | 2880489317 | Bacteria | 7096270 |
| 2095 | 2880498361 | 2880495981 | Bacteria | 7340502 |
| 2096 | 2884996753 | 2884994152 | Bacteria | 4492978 |
| 2097 | 2887446937 | 2887443736 | Bacteria | 4426037 |
| 2098 | 2887483645 | 2887478801 | Bacteria | 8972725 |
| 2099 | 2891401264 | 2891395885 | Bacteria | 9251614 |
| 2100 | 2895888156 | 2895880812 | Bacteria | 11255272 |
| 2101 | 2904501535 | 2904497146 | Bacteria | 4731781 |
| 2102 | 2904778167 | 2904776348 | Bacteria | 4658726 |
| 2103 | 2905928653 | 2905926851 | Bacteria | 4423176 |
| 2104 | 2910813480 | 2910809715 | Bacteria | 4982797 |
| 2105 | 2912719939 | 2912715099 | Bacteria | 9460473 |
| 2106 | 2912724331 | 2912723979 | Bacteria | 8557534 |
| 2107 | 2912760801 | 2912757875 | Bacteria | 7940295 |
| 2108 | 2918505620 | 2918501144 | Bacteria | 8668083 |
| 2109 | 2919035543 | 2919034639 | Bacteria | 4763403 |
| 2110 | 2919054615 | 2919051321 | Bacteria | 4210889 |
| 2111 | 2919060213 | 2919059106 | Bacteria | 4991624 |
| 2112 | 2919395334 | 2919391150 | Bacteria | 4884741 |
| 2113 | 2919469497 | 2919468124 | Bacteria | 9133025 |
| 2114 | 2919539239 | 2919538618 | Bacteria | 4677069 |
| 2115 | 2920883334 | 2920879853 | Bacteria | 4216831 |
| 2116 | 2929220391 | 2929219909 | Bacteria | 6984360 |
| 2117 | 2929226946 | 2929226422 | Bacteria | 7248583 |
| 2118 | 2932427827 | 2932426870 | Bacteria | 4547726 |
| 2119 | 2932434482 | 2932431166 | Bacteria | 4215299 |
| 2120 | 2933418599 | 2933418574 | Bacteria | 4476724 |
| 2121 | 2935393401 | 2935390628 | Bacteria | 7043367 |
| 2122 | 2935410757 | 2935409751 | Bacteria | 4179611 |
| 2123 | 2939599352 | 2939598168 | Bacteria | 4687164 |
| 2124 | 2939650273 | 2939647034 | Bacteria | 4681660 |
| 2125 | 2939659169 | 2939657138 | Bacteria | 3740283 |
| 2126 | 2939677693 | 2939674588 | Bacteria | 4844420 |
| 2127 | 2945920274 | 2945916053 | Bacteria | 4555517 |
| 2128 | 2945923865 | 2945920336 | Bacteria | 4501603 |
| 2129 | 2945944473 | 2945941187 | Bacteria | 4682474 |
| 2130 | 2945957335 | 2945956166 | Bacteria | 5110334 |
| 2131 | 2945958695 | 2945956166 | Bacteria | 5110334 |
| 2132 | 2946003365 | 2946003308 | Bacteria | 3857229 |
| 2133 | 2946040391 | 2946037020 | Bacteria | 4900426 |
| 2134 | 2946048858 | 2946045630 | Bacteria | 8527308 |
| 2135 | 2946063991 | 2946059875 | Bacteria | 4386623 |
| 2136 | 2946067751 | 2946064051 | Bacteria | 8957905 |
| 2137 | 2946075930 | 2946072368 | Bacteria | 8999607 |
| 2138 | 2947229215 | 2947224130 | Bacteria | 9938529 |
| 2139 | 2954001656 | 2953998280 | Bacteria | 4812144 |
| 2140 | 2954007394 | 2954002825 | Bacteria | 9173742 |
| 2141 | 2954386225 | 2954380949 | Bacteria | 10050426 |
| 2142 | 2954676941 | 2954673503 | Bacteria | 9685905 |
| 2143 | 2954687217 | 2954682443 | Bacteria | 9862841 |
| 2144 | 2954696863 | 2954691527 | Bacteria | 10720516 |
| 2145 | 2954705273 | 2954701450 | Bacteria | 10834262 |
| 2146 | 2954716236 | 2954711539 | Bacteria | 10867210 |
| 2147 | 2954726178 | 2954721474 | Bacteria | 10456478 |
| 2148 | 2954735632 | 2954731030 | Bacteria | 10243860 |
| 2149 | 2954745104 | 2954740390 | Bacteria | 10229294 |
| 2150 | 2954754487 | 2954749733 | Bacteria | 10366972 |
| 2151 | 2954764077 | 2954759201 | Bacteria | 9358192 |
| 2152 | 2964328617 | 2964326757 | Bacteria | 3290868 |
| 2153 | 2966601630 | 2966598605 | Bacteria | 7676064 |
| 2154 | 2974303822 | 2974302888 | Bacteria | 4369871 |
| 2155 | 2984579265 | 2984576629 | Bacteria | 4248407 |
| 2156 | 2990060746 | 2990059506 | Bacteria | 9321252 |
| 2157 | 2990090532 | 2990088156 | Bacteria | 6657676 |
| 2158 | 2990259842 | 2990256926 | Bacteria | 4252839 |
| 2159 | 2996223380 | 2996221748 | Bacteria | 6799777 |
| 2160 | 2997457816 | 2997451912 | Bacteria | 8492419 |
| 2161 | 2997600395 | 2997600082 | Bacteria | 9896405 |
| 2162 | 3001890363 | 3001889506 | Bacteria | 2975194 |
| 2163 | 3006325033 | 3006321560 | Bacteria | 8247479 |
| 2164 | 3006398368 | 3006393351 | Bacteria | 6615579 |
| 2165 | 3006428717 | 3006425503 | Bacteria | 6491253 |
| 2166 | 3006491969 | 3006486233 | Bacteria | 8157040 |
| 2167 | 3006500775 | 3006493962 | Bacteria | 8825450 |
| 2168 | 637877412 | 637000116 | Bacteria | 5433628 |
| 2169 | 649810872 | 649633069 | Bacteria | 6962533 |
| 2170 | 8001788181 | 8001781756 | Bacteria | 9586736 |
| 2171 | 8002776324 | 8002775197 | Bacteria | 10728764 |
| 2172 | 8002784515 | 8002784119 | Bacteria | 9788632 |
| 2173 | 8003835786 | 8003830390 | Bacteria | 6541657 |
| 2174 | 8003857612 | 8003856774 | Bacteria | 7675274 |
| 2175 | 8003878195 | 8003870546 | Bacteria | 7396674 |
| 2176 | 8004022429 | 8004021418 | Bacteria | 4313954 |
| 2177 | 8008567283 | 8008558824 | Bacteria | 10610750 |
| 2178 | 8008578873 | 8008574985 | Bacteria | 7815457 |
| 2179 | 8023630165 | 8023623736 | Bacteria | 8593882 |
| 2180 | 8025417710 | 8025413630 | Bacteria | 7014048 |
| 2181 | 8025480347 | 8025478263 | Bacteria | 8209203 |
| 2182 | 8025538022 | 8025530807 | Bacteria | 8495698 |
| 2183 | 8045834438 | 8045830549 | Bacteria | 4444727 |
| 2184 | 8047714256 | 8047710418 | Bacteria | 11023148 |
| 2185 | 8047898090 | 8047893842 | Bacteria | 11723082 |
| 2186 | 8048136806 | 8048127548 | Bacteria | 11053136 |
| 2187 | 8048360803 | 8048356638 | Bacteria | 11044339 |
| 2188 | 8048375053 | 8048369669 | Bacteria | 11666822 |
| 2189 | 8048383153 | 8048379754 | Bacteria | 11877923 |
| 2190 | 8048412732 | 8048406513 | Bacteria | 8936924 |
| 2191 | 8054109716 | 8054107350 | Bacteria | 5022511 |
| 2192 | 8054166059 | 8054160619 | Bacteria | 7783213 |
| 2193 | 8054609836 | 8054609563 | Bacteria | 5170090 |
| 2194 | 8054710070 | 8054704163 | Bacteria | 7247792 |
| 2195 | 8054728285 | 8054727385 | Bacteria | 7558670 |
| 2196 | 8054735324 | 8054734606 | Bacteria | 6947278 |
| 2197 | 8054913814 | 8054913762 | Bacteria | 7713009 |
| 2198 | 8054921054 | 8054920844 | Bacteria | 7068637 |
| 2199 | 8055161321 | 8055157932 | Bacteria | 6429399 |
| 2200 | 8055414138 | 8055412473 | Bacteria | 6257500 |
| 2201 | 8056039218 | 8056037122 | Bacteria | 3854319 |
| 2202 | 8056057885 | 8056054917 | Bacteria | 5736694 |
| 2203 | 8056452984 | 8056447290 | Bacteria | 7680491 |
| 2204 | 8056837710 | 8056829672 | Bacteria | 9045328 |
| 2205 | Ga0070658_10003010 | |||
| 2206 | LJQas_1001827 | |||
| 2207 | JGI24740J21852_10012278 | |||
| 2208 | JGI24740J21852_10024718 | |||
| 2209 | JGI24739J22299_10004610 | |||
| 2210 | JGI24737J22298_10005964 | |||
| 2211 | JGI24737J22298_10050458 | |||
| 2212 | JGI24735J21928_10005250 | |||
| 2213 | JGI24735J21928_10035354 | |||
| 2214 | JGI24738J21930_10011549 | |||
| 2215 | JGI24738J21930_10020922 | |||
| 2216 | JGI25164J39214_1000508 | |||
| 2217 | JGI25152J39213_1000323 | |||
| 2218 | JGI25406J46586_10006250 | |||
| 2219 | JGI25406J46586_10027794 | |||
| 2220 | rootH1_10000474 | |||
| 2221 | JGI25407J50210_10001412 | |||
| 2222 | JGI25407J50210_10007122 | |||
| 2223 | Ga0006562J51391_1027612 | |||
| 2224 | Ga0006562J51391_1027614 | |||
| 2225 | Ga0006562J51391_1047252 | |||
| 2226 | Ga0006562J51391_1054242 | |||
| 2227 | Ga0006562J51391_1124095 | |||
| 2228 | Ga0055539_1000005 | |||
| 2229 | Ga0055532_1007097 | |||
| 2230 | JGI25405J52794_10017243 | |||
| 2231 | Ga0070658_10001049 | |||
| 2232 | Ga0070658_10001184 | |||
| 2233 | Ga0070658_10001244 | |||
| 2234 | Ga0070658_10029880 | |||
| 2235 | Ga0070658_10067351 | |||
| 2236 | Ga0070658_10077960 | |||
| 2237 | Ga0070658_10137783 | |||
| 2238 | Ga0070658_10215687 | |||
| 2239 | Ga0070676_10036896 | |||
| 2240 | Ga0070683_100009639 | |||
| 2241 | Ga0070683_100020537 | |||
| 2242 | Ga0070683_100022815 | |||
| 2243 | Ga0070683_100051863 | |||
| 2244 | Ga0070683_100177871 | |||
| 2245 | Ga0070683_100410443 | |||
| 2246 | Ga0068869_100023696 | |||
| 2247 | Ga0068869_100239303 | |||
| 2248 | Ga0068869_100310161 | |||
| 2249 | Ga0070680_100004871 | |||
| 2250 | Ga0070680_100021665 | |||
| 2251 | Ga0070680_100102504 | |||
| 2252 | Ga0070682_100011844 | |||
| 2253 | Ga0070682_100024609 | |||
| 2254 | Ga0070682_100139847 | |||
| 2255 | Ga0068868_100117287 | |||
| 2256 | Ga0070660_100066881 | |||
| 2257 | Ga0070660_100187500 | |||
| 2258 | Ga0070660_100351238 | |||
| 2259 | Ga0070661_100051362 | |||
| 2260 | Ga0070661_100086714 | |||
| 2261 | Ga0070661_100094069 | |||
| 2262 | Ga0070661_100271339 | |||
| 2263 | Ga0070692_10025969 | |||
| 2264 | Ga0070692_10078446 | |||
| 2265 | Ga0070668_100000183 | |||
| 2266 | Ga0070675_100001049 | |||
| 2267 | Ga0070675_100028678 | |||
| 2268 | Ga0070674_100019612 | |||
| 2269 | Ga0070674_100136724 | |||
| 2270 | Ga0070688_100109479 | |||
| 2271 | Ga0070659_100000331 | |||
| 2272 | Ga0070659_100007388 | |||
| 2273 | Ga0070659_100009022 | |||
| 2274 | Ga0070659_100010310 | |||
| 2275 | Ga0070659_100076338 | |||
| 2276 | Ga0070659_100120684 | |||
| 2277 | Ga0070659_100179332 | |||
| 2278 | Ga0070667_100002049 | |||
| 2279 | Ga0070709_10001322 | |||
| 2280 | Ga0070709_10160270 | |||
| 2281 | Ga0070709_10191751 | |||
| 2282 | Ga0070714_100003654 | |||
| 2283 | Ga0070714_100004246 | |||
| 2284 | Ga0070714_100016064 | |||
| 2285 | Ga0070714_100029830 | |||
| 2286 | Ga0070714_100046660 | |||
| 2287 | Ga0070714_100059039 | |||
| 2288 | Ga0070714_100092360 | |||
| 2289 | Ga0070714_100158003 | |||
| 2290 | Ga0070714_100356968 | |||
| 2291 | Ga0070713_100042937 | |||
| 2292 | Ga0070713_100047895 | |||
| 2293 | Ga0070713_100139419 | |||
| 2294 | Ga0070710_10001003 | |||
| 2295 | Ga0070710_10002233 | |||
| 2296 | Ga0070710_10002612 | |||
| 2297 | Ga0070710_10036922 | |||
| 2298 | Ga0070711_100010024 | |||
| 2299 | Ga0070711_100064623 | |||
| 2300 | Ga0070711_100096095 | |||
| 2301 | Ga0070711_100174880 | |||
| 2302 | Ga0070700_100005333 | |||
| 2303 | Ga0070700_100010186 | |||
| 2304 | Ga0070663_100024148 | |||
| 2305 | Ga0070663_100040245 | |||
| 2306 | Ga0070663_100157716 | |||
| 2307 | Ga0070678_100019785 | |||
| 2308 | Ga0070678_100140937 | |||
| 2309 | Ga0070678_100229439 | |||
| 2310 | Ga0070662_100007273 | |||
| 2311 | Ga0070662_100015432 | |||
| 2312 | Ga0070681_10003004 | |||
| 2313 | Ga0070681_10041744 | |||
| 2314 | Ga0070681_10043431 | |||
| 2315 | Ga0070681_10074174 | |||
| 2316 | Ga0068867_100008050 | |||
| 2317 | Ga0070706_100004341 | |||
| 2318 | Ga0070706_100070700 | |||
| 2319 | Ga0070707_100069853 | |||
| 2320 | Ga0070707_100178664 | |||
| 2321 | Ga0070707_100332979 | |||
| 2322 | Ga0070698_100002205 | |||
| 2323 | Ga0070698_100010603 | |||
| 2324 | Ga0070698_100036593 | |||
| 2325 | Ga0070679_100003703 | |||
| 2326 | Ga0070679_100012146 | |||
| 2327 | Ga0070679_100013183 | |||
| 2328 | Ga0070679_100055836 | |||
| 2329 | Ga0070679_100087398 | |||
| 2330 | Ga0070684_100032029 | |||
| 2331 | Ga0070684_100053278 | |||
| 2332 | Ga0070684_100067991 | |||
| 2333 | Ga0070684_100099709 | |||
| 2334 | Ga0070684_100130315 | |||
| 2335 | Ga0068853_100064870 | |||
| 2336 | Ga0068853_100147353 | |||
| 2337 | Ga0070672_100008591 | |||
| 2338 | Ga0070695_100005591 | |||
| 2339 | Ga0070665_100002967 | |||
| 2340 | Ga0070665_100064400 | |||
| 2341 | Ga0070665_100101717 | |||
| 2342 | Ga0070665_100130858 | |||
| 2343 | Ga0070704_100041196 | |||
| 2344 | Ga0068855_100001428 | |||
| 2345 | Ga0068855_100079030 | |||
| 2346 | Ga0070664_100023722 | |||
| 2347 | Ga0068857_100007045 | |||
| 2348 | Ga0068857_100013000 | |||
| 2349 | Ga0068857_100187880 | |||
| 2350 | Ga0068857_100207577 | |||
| 2351 | Ga0068854_100015333 | |||
| 2352 | Ga0068856_100076027 | |||
| 2353 | Ga0068856_100197911 | |||
| 2354 | Ga0070702_100004888 | |||
| 2355 | Ga0068852_100020429 | |||
| 2356 | Ga0068859_100000067 | |||
| 2357 | Ga0068859_100039334 | |||
| 2358 | Ga0068859_100047695 | |||
| 2359 | Ga0068859_100350487 | |||
| 2360 | Ga0068861_100029657 | |||
| 2361 | Ga0068861_100102696 | |||
| 2362 | Ga0068861_100118255 | |||
| 2363 | Ga0068851_10000025 | |||
| 2364 | Ga0068870_10036993 | |||
| 2365 | Ga0068863_100004056 | |||
| 2366 | Ga0068863_100024933 | |||
| 2367 | Ga0068863_100224579 | |||
| 2368 | Ga0068863_100247885 | |||
| 2369 | Ga0068858_100000001 | |||
| 2370 | Ga0068858_100000073 | |||
| 2371 | Ga0068858_100022212 | |||
| 2372 | Ga0068860_100000160 | |||
| 2373 | Ga0068860_100185576 | |||
| 2374 | Ga0068860_100379660 | |||
| 2375 | Ga0068862_100000061 | |||
| 2376 | Ga0068862_100000131 | |||
| 2377 | Ga0081455_10000159 | |||
| 2378 | Ga0081455_10001413 | |||
| 2379 | Ga0081455_10003874 | |||
| 2380 | Ga0081455_10006383 | |||
| 2381 | Ga0081455_10020441 | |||
| 2382 | Ga0081455_10020874 | |||
| 2383 | Ga0081455_10043153 | |||
| 2384 | Ga0081455_10043453 | |||
| 2385 | Ga0081455_10103941 | |||
| 2386 | Ga0081455_10126898 | |||
| 2387 | Ga0081538_10001163 | |||
| 2388 | Ga0081538_10001523 | |||
| 2389 | Ga0081538_10002152 | |||
| 2390 | Ga0081538_10007077 | |||
| 2391 | Ga0081538_10035352 | |||
| 2392 | Ga0081538_10044152 | |||
| 2393 | Ga0081540_1002855 | |||
| 2394 | Ga0081540_1030633 | |||
| 2395 | Ga0081540_1039207 | |||
| 2396 | Ga0081539_10000205 | |||
| 2397 | Ga0081539_10001811 | |||
| 2398 | Ga0081539_10003373 | |||
| 2399 | Ga0081539_10003816 | |||
| 2400 | Ga0081539_10008555 | |||
| 2401 | Ga0081539_10009590 | |||
| 2402 | Ga0081539_10036960 | |||
| 2403 | Ga0070717_10012997 | |||
| 2404 | Ga0070717_10016221 | |||
| 2405 | Ga0070717_10033577 | |||
| 2406 | Ga0070717_10198024 | |||
| 2407 | Ga0075365_10000486 | |||
| 2408 | Ga0075365_10014721 | |||
| 2409 | Ga0075365_10033347 | |||
| 2410 | Ga0075365_10034752 | |||
| 2411 | Ga0075365_10056700 | |||
| 2412 | Ga0075365_10056989 | |||
| 2413 | Ga0075365_10062852 | |||
| 2414 | Ga0075365_10129814 | |||
| 2415 | Ga0075368_10000878 | |||
| 2416 | Ga0075363_100008537 | |||
| 2417 | Ga0075363_100012931 | |||
| 2418 | Ga0075363_100023615 | |||
| 2419 | Ga0075363_100043142 | |||
| 2420 | Ga0075363_100104540 | |||
| 2421 | Ga0075363_100105059 | |||
| 2422 | Ga0075363_100111867 | |||
| 2423 | Ga0075364_10001480 | |||
| 2424 | Ga0075364_10002322 | |||
| 2425 | Ga0075364_10004050 | |||
| 2426 | Ga0075364_10011600 | |||
| 2427 | Ga0075432_10002641 | |||
| 2428 | Ga0070716_100000703 | |||
| 2429 | Ga0070716_100006125 | |||
| 2430 | Ga0070712_100002734 | |||
| 2431 | Ga0070712_100320632 | |||
| 2432 | Ga0075362_10000684 | |||
| 2433 | Ga0075367_10006299 | |||
| 2434 | Ga0075367_10009909 | |||
| 2435 | Ga0075367_10050343 | |||
| 2436 | Ga0075367_10059194 | |||
| 2437 | Ga0075367_10074734 | |||
| 2438 | Ga0075367_10093752 | |||
| 2439 | Ga0075369_10009130 | |||
| 2440 | Ga0075370_10007490 | |||
| 2441 | Ga0075370_10007584 | |||
| 2442 | Ga0075428_100000389 | |||
| 2443 | Ga0075428_100004341 | |||
| 2444 | Ga0075428_100007979 | |||
| 2445 | Ga0075428_100011245 | |||
| 2446 | Ga0075428_100021756 | |||
| 2447 | Ga0075428_100316310 | |||
| 2448 | Ga0075430_100010091 | |||
| 2449 | Ga0075430_100012981 | |||
| 2450 | Ga0075430_100015263 | |||
| 2451 | Ga0075430_100091383 | |||
| 2452 | Ga0075431_100004396 | |||
| 2453 | Ga0075431_100006800 | |||
| 2454 | Ga0075431_100009948 | |||
| 2455 | Ga0075431_100018477 | |||
| 2456 | Ga0075431_100020488 | |||
| 2457 | Ga0075431_100026181 | |||
| 2458 | Ga0075431_100047653 | |||
| 2459 | Ga0075431_100366333 | |||
| 2460 | Ga0075431_100451928 | |||
| 2461 | Ga0075433_10020188 | |||
| 2462 | Ga0075434_100038493 | |||
| 2463 | Ga0075429_100000908 | |||
| 2464 | Ga0075429_100013442 | |||
| 2465 | Ga0075429_100017753 | |||
| 2466 | Ga0075429_100096524 | |||
| 2467 | Ga0075429_100188247 | |||
| 2468 | Ga0068865_100018317 | |||
| 2469 | Ga0075436_100030029 | |||
| 2470 | Ga0097620_100000067 | |||
| 2471 | Ga0097620_100039334 | |||
| 2472 | Ga0097620_100047694 | |||
| 2473 | Ga0097620_100350465 | |||
| 2474 | Ga0075435_100004795 | |||
| 2475 | Ga0075435_100048185 | |||
| 2476 | Ga0075435_100185124 | |||
| 2477 | Ga0105251_10003753 | |||
| 2478 | Ga0105251_10003783 | |||
| 2479 | Ga0105244_10001928 | |||
| 2480 | Ga0105244_10012472 | |||
| 2481 | Ga0105250_10043082 | |||
| 2482 | Ga0105240_10042031 | |||
| 2483 | Ga0111539_10005032 | |||
| 2484 | Ga0111539_10005100 | |||
| 2485 | Ga0111539_10010425 | |||
| 2486 | Ga0111539_10017829 | |||
| 2487 | Ga0111539_10110689 | |||
| 2488 | Ga0111539_10348652 | |||
| 2489 | Ga0105245_10004977 | |||
| 2490 | Ga0105245_10006307 | |||
| 2491 | Ga0105245_10067457 | |||
| 2492 | Ga0105245_10107343 | |||
| 2493 | Ga0105245_10172357 | |||
| 2494 | Ga0105245_10178526 | |||
| 2495 | Ga0105245_10200160 | |||
| 2496 | Ga0105247_10000024 | |||
| 2497 | Ga0105247_10000078 | |||
| 2498 | Ga0105247_10009918 | |||
| 2499 | Ga0105247_10076014 | |||
| 2500 | Ga0114129_10000039 | |||
| 2501 | Ga0114129_10000131 | |||
| 2502 | Ga0114129_10000932 | |||
| 2503 | Ga0114129_10002109 | |||
| 2504 | Ga0114129_10048876 | |||
| 2505 | Ga0114129_10281097 | |||
| 2506 | Ga0114129_10336013 | |||
| 2507 | Ga0105243_10029942 | |||
| 2508 | Ga0105243_10036949 | |||
| 2509 | Ga0105243_10040731 | |||
| 2510 | Ga0105243_10072185 | |||
| 2511 | Ga0105243_10396929 | |||
| 2512 | Ga0105241_10021369 | |||
| 2513 | Ga0105242_10041626 | |||
| 2514 | Ga0105248_10000055 | |||
| 2515 | Ga0105248_10000082 | |||
| 2516 | Ga0105248_10000529 | |||
| 2517 | Ga0105248_10004955 | |||
| 2518 | Ga0105248_10009087 | |||
| 2519 | Ga0105248_10019185 | |||
| 2520 | Ga0105248_10165622 | |||
| 2521 | Ga0105248_10623057 | |||
| 2522 | Ga0105237_10000308 | |||
| 2523 | Ga0105237_10016427 | |||
| 2524 | Ga0105238_10008834 | |||
| 2525 | Ga0105238_10369110 | |||
| 2526 | Ga0105249_10000031 | |||
| 2527 | Ga0105249_10001144 | |||
| 2528 | Ga0105249_10018272 | |||
| 2529 | Ga0105249_10136450 | |||
| 2530 | Ga0105249_10164022 | |||
| 2531 | Ga0105239_10007263 | |||
| 2532 | Ga0105239_10008306 | |||
| 2533 | Ga0105239_10118655 | |||
| 2534 | Ga0105239_10433460 | |||
| 2535 | Ga0105246_10001132 | |||
| 2536 | Ga0105246_10002305 | |||
| 2537 | Ga0105246_10002378 | |||
| 2538 | Ga0105246_10032742 | |||
| 2539 | Ga0105246_10034427 | |||
| 2540 | Ga0105246_10187408 | |||
| 2541 | Ga0157371_10027112 | |||
| 2542 | Ga0157370_10025167 | |||
| 2543 | Ga0157370_10026798 | |||
| 2544 | Ga0157370_10139184 | |||
| 2545 | Ga0157369_10000422 | |||
| 2546 | Ga0157369_10001067 | |||
| 2547 | Ga0157369_10001126 | |||
| 2548 | Ga0157369_10006480 | |||
| 2549 | Ga0157369_10028541 | |||
| 2550 | Ga0157369_10038886 | |||
| 2551 | Ga0157369_10045621 | |||
| 2552 | Ga0157369_10052990 | |||
| 2553 | Ga0157369_10082912 | |||
| 2554 | Ga0157369_10154305 | |||
| 2555 | Ga0157369_10177108 | |||
| 2556 | Ga0171462_1004 | |||
| 2557 | Ga0157374_10424739 | |||
| 2558 | Ga0163162_10022417 | |||
| 2559 | Ga0163162_10055426 | |||
| 2560 | Ga0163162_10108128 | |||
| 2561 | Ga0157372_10003775 | |||
| 2562 | Ga0157372_10073291 | |||
| 2563 | Ga0157372_10094569 | |||
| 2564 | Ga0157372_10121930 | |||
| 2565 | Ga0157372_10202469 | |||
| 2566 | Ga0157372_10289668 | |||
| 2567 | Ga0157372_10426996 | |||
| 2568 | Ga0157375_10004628 | |||
| 2569 | Ga0157375_10028843 | |||
| 2570 | Ga0157375_10109120 | |||
| 2571 | Ga0157375_10185198 | |||
| 2572 | Ga0157375_10195676 | |||
| 2573 | Ga0157375_10361725 | |||
| 2574 | Ga0163163_10014442 | |||
| 2575 | Ga0163163_10032958 | |||
| 2576 | Ga0163163_10112269 | |||
| 2577 | Ga0163163_10141673 | |||
| 2578 | Ga0163163_10471369 | |||
| 2579 | Ga0157380_10117172 | |||
| 2580 | Ga0182008_10041266 | |||
| 2581 | Ga0182008_10050302 | |||
| 2582 | Ga0157377_10012796 | |||
| 2583 | Ga0157377_10044816 | |||
| 2584 | Ga0157379_10000059 | |||
| 2585 | Ga0157379_10000289 | |||
| 2586 | Ga0157379_10002960 | |||
| 2587 | Ga0157379_10012749 | |||
| 2588 | Ga0182007_10031963 | |||
| 2589 | Ga0182007_10038282 | |||
| 2590 | Ga0163161_10037148 | |||
| 2591 | Ga0197907_10031078 | |||
| 2592 | Ga0197907_10410903 | |||
| 2593 | Ga0206356_10755570 | |||
| 2594 | Ga0206356_11644942 | |||
| 2595 | Ga0206351_10447535 | |||
| 2596 | Ga0206350_10967704 | |||
| 2597 | Ga0206354_10323126 | |||
| 2598 | Ga0206354_10773930 | |||
| 2599 | Ga0206354_10785617 | |||
| 2600 | Ga0206354_11275952 | |||
| 2601 | Ga0206354_11281303 | |||
| 2602 | Ga0206353_10110127 | |||
| 2603 | Ga0206353_10404455 | |||
| 2604 | Ga0206353_10623844 | |||
| 2605 | Ga0206353_10717728 | |||
| 2606 | Ga0206353_11446185 | |||
| 2607 | Ga0206353_11629272 | |||
| 2608 | Ga0206353_12032015 | |||
| 2609 | Ga0213876_10015875 | |||
| 2610 | Ga0213876_10032087 | |||
| 2611 | Ga0213875_10009163 | |||
| 2612 | Ga0213875_10009179 | |||
| 2613 | Ga0213875_10016007 | |||
| 2614 | Ga0213875_10030369 | |||
| 2615 | Ga0224712_10001604 | |||
| 2616 | Ga0224712_10016756 | |||
| 2617 | Ga0209563_100349 | |||
| 2618 | Ga0209129_1000109 | |||
| 2619 | Ga0209025_1000984 | |||
| 2620 | Ga0207426_1017639 | |||
| 2621 | Ga0209051_1001258 | |||
| 2622 | Ga0207697_10004003 | |||
| 2623 | Ga0207656_10000001 | |||
| 2624 | Ga0207696_1018500 | |||
| 2625 | Ga0207655_1008569 | |||
| 2626 | Ga0207655_1008906 | |||
| 2627 | Ga0207655_1022210 | |||
| 2628 | Ga0207713_1029743 | |||
| 2629 | Ga0207682_10005812 | |||
| 2630 | Ga0207692_10000890 | |||
| 2631 | Ga0207692_10002582 | |||
| 2632 | Ga0207692_10004306 | |||
| 2633 | Ga0207642_10038384 | |||
| 2634 | Ga0207710_10000022 | |||
| 2635 | Ga0207710_10000045 | |||
| 2636 | Ga0207710_10000249 | |||
| 2637 | Ga0207710_10060310 | |||
| 2638 | Ga0207688_10008035 | |||
| 2639 | Ga0207647_10018358 | |||
| 2640 | Ga0207647_10031102 | |||
| 2641 | Ga0207647_10038168 | |||
| 2642 | Ga0207685_10102201 | |||
| 2643 | Ga0207699_10000452 | |||
| 2644 | Ga0207699_10018969 | |||
| 2645 | Ga0207699_10063482 | |||
| 2646 | Ga0207699_10113570 | |||
| 2647 | Ga0207645_10000233 | |||
| 2648 | Ga0207645_10030709 | |||
| 2649 | Ga0207643_10005573 | |||
| 2650 | Ga0207705_10001165 | |||
| 2651 | Ga0207705_10002204 | |||
| 2652 | Ga0207705_10008166 | |||
| 2653 | Ga0207705_10137202 | |||
| 2654 | Ga0207684_10026114 | |||
| 2655 | Ga0207654_10011007 | |||
| 2656 | Ga0207707_10000376 | |||
| 2657 | Ga0207707_10010705 | |||
| 2658 | Ga0207707_10054680 | |||
| 2659 | Ga0207707_10056837 | |||
| 2660 | Ga0207695_10005783 | |||
| 2661 | Ga0207695_10216505 | |||
| 2662 | Ga0207671_10000001 | |||
| 2663 | Ga0207671_10000216 | |||
| 2664 | Ga0207671_10007161 | |||
| 2665 | Ga0207693_10000318 | |||
| 2666 | Ga0207693_10002107 | |||
| 2667 | Ga0207693_10009636 | |||
| 2668 | Ga0207693_10169868 | |||
| 2669 | Ga0207663_10136242 | |||
| 2670 | Ga0207663_10177271 | |||
| 2671 | Ga0207663_10260913 | |||
| 2672 | Ga0207660_10000754 | |||
| 2673 | Ga0207660_10017022 | |||
| 2674 | Ga0207660_10071902 | |||
| 2675 | Ga0207660_10243374 | |||
| 2676 | Ga0207662_10011022 | |||
| 2677 | Ga0207657_10001578 | |||
| 2678 | Ga0207657_10025004 | |||
| 2679 | Ga0207657_10049197 | |||
| 2680 | Ga0207657_10072049 | |||
| 2681 | Ga0207657_10133726 | |||
| 2682 | Ga0207649_10006873 | |||
| 2683 | Ga0207652_10000591 | |||
| 2684 | Ga0207652_10004252 | |||
| 2685 | Ga0207652_10032574 | |||
| 2686 | Ga0207652_10067633 | |||
| 2687 | Ga0207652_10119121 | |||
| 2688 | Ga0207652_10202293 | |||
| 2689 | Ga0207646_10437409 | |||
| 2690 | Ga0207681_10004026 | |||
| 2691 | Ga0207694_10000052 | |||
| 2692 | Ga0207694_10002482 | |||
| 2693 | Ga0207694_10334333 | |||
| 2694 | Ga0207650_10143136 | |||
| 2695 | Ga0207659_10021801 | |||
| 2696 | Ga0207659_10023126 | |||
| 2697 | Ga0207687_10015080 | |||
| 2698 | Ga0207687_10055033 | |||
| 2699 | Ga0207687_10127963 | |||
| 2700 | Ga0207687_10152794 | |||
| 2701 | Ga0207700_10000250 | |||
| 2702 | Ga0207700_10006774 | |||
| 2703 | Ga0207700_10017655 | |||
| 2704 | Ga0207700_10055708 | |||
| 2705 | Ga0207700_10235875 | |||
| 2706 | Ga0207664_10003365 | |||
| 2707 | Ga0207664_10010336 | |||
| 2708 | Ga0207664_10047601 | |||
| 2709 | Ga0207664_10054835 | |||
| 2710 | Ga0207664_10061277 | |||
| 2711 | Ga0207664_10096040 | |||
| 2712 | Ga0207664_10125022 | |||
| 2713 | Ga0207664_10255118 | |||
| 2714 | Ga0207664_10350152 | |||
| 2715 | Ga0207644_10026394 | |||
| 2716 | Ga0207690_10057057 | |||
| 2717 | Ga0207706_10031749 | |||
| 2718 | Ga0207706_10079844 | |||
| 2719 | Ga0207709_10008158 | |||
| 2720 | Ga0207709_10025391 | |||
| 2721 | Ga0207709_10107809 | |||
| 2722 | Ga0207669_10004037 | |||
| 2723 | Ga0207669_10086815 | |||
| 2724 | Ga0207669_10105698 | |||
| 2725 | Ga0207704_10102974 | |||
| 2726 | Ga0207665_10006709 | |||
| 2727 | Ga0207665_10017534 | |||
| 2728 | Ga0207665_10102803 | |||
| 2729 | Ga0207691_10008796 | |||
| 2730 | Ga0207691_10015983 | |||
| 2731 | Ga0207691_10106923 | |||
| 2732 | Ga0207691_10160805 | |||
| 2733 | Ga0207711_10000030 | |||
| 2734 | Ga0207711_10000537 | |||
| 2735 | Ga0207711_10000984 | |||
| 2736 | Ga0207711_10143468 | |||
| 2737 | Ga0207711_10180524 | |||
| 2738 | Ga0207711_10185668 | |||
| 2739 | Ga0207689_10005246 | |||
| 2740 | Ga0207689_10015663 | |||
| 2741 | Ga0207689_10225787 | |||
| 2742 | Ga0207661_10049543 | |||
| 2743 | Ga0207661_10065411 | |||
| 2744 | Ga0207661_10108019 | |||
| 2745 | Ga0207661_10268776 | |||
| 2746 | Ga0207661_10312331 | |||
| 2747 | Ga0207679_10005355 | |||
| 2748 | Ga0207667_10140104 | |||
| 2749 | Ga0207712_10000029 | |||
| 2750 | Ga0207712_10166044 | |||
| 2751 | Ga0207668_10000831 | |||
| 2752 | Ga0207640_10097971 | |||
| 2753 | Ga0207658_10001194 | |||
| 2754 | Ga0207677_10004264 | |||
| 2755 | Ga0207677_10084079 | |||
| 2756 | Ga0207703_10000007 | |||
| 2757 | Ga0207703_10000025 | |||
| 2758 | Ga0207703_10027058 | |||
| 2759 | Ga0207703_10113321 | |||
| 2760 | Ga0207703_10158718 | |||
| 2761 | Ga0207703_10223235 | |||
| 2762 | Ga0207639_10111830 | |||
| 2763 | Ga0207678_10006441 | |||
| 2764 | Ga0207678_10046758 | |||
| 2765 | Ga0207708_10001321 | |||
| 2766 | Ga0207702_10065625 | |||
| 2767 | Ga0207702_10068786 | |||
| 2768 | Ga0207702_10252232 | |||
| 2769 | Ga0207641_10003684 | |||
| 2770 | Ga0207641_10097909 | |||
| 2771 | Ga0207648_10007694 | |||
| 2772 | Ga0207676_10208312 | |||
| 2773 | Ga0207674_10006951 | |||
| 2774 | Ga0207674_10009685 | |||
| 2775 | Ga0207674_10015743 | |||
| 2776 | Ga0207674_10074159 | |||
| 2777 | Ga0207675_100004867 | |||
| 2778 | Ga0207675_100025855 | |||
| 2779 | Ga0207675_100028903 | |||
| 2780 | Ga0207675_100094919 | |||
| 2781 | Ga0207675_100169101 | |||
| 2782 | Ga0207683_10021922 | |||
| 2783 | Ga0207683_10024767 | |||
| 2784 | Ga0207683_10116141 | |||
| 2785 | Ga0207683_10136562 | |||
| 2786 | Ga0207683_10155475 | |||
| 2787 | Ga0207698_10002488 | |||
| 2788 | Ga0209813_10011294 | |||
| 2789 | Ga0209813_10017570 | |||
| 2790 | Ga0207428_10001881 | |||
| 2791 | Ga0207428_10007432 | |||
| 2792 | Ga0207428_10011894 | |||
| 2793 | Ga0207428_10059544 | |||
| 2794 | Ga0268266_10003905 | |||
| 2795 | Ga0268266_10028674 | |||
| 2796 | Ga0268266_10111773 | |||
| 2797 | Ga0268266_10406801 | |||
| 2798 | Ga0268265_10000040 | |||
| 2799 | Ga0268265_10000721 | |||
| 2800 | Ga0268264_10000017 | |||
| 2801 | Ga0268264_10280490 | |||
| 2802 | Ga0265337_1000015 | |||
| 2803 | Ga0265326_10006985 | |||
| 2804 | Ga0265319_1003575 | |||
| 2805 | Ga0265334_10000328 | |||
| 2806 | Ga0265334_10002545 | |||
| 2807 | Ga0265318_10004466 | |||
| 2808 | Ga0265318_10025592 | |||
| 2809 | Ga0265318_10049013 | |||
| 2810 | Ga0265323_10028082 | |||
| 2811 | Ga0265322_10020887 | |||
| 2812 | Ga0265336_10018156 | |||
| 2813 | Ga0307517_10089007 | |||
| 2814 | Ga0307515_10000379 | |||
| 2815 | Ga0307515_10000732 | |||
| 2816 | Ga0307515_10033054 | |||
| 2817 | Ga0307515_10038784 | |||
| 2818 | Ga0307515_10221688 | |||
| 2819 | Ga0265338_10000073 | |||
| 2820 | Ga0265338_10000767 | |||
| 2821 | Ga0265338_10005370 | |||
| 2822 | Ga0265338_10008838 | |||
| 2823 | Ga0265338_10029943 | |||
| 2824 | Ga0265324_10006721 | |||
| 2825 | Ga0307511_10002182 | |||
| 2826 | Ga0307511_10070493 | |||
| 2827 | Ga0307512_10003334 | |||
| 2828 | Ga0307512_10005672 | |||
| 2829 | Ga0307512_10009307 | |||
| 2830 | Ga0307512_10017588 | |||
| 2831 | Ga0316181_1197229 | |||
| 2832 | Ga0265320_10005644 | |||
| 2833 | Ga0265320_10006011 | |||
| 2834 | Ga0265320_10008148 | |||
| 2835 | Ga0265325_10001073 | |||
| 2836 | Ga0265325_10022527 | |||
| 2837 | Ga0265325_10024264 | |||
| 2838 | Ga0265340_10000565 | |||
| 2839 | Ga0265340_10002581 | |||
| 2840 | Ga0265339_10002688 | |||
| 2841 | Ga0265339_10009462 | |||
| 2842 | Ga0265339_10033756 | |||
| 2843 | Ga0265339_10076679 | |||
| 2844 | Ga0265327_10000001 | |||
| 2845 | Ga0265327_10001602 | |||
| 2846 | Ga0265327_10017868 | |||
| 2847 | Ga0265327_10028282 | |||
| 2848 | Ga0265327_10039390 | |||
| 2849 | Ga0265316_10029288 | |||
| 2850 | Ga0265316_10048500 | |||
| 2851 | Ga0307513_10000163 | |||
| 2852 | Ga0307513_10002467 | |||
| 2853 | Ga0307513_10009749 | |||
| 2854 | Ga0307513_10012802 | |||
| 2855 | Ga0307509_10004994 | |||
| 2856 | Ga0307509_10033071 | |||
| 2857 | Ga0307509_10059047 | |||
| 2858 | Ga0307509_10124736 | |||
| 2859 | Ga0307408_100004432 | |||
| 2860 | Ga0307408_100005591 | |||
| 2861 | Ga0307408_100008967 | |||
| 2862 | Ga0307408_100010273 | |||
| 2863 | Ga0307408_100012300 | |||
| 2864 | Ga0307408_100014274 | |||
| 2865 | Ga0307408_100071569 | |||
| 2866 | Ga0307408_100101821 | |||
| 2867 | Ga0307408_100103867 | |||
| 2868 | Ga0307408_100114861 | |||
| 2869 | Ga0307408_100160846 | |||
| 2870 | Ga0307408_100201203 | |||
| 2871 | Ga0265313_10000614 | |||
| 2872 | Ga0265313_10028421 | |||
| 2873 | Ga0307508_10002053 | |||
| 2874 | Ga0307508_10005976 | |||
| 2875 | Ga0307508_10018562 | |||
| 2876 | Ga0307508_10094044 | |||
| 2877 | Ga0307508_10118451 | |||
| 2878 | Ga0307508_10267593 | |||
| 2879 | Ga0307514_10001479 | |||
| 2880 | Ga0307514_10008804 | |||
| 2881 | Ga0307514_10016383 | |||
| 2882 | Ga0307514_10113967 | |||
| 2883 | Ga0316575_10001935 | |||
| 2884 | Ga0316579_10000014 | |||
| 2885 | Ga0316579_10020088 | |||
| 2886 | Ga0265314_10008595 | |||
| 2887 | Ga0265314_10020900 | |||
| 2888 | Ga0265314_10066870 | |||
| 2889 | Ga0265314_10132830 | |||
| 2890 | Ga0316576_10022075 | |||
| 2891 | Ga0316576_10032808 | |||
| 2892 | Ga0316576_10035603 | |||
| 2893 | Ga0316576_10070794 | |||
| 2894 | Ga0316578_10016176 | |||
| 2895 | Ga0316578_10030439 | |||
| 2896 | Ga0307516_10001135 | |||
| 2897 | Ga0307516_10002744 | |||
| 2898 | Ga0307516_10041766 | |||
| 2899 | Ga0307516_10107073 | |||
| 2900 | Ga0307516_10252112 | |||
| 2901 | Ga0307405_10001947 | |||
| 2902 | Ga0307405_10005216 | |||
| 2903 | Ga0307405_10005302 | |||
| 2904 | Ga0307405_10006582 | |||
| 2905 | Ga0307405_10021603 | |||
| 2906 | Ga0307405_10061224 | |||
| 2907 | Ga0307405_10120277 | |||
| 2908 | Ga0307405_10152741 | |||
| 2909 | Ga0307405_10161919 | |||
| 2910 | Ga0307405_10292523 | |||
| 2911 | Ga0307413_10012984 | |||
| 2912 | Ga0307413_10022081 | |||
| 2913 | Ga0307413_10029042 | |||
| 2914 | Ga0307413_10049993 | |||
| 2915 | Ga0307413_10132963 | |||
| 2916 | Ga0307518_10061743 | |||
| 2917 | Ga0307518_10127406 | |||
| 2918 | Ga0307410_10003801 | |||
| 2919 | Ga0307410_10018295 | |||
| 2920 | Ga0307410_10080922 | |||
| 2921 | Ga0307410_10098137 | |||
| 2922 | Ga0307410_10143926 | |||
| 2923 | Ga0307410_10155511 | |||
| 2924 | Ga0307410_10169418 | |||
| 2925 | Ga0307410_10210374 | |||
| 2926 | Ga0307406_10009972 | |||
| 2927 | Ga0307406_10035665 | |||
| 2928 | Ga0307406_10037822 | |||
| 2929 | Ga0307406_10075745 | |||
| 2930 | Ga0307406_10111177 | |||
| 2931 | Ga0307406_10113333 | |||
| 2932 | Ga0307406_10138700 | |||
| 2933 | Ga0307407_10005551 | |||
| 2934 | Ga0307407_10011209 | |||
| 2935 | Ga0307407_10013075 | |||
| 2936 | Ga0307407_10014581 | |||
| 2937 | Ga0307407_10035385 | |||
| 2938 | Ga0307407_10064675 | |||
| 2939 | Ga0307407_10067269 | |||
| 2940 | Ga0307407_10099217 | |||
| 2941 | Ga0307412_10005441 | |||
| 2942 | Ga0307412_10005716 | |||
| 2943 | Ga0307412_10020334 | |||
| 2944 | Ga0307412_10027769 | |||
| 2945 | Ga0307412_10029316 | |||
| 2946 | Ga0307412_10032183 | |||
| 2947 | Ga0307412_10057012 | |||
| 2948 | Ga0307412_10057960 | |||
| 2949 | Ga0307412_10103586 | |||
| 2950 | Ga0307409_100000140 | |||
| 2951 | Ga0307409_100005261 | |||
| 2952 | Ga0307409_100015896 | |||
| 2953 | Ga0307409_100037172 | |||
| 2954 | Ga0307409_100081305 | |||
| 2955 | Ga0307409_100084689 | |||
| 2956 | Ga0307409_100085190 | |||
| 2957 | Ga0307409_100091261 | |||
| 2958 | Ga0307409_100096551 | |||
| 2959 | Ga0307409_100178908 | |||
| 2960 | Ga0307409_100183742 | |||
| 2961 | Ga0307409_100203331 | |||
| 2962 | Ga0307409_100223510 | |||
| 2963 | Ga0307409_100254517 | |||
| 2964 | Ga0307409_100294322 | |||
| 2965 | Ga0307416_100001123 | |||
| 2966 | Ga0307416_100002858 | |||
| 2967 | Ga0307416_100003603 | |||
| 2968 | Ga0307416_100030957 | |||
| 2969 | Ga0307416_100037482 | |||
| 2970 | Ga0307416_100050843 | |||
| 2971 | Ga0307416_100055353 | |||
| 2972 | Ga0307416_100065276 | |||
| 2973 | Ga0307416_100066740 | |||
| 2974 | Ga0307416_100106711 | |||
| 2975 | Ga0307416_100115802 | |||
| 2976 | Ga0307416_100116160 | |||
| 2977 | Ga0307416_100320722 | |||
| 2978 | Ga0307416_100354412 | |||
| 2979 | Ga0307416_100370165 | |||
| 2980 | Ga0307414_10001749 | |||
| 2981 | Ga0307414_10044902 | |||
| 2982 | Ga0307414_10070104 | |||
| 2983 | Ga0307411_10054147 | |||
| 2984 | Ga0307411_10121065 | |||
| 2985 | Ga0307411_10314945 | |||
| 2986 | Ga0307415_100000073 | |||
| 2987 | Ga0307415_100001231 | |||
| 2988 | Ga0307415_100011722 | |||
| 2989 | Ga0307415_100015593 | |||
| 2990 | Ga0307415_100046044 | |||
| 2991 | Ga0307415_100054609 | |||
| 2992 | Ga0307415_100061596 | |||
| 2993 | Ga0307415_100063772 | |||
| 2994 | Ga0307415_100079489 | |||
| 2995 | Ga0307415_100086248 | |||
| 2996 | Ga0307415_100089877 | |||
| 2997 | Ga0307415_100129330 | |||
| 2998 | Ga0307415_100157080 | |||
| 2999 | Ga0307415_100160213 | |||
| 3000 | Ga0307415_100173232 | |||
| 3001 | Ga0307415_100196181 | |||
| 3002 | Ga0307415_100242207 | |||
| 3003 | Ga0316580_10001252 | |||
| 3004 | Ga0307507_10000013 | |||
| 3005 | Ga0307507_10024103 | |||
| 3006 | Ga0307507_10029206 | |||
| 3007 | Ga0307507_10062771 | |||
| 3008 | Ga0307510_10073722 | |||
| 3009 | Ga0307510_10074879 | |||
| 3010 | Ga0307510_10102648 | |||
| 3011 | Ga0373934_0020232 | |||
| 3012 | Ga0373940_0005350 | |||
| 3013 | Ga0373951_0000188 | |||
| 3014 | Ga0373923_0025570 | |||
| 3015 | Ga0373932_0034304 | |||
| 3016 | Ga0373936_0003793 | |||
| 3017 | Ga0373936_0041009 | |||
| 3018 | Ga0373953_0037406 | |||
| 3019 | Ga0373956_0007853 | |||
| 3020 | Ga0373957_0001687 | |||
| 3021 | Ga0373957_0010148 | |||
| 3022 | Ga0373955_0017592 | |||
| 3023 | Ga0373942_0000142 | |||
| 3024 | Ga0373962_0001245 | |||
| 3025 | Ga0316574_0001220 | |||
| 3026 | Ga0316574_0006452 | |||
| 3027 | Ga0316574_0088238 | |||
| 3028 | Ga0316574_0155552 | |||
| 3029 | Ga0316574_0163800 | |||
| 3030 | Ga0373924_0001204 | |||
| 3031 | Ga0373924_0002400 | |||
| 3032 | Ga0373924_0145237 | |||
| 3033 | Ga0373931_0000119 | |||
| 3034 | Ga0373931_0126712 | |||
| 3035 | Ga0373935_0015724 | |||
| 3036 | Ga0373935_0041638 | |||
| 3037 | Ga0373935_0175000 | |||
| 3038 | Ga0373935_0181124 | |||
| 3039 | Ga0373933_0003781 | |||
| 3040 | Ga0373933_0008354 | |||
| 3041 | Ga0373933_0032470 | |||
| 3042 | Ga0373937_0027530 | |||
| 3043 | Ga0373937_0046609 | |||
| 3044 | Ga0373937_0073144 | |||
| 3045 | Ga0373937_0155014 | |||
| 3046 | Ga0316582_0011020 | |||
| 3047 | Ga0316582_0034025 | |||
| 3048 | Ga0316582_0138888 | |||
| 3049 | Ga0316584_0000612 | |||
| 3050 | Ga0316584_0011150 | |||
| 3051 | Ga0316584_0045363 | |||
| 3052 | Ga0316584_0153131 | |||
| 3053 | Ga0316584_0235173 | |||
| 3054 | Ga0373925_0000006 | |||
| 3055 | Ga0373925_0067135 | |||
| 3056 | Ga0395899_0001199 | |||
| 3057 | Ga0395899_0100480 | |||
| 3058 | Ga0395899_0113067 | |||
| 3059 | Ga0395900_0007242 | |||
| 3060 | Ga0395900_0012677 | |||
| 3061 | Ga0395900_0042137 | |||
| 3062 | Ga0395900_0058323 | |||
| 3063 | Ga0395900_0118148 | |||
| 3064 | Ga0395900_0127319 | |||
| 3065 | Ga0395900_0137145 | |||
| 3066 | Ga0395900_0196973 | |||
| 3067 | Ga0395900_0258675 | |||
| 3068 | Ga0395900_0396075 | |||
| 3069 | Ga0395900_0439259 | |||
| 3070 | Ga0395898_0000256 | |||
| 3071 | Ga0395898_0001516 | |||
| 3072 | Ga0395898_0011157 | |||
| 3073 | Ga0395898_0014066 | |||
| 3074 | Ga0395898_0016808 | |||
| 3075 | Ga0395898_0023381 | |||
| 3076 | Ga0395898_0036404 | |||
| 3077 | Ga0395898_0040985 | |||
| 3078 | Ga0395898_0107358 | |||
| 3079 | Ga0395898_0110750 | |||
| 3080 | Ga0395898_0140127 | |||
| 3081 | Ga0395905_0250772 | |||
| 3082 | Ga0395905_0275209 | |||
| 3083 | Ga0436364_0053804 | |||
| 3084 | Ga0436364_0445774 | |||
| 3085 | Ga0436364_0497556 | |||
| 3086 | Ga0436364_0675155 | |||
| 3087 | Ga0436364_1106417 | |||
| 3088 | Ga0436364_1149812 | |||
| 3089 | Ga0436364_1484307 | |||
| 3090 | Ga0395901_0012535 | |||
| 3091 | Ga0395901_0016431 | |||
| 3092 | Ga0395901_0039183 | |||
| 3093 | Ga0395901_0042568 | |||
| 3094 | Ga0395901_0051841 | |||
| 3095 | Ga0395901_0065461 | |||
| 3096 | Ga0395901_0117736 | |||
| 3097 | Ga0395901_0215491 | |||
| 3098 | Ga0395901_0344436 | |||
| 3099 | Ga0395901_0360429 | |||
| 3100 | Ga0400485_14323 | |||
| 3101 | Ga0400488_04969 | |||
| 3102 | Ga0400486_06112 | |||
| 3103 | Ga0400483_078666 | |||
| 3104 | Ga0400483_237273 | |||
| 3105 | Ga0436365_0562669 | |||
| 3106 | Ga0436365_0726960 | |||
| 3107 | Ga0436365_0934847 | |||
| 3108 | Ga0436365_1425629 | |||
| 3109 | Ga0436365_1765450 | |||
| 3110 | Ga0436360_0336736 | |||
| 3111 | Ga0436361_0647809 | |||
| 3112 | Ga0436363_0456998 | |||
| 3113 | Ga0436363_1147919 | |||
| 3114 | Ga0436362_0329220 | |||
| 3115 | Ga0436362_0334792 | |||
| 3116 | Ga0439436_0001406 | |||
| 3117 | Ga0439436_0003882 | |||
| 3118 | Ga0439436_0007177 | |||
| 3119 | Ga0439438_009258 | |||
| 3120 | Ga0439439_0000608 | |||
| 3121 | Ga0439439_0001403 | |||
| 3122 | Ga0439439_0020682 | |||
| 3123 | Ga0439461_0022381 | |||
| 3124 | Ga0439466_0013894 | |||
| 3125 | Ga0439466_0015547 | |||
| 3126 | Ga0439465_0024574 | |||
| 3127 | Ga0451797_0576558 | |||
| 3128 | Ga0451853_0524125 | |||
| 3129 | Ga0439431_0001082 | |||
| 3130 | Ga0439433_0000011 | |||
| 3131 | Ga0439433_0001106 | |||
| 3132 | Ga0439433_0002150 | |||
| 3133 | Ga0439442_000100 | |||
| 3134 | Ga0439442_000105 | |||
| 3135 | Ga0439442_009117 | |||
| 3136 | Ga0439448_0001623 | |||
| 3137 | Ga0439448_0013630 | |||
| 3138 | Ga0439448_0025926 | |||
| 3139 | Ga0439432_000499 | |||
| 3140 | Ga0439449_0001339 | |||
| 3141 | Ga0439449_0001769 | |||
| 3142 | Ga0439449_0005285 | |||
| 3143 | Ga0439449_0008539 | |||
| 3144 | Ga0439449_0028145 | |||
| 3145 | Ga0439449_0036603 | |||
| 3146 | Ga0439449_0046534 | |||
| 3147 | Ga0439450_001186 | |||
| 3148 | Ga0439450_003476 | |||
| 3149 | Ga0439452_002706 | |||
| 3150 | Ga0439455_0000986 | |||
| 3151 | Ga0439457_000166 | |||
| 3152 | Ga0439457_001067 | |||
| 3153 | Ga0439457_012975 | |||
| 3154 | Ga0439462_0014847 | |||
| 3155 | Ga0439463_000211 | |||
| 3156 | Ga0439463_001385 | |||
| 3157 | Ga0439463_003518 | |||
| 3158 | Ga0450911_003799 | |||
| 3159 | Ga0450913_000164 | |||
| 3160 | Ga0450919_000414 | |||
| 3161 | Ga0450920_004056 | |||
| 3162 | Ga0450920_009768 | |||
| 3163 | Ga0450894_001280 | |||
| 3164 | Ga0450898_011488 | |||
| 3165 | Ga0450899_001054 | |||
| 3166 | Ga0450903_002809 | |||
| 3167 | Ga0450907_000086 | |||
| 3168 | Ga0450907_003667 | |||
| 3169 | Ga0439446_0007643 | |||
| 3170 | Ga0439458_0004260 | |||
| 3171 | Ga0439458_0030079 | |||
| 3172 | Ga0450909_000097 | |||
| 3173 | Ga0439434_0003039 | |||
| 3174 | Ga0439434_0006572 | |||
| 3175 | Ga0439434_0006796 | |||
| 3176 | Ga0439434_0013656 | |||
| 3177 | Ga0439434_0015655 | |||
| 3178 | Ga0439435_0002840 | |||
| 3179 | Ga0439464_0000089 | |||
| 3180 | Ga0439460_0001743 | |||
| 3181 | Ga0450918_004987 | |||
| 3182 | Ga0439440_0000033 | |||
| 3183 | Ga0466969_0013288 | |||
| 3184 | Ga0466969_0021485 | |||
| 3185 | Ga0466969_0037244 | |||
| 3186 | Ga0466972_0005469 | |||
| 3187 | Ga0466972_0026235 | |||
| 3188 | Ga0466972_0111265 | |||
| 3189 | Ga0466965_0000001 | |||
| 3190 | Ga0466965_0056046 | |||
| 3191 | Ga0466965_0070489 | |||
| 3192 | Ga0466965_0108721 | |||
| 3193 | Ga0466966_0001229 | |||
| 3194 | Ga0466966_0002669 | |||
| 3195 | Ga0466966_0010569 | |||
| 3196 | Ga0466966_0039987 | |||
| 3197 | Ga0466966_0084173 | |||
| 3198 | Ga0466966_0092457 | |||
| 3199 | Ga0466966_0104143 | |||
| 3200 | Ga0466966_0110201 | |||
| 3201 | Ga0466961_0000334 | |||
| 3202 | Ga0466961_0002146 | |||
| 3203 | Ga0466961_0018302 | |||
| 3204 | Ga0466961_0018600 | |||
| 3205 | Ga0466961_0041665 | |||
| 3206 | Ga0466961_0057149 | |||
| 3207 | Ga0466961_0098614 | |||
| 3208 | Ga0466961_0155367 | |||
| 3209 | Ga0466963_0000113 | |||
| 3210 | Ga0466963_0032072 | |||
| 3211 | Ga0466963_0041053 | |||
| 3212 | Ga0466963_0044903 | |||
| 3213 | Ga0466963_0063551 | |||
| 3214 | Ga0466963_0069693 | |||
| 3215 | Ga0466963_0116491 | |||
| 3216 | Ga0466963_0127713 | |||
| 3217 | Ga0466963_0151374 | |||
| 3218 | Ga0466964_0003680 | |||
| 3219 | Ga0466964_0019823 | |||
| 3220 | Ga0466964_0069955 | |||
| 3221 | Ga0466971_0000604 | |||
| 3222 | Ga0466971_0028490 | |||
| 3223 | Ga0466971_0060763 | |||
| 3224 | Ga0466968_0009794 | |||
| 3225 | Ga0466968_0009975 | |||
| 3226 | Ga0466970_0004815 | |||
| 3227 | Ga0466970_0005522 | |||
| 3228 | Ga0466970_0005582 | |||
| 3229 | Ga0466970_0028303 | |||
| 3230 | Ga0466970_0050345 | |||
| 3231 | Ga0466957_0003322 | |||
| 3232 | Ga0466957_0005112 | |||
| 3233 | Ga0466957_0031622 | |||
| 3234 | Ga0466957_0058297 | |||
| 3235 | Ga0466957_0145264 | |||
| 3236 | Ga0466960_0003005 | |||
| 3237 | Ga0466960_0008168 | |||
| 3238 | Ga0466960_0016591 | |||
| 3239 | Ga0466960_0020405 | |||
| 3240 | Ga0466960_0048394 | |||
| 3241 | Ga0466959_0000927 | |||
| 3242 | Ga0466959_0001283 | |||
| 3243 | Ga0466959_0001538 | |||
| 3244 | Ga0466959_0002972 | |||
| 3245 | Ga0466959_0010248 | |||
| 3246 | Ga0466959_0019337 | |||
| 3247 | Ga0466959_0025712 | |||
| 3248 | Ga0466959_0059395 | |||
| 3249 | Ga0466959_0073850 | |||
| 3250 | Ga0466959_0125754 | |||
| 3251 | Ga0466959_0164472 | |||
| 3252 | Ga0451576_0158695 | |||
| 3253 | Ga0466958_0001093 | |||
| 3254 | Ga0466958_0009620 | |||
| 3255 | Ga0466958_0010518 | |||
| 3256 | Ga0466958_0012195 | |||
| 3257 | Ga0466958_0016297 | |||
| 3258 | Ga0466958_0022265 | |||
| 3259 | Ga0466958_0045290 | |||
| 3260 | Ga0466958_0045776 | |||
| 3261 | Ga0466967_0007780 | |||
| 3262 | Ga0466967_0008112 | |||
| 3263 | Ga0466967_0010829 | |||
| 3264 | Ga0466967_0014774 | |||
| 3265 | Ga0466967_0031412 | |||
| 3266 | Ga0466967_0033743 | |||
| 3267 | Ga0466967_0036626 | |||
| 3268 | Ga0466967_0049506 | |||
| 3269 | Ga0466967_0072987 | |||
| 3270 | Ga0466967_0132887 | |||
| 3271 | Ga0466967_0226686 | |||
| 3272 | Ga0466967_0259780 | |||
| 3273 | Ga0466967_0386883 | |||
| 3274 | Ga0466967_0514827 | |||
| 3275 | Ga0495617_021032 | |||
| 3276 | Ga0495627_012192 | |||
| 3277 | Ga0495592_0058887 | |||
| 3278 | Ga0495592_0078800 | |||
| 3279 | Ga0495592_0120905 | |||
| 3280 | Ga0495603_0001591 | |||
| 3281 | Ga0495603_0029411 | |||
| 3282 | Ga0495603_0093844 | |||
| 3283 | Ga0495603_0128588 | |||
| 3284 | Ga0495603_0152818 | |||
| 3285 | Ga0495629_0000933 | |||
| 3286 | Ga0495629_0018469 | |||
| 3287 | Ga0495629_0018510 | |||
| 3288 | Ga0495629_0020144 | |||
| 3289 | Ga0495629_0036281 | |||
| 3290 | Ga0495629_0063068 | |||
| 3291 | Ga0495629_0248485 | |||
| 3292 | Ga0495641_0002845 | |||
| 3293 | Ga0495641_0006228 | |||
| 3294 | Ga0495651_0019189 | |||
| 3295 | Ga0495651_0023476 | |||
| 3296 | Ga0495651_0075302 | |||
| 3297 | Ga0495653_0043766 | |||
| 3298 | Ga0495653_0045307 | |||
| 3299 | Ga0495653_0052061 | |||
| 3300 | Ga0495653_0085760 | |||
| 3301 | Ga0495580_0001823 | |||
| 3302 | Ga0495580_0019335 | |||
| 3303 | Ga0495582_0001683 | |||
| 3304 | Ga0495582_0008683 | |||
| 3305 | Ga0495582_0080414 | |||
| 3306 | Ga0495639_0004885 | |||
| 3307 | Ga0495662_0000168 | |||
| 3308 | Ga0495662_0000230 | |||
| 3309 | Ga0495662_0009153 | |||
| 3310 | Ga0495662_0010114 | |||
| 3311 | Ga0495662_0010703 | |||
| 3312 | Ga0495664_0001164 | |||
| 3313 | Ga0495664_0003063 | |||
| 3314 | Ga0495664_0003236 | |||
| 3315 | Ga0495664_0011791 | |||
| 3316 | Ga0495664_0166029 | |||
| 3317 | Ga0495585_0005641 | |||
| 3318 | Ga0495594_0000836 | |||
| 3319 | Ga0495594_0003472 | |||
| 3320 | Ga0495594_0052174 | |||
| 3321 | Ga0495594_0117460 | |||
| 3322 | Ga0495594_0119449 | |||
| 3323 | Ga0495606_0002906 | |||
| 3324 | Ga0495606_0003739 | |||
| 3325 | Ga0495608_0008718 | |||
| 3326 | Ga0495608_0019074 | |||
| 3327 | Ga0495608_0149266 | |||
| 3328 | Ga0495608_0196197 | |||
| 3329 | Ga0495616_0064235 | |||
| 3330 | Ga0495618_0039495 | |||
| 3331 | Ga0495618_0127142 | |||
| 3332 | Ga0495618_0131554 | |||
| 3333 | Ga0495618_0170009 | |||
| 3334 | Ga0495620_0014258 | |||
| 3335 | Ga0495628_0025612 | |||
| 3336 | Ga0495628_0027557 | |||
| 3337 | Ga0495628_0029006 | |||
| 3338 | Ga0495628_0083316 | |||
| 3339 | Ga0495628_0089084 | |||
| 3340 | Ga0495628_0109685 | |||
| 3341 | Ga0495630_0118656 | |||
| 3342 | Ga0495630_0138202 | |||
| 3343 | Ga0495630_0239350 | |||
| 3344 | Ga0495631_0020150 | |||
| 3345 | Ga0495632_0105041 | |||
| 3346 | Ga0495643_0046165 | |||
| 3347 | Ga0495643_0056340 | |||
| 3348 | Ga0495666_0011813 | |||
| 3349 | Ga0495666_0077705 | |||
| 3350 | Ga0495642_0029792 | |||
| 3351 | Ga0495642_0031202 | |||
| 3352 | Ga0495642_0031540 | |||
| 3353 | Ga0495652_0003119 | |||
| 3354 | Ga0495652_0027169 | |||
| 3355 | Ga0495652_0032257 | |||
| 3356 | Ga0495652_0075686 | |||
| 3357 | Ga0495652_0130715 | |||
| 3358 | Ga0495665_0002144 | |||
| 3359 | Ga0495665_0012658 | |||
| 3360 | Ga0495665_0023899 | |||
| 3361 | Ga0495640_0014350 | |||
| 3362 | Ga0495640_0017751 | |||
| 3363 | Ga0495640_0059064 | |||
| 3364 | Ga0495640_0061264 | |||
| 3365 | Ga0495640_0087230 | |||
| 3366 | Ga0495640_0087990 | |||
| 3367 | Ga0495586_0003443 | |||
| 3368 | Ga0495586_0022779 | |||
| 3369 | Ga0495586_0036162 | |||
| 3370 | Ga0495586_0058186 | |||
| 3371 | Ga0495587_0005854 | |||
| 3372 | Ga0495645_0012568 | |||
| 3373 | Ga0495645_0021786 | |||
| 3374 | Ga0495645_0086876 | |||
| 3375 | Ga0495622_0005909 | |||
| 3376 | Ga0495633_0005618 | |||
| 3377 | Ga0495633_0022654 | |||
| 3378 | Ga0495667_0006867 | |||
| 3379 | Ga0495667_0049798 | |||
| 3380 | Ga0495656_0012363 | |||
| 3381 | Ga0495656_0036089 | |||
| 3382 | Ga0495656_0092790 | |||
| 3383 | Ga0495668_0000400 | |||
| 3384 | Ga0495634_0004689 | |||
| 3385 | Ga0495634_0009795 | |||
| 3386 | Ga0495634_0043471 | |||
| 3387 | Ga0495634_0131223 | |||
| 3388 | Ga0495611_0028000 | |||
| 3389 | Ga0495611_0051654 | |||
| 3390 | Ga0495611_0066514 | |||
| 3391 | Ga0495625_0002415 | |||
| 3392 | Ga0495625_0007523 | |||
| 3393 | Ga0495625_0038110 | |||
| 3394 | Ga0495635_0000946 | |||
| 3395 | Ga0495635_0009366 | |||
| 3396 | Ga0495635_0075979 | |||
| 3397 | Ga0495659_0082898 | |||
| 3398 | Ga0495588_0018738 | |||
| 3399 | Ga0495657_0002272 | |||
| 3400 | Ga0495657_0003402 | |||
| 3401 | Ga0495657_0011090 | |||
| 3402 | Ga0495657_0047966 | |||
| 3403 | Ga0495657_0050481 | |||
| 3404 | Ga0495657_0061205 | |||
| 3405 | Ga0495657_0089029 | |||
| 3406 | Ga0495599_0006012 | |||
| 3407 | Ga0495599_0159504 | |||
| 3408 | Ga0495623_0012392 | |||
| 3409 | Ga0495623_0033976 | |||
| 3410 | Ga0495623_0063999 | |||
| 3411 | Ga0495623_0170727 | |||
| 3412 | Ga0495646_0000452 | |||
| 3413 | Ga0495646_0007858 | |||
| 3414 | Ga0495646_0009781 | |||
| 3415 | Ga0495646_0052952 | |||
| 3416 | Ga0495658_0007916 | |||
| 3417 | Ga0495658_0039943 | |||
| 3418 | Ga0495658_0087409 | |||
| 3419 | Ga0495669_0016059 | |||
| 3420 | Ga0495613_0003768 | |||
| 3421 | Ga0495613_0017034 | |||
| 3422 | Ga0495613_0018725 | |||
| 3423 | Ga0495613_0186604 | |||
| 3424 | Ga0495613_0202364 | |||
| 3425 | Ga0495613_0252674 | |||
| 3426 | Ga0495624_0008540 | |||
| 3427 | Ga0495624_0015418 | |||
| 3428 | Ga0495624_0068748 | |||
| 3429 | Ga0495670_0002199 | |||
| 3430 | Ga0495670_0002991 | |||
| 3431 | Ga0495670_0077290 | |||
| 3432 | Ga0495671_0049179 | |||
| 3433 | Ga0495649_0025282 | |||
| 3434 | Ga0495600_0013854 | |||
| 3435 | Ga0495600_0033692 | |||
| 3436 | Ga0495600_0073128 | |||
| 3437 | Ga0495600_0112736 | |||
| 3438 | Ga0495660_0053234 | |||
| 3439 | Ga0495581_0002512 | |||
| 3440 | Ga0495581_0004308 | |||
| 3441 | Ga0495581_0032992 | |||
| 3442 | Ga0495581_0058657 | |||
| 3443 | Ga0495581_0098816 | |||
| 3444 | Ga0495581_0138701 | |||
| 3445 | Ga0495604_0001416 | |||
| 3446 | Ga0495604_0002144 | |||
| 3447 | Ga0495604_0005831 | |||
| 3448 | Ga0495604_0014230 | |||
| 3449 | Ga0495604_0165146 | |||
| 3450 | Ga0495604_0192660 | |||
| 3451 | Ga0495604_0201614 | |||
| 3452 | Ga0495636_0002818 | |||
| 3453 | Ga0495636_0061648 | |||
| 3454 | Ga0495636_0079384 | |||
| 3455 | Ga0495674_0018315 | |||
| 3456 | Ga0495674_0061308 | |||
| 3457 | Ga0495674_0102820 | |||
| 3458 | Ga0495674_0156660 | |||
| 3459 | Ga0495674_0192739 | |||
| 3460 | Ga0495672_0004785 | |||
| 3461 | Ga0495676_0023788 | |||
| 3462 | Ga0495676_0072221 | |||
| 3463 | Ga0495680_0006764 | |||
| 3464 | Ga0495680_0011844 | |||
| 3465 | Ga0495680_0017348 | |||
| 3466 | Ga0495680_0022079 | |||
| 3467 | Ga0495680_0026856 | |||
| 3468 | Ga0495680_0213611 | |||
| 3469 | Ga0495683_0023977 | |||
| 3470 | Ga0495683_0045786 | |||
| 3471 | Ga0495683_0053704 | |||
| 3472 | Ga0495687_002815 | |||
| 3473 | Ga0495687_006848 | |||
| 3474 | Ga0495675_0002889 | |||
| 3475 | Ga0495675_0004974 | |||
| 3476 | Ga0495675_0006351 | |||
| 3477 | Ga0495675_0014687 | |||
| 3478 | Ga0495675_0021343 | |||
| 3479 | Ga0495675_0023645 | |||
| 3480 | Ga0495675_0046692 | |||
| 3481 | Ga0495685_000982 | |||
| 3482 | Ga0495685_020451 | |||
| 3483 | Ga0495685_023255 | |||
| 3484 | Ga0495685_024961 | |||
| 3485 | Ga0495685_042339 | |||
| 3486 | Ga0495681_0015753 | |||
| 3487 | Ga0495681_0064671 | |||
| 3488 | Ga0495681_0104454 | |||
| 3489 | Ga0495681_0114760 | |||
| 3490 | Ga0495684_0005403 | |||
| 3491 | Ga0495684_0242685 | |||
| 3492 | Ga0495686_0116420 | |||
| 3493 | Ga0495593_0000443 | |||
| 3494 | Ga0495593_0002560 | |||
| 3495 | Ga0495593_0034279 | |||
| 3496 | Ga0495593_0111386 | |||
| 3497 | Ga0495602_0006880 | |||
| 3498 | Ga0495602_0029227 | |||
| 3499 | Ga0495602_0036142 | |||
| 3500 | Ga0495602_0075673 | |||
| 3501 | Ga0495602_0175671 | |||
| 3502 | Ga0495602_0212854 | |||
| 3503 | Ga0495614_0000332 | |||
| 3504 | Ga0495614_0031915 | |||
| 3505 | Ga0495614_0033535 | |||
| 3506 | Ga0495626_0000107 | |||
| 3507 | Ga0496100_0000230 | |||
| 3508 | Ga0496100_0043820 | |||
| 3509 | Ga0496100_0087974 | |||
| 3510 | Ga0496100_0161740 | |||
| 3511 | Ga0496100_0196657 | |||
| 3512 | Ga0496101_0001323 | |||
| 3513 | Ga0496101_0054973 | |||
| 3514 | Ga0496101_0082071 | |||
| 3515 | Ga0496102_0000197 | |||
| 3516 | Ga0496102_0021041 | |||
| 3517 | Ga0496102_0023849 | |||
| 3518 | Ga0496102_0037590 | |||
| 3519 | Ga0496102_0038480 | |||
| 3520 | Ga0496102_0045644 | |||
| 3521 | Ga0496102_0055745 | |||
| 3522 | Ga0496102_0083131 | |||
| 3523 | Ga0496102_0093081 | |||
| 3524 | Ga0496102_0102067 | |||
| 3525 | Ga0496102_0171358 | |||
| 3526 | Ga0496103_0000567 | |||
| 3527 | Ga0496103_0023676 | |||
| 3528 | Ga0496103_0030514 | |||
| 3529 | Ga0496103_0039662 | |||
| 3530 | Ga0496103_0067538 | |||
| 3531 | Ga0496104_0003320 | |||
| 3532 | Ga0496104_0011409 | |||
| 3533 | Ga0496104_0033704 | |||
| 3534 | Ga0496104_0034546 | |||
| 3535 | Ga0496104_0036380 | |||
| 3536 | Ga0496104_0046580 | |||
| 3537 | Ga0496104_0099606 | |||
| 3538 | Ga0496104_0111162 | |||
| 3539 | Ga0496104_0121872 | |||
| 3540 | Ga0496104_0131900 | |||
| 3541 | Ga0496104_0234151 | |||
| 3542 | Ga0496104_0257471 | |||
| 3543 | Ga0496105_0011926 | |||
| 3544 | Ga0496105_0015275 | |||
| 3545 | Ga0496105_0038966 | |||
| 3546 | Ga0496105_0046991 | |||
| 3547 | Ga0496105_0090132 | |||
| 3548 | Ga0496105_0090865 | |||
| 3549 | Ga0496105_0132441 | |||
| 3550 | Ga0496105_0258066 | |||
| 3551 | Ga0496106_0007408 | |||
| 3552 | Ga0496106_0031548 | |||
| 3553 | Ga0496106_0036550 | |||
| 3554 | Ga0496106_0069881 | |||
| 3555 | Ga0496106_0123434 | |||
| 3556 | Ga0496106_0133453 | |||
| 3557 | Ga0496107_0001318 | |||
| 3558 | Ga0496107_0037188 | |||
| 3559 | Ga0496107_0038003 | |||
| 3560 | Ga0496107_0055606 | |||
| 3561 | Ga0496107_0076169 | |||
| 3562 | Ga0496107_0100298 | |||
| 3563 | Ga0496107_0102047 | |||
| 3564 | Ga0496108_0000323 | |||
| 3565 | Ga0496108_0006496 | |||
| 3566 | Ga0496108_0012803 | |||
| 3567 | Ga0496108_0084950 | |||
| 3568 | Ga0496108_0095629 | |||
| 3569 | Ga0496108_0105015 | |||
| 3570 | Ga0496108_0120317 | |||
| 3571 | Ga0496108_0124866 | |||
| 3572 | Ga0496108_0186921 | |||
| 3573 | Ga0496109_0002523 | |||
| 3574 | Ga0496109_0004862 | |||
| 3575 | Ga0496109_0019246 | |||
| 3576 | Ga0496109_0032372 | |||
| 3577 | Ga0496109_0034824 | |||
| 3578 | Ga0496109_0115425 | |||
| 3579 | Ga0496109_0129255 | |||
| 3580 | Ga0496109_0157565 | |||
| 3581 | Ga0496109_0199461 | |||
| 3582 | Ga0496109_0204079 | |||
| 3583 | Ga0496109_0215218 | |||
| 3584 | Ga0496109_0237679 | |||
| 3585 | Ga0496109_0486189 | |||
| 3586 | Ga0496110_0004803 | |||
| 3587 | Ga0496110_0008247 | |||
| 3588 | Ga0496110_0008548 | |||
| 3589 | Ga0496110_0017679 | |||
| 3590 | Ga0496110_0038743 | |||
| 3591 | Ga0496110_0039302 | |||
| 3592 | Ga0496110_0043146 | |||
| 3593 | Ga0496110_0059470 | |||
| 3594 | Ga0496110_0059635 | |||
| 3595 | Ga0496110_0117426 | |||
| 3596 | Ga0496110_0118881 | |||
| 3597 | Ga0496110_0199315 | |||
| 3598 | Ga0496111_0047322 | |||
| 3599 | Ga0496111_0059520 | |||
| 3600 | Ga0496111_0069275 | |||
| 3601 | Ga0496111_0099236 | |||
| 3602 | Ga0496111_0105774 | |||
| 3603 | Ga0496111_0139751 | |||
| 3604 | Ga0496111_0220146 | |||
| 3605 | Ga0496112_0027019 | |||
| 3606 | Ga0496112_0027336 | |||
| 3607 | Ga0496112_0027513 | |||
| 3608 | Ga0496112_0062948 | |||
| 3609 | Ga0496112_0093772 | |||
| 3610 | Ga0496112_0095368 | |||
| 3611 | Ga0496112_0134082 | |||
| 3612 | Ga0496112_0419569 | |||
| 3613 | Ga0496113_0002025 | |||
| 3614 | Ga0496113_0054965 | |||
| 3615 | Ga0496113_0055383 | |||
| 3616 | Ga0496113_0082918 | |||
| 3617 | Ga0496113_0105761 | |||
| 3618 | Ga0496113_0113680 | |||
| 3619 | Ga0496113_0214923 | |||
| 3620 | Ga0496113_0350872 | |||
| 3621 | Ga0496114_0000312 | |||
| 3622 | Ga0496114_0004399 | |||
| 3623 | Ga0496114_0005039 | |||
| 3624 | Ga0496114_0021136 | |||
| 3625 | Ga0496114_0037163 | |||
| 3626 | Ga0496114_0045642 | |||
| 3627 | Ga0496114_0062739 | |||
| 3628 | Ga0496114_0065970 | |||
| 3629 | Ga0496114_0083702 | |||
| 3630 | Ga0496114_0100408 | |||
| 3631 | Ga0496114_0105861 | |||
| 3632 | Ga0496114_0106305 | |||
| 3633 | Ga0496114_0122375 | |||
| 3634 | Ga0496114_0159674 | |||
| 3635 | Ga0496115_0000958 | |||
| 3636 | Ga0496115_0015306 | |||
| 3637 | Ga0496115_0017500 | |||
| 3638 | Ga0496115_0030420 | |||
| 3639 | Ga0496115_0039635 | |||
| 3640 | Ga0496115_0055631 | |||
| 3641 | Ga0496115_0157271 | |||
| 3642 | Ga0496116_0001814 | |||
| 3643 | Ga0496117_0000160 | |||
| 3644 | Ga0496117_0025274 | |||
| 3645 | Ga0496117_0078466 | |||
| 3646 | Ga0496118_0000391 | |||
| 3647 | Ga0496118_0004280 | |||
| 3648 | Ga0496118_0008436 | |||
| 3649 | Ga0496118_0013776 | |||
| 3650 | Ga0496118_0077813 | |||
| 3651 | Ga0496119_0000585 | |||
| 3652 | Ga0496119_0001388 | |||
| 3653 | Ga0496119_0006896 | |||
| 3654 | Ga0496119_0014398 | |||
| 3655 | Ga0496119_0022637 | |||
| 3656 | Ga0496120_0000664 | |||
| 3657 | Ga0496120_0025613 | |||
| 3658 | Ga0496121_0001733 | |||
| 3659 | Ga0496121_0005283 | |||
| 3660 | Ga0496121_0015399 | |||
| 3661 | Ga0496121_0038881 | |||
| 3662 | Ga0496122_0000420 | |||
| 3663 | Ga0496123_0000241 | |||
| 3664 | Ga0496123_0007065 | |||
| 3665 | Ga0496124_0001389 | |||
| 3666 | Ga0496124_0008501 | |||
| 3667 | Ga0496124_0131795 | |||
| 3668 | Ga0496124_0245039 | |||
| 3669 | Ga0496125_0001823 | |||
| 3670 | Ga0496125_0023204 | |||
| 3671 | Ga0496125_0183937 | |||
| 3672 | Ga0496126_0000003 | |||
| 3673 | Ga0496126_0000007 | |||
| 3674 | Ga0496126_0001780 | |||
| 3675 | Ga0496126_0014094 | |||
| 3676 | Ga0496126_0115230 | |||
| 3677 | Ga0495678_033053 | |||
| 3678 | Ga0501311_006970 | |||
| 3679 | Ga0501316_002091 | |||
| 3680 | Ga0501317_005953 | |||
| 3681 | Ga0501317_006872 | |||
| 3682 | Ga0501031_0005025 | |||
| 3683 | Ga0501031_0017177 | |||
| 3684 | Ga0501031_0017508 | |||
| 3685 | Ga0501031_0035488 | |||
| 3686 | Ga0501031_0177693 | |||
| 3687 | Ga0501032_0000233 | |||
| 3688 | Ga0501032_0001476 | |||
| 3689 | Ga0501032_0005177 | |||
| 3690 | Ga0501032_0028713 | |||
| 3691 | Ga0501032_0030584 | |||
| 3692 | Ga0501032_0032894 | |||
| 3693 | Ga0501032_0123909 | |||
| 3694 | Ga0501032_0134293 | |||
| 3695 | Ga0501033_0000068 | |||
| 3696 | Ga0501033_0001790 | |||
| 3697 | Ga0501033_0003003 | |||
| 3698 | Ga0501033_0024169 | |||
| 3699 | Ga0501033_0028021 | |||
| 3700 | Ga0501033_0036697 | |||
| 3701 | Ga0501033_0043060 | |||
| 3702 | Ga0501033_0043157 | |||
| 3703 | Ga0501033_0048329 | |||
| 3704 | Ga0501033_0072646 | |||
| 3705 | Ga0501033_0160141 | |||
| 3706 | Ga0501033_0210754 | |||
| 3707 | Ga0501034_0000112 | |||
| 3708 | Ga0501034_0000445 | |||
| 3709 | Ga0501034_0006054 | |||
| 3710 | Ga0501034_0007138 | |||
| 3711 | Ga0501034_0010407 | |||
| 3712 | Ga0501034_0012880 | |||
| 3713 | Ga0501034_0014057 | |||
| 3714 | Ga0501034_0015728 | |||
| 3715 | Ga0501034_0016899 | |||
| 3716 | Ga0501034_0026522 | |||
| 3717 | Ga0501034_0030332 | |||
| 3718 | Ga0501034_0045746 | |||
| 3719 | Ga0501034_0061252 | |||
| 3720 | Ga0501034_0069812 | |||
| 3721 | Ga0501034_0076242 | |||
| 3722 | Ga0501034_0134456 | |||
| 3723 | Ga0501034_0142499 | |||
| 3724 | Ga0501034_0198622 | |||
| 3725 | Ga0501036_0000173 | |||
| 3726 | Ga0501036_0000311 | |||
| 3727 | Ga0501036_0003610 | |||
| 3728 | Ga0501036_0008768 | |||
| 3729 | Ga0501036_0008920 | |||
| 3730 | Ga0501036_0029342 | |||
| 3731 | Ga0501036_0043083 | |||
| 3732 | Ga0501036_0043488 | |||
| 3733 | Ga0501036_0056446 | |||
| 3734 | Ga0501036_0065845 | |||
| 3735 | Ga0501036_0112295 | |||
| 3736 | Ga0501036_0222346 | |||
| 3737 | Ga0501036_0258655 | |||
| 3738 | Ga0501036_0280210 | |||
| 3739 | Ga0501036_0383459 | |||
| 3740 | Ga0501037_0003443 | |||
| 3741 | Ga0501037_0006517 | |||
| 3742 | Ga0501037_0027561 | |||
| 3743 | Ga0501037_0062648 | |||
| 3744 | Ga0501037_0074828 | |||
| 3745 | Ga0501037_0085228 | |||
| 3746 | Ga0501037_0087800 | |||
| 3747 | Ga0501037_0096108 | |||
| 3748 | Ga0501037_0118814 | |||
| 3749 | Ga0501037_0118967 | |||
| 3750 | Ga0501037_0154033 | |||
| 3751 | Ga0501037_0171181 | |||
| 3752 | Ga0501037_0217775 | |||
| 3753 | Ga0501038_0001008 | |||
| 3754 | Ga0501038_0003450 | |||
| 3755 | Ga0501038_0014731 | |||
| 3756 | Ga0501038_0017937 | |||
| 3757 | Ga0501038_0018475 | |||
| 3758 | Ga0501038_0022056 | |||
| 3759 | Ga0501038_0022327 | |||
| 3760 | Ga0501038_0024582 | |||
| 3761 | Ga0501038_0033926 | |||
| 3762 | Ga0501038_0037905 | |||
| 3763 | Ga0501038_0100233 | |||
| 3764 | Ga0501039_0000365 | |||
| 3765 | Ga0501039_0001818 | |||
| 3766 | Ga0501039_0002989 | |||
| 3767 | Ga0501039_0022325 | |||
| 3768 | Ga0501039_0047522 | |||
| 3769 | Ga0501039_0055707 | |||
| 3770 | Ga0501040_0000601 | |||
| 3771 | Ga0501040_0003265 | |||
| 3772 | Ga0501040_0005731 | |||
| 3773 | Ga0501040_0010110 | |||
| 3774 | Ga0501040_0024469 | |||
| 3775 | Ga0501040_0030966 | |||
| 3776 | Ga0501040_0034618 | |||
| 3777 | Ga0501040_0046369 | |||
| 3778 | Ga0501040_0167863 | |||
| 3779 | Ga0501040_0169048 | |||
| 3780 | Ga0501041_0000058 | |||
| 3781 | Ga0501041_0003675 | |||
| 3782 | Ga0501041_0007040 | |||
| 3783 | Ga0501041_0035545 | |||
| 3784 | Ga0501041_0047911 | |||
| 3785 | Ga0501041_0089087 | |||
| 3786 | Ga0501041_0126922 | |||
| 3787 | Ga0501042_0000028 | |||
| 3788 | Ga0501042_0001191 | |||
| 3789 | Ga0501042_0002058 | |||
| 3790 | Ga0501042_0002832 | |||
| 3791 | Ga0501042_0018019 | |||
| 3792 | Ga0501042_0052282 | |||
| 3793 | Ga0501042_0069868 | |||
| 3794 | Ga0501043_0002108 | |||
| 3795 | Ga0501043_0003406 | |||
| 3796 | Ga0501043_0003689 | |||
| 3797 | Ga0501043_0006173 | |||
| 3798 | Ga0501043_0006711 | |||
| 3799 | Ga0501043_0122203 | |||
| 3800 | Ga0501043_0166297 | |||
| 3801 | Ga0501046_0000269 | |||
| 3802 | Ga0501046_0002221 | |||
| 3803 | Ga0501046_0011509 | |||
| 3804 | Ga0501046_0014720 | |||
| 3805 | Ga0501046_0019530 | |||
| 3806 | Ga0501046_0033858 | |||
| 3807 | Ga0501046_0138238 | |||
| 3808 | Ga0501046_0205518 | |||
| 3809 | Ga0501047_0001586 | |||
| 3810 | Ga0501047_0001974 | |||
| 3811 | Ga0501047_0002200 | |||
| 3812 | Ga0501047_0006112 | |||
| 3813 | Ga0501047_0033018 | |||
| 3814 | Ga0501047_0039286 | |||
| 3815 | Ga0501047_0063533 | |||
| 3816 | Ga0501047_0063892 | |||
| 3817 | Ga0501047_0064059 | |||
| 3818 | Ga0501047_0066684 | |||
| 3819 | Ga0501047_0140224 | |||
| 3820 | Ga0501047_0209861 | |||
| 3821 | Ga0501047_0324272 | |||
| 3822 | Ga0501048_0000200 | |||
| 3823 | Ga0501048_0000208 | |||
| 3824 | Ga0501048_0005603 | |||
| 3825 | Ga0501048_0007562 | |||
| 3826 | Ga0501048_0008379 | |||
| 3827 | Ga0501048_0202570 | |||
| 3828 | Ga0501067_0007563 | |||
| 3829 | Ga0501067_0032055 | |||
| 3830 | Ga0501067_0039453 | |||
| 3831 | Ga0501067_0044280 | |||
| 3832 | Ga0501067_0048889 | |||
| 3833 | Ga0501068_0000883 | |||
| 3834 | Ga0501068_0002304 | |||
| 3835 | Ga0501068_0005165 | |||
| 3836 | Ga0501068_0043033 | |||
| 3837 | Ga0501068_0094068 | |||
| 3838 | Ga0501069_0000009 | |||
| 3839 | Ga0501069_0000779 | |||
| 3840 | Ga0501069_0003171 | |||
| 3841 | Ga0501069_0010725 | |||
| 3842 | Ga0501069_0011829 | |||
| 3843 | Ga0501069_0019199 | |||
| 3844 | Ga0501070_0000006 | |||
| 3845 | Ga0501070_0000090 | |||
| 3846 | Ga0501070_0000381 | |||
| 3847 | Ga0501070_0002977 | |||
| 3848 | Ga0501070_0003717 | |||
| 3849 | Ga0501070_0004522 | |||
| 3850 | Ga0501070_0005764 | |||
| 3851 | Ga0501070_0007642 | |||
| 3852 | Ga0501070_0020310 | |||
| 3853 | Ga0501070_0067333 | |||
| 3854 | Ga0501070_0072577 | |||
| 3855 | Ga0501070_0072816 | |||
| 3856 | Ga0501070_0076534 | |||
| 3857 | Ga0501070_0076808 | |||
| 3858 | Ga0501070_0098471 | |||
| 3859 | Ga0501070_0111273 | |||
| 3860 | Ga0501070_0123860 | |||
| 3861 | Ga0501070_0263901 | |||
| 3862 | Ga0501071_0001455 | |||
| 3863 | Ga0501071_0002907 | |||
| 3864 | Ga0501071_0003307 | |||
| 3865 | Ga0501071_0008605 | |||
| 3866 | Ga0501071_0009897 | |||
| 3867 | Ga0501071_0018889 | |||
| 3868 | Ga0501071_0075154 | |||
| 3869 | Ga0501071_0162036 | |||
| 3870 | Ga0501072_0000452 | |||
| 3871 | Ga0501072_0000456 | |||
| 3872 | Ga0501072_0001842 | |||
| 3873 | Ga0501072_0005756 | |||
| 3874 | Ga0501072_0008669 | |||
| 3875 | Ga0501072_0017657 | |||
| 3876 | Ga0501072_0092052 | |||
| 3877 | Ga0501072_0134057 | |||
| 3878 | Ga0501073_0002160 | |||
| 3879 | Ga0501073_0003916 | |||
| 3880 | Ga0501073_0008948 | |||
| 3881 | Ga0501073_0083303 | |||
| 3882 | Ga0501073_0093393 | |||
| 3883 | Ga0501073_0103888 | |||
| 3884 | Ga0501073_0115876 | |||
| 3885 | Ga0501073_0131878 | |||
| 3886 | Ga0501074_0000592 | |||
| 3887 | Ga0501074_0001226 | |||
| 3888 | Ga0501074_0001449 | |||
| 3889 | Ga0501074_0001504 | |||
| 3890 | Ga0501074_0001760 | |||
| 3891 | Ga0501074_0002346 | |||
| 3892 | Ga0501074_0010495 | |||
| 3893 | Ga0501074_0014772 | |||
| 3894 | Ga0501074_0027690 | |||
| 3895 | Ga0501074_0046308 | |||
| 3896 | Ga0501074_0081549 | |||
| 3897 | Ga0501074_0107580 | |||
| 3898 | Ga0501074_0122618 | |||
| 3899 | Ga0501074_0329696 | |||
| 3900 | Ga0501075_0002435 | |||
| 3901 | Ga0501075_0003534 | |||
| 3902 | Ga0501075_0006156 | |||
| 3903 | Ga0501075_0009381 | |||
| 3904 | Ga0501075_0025620 | |||
| 3905 | Ga0501075_0079735 | |||
| 3906 | Ga0501076_0000061 | |||
| 3907 | Ga0501076_0003089 | |||
| 3908 | Ga0501076_0005895 | |||
| 3909 | Ga0501076_0036881 | |||
| 3910 | Ga0501076_0055586 | |||
| 3911 | Ga0501076_0088735 | |||
| 3912 | Ga0501076_0325929 | |||
| 3913 | Ga0501077_0000349 | |||
| 3914 | Ga0501077_0018887 | |||
| 3915 | Ga0501077_0028205 | |||
| 3916 | Ga0501077_0108285 | |||
| 3917 | Ga0501079_0000088 | |||
| 3918 | Ga0501079_0000185 | |||
| 3919 | Ga0501079_0000787 | |||
| 3920 | Ga0501079_0003605 | |||
| 3921 | Ga0501079_0008202 | |||
| 3922 | Ga0501079_0015246 | |||
| 3923 | Ga0501079_0044068 | |||
| 3924 | Ga0501079_0048254 | |||
| 3925 | Ga0501079_0090727 | |||
| 3926 | Ga0501080_0000714 | |||
| 3927 | Ga0501080_0005622 | |||
| 3928 | Ga0501080_0014618 | |||
| 3929 | Ga0501080_0022775 | |||
| 3930 | Ga0501080_0033816 | |||
| 3931 | Ga0501080_0034394 | |||
| 3932 | Ga0501080_0035150 | |||
| 3933 | Ga0501080_0039087 | |||
| 3934 | Ga0501080_0050424 | |||
| 3935 | Ga0501080_0056786 | |||
| 3936 | Ga0501080_0130430 | |||
| 3937 | Ga0501080_0278916 | |||
| 3938 | Ga0501080_0285112 | |||
| 3939 | Ga0501081_0000808 | |||
| 3940 | Ga0501081_0001235 | |||
| 3941 | Ga0501081_0014905 | |||
| 3942 | Ga0501081_0025943 | |||
| 3943 | Ga0501083_0000096 | |||
| 3944 | Ga0501083_0006021 | |||
| 3945 | Ga0501083_0006066 | |||
| 3946 | Ga0501083_0009376 | |||
| 3947 | Ga0501083_0012445 | |||
| 3948 | Ga0501083_0049329 | |||
| 3949 | Ga0501083_0092031 | |||
| 3950 | Ga0501035_0007509 | |||
| 3951 | Ga0501035_0009862 | |||
| 3952 | Ga0501035_0021233 | |||
| 3953 | Ga0501035_0041946 | |||
| 3954 | Ga0501035_0054245 | |||
| 3955 | Ga0501035_0057970 | |||
| 3956 | Ga0501035_0059274 | |||
| 3957 | Ga0501035_0061025 | |||
| 3958 | Ga0501035_0068650 | |||
| 3959 | Ga0501035_0110052 | |||
| 3960 | Ga0501035_0122856 | |||
| 3961 | Ga0501035_0135499 | |||
| 3962 | Ga0501035_0157221 | |||
| 3963 | Ga0501035_0184080 | |||
| 3964 | Ga0501035_0275648 | |||
| 3965 | Ga0501044_0000191 | |||
| 3966 | Ga0501044_0000276 | |||
| 3967 | Ga0501044_0002167 | |||
| 3968 | Ga0501044_0003934 | |||
| 3969 | Ga0501044_0007350 | |||
| 3970 | Ga0501044_0021567 | |||
| 3971 | Ga0501044_0038842 | |||
| 3972 | Ga0501044_0079472 | |||
| 3973 | Ga0501044_0093090 | |||
| 3974 | Ga0501044_0097355 | |||
| 3975 | Ga0501044_0133618 | |||
| 3976 | Ga0501044_0136408 | |||
| 3977 | Ga0501044_0155813 | |||
| 3978 | Ga0501044_0156108 | |||
| 3979 | Ga0501044_0168415 | |||
| 3980 | Ga0501044_0214900 | |||
| 3981 | Ga0501044_0244745 | |||
| 3982 | Ga0501044_0304865 | |||
| 3983 | Ga0501045_0000044 | |||
| 3984 | Ga0501045_0000099 | |||
| 3985 | Ga0501045_0002750 | |||
| 3986 | Ga0501045_0003799 | |||
| 3987 | Ga0501045_0008315 | |||
| 3988 | Ga0501045_0013372 | |||
| 3989 | Ga0501045_0018652 | |||
| 3990 | Ga0501045_0023583 | |||
| 3991 | Ga0501045_0047497 | |||
| 3992 | Ga0501045_0061270 | |||
| 3993 | Ga0501045_0104273 | |||
| 3994 | Ga0501045_0191142 | |||
| 3995 | nmdc:mga03683_8047_c1 | |||
| 3996 | nmdc:mga03n38_113700_c1 | |||
| 3997 | nmdc:mga03n38_4316_c1 | |||
| 3998 | nmdc:mga00v17_51214_c1 | |||
| 3999 | nmdc:mga00v17_9992_c1 | |||
| 4000 | nmdc:mga0yw44_159042_c1 | |||
| 4001 | nmdc:mga0yw44_27194_c1 | |||
| 4002 | nmdc:mga0yw44_43386_c1 | |||
| 4003 | nmdc:mga0yw44_64051_c1 | |||
| 4004 | nmdc:mga0yw44_78387_c1 | |||
| 4005 | nmdc:mga0yw44_87740_c1 | |||
| 4006 | nmdc:mga06z11_13537_c1 | |||
| 4007 | nmdc:mga06z11_17805_c1 | |||
| 4008 | nmdc:mga06z11_51546_c1 | |||
| 4009 | nmdc:mga06z11_5961_c1 | |||
| 4010 | nmdc:mga04h51_10331_c1 | |||
| 4011 | nmdc:mga04h51_5221_c1 | |||
| 4012 | nmdc:mga07m45_107673_c1 | |||
| 4013 | nmdc:mga07m45_21523_c1 | |||
| 4014 | nmdc:mga05p37_1507_c1 | |||
| 4015 | nmdc:mga05p37_153_c1 | |||
| 4016 | nmdc:mga05p37_19739_c1 | |||
| 4017 | nmdc:mga05p37_2500_c1 | |||
| 4018 | nmdc:mga05p37_36897_c1 | |||
| 4019 | nmdc:mga05p37_389220_c1 | |||
| 4020 | nmdc:mga05p37_519_c1 | |||
| 4021 | nmdc:mga09592_1439_c1 | |||
| 4022 | nmdc:mga09592_40807_c1 | |||
| 4023 | nmdc:mga09592_4_c1 | |||
| 4024 | nmdc:mga09592_54533_c1 | |||
| 4025 | nmdc:mga09592_6157_c1 | |||
| 4026 | nmdc:mga0qj67_3_c2 | |||
| 4027 | nmdc:mga0qj67_61677_c1 | |||
| 4028 | nmdc:mga0qj67_6977_c1 | |||
| 4029 | nmdc:mga0qj67_79776_c1 | |||
| 4030 | nmdc:mga0qj67_9248_c1 | |||
| 4031 | nmdc:mga0qj67_97743_c1 | |||
| 4032 | nmdc:mga06r32_1153_c1 | |||
| 4033 | nmdc:mga06r32_20179_c1 | |||
| 4034 | nmdc:mga06r32_6093_c1 | |||
| 4035 | nmdc:mga06r32_6_c2 | |||
| 4036 | nmdc:mga06r32_7494_c1 | |||
| 4037 | nmdc:mga06r32_791_c1 | |||
| 4038 | nmdc:mga06r32_87415_c1 | |||
| 4039 | nmdc:mga08y16_10989_c1 | |||
| 4040 | nmdc:mga08y16_1109_c1 | |||
| 4041 | nmdc:mga08y16_15537_c1 | |||
| 4042 | nmdc:mga0n895_4859_c1 | |||
| 4043 | nmdc:mga0rr50_103852_c1 | |||
| 4044 | nmdc:mga0rr50_109975_c1 | |||
| 4045 | nmdc:mga0rr50_1591_c1 | |||
| 4046 | nmdc:mga0a205_1654_c1 | |||
| 4047 | nmdc:mga0a205_171897_c1 | |||
| 4048 | nmdc:mga0sz30_42436_c1 | |||
| 4049 | Ga0495601_0023913 | |||
| 4050 | Ga0495601_0031787 | |||
| 4051 | Ga0495601_0036267 | |||
| 4052 | Ga0495601_0082023 | |||
| 4053 | Ga0495601_0128056 | |||
| 4054 | Ga0495601_0181442 | |||
| 4055 | Ga0495612_0001858 | |||
| 4056 | Ga0495612_0007022 | |||
| 4057 | Ga0500610_0002713 | |||
| 4058 | Ga0495595_0002567 | |||
| 4059 | Ga0495595_0013276 | |||
| 4060 | Ga0495595_0093127 | |||
| 4061 | Ga0495619_0010545 | |||
| 4062 | Ga0495619_0018136 | |||
| 4063 | Ga0495619_0052583 | |||
| 4064 | Ga0495619_0069188 | |||
| 4065 | Ga0495619_0105163 | |||
| 4066 | Ga0495619_0111566 | |||
| 4067 | Ga0500643_000341 | |||
| 4068 | Ga0500643_000621 | |||
| 4069 | Ga0500644_0000003 | |||
| 4070 | Ga0500644_0014886 | |||
| 4071 | Ga0500644_0047278 | |||
| 4072 | Ga0500646_0000441 | |||
| 4073 | Ga0500583_0027610 | |||
| 4074 | Ga0500583_0092885 | |||
| 4075 | Ga0500566_0000073 | |||
| 4076 | Ga0500640_062360 | |||
| 4077 | Ga0500650_0001215 | |||
| 4078 | Ga0500650_0087862 | |||
| 4079 | Ga0500654_087111 | |||
| 4080 | Ga0500553_035850 | |||
| 4081 | Ga0500556_0000028 | |||
| 4082 | Ga0500556_0000394 | |||
| 4083 | Ga0500556_0001874 | |||
| 4084 | Ga0500560_021127 | |||
| 4085 | Ga0500562_000178 | |||
| 4086 | Ga0500580_065616 | |||
| 4087 | Ga0500593_000225 | |||
| 4088 | Ga0500652_001350 | |||
| 4089 | Ga0500655_006799 | |||
| 4090 | Ga0500559_0000648 | |||
| 4091 | Ga0500559_0032730 | |||
| 4092 | Ga0500561_0000434 | |||
| 4093 | Ga0500568_0000009 | |||
| 4094 | Ga0500568_0000043 | |||
| 4095 | Ga0500568_0000223 | |||
| 4096 | Ga0500568_0006232 | |||
| 4097 | Ga0500573_0006057 | |||
| 4098 | Ga0500573_0008740 | |||
| 4099 | Ga0500573_0073893 | |||
| 4100 | Ga0500573_0110950 | |||
| 4101 | Ga0500573_0159190 | |||
| 4102 | Ga0500577_0100319 | |||
| 4103 | Ga0500579_054963 | |||
| 4104 | Ga0500588_0000670 | |||
| 4105 | Ga0500616_0000027 | |||
| 4106 | Ga0500616_0000273 | |||
| 4107 | Ga0500616_0000570 | |||
| 4108 | Ga0500616_0006098 | |||
| 4109 | Ga0500616_0038349 | |||
| 4110 | Ga0500616_0056073 | |||
| 4111 | Ga0500620_006012 | |||
| 4112 | Ga0500624_012642 | |||
| 4113 | Ga0500636_0071097 | |||
| 4114 | Ga0501084_0000109 | |||
| 4115 | Ga0501084_0001023 | |||
| 4116 | Ga0501084_0002549 | |||
| 4117 | Ga0501084_0007261 | |||
| 4118 | Ga0501084_0008559 | |||
| 4119 | Ga0501084_0014163 | |||
| 4120 | Ga0501084_0023072 | |||
| 4121 | Ga0501084_0068395 | |||
| 4122 | Ga0501084_0107461 | |||
| 4123 | Ga0501084_0115212 | |||
| 4124 | Ga0501084_0148900 | |||
| 4125 | Ga0587090_009055 | |||
| 4126 | Ga0501082_0003253 | |||
| 4127 | Ga0501082_0027102 | |||
| 4128 | Ga0501082_0041255 | |||
| 4129 | Ga0501082_0072107 | |||
| 4130 | Ga0501082_0083044 | |||
| 4131 | Ga0466962_0000051 | |||
| 4132 | Ga0466962_0000057 | |||
| 4133 | Ga0466962_0010819 | |||
| 4134 | Ga0466962_0086439 | |||
| 4135 | Ga0530510_0000204 | |||
| 4136 | Ga0530510_0001129 | |||
| 4137 | Ga0530510_0007848 | |||
| 4138 | Ga0530510_0011566 | |||
| 4139 | Ga0530510_0016065 | |||
| 4140 | Ga0530510_0022473 | |||
| 4141 | 2501945014 | |||
| 4142 | 2506864793 | |||
| 4143 | 2508671422 | |||
| 4144 | 2515494075 | |||
| 4145 | 2515721370 | |||
| 4146 | 2515755882 | |||
| 4147 | 2516085498 | |||
| 4148 | 2516089785 | |||
| 4149 | 2517761769 | |||
| 4150 | 2528202174 | |||
| 4151 | 2528212776 | |||
| 4152 | 2537898918 | |||
| 4153 | 2546948574 | |||
| 4154 | 2547408133 | |||
| 4155 | 2554257852 | |||
| 4156 | 2555229487 | |||
| 4157 | 2579749817 | |||
| 4158 | 2579854928 | |||
| 4159 | 2585308805 | |||
| 4160 | 2585313508 | |||
| 4161 | 2587864081 | |||
| 4162 | 2616695052 | |||
| 4163 | 2616902174 | |||
| 4164 | 2619853120 | |||
| 4165 | 2620351088 | |||
| 4166 | 2623586326 | |||
| 4167 | 2626637206 | |||
| 4168 | 2643764940 | |||
| 4169 | 2643827418 | |||
| 4170 | 2643849056 | |||
| 4171 | 2643852419 | |||
| 4172 | 2643891900 | |||
| 4173 | 2643902616 | |||
| 4174 | 2643942199 | |||
| 4175 | 2643960952 | |||
| 4176 | 2643995246 | |||
| 4177 | 2644017180 | |||
| 4178 | 2644031966 | |||
| 4179 | 2644094016 | |||
| 4180 | 2644100367 | |||
| 4181 | 2644116774 | |||
| 4182 | 2644136942 | |||
| 4183 | 2644173859 | |||
| 4184 | 2644228551 | |||
| 4185 | 2644262289 | |||
| 4186 | 2644323859 | |||
| 4187 | 2644389865 | |||
| 4188 | 2644404876 | |||
| 4189 | 2644429282 | |||
| 4190 | 2644437176 | |||
| 4191 | 2644458294 | |||
| 4192 | 2644461220 | |||
| 4193 | 2644504884 | |||
| 4194 | 2644527204 | |||
| 4195 | 2644533755 | |||
| 4196 | 2644610265 | |||
| 4197 | 2644628915 | |||
| 4198 | 2644667753 | |||
| 4199 | 2645722438 | |||
| 4200 | 2645725411 | |||
| 4201 | 2655031501 | |||
| 4202 | 2671837652 | |||
| 4203 | 2676203036 | |||
| 4204 | 2676484158 | |||
| 4205 | 2686537920 | |||
| 4206 | 2686542989 | |||
| 4207 | 2689956382 | |||
| 4208 | 2710603307 | |||
| 4209 | 2740166019 | |||
| 4210 | 2753269546 | |||
| 4211 | 2768644748 | |||
| 4212 | 2772641467 | |||
| 4213 | 2774383792 | |||
| 4214 | 2774847612 | |||
| 4215 | 2774855808 | |||
| 4216 | 2774866300 | |||
| 4217 | 2774904883 | |||
| 4218 | 2775658508 | |||
| 4219 | 2784473033 | |||
| 4220 | 2784588586 | |||
| 4221 | 2785343281 | |||
| 4222 | 2785369515 | |||
| 4223 | 2786670619 | |||
| 4224 | 2793979713 | |||
| 4225 | 2804847037 | |||
| 4226 | 2808830052 | |||
| 4227 | 2808842074 | |||
| 4228 | 2808851227 | |||
| 4229 | 2808876248 | |||
| 4230 | 2808894302 | |||
| 4231 | 2808897751 | |||
| 4232 | 2808920592 | |||
| 4233 | 2809232198 | |||
| 4234 | 2810363130 | |||
| 4235 | 2811849064 | |||
| 4236 | 2812318173 | |||
| 4237 | 2812371666 | |||
| 4238 | 2812480508 | |||
| 4239 | 2816420874 | |||
| 4240 | 2819667227 | |||
| 4241 | 2819690559 | |||
| 4242 | 2819695391 | |||
| 4243 | 2819728129 | |||
| 4244 | 2819741161 | |||
| 4245 | 2827628670 | |||
| 4246 | 2831937257 | |||
| 4247 | 2832006611 | |||
| 4248 | 2837187328 | |||
| 4249 | 2837274720 | |||
| 4250 | 2839988783 | |||
| 4251 | 2844851726 | |||
| 4252 | 2848552212 | |||
| 4253 | 2852636654 | |||
| 4254 | 2852678749 | |||
| 4255 | 2855676551 | |||
| 4256 | 2855683399 | |||
| 4257 | 2855685128 | |||
| 4258 | 2856860171 | |||
| 4259 | 2857294985 | |||
| 4260 | 2857481202 | |||
| 4261 | 2857633465 | |||
| 4262 | 2857712944 | |||
| 4263 | 2857734272 | |||
| 4264 | 2857740854 | |||
| 4265 | 2858852149 | |||
| 4266 | 2858872875 | |||
| 4267 | 2858888335 | |||
| 4268 | 2858893250 | |||
| 4269 | 2858899093 | |||
| 4270 | 2858905417 | |||
| 4271 | 2862180154 | |||
| 4272 | 2862285674 | |||
| 4273 | 2862290636 | |||
| 4274 | 2862384445 | |||
| 4275 | 2862511796 | |||
| 4276 | 2862579238 | |||
| 4277 | 2862993449 | |||
| 4278 | 2863404590 | |||
| 4279 | 2866065722 | |||
| 4280 | 2867304186 | |||
| 4281 | 2867313513 | |||
| 4282 | 2867322665 | |||
| 4283 | 2867348799 | |||
| 4284 | 2867371911 | |||
| 4285 | 2867435889 | |||
| 4286 | 2867480596 | |||
| 4287 | 2867509187 | |||
| 4288 | 2868094032 | |||
| 4289 | 2869055292 | |||
| 4290 | 2869062571 | |||
| 4291 | 2869074566 | |||
| 4292 | 2870622451 | |||
| 4293 | 2870803312 | |||
| 4294 | 2870805355 | |||
| 4295 | 2873155713 | |||
| 4296 | 2875395764 | |||
| 4297 | 2877681096 | |||
| 4298 | 2880493979 | |||
| 4299 | 2880498361 | |||
| 4300 | 2884996753 | |||
| 4301 | 2887446937 | |||
| 4302 | 2887483645 | |||
| 4303 | 2891401264 | |||
| 4304 | 2895888156 | |||
| 4305 | 2904501535 | |||
| 4306 | 2904778167 | |||
| 4307 | 2905928653 | |||
| 4308 | 2910813480 | |||
| 4309 | 2912719939 | |||
| 4310 | 2912724331 | |||
| 4311 | 2912760801 | |||
| 4312 | 2918505620 | |||
| 4313 | 2919035543 | |||
| 4314 | 2919054615 | |||
| 4315 | 2919060213 | |||
| 4316 | 2919395334 | |||
| 4317 | 2919469497 | |||
| 4318 | 2919539239 | |||
| 4319 | 2920883334 | |||
| 4320 | 2929220391 | |||
| 4321 | 2929226946 | |||
| 4322 | 2932427827 | |||
| 4323 | 2932434482 | |||
| 4324 | 2933418599 | |||
| 4325 | 2935393401 | |||
| 4326 | 2935410757 | |||
| 4327 | 2939599352 | |||
| 4328 | 2939650273 | |||
| 4329 | 2939659169 | |||
| 4330 | 2939677693 | |||
| 4331 | 2945920274 | |||
| 4332 | 2945923865 | |||
| 4333 | 2945944473 | |||
| 4334 | 2945957335 | |||
| 4335 | 2945958695 | |||
| 4336 | 2946003365 | |||
| 4337 | 2946040391 | |||
| 4338 | 2946048858 | |||
| 4339 | 2946063991 | |||
| 4340 | 2946067751 | |||
| 4341 | 2946075930 | |||
| 4342 | 2947229215 | |||
| 4343 | 2954001656 | |||
| 4344 | 2954007394 | |||
| 4345 | 2954386225 | |||
| 4346 | 2954676941 | |||
| 4347 | 2954687217 | |||
| 4348 | 2954696863 | |||
| 4349 | 2954705273 | |||
| 4350 | 2954716236 | |||
| 4351 | 2954726178 | |||
| 4352 | 2954735632 | |||
| 4353 | 2954745104 | |||
| 4354 | 2954754487 | |||
| 4355 | 2954764077 | |||
| 4356 | 2964328617 | |||
| 4357 | 2966601630 | |||
| 4358 | 2974303822 | |||
| 4359 | 2984579265 | |||
| 4360 | 2990060746 | |||
| 4361 | 2990090532 | |||
| 4362 | 2990259842 | |||
| 4363 | 2996223380 | |||
| 4364 | 2997457816 | |||
| 4365 | 2997600395 | |||
| 4366 | 3001890363 | |||
| 4367 | 3006325033 | |||
| 4368 | 3006398368 | |||
| 4369 | 3006428717 | |||
| 4370 | 3006491969 | |||
| 4371 | 3006500775 | |||
| 4372 | 637877412 | |||
| 4373 | 649810872 | |||
| 4374 | 8001788181 | |||
| 4375 | 8002776324 | |||
| 4376 | 8002784515 | |||
| 4377 | 8003835786 | |||
| 4378 | 8003857612 | |||
| 4379 | 8003878195 | |||
| 4380 | 8004022429 | |||
| 4381 | 8008567283 | |||
| 4382 | 8008578873 | |||
| 4383 | 8023630165 | |||
| 4384 | 8025417710 | |||
| 4385 | 8025480347 | |||
| 4386 | 8025538022 | |||
| 4387 | 8045834438 | |||
| 4388 | 8047714256 | |||
| 4389 | 8047898090 | |||
| 4390 | 8048136806 | |||
| 4391 | 8048360803 | |||
| 4392 | 8048375053 | |||
| 4393 | 8048383153 | |||
| 4394 | 8048412732 | |||
| 4395 | 8054109716 | |||
| 4396 | 8054166059 | |||
| 4397 | 8054609836 | |||
| 4398 | 8054710070 | |||
| 4399 | 8054728285 | |||
| 4400 | 8054735324 | |||
| 4401 | 8054913814 | |||
| 4402 | 8054921054 | |||
| 4403 | 8055161321 | |||
| 4404 | 8055414138 | |||
| 4405 | 8056039218 | |||
| 4406 | 8056057885 | |||
| 4407 | 8056452984 | |||
| 4408 | 8056837710 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3vom-assembly1.cif.gz_B | structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis | 0.9886 | 5 | 374 |
| 2fyf-assembly1.cif.gz_B | structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis | 0.9871 | 5 | 374 |
| 3vom-assembly1.cif.gz_B | structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis | 0.986 | 5 | 374 |
| 2fyf-assembly1.cif.gz_B | structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis | 0.9818 | 5 | 374 |
| 3ffr-assembly1.cif.gz_A-2 | crystal structure of a phosphoserine aminotransferase serc (chu_0995) from cytophaga hutchinsonii atcc 33406 at 1.75 a resolution | 0.9178 | 15 | 369 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQ73_272_376_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 1.003 | 270 | 374 | 3.90.1150.10 |
| af_P9WQ73_272_376_3.90.1150.10 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9931 | 270 | 374 | 3.90.1150.10 |
| af_P9WQ73_31_269_3.20.10.10 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9874 | 28 | 266 | 3.20.10.10 |
| af_P9WQ73_31_269_3.20.10.10 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9751 | 28 | 266 | 3.20.10.10 |
| 3qm2B01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9117 | 270 | 373 | 3.90.1150.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0LQJ6-F1-model_v4 | Phosphoserine transaminase | 1.003 | 277 | 373 |
|
| AF-A0A6G3V8F1-F1-model_v4 | deleted | 0.9981 | 254 | 374 |
|
| AF-A0A3C1P2Y0-F1-model_v4 | Phosphoserine transaminase | 0.9977 | 276 | 373 |
|
| AF-A0A257NJ30-F1-model_v4 | Phosphoserine aminotransferase | 0.9963 | 175 | 374 |
GO:0004760
GO:0005777 GO:0008453 GO:0019265 |
| AF-A0A6J7BGE6-F1-model_v4 | Unannotated protein | 0.9958 | 266 | 374 |
|