F496572
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2229 | 741 | 4459 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300049743|Ga0501081_1435834|Ga0501081_1435834_84_389 |
| Length | 95 |
| Sequence | MRTPIGYFLVVSAMLFSIGTIGVLVRRNALIIFMSVELQLNAVNLALVAFSRMHGELNGQVLAFFSLVVAGLAIIVTVFRRRHSASVDDASVLRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 7 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 8 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 11 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 12 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 13 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 14 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 17 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 20 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 21 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 47 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 77 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 79 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 80 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 81 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 83 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 84 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 85 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 86 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 87 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 88 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 89 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 90 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 91 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 92 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 93 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 94 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 95 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 96 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 97 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 99 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 100 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 101 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 102 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 103 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 106 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 107 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 108 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 110 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 111 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 112 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 113 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 114 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 115 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 116 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 117 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 119 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 120 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 121 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 122 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 138 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Metagenome | Rhizosphere |
| 141 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 142 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 143 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 144 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 156 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 160 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 161 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 162 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 165 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 167 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 168 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 171 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 172 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 173 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 174 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 247 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 248 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 249 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 253 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 254 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 255 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 256 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 257 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 258 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 259 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 260 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 261 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 262 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 263 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 264 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 265 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 266 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 267 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 268 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 269 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 270 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 271 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 272 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 273 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 274 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 275 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 276 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 277 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 278 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 279 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 280 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 281 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 282 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 283 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 284 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 285 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 287 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 288 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 290 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 291 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 292 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 293 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 294 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 295 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 296 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 297 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 298 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 299 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 300 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 301 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 302 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 303 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 304 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 305 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 306 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 307 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 308 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 309 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 310 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 311 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 312 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 313 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 314 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 315 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 316 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 317 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 318 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 319 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 320 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 321 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 322 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 323 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 324 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 325 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 326 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 327 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 328 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 329 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 330 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 331 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 332 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 333 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 334 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 335 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 336 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 337 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 338 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 339 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 340 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 341 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 342 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 343 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 344 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 345 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 346 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 347 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 348 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 349 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 350 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 351 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 352 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 353 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 354 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 355 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 356 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 357 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 358 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 359 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 360 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 361 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 362 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 363 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 364 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 365 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 366 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 367 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 368 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 369 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 370 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 371 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 372 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 373 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 374 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 375 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 376 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 377 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 378 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 379 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 380 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 381 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 382 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 383 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 384 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 477 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 478 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 479 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 480 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 481 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 482 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 483 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 484 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 485 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 486 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 487 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 488 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 489 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 490 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 491 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 492 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 493 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 494 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 495 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 496 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 497 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 498 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 499 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 500 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 501 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 502 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 503 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 504 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 507 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 508 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 509 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 510 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 511 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 512 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 513 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 514 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 515 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 516 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 517 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 518 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 519 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 520 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 521 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 522 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 523 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 524 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 525 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 526 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 527 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 528 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 529 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 530 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 531 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 532 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 533 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 534 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 535 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 536 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 537 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 538 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 539 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 540 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 541 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 542 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 543 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 544 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 545 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 546 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 547 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 548 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 549 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 550 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 551 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 552 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 553 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 554 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 555 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 556 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 559 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 560 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 564 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 565 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 566 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 567 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 568 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 569 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 570 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 571 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 572 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 573 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 574 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 575 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 576 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 577 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 578 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 579 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 580 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 581 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 582 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 583 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 584 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 585 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 586 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 587 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 588 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 589 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 590 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 591 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 592 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 593 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 594 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 595 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 596 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 597 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 598 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 599 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 600 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 601 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 602 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 603 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 604 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 605 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 606 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 607 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 608 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 609 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 610 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 611 | 3300059628 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 612 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 613 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 614 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 615 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 616 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 617 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 618 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 619 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 620 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 621 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 622 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 623 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 624 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 625 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 626 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 627 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 628 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 629 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 630 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 631 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 632 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 633 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 634 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 635 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 636 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 637 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 638 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 639 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 640 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 641 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 642 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 643 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 644 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 645 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 646 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 647 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 648 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 649 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 650 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 651 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 652 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 653 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 654 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 655 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 656 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 657 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 658 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 659 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 660 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 661 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 662 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 663 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 664 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 665 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 666 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 667 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 668 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 669 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 670 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 671 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 672 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 673 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 674 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 675 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 676 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 677 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 678 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 679 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 680 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 681 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 682 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 683 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 684 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 685 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 686 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 687 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 688 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 689 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 690 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 691 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 692 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 693 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 694 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 695 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 696 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 697 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 698 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 699 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 700 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 701 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 702 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 703 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 704 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 705 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 706 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 707 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 708 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 709 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 710 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 711 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 712 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 713 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 714 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 715 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 716 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 717 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 718 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 719 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 720 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 721 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 722 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 723 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 724 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 725 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 726 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 727 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 728 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 729 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 730 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 731 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 732 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 733 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 734 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 735 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 736 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 737 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 738 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 739 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 740 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 741 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.27 |
| Metatranscriptomes | 1.03 |
| Isolates | 5.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.04 |
| Bulb | 0 |
| Endosphere | 12.25 |
| Nodule | 0.27 |
| Rhizoplane | 7.27 |
| Rhizosphere | 71.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501081_1435834 | 3300049743 | Bacteria | 524 |
| 2 | LJNas_1001325 | 3300000546 | Bacteria | 3615 |
| 3 | JGI24739J22299_10017756 | 3300001989 | Bacteria | 2564 |
| 4 | JGI24737J22298_10020298 | 3300001990 | Bacteria | 2121 |
| 5 | JGI24743J22301_10007900 | 3300001991 | Bacteria | 1856 |
| 6 | JGI24750J21931_1001262 | 3300002070 | Bacteria | 3204 |
| 7 | JGI24750J21931_1025756 | 3300002070 | Bacteria | 844 |
| 8 | JGI24745J21846_1004116 | 3300002073 | Bacteria | 1546 |
| 9 | JGI24748J21848_1003666 | 3300002074 | Bacteria | 1757 |
| 10 | JGI24738J21930_10004342 | 3300002075 | Bacteria | 3487 |
| 11 | JGI24749J21850_1003699 | 3300002076 | Bacteria | 2139 |
| 12 | JGI24744J21845_10000088 | 3300002077 | Bacteria | 11973 |
| 13 | JGI24744J21845_10002005 | 3300002077 | Bacteria | 4117 |
| 14 | JGI24744J21845_10002298 | 3300002077 | Bacteria | 3895 |
| 15 | JGI24034J26672_10035846 | 3300002239 | Bacteria | 821 |
| 16 | JGI24742J22300_10000958 | 3300002244 | Bacteria | 4421 |
| 17 | JGI24742J22300_10028088 | 3300002244 | Bacteria | 976 |
| 18 | JGI24751J29686_10037569 | 3300002459 | Bacteria | 1002 |
| 19 | JGI25153J46596_10083828 | 3300003215 | Bacteria | 787 |
| 20 | rootH1_10017056 | 3300003316 | Bacteria | 1229 |
| 21 | rootH1_10017056 | 3300003323 | Bacteria | 40617 |
| 22 | rootH2_10032831 | 3300003320 | Bacteria | 1759 |
| 23 | rootL2_10002375 | 3300003322 | Bacteria | 2847 |
| 24 | rootH1_10061150 | 3300003323 | Bacteria | 2895 |
| 25 | JGI25160J50197_1015644 | 3300003354 | Bacteria | 2482 |
| 26 | JGI25160J50197_1022123 | 3300003354 | Bacteria | 1871 |
| 27 | JGI25160J50197_1050490 | 3300003354 | Bacteria | 886 |
| 28 | JGI25160J50197_1096305 | 3300003354 | Bacteria | 531 |
| 29 | Ga0006562J51391_1101924 | 3300003578 | Bacteria | 1620 |
| 30 | Ga0055540_1000003 | 3300003792 | Bacteria | 428375 |
| 31 | Ga0055540_1003721 | 3300003792 | Bacteria | 7211 |
| 32 | Ga0055540_1005958 | 3300003792 | Bacteria | 4956 |
| 33 | Ga0055540_1006423 | 3300003792 | Bacteria | 4673 |
| 34 | Ga0055540_1012991 | 3300003792 | Bacteria | 2573 |
| 35 | Ga0055540_1060386 | 3300003792 | Bacteria | 759 |
| 36 | Ga0070658_10000319 | 3300005327 | Bacteria | 41203 |
| 37 | Ga0070658_10168973 | 3300005327 | Bacteria | 1837 |
| 38 | Ga0070658_11043273 | 3300005327 | Bacteria | 711 |
| 39 | Ga0070676_10005021 | 3300005328 | Bacteria | 7011 |
| 40 | Ga0070683_100255133 | 3300005329 | Bacteria | 1668 |
| 41 | Ga0070683_100544285 | 3300005329 | Bacteria | 1110 |
| 42 | Ga0070683_102219522 | 3300005329 | Bacteria | 527 |
| 43 | Ga0070690_100066359 | 3300005330 | Bacteria | 2336 |
| 44 | Ga0070690_100514413 | 3300005330 | Bacteria | 898 |
| 45 | Ga0070670_100341739 | 3300005331 | Bacteria | 1314 |
| 46 | Ga0070670_101463295 | 3300005331 | Bacteria | 627 |
| 47 | Ga0070677_10131461 | 3300005333 | Bacteria | 1143 |
| 48 | Ga0068869_100078270 | 3300005334 | Bacteria | 2462 |
| 49 | Ga0068869_102158052 | 3300005334 | Bacteria | 501 |
| 50 | Ga0070666_10114765 | 3300005335 | Bacteria | 1865 |
| 51 | Ga0070666_10206198 | 3300005335 | Bacteria | 1384 |
| 52 | Ga0070666_10589613 | 3300005335 | Bacteria | 811 |
| 53 | Ga0070680_100000061 | 3300005336 | Bacteria | 56357 |
| 54 | Ga0070680_100238798 | 3300005336 | Bacteria | 1536 |
| 55 | Ga0070680_101437996 | 3300005336 | Bacteria | 597 |
| 56 | Ga0070682_100071052 | 3300005337 | Bacteria | 2227 |
| 57 | Ga0070682_100286998 | 3300005337 | Bacteria | 1202 |
| 58 | Ga0070682_100841066 | 3300005337 | Bacteria | 749 |
| 59 | Ga0070682_101277581 | 3300005337 | Bacteria | 623 |
| 60 | Ga0070682_101512840 | 3300005337 | Bacteria | 577 |
| 61 | Ga0068868_100001480 | 3300005338 | Bacteria | 16204 |
| 62 | Ga0070660_100110954 | 3300005339 | Bacteria | 2182 |
| 63 | Ga0070660_100361827 | 3300005339 | Bacteria | 1196 |
| 64 | Ga0070689_100020932 | 3300005340 | Bacteria | 4862 |
| 65 | Ga0070689_100706067 | 3300005340 | Bacteria | 881 |
| 66 | Ga0070691_10002982 | 3300005341 | Bacteria | 7578 |
| 67 | Ga0070691_11041401 | 3300005341 | Bacteria | 513 |
| 68 | Ga0070687_100186584 | 3300005343 | Bacteria | 1246 |
| 69 | Ga0070687_100198977 | 3300005343 | Bacteria | 1213 |
| 70 | Ga0070661_100990318 | 3300005344 | Bacteria | 697 |
| 71 | Ga0070692_10095309 | 3300005345 | Bacteria | 1624 |
| 72 | Ga0070692_10401231 | 3300005345 | Bacteria | 866 |
| 73 | Ga0070668_100001192 | 3300005347 | Bacteria | 18433 |
| 74 | Ga0070668_100006438 | 3300005347 | Bacteria | 8708 |
| 75 | Ga0070668_100068621 | 3300005347 | Bacteria | 2756 |
| 76 | Ga0070668_101492986 | 3300005347 | Bacteria | 618 |
| 77 | Ga0070669_100004569 | 3300005353 | Bacteria | 9993 |
| 78 | Ga0070669_100099405 | 3300005353 | Bacteria | 2193 |
| 79 | Ga0070675_101430454 | 3300005354 | Bacteria | 637 |
| 80 | Ga0070671_100047031 | 3300005355 | Bacteria | 3589 |
| 81 | Ga0070674_100000187 | 3300005356 | Bacteria | 29321 |
| 82 | Ga0070674_100025474 | 3300005356 | Bacteria | 3851 |
| 83 | Ga0070674_100300932 | 3300005356 | Bacteria | 1279 |
| 84 | Ga0070674_100495203 | 3300005356 | Bacteria | 1017 |
| 85 | Ga0070673_100102120 | 3300005364 | Bacteria | 2364 |
| 86 | Ga0070688_101080451 | 3300005365 | Bacteria | 641 |
| 87 | Ga0070659_100018793 | 3300005366 | Bacteria | 5217 |
| 88 | Ga0070659_100026599 | 3300005366 | Bacteria | 4453 |
| 89 | Ga0070659_100436784 | 3300005366 | Bacteria | 1109 |
| 90 | Ga0070667_100000056 | 3300005367 | Bacteria | 150952 |
| 91 | Ga0070667_100000854 | 3300005367 | Bacteria | 28370 |
| 92 | Ga0070667_100003985 | 3300005367 | Bacteria | 12518 |
| 93 | Ga0070667_100025316 | 3300005367 | Bacteria | 4933 |
| 94 | Ga0070667_100221674 | 3300005367 | Bacteria | 1683 |
| 95 | Ga0070667_100591567 | 3300005367 | Bacteria | 1022 |
| 96 | Ga0070703_10053183 | 3300005406 | Bacteria | 1302 |
| 97 | Ga0070709_10032314 | 3300005434 | Bacteria | 3155 |
| 98 | Ga0070709_10130230 | 3300005434 | Bacteria | 1717 |
| 99 | Ga0070714_100016403 | 3300005435 | Bacteria | 5979 |
| 100 | Ga0070714_100065097 | 3300005435 | Bacteria | 3139 |
| 101 | Ga0070714_100252503 | 3300005435 | Bacteria | 1631 |
| 102 | Ga0070714_100348335 | 3300005435 | Bacteria | 1391 |
| 103 | Ga0070714_100451848 | 3300005435 | Bacteria | 1221 |
| 104 | Ga0070714_100863902 | 3300005435 | Bacteria | 878 |
| 105 | Ga0070714_101432416 | 3300005435 | Bacteria | 675 |
| 106 | Ga0070714_101507705 | 3300005435 | Bacteria | 657 |
| 107 | Ga0070713_100015655 | 3300005436 | Bacteria | 5680 |
| 108 | Ga0070713_100080518 | 3300005436 | Bacteria | 2777 |
| 109 | Ga0070713_100215794 | 3300005436 | Bacteria | 1739 |
| 110 | Ga0070713_100265185 | 3300005436 | Bacteria | 1571 |
| 111 | Ga0070713_100361968 | 3300005436 | Bacteria | 1348 |
| 112 | Ga0070713_100629163 | 3300005436 | Bacteria | 1021 |
| 113 | Ga0070710_10000277 | 3300005437 | Bacteria | 24255 |
| 114 | Ga0070710_10044347 | 3300005437 | Bacteria | 2467 |
| 115 | Ga0070710_10168660 | 3300005437 | Bacteria | 1362 |
| 116 | Ga0070710_10370702 | 3300005437 | Bacteria | 953 |
| 117 | Ga0070701_10034333 | 3300005438 | Bacteria | 2540 |
| 118 | Ga0070711_100000493 | 3300005439 | Bacteria | 20558 |
| 119 | Ga0070711_100029466 | 3300005439 | Bacteria | 3622 |
| 120 | Ga0070711_100253283 | 3300005439 | Bacteria | 1382 |
| 121 | Ga0070711_100885304 | 3300005439 | Bacteria | 761 |
| 122 | Ga0070705_100200449 | 3300005440 | Bacteria | 1368 |
| 123 | Ga0070705_100263554 | 3300005440 | Bacteria | 1217 |
| 124 | Ga0070700_100289210 | 3300005441 | Bacteria | 1191 |
| 125 | Ga0070694_100008280 | 3300005444 | Bacteria | 6359 |
| 126 | Ga0070694_100118065 | 3300005444 | Bacteria | 1899 |
| 127 | Ga0070708_100297322 | 3300005445 | Bacteria | 1520 |
| 128 | Ga0070663_100042981 | 3300005455 | Bacteria | 3178 |
| 129 | Ga0070663_100362811 | 3300005455 | Bacteria | 1176 |
| 130 | Ga0070663_100429842 | 3300005455 | Bacteria | 1085 |
| 131 | Ga0070663_101210567 | 3300005455 | Bacteria | 664 |
| 132 | Ga0070663_101289937 | 3300005455 | Bacteria | 644 |
| 133 | Ga0070678_100000280 | 3300005456 | Bacteria | 23679 |
| 134 | Ga0070678_100247043 | 3300005456 | Bacteria | 1495 |
| 135 | Ga0070678_100300022 | 3300005456 | Bacteria | 1365 |
| 136 | Ga0070678_100982985 | 3300005456 | Bacteria | 775 |
| 137 | Ga0070678_101874325 | 3300005456 | Bacteria | 566 |
| 138 | Ga0070662_100001491 | 3300005457 | Bacteria | 14399 |
| 139 | Ga0070662_101359820 | 3300005457 | Bacteria | 611 |
| 140 | Ga0070681_10001025 | 3300005458 | Bacteria | 23693 |
| 141 | Ga0070681_10754339 | 3300005458 | Bacteria | 890 |
| 142 | Ga0070681_11539087 | 3300005458 | Bacteria | 590 |
| 143 | Ga0068867_100002048 | 3300005459 | Bacteria | 14123 |
| 144 | Ga0070685_10119192 | 3300005466 | Bacteria | 1637 |
| 145 | Ga0070685_10148015 | 3300005466 | Bacteria | 1485 |
| 146 | Ga0070685_10838994 | 3300005466 | Bacteria | 680 |
| 147 | Ga0070679_100001551 | 3300005530 | Bacteria | 20538 |
| 148 | Ga0070684_100169163 | 3300005535 | Bacteria | 1985 |
| 149 | Ga0070697_100880770 | 3300005536 | Bacteria | 794 |
| 150 | Ga0068853_100001367 | 3300005539 | Bacteria | 17604 |
| 151 | Ga0068853_100084260 | 3300005539 | Bacteria | 2785 |
| 152 | Ga0068853_100142792 | 3300005539 | Bacteria | 2150 |
| 153 | Ga0068853_100570000 | 3300005539 | Bacteria | 1074 |
| 154 | Ga0068853_101643301 | 3300005539 | Bacteria | 623 |
| 155 | Ga0070672_100249143 | 3300005543 | Bacteria | 1496 |
| 156 | Ga0070672_100569437 | 3300005543 | Bacteria | 985 |
| 157 | Ga0070695_100008891 | 3300005545 | Bacteria | 5966 |
| 158 | Ga0070695_100267175 | 3300005545 | Bacteria | 1252 |
| 159 | Ga0070696_100002977 | 3300005546 | Bacteria | 11251 |
| 160 | Ga0070696_100854901 | 3300005546 | Bacteria | 752 |
| 161 | Ga0070693_100021947 | 3300005547 | Bacteria | 3389 |
| 162 | Ga0070693_100098763 | 3300005547 | Bacteria | 1775 |
| 163 | Ga0070693_100531666 | 3300005547 | Bacteria | 839 |
| 164 | Ga0070693_101023388 | 3300005547 | Bacteria | 626 |
| 165 | Ga0070665_100011296 | 3300005548 | Bacteria | 9031 |
| 166 | Ga0070665_100039320 | 3300005548 | Bacteria | 4756 |
| 167 | Ga0070665_100083036 | 3300005548 | Bacteria | 3209 |
| 168 | Ga0070665_100230350 | 3300005548 | Bacteria | 1853 |
| 169 | Ga0070665_100316153 | 3300005548 | Bacteria | 1566 |
| 170 | Ga0070665_100825882 | 3300005548 | Bacteria | 940 |
| 171 | Ga0070665_101327790 | 3300005548 | Bacteria | 729 |
| 172 | Ga0070665_102564412 | 3300005548 | Bacteria | 511 |
| 173 | Ga0070704_100001052 | 3300005549 | Bacteria | 14260 |
| 174 | Ga0070704_100019306 | 3300005549 | Bacteria | 4378 |
| 175 | Ga0070704_100819551 | 3300005549 | Bacteria | 833 |
| 176 | Ga0068855_100244028 | 3300005563 | Bacteria | 2006 |
| 177 | Ga0068855_100417642 | 3300005563 | Bacteria | 1468 |
| 178 | Ga0068855_100590408 | 3300005563 | Bacteria | 1199 |
| 179 | Ga0068855_100596191 | 3300005563 | Bacteria | 1192 |
| 180 | Ga0068855_100745022 | 3300005563 | Bacteria | 1045 |
| 181 | Ga0068855_101397090 | 3300005563 | Bacteria | 722 |
| 182 | Ga0068855_102602693 | 3300005563 | Bacteria | 502 |
| 183 | Ga0070664_101013283 | 3300005564 | Bacteria | 781 |
| 184 | Ga0068857_100597961 | 3300005577 | Bacteria | 1043 |
| 185 | Ga0068854_100000458 | 3300005578 | Bacteria | 25182 |
| 186 | Ga0068854_100020918 | 3300005578 | Bacteria | 4433 |
| 187 | Ga0068854_100252151 | 3300005578 | Bacteria | 1410 |
| 188 | Ga0068856_100203470 | 3300005614 | Bacteria | 1994 |
| 189 | Ga0070702_100000308 | 3300005615 | Bacteria | 16864 |
| 190 | Ga0070702_100148986 | 3300005615 | Bacteria | 1499 |
| 191 | Ga0070702_100956426 | 3300005615 | Bacteria | 675 |
| 192 | Ga0068852_100063059 | 3300005616 | Bacteria | 3226 |
| 193 | Ga0068852_100154194 | 3300005616 | Bacteria | 2138 |
| 194 | Ga0068852_101270523 | 3300005616 | Bacteria | 758 |
| 195 | Ga0068852_101980594 | 3300005616 | Bacteria | 605 |
| 196 | Ga0068859_100000751 | 3300005617 | Bacteria | 32654 |
| 197 | Ga0068859_100039348 | 3300005617 | Bacteria | 4743 |
| 198 | Ga0068859_100206485 | 3300005617 | Bacteria | 2050 |
| 199 | Ga0068864_100132511 | 3300005618 | Bacteria | 2241 |
| 200 | Ga0068864_100468211 | 3300005618 | Bacteria | 1208 |
| 201 | Ga0068864_101863702 | 3300005618 | Bacteria | 607 |
| 202 | Ga0068864_102197808 | 3300005618 | Bacteria | 558 |
| 203 | Ga0068866_10000187 | 3300005718 | Bacteria | 29090 |
| 204 | Ga0068866_10029932 | 3300005718 | Bacteria | 2608 |
| 205 | Ga0068866_10533620 | 3300005718 | Bacteria | 782 |
| 206 | Ga0068866_11223904 | 3300005718 | Bacteria | 543 |
| 207 | Ga0068861_100000195 | 3300005719 | Bacteria | 32550 |
| 208 | Ga0068861_100225745 | 3300005719 | Bacteria | 1585 |
| 209 | Ga0068861_101604859 | 3300005719 | Bacteria | 641 |
| 210 | Ga0068851_10393066 | 3300005834 | Bacteria | 815 |
| 211 | Ga0068870_10747542 | 3300005840 | Bacteria | 679 |
| 212 | Ga0068863_100018953 | 3300005841 | Bacteria | 6585 |
| 213 | Ga0068863_100081670 | 3300005841 | Bacteria | 3062 |
| 214 | Ga0068863_100128462 | 3300005841 | Bacteria | 2419 |
| 215 | Ga0068863_100207411 | 3300005841 | Bacteria | 1886 |
| 216 | Ga0068863_101773287 | 3300005841 | Bacteria | 627 |
| 217 | Ga0068858_100006827 | 3300005842 | Bacteria | 11104 |
| 218 | Ga0068858_100015158 | 3300005842 | Bacteria | 7250 |
| 219 | Ga0068858_100106856 | 3300005842 | Bacteria | 2612 |
| 220 | Ga0068858_100269146 | 3300005842 | Bacteria | 1621 |
| 221 | Ga0068858_100447887 | 3300005842 | Bacteria | 1244 |
| 222 | Ga0068858_100999124 | 3300005842 | Bacteria | 820 |
| 223 | Ga0068858_101387952 | 3300005842 | Bacteria | 692 |
| 224 | Ga0068858_102180194 | 3300005842 | Bacteria | 548 |
| 225 | Ga0068860_100000092 | 3300005843 | Bacteria | 150190 |
| 226 | Ga0068860_100001932 | 3300005843 | Bacteria | 21940 |
| 227 | Ga0068860_100157374 | 3300005843 | Bacteria | 2190 |
| 228 | Ga0068862_100000035 | 3300005844 | Bacteria | 174953 |
| 229 | Ga0068862_100006561 | 3300005844 | Bacteria | 9653 |
| 230 | Ga0068862_100074824 | 3300005844 | Bacteria | 2928 |
| 231 | Ga0068862_101578887 | 3300005844 | Bacteria | 663 |
| 232 | Ga0081455_10024172 | 3300005937 | Bacteria | 5635 |
| 233 | Ga0081455_10031920 | 3300005937 | Bacteria | 4755 |
| 234 | Ga0081455_10034690 | 3300005937 | Bacteria | 4517 |
| 235 | Ga0081455_10091239 | 3300005937 | Bacteria | 2468 |
| 236 | Ga0081455_10192807 | 3300005937 | Bacteria | 1533 |
| 237 | Ga0081455_10273175 | 3300005937 | Bacteria | 1225 |
| 238 | Ga0081538_10136302 | 3300005981 | Bacteria | 1142 |
| 239 | Ga0081540_1047146 | 3300005983 | Bacteria | 2169 |
| 240 | Ga0081539_10045318 | 3300005985 | Bacteria | 2530 |
| 241 | Ga0081539_10050996 | 3300005985 | Bacteria | 2336 |
| 242 | Ga0070717_10212312 | 3300006028 | Bacteria | 1699 |
| 243 | Ga0070717_10384114 | 3300006028 | Bacteria | 1259 |
| 244 | Ga0075365_10004705 | 3300006038 | Bacteria | 7278 |
| 245 | Ga0075365_10019404 | 3300006038 | Bacteria | 4196 |
| 246 | Ga0075365_10024575 | 3300006038 | Bacteria | 3802 |
| 247 | Ga0075365_10082992 | 3300006038 | Bacteria | 2174 |
| 248 | Ga0075365_10197265 | 3300006038 | Bacteria | 1410 |
| 249 | Ga0075365_10292279 | 3300006038 | Bacteria | 1146 |
| 250 | Ga0075365_10470498 | 3300006038 | Bacteria | 888 |
| 251 | Ga0075365_10635542 | 3300006038 | Bacteria | 754 |
| 252 | Ga0075365_10963222 | 3300006038 | Bacteria | 601 |
| 253 | Ga0075365_11198904 | 3300006038 | Bacteria | 534 |
| 254 | Ga0075368_10007123 | 3300006042 | Bacteria | 3937 |
| 255 | Ga0075368_10251780 | 3300006042 | Bacteria | 755 |
| 256 | Ga0075368_10293280 | 3300006042 | Bacteria | 701 |
| 257 | Ga0075368_10480886 | 3300006042 | Bacteria | 553 |
| 258 | Ga0075363_100000383 | 3300006048 | Bacteria | 13424 |
| 259 | Ga0075363_100000613 | 3300006048 | Bacteria | 11798 |
| 260 | Ga0075363_100002816 | 3300006048 | Bacteria | 7228 |
| 261 | Ga0075363_100012126 | 3300006048 | Bacteria | 4146 |
| 262 | Ga0075363_100026851 | 3300006048 | Bacteria | 2949 |
| 263 | Ga0075363_100032534 | 3300006048 | Bacteria | 2710 |
| 264 | Ga0075363_100076456 | 3300006048 | Bacteria | 1825 |
| 265 | Ga0075363_100099522 | 3300006048 | Bacteria | 1608 |
| 266 | Ga0075363_100135422 | 3300006048 | Bacteria | 1384 |
| 267 | Ga0075363_100190303 | 3300006048 | Bacteria | 1170 |
| 268 | Ga0075363_100213308 | 3300006048 | Bacteria | 1105 |
| 269 | Ga0075363_100274408 | 3300006048 | Bacteria | 974 |
| 270 | Ga0075363_100279189 | 3300006048 | Bacteria | 966 |
| 271 | Ga0075363_100292455 | 3300006048 | Bacteria | 944 |
| 272 | Ga0075363_100299583 | 3300006048 | Bacteria | 933 |
| 273 | Ga0075363_100328371 | 3300006048 | Bacteria | 891 |
| 274 | Ga0075363_100472321 | 3300006048 | Bacteria | 743 |
| 275 | Ga0075364_10003028 | 3300006051 | Bacteria | 9494 |
| 276 | Ga0075364_10035907 | 3300006051 | Bacteria | 3203 |
| 277 | Ga0075364_10043671 | 3300006051 | Bacteria | 2914 |
| 278 | Ga0075364_10044294 | 3300006051 | Bacteria | 2894 |
| 279 | Ga0075364_10066923 | 3300006051 | Bacteria | 2361 |
| 280 | Ga0075364_10092827 | 3300006051 | Bacteria | 2004 |
| 281 | Ga0075364_10132230 | 3300006051 | Bacteria | 1675 |
| 282 | Ga0075364_10134790 | 3300006051 | Bacteria | 1659 |
| 283 | Ga0075364_10143695 | 3300006051 | Bacteria | 1606 |
| 284 | Ga0075364_10199940 | 3300006051 | Bacteria | 1354 |
| 285 | Ga0075364_10266749 | 3300006051 | Bacteria | 1164 |
| 286 | Ga0075364_10433398 | 3300006051 | Bacteria | 898 |
| 287 | Ga0075364_10626454 | 3300006051 | Bacteria | 735 |
| 288 | Ga0075364_10628202 | 3300006051 | Bacteria | 734 |
| 289 | Ga0075364_10682480 | 3300006051 | Bacteria | 701 |
| 290 | Ga0075364_10869353 | 3300006051 | Bacteria | 614 |
| 291 | Ga0075364_10946726 | 3300006051 | Bacteria | 586 |
| 292 | Ga0075364_11009446 | 3300006051 | Bacteria | 566 |
| 293 | Ga0070715_10053904 | 3300006163 | Bacteria | 1740 |
| 294 | Ga0070715_10071980 | 3300006163 | Bacteria | 1547 |
| 295 | Ga0070716_100024573 | 3300006173 | Bacteria | 3208 |
| 296 | Ga0070716_100639733 | 3300006173 | Bacteria | 805 |
| 297 | Ga0070712_100001061 | 3300006175 | Bacteria | 16610 |
| 298 | Ga0070712_100005282 | 3300006175 | Bacteria | 7992 |
| 299 | Ga0075362_10015901 | 3300006177 | Bacteria | 3070 |
| 300 | Ga0075362_10072661 | 3300006177 | Bacteria | 1574 |
| 301 | Ga0075362_10083764 | 3300006177 | Bacteria | 1472 |
| 302 | Ga0075362_10126789 | 3300006177 | Bacteria | 1211 |
| 303 | Ga0075362_10289765 | 3300006177 | Bacteria | 811 |
| 304 | Ga0075362_10352118 | 3300006177 | Bacteria | 737 |
| 305 | Ga0075367_10002885 | 3300006178 | Bacteria | 8000 |
| 306 | Ga0075367_10042461 | 3300006178 | Bacteria | 2661 |
| 307 | Ga0075367_10186612 | 3300006178 | Bacteria | 1293 |
| 308 | Ga0075367_10233147 | 3300006178 | Bacteria | 1153 |
| 309 | Ga0075367_10260938 | 3300006178 | Bacteria | 1088 |
| 310 | Ga0075367_10399203 | 3300006178 | Bacteria | 869 |
| 311 | Ga0075367_10546065 | 3300006178 | Bacteria | 736 |
| 312 | Ga0075367_10559833 | 3300006178 | Bacteria | 726 |
| 313 | Ga0075369_10001505 | 3300006186 | Bacteria | 7959 |
| 314 | Ga0075369_10018446 | 3300006186 | Bacteria | 2841 |
| 315 | Ga0075369_10021403 | 3300006186 | Bacteria | 2658 |
| 316 | Ga0075369_10026182 | 3300006186 | Bacteria | 2430 |
| 317 | Ga0075369_10061574 | 3300006186 | Bacteria | 1638 |
| 318 | Ga0075369_10105102 | 3300006186 | Bacteria | 1269 |
| 319 | Ga0075369_10118627 | 3300006186 | Bacteria | 1196 |
| 320 | Ga0075369_10154077 | 3300006186 | Bacteria | 1051 |
| 321 | Ga0075369_10200650 | 3300006186 | Bacteria | 920 |
| 322 | Ga0075369_10271899 | 3300006186 | Bacteria | 788 |
| 323 | Ga0097621_100132479 | 3300006237 | Bacteria | 2123 |
| 324 | Ga0097621_100392623 | 3300006237 | Bacteria | 1241 |
| 325 | Ga0097621_100494859 | 3300006237 | Bacteria | 1107 |
| 326 | Ga0075370_10001408 | 3300006353 | Bacteria | 10397 |
| 327 | Ga0075370_10001448 | 3300006353 | Bacteria | 10304 |
| 328 | Ga0075370_10008954 | 3300006353 | Bacteria | 5174 |
| 329 | Ga0075370_10097924 | 3300006353 | Bacteria | 1696 |
| 330 | Ga0075370_10104498 | 3300006353 | Bacteria | 1641 |
| 331 | Ga0075370_10186332 | 3300006353 | Bacteria | 1222 |
| 332 | Ga0075370_10257482 | 3300006353 | Bacteria | 1035 |
| 333 | Ga0075370_10398205 | 3300006353 | Bacteria | 826 |
| 334 | Ga0075370_10620621 | 3300006353 | Bacteria | 655 |
| 335 | Ga0075370_10648252 | 3300006353 | Bacteria | 641 |
| 336 | Ga0075370_10664947 | 3300006353 | Bacteria | 632 |
| 337 | Ga0068871_100174821 | 3300006358 | Bacteria | 1843 |
| 338 | Ga0075428_100015023 | 3300006844 | Bacteria | 8601 |
| 339 | Ga0075430_100259087 | 3300006846 | Bacteria | 1441 |
| 340 | Ga0075431_101575367 | 3300006847 | Bacteria | 615 |
| 341 | Ga0075433_10984058 | 3300006852 | Bacteria | 735 |
| 342 | Ga0075433_11130050 | 3300006852 | Bacteria | 681 |
| 343 | Ga0075433_11760735 | 3300006852 | Bacteria | 533 |
| 344 | Ga0075429_100558479 | 3300006880 | Bacteria | 1003 |
| 345 | Ga0068865_100001276 | 3300006881 | Bacteria | 14662 |
| 346 | Ga0068865_100032758 | 3300006881 | Bacteria | 3475 |
| 347 | Ga0068865_100630967 | 3300006881 | Bacteria | 909 |
| 348 | Ga0097620_100000751 | 3300006931 | Bacteria | 32654 |
| 349 | Ga0097620_100039348 | 3300006931 | Bacteria | 4743 |
| 350 | Ga0097620_100206491 | 3300006931 | Bacteria | 2050 |
| 351 | Ga0099826_10257458 | 3300006948 | Bacteria | 915 |
| 352 | Ga0075435_100931273 | 3300007076 | Bacteria | 758 |
| 353 | Ga0099794_10681931 | 3300007265 | Bacteria | 547 |
| 354 | Ga0099795_10038450 | 3300007788 | Bacteria | 1689 |
| 355 | Ga0105251_10120384 | 3300009011 | Bacteria | 1192 |
| 356 | Ga0105244_10181460 | 3300009036 | Bacteria | 998 |
| 357 | Ga0105250_10016382 | 3300009092 | Bacteria | 3021 |
| 358 | Ga0105250_10034275 | 3300009092 | Bacteria | 2037 |
| 359 | Ga0105250_10170611 | 3300009092 | Bacteria | 911 |
| 360 | Ga0105240_10619898 | 3300009093 | Bacteria | 1189 |
| 361 | Ga0105240_10956301 | 3300009093 | Bacteria | 918 |
| 362 | Ga0111539_10409140 | 3300009094 | Bacteria | 1580 |
| 363 | Ga0111539_10828184 | 3300009094 | Bacteria | 1077 |
| 364 | Ga0111539_11548544 | 3300009094 | Bacteria | 769 |
| 365 | Ga0105245_10000870 | 3300009098 | Bacteria | 27352 |
| 366 | Ga0105245_10152899 | 3300009098 | Bacteria | 2183 |
| 367 | Ga0105245_10166509 | 3300009098 | Bacteria | 2095 |
| 368 | Ga0105245_10370949 | 3300009098 | Bacteria | 1423 |
| 369 | Ga0105245_10476371 | 3300009098 | Bacteria | 1261 |
| 370 | Ga0105245_10881421 | 3300009098 | Bacteria | 936 |
| 371 | Ga0105245_11742491 | 3300009098 | Bacteria | 675 |
| 372 | Ga0105247_10000062 | 3300009101 | Bacteria | 126437 |
| 373 | Ga0105247_10000637 | 3300009101 | Bacteria | 28051 |
| 374 | Ga0105247_10021071 | 3300009101 | Bacteria | 3921 |
| 375 | Ga0105247_10075913 | 3300009101 | Bacteria | 2110 |
| 376 | Ga0105247_10140167 | 3300009101 | Bacteria | 1584 |
| 377 | Ga0105247_10250979 | 3300009101 | Bacteria | 1209 |
| 378 | Ga0105247_10761866 | 3300009101 | Bacteria | 735 |
| 379 | Ga0114129_10093305 | 3300009147 | Bacteria | 4170 |
| 380 | Ga0114129_10148224 | 3300009147 | Bacteria | 3213 |
| 381 | Ga0114129_10265638 | 3300009147 | Bacteria | 2298 |
| 382 | Ga0105243_10001020 | 3300009148 | Bacteria | 25871 |
| 383 | Ga0105243_10074007 | 3300009148 | Bacteria | 2762 |
| 384 | Ga0105243_10190530 | 3300009148 | Bacteria | 1791 |
| 385 | Ga0105243_10283666 | 3300009148 | Bacteria | 1493 |
| 386 | Ga0105243_10509827 | 3300009148 | Bacteria | 1142 |
| 387 | Ga0105243_11285122 | 3300009148 | Bacteria | 748 |
| 388 | Ga0105243_11528518 | 3300009148 | Bacteria | 692 |
| 389 | Ga0105243_12183366 | 3300009148 | Bacteria | 590 |
| 390 | Ga0105241_10062601 | 3300009174 | Bacteria | 2869 |
| 391 | Ga0105241_10183888 | 3300009174 | Bacteria | 1735 |
| 392 | Ga0105241_10806709 | 3300009174 | Bacteria | 865 |
| 393 | Ga0105241_11212921 | 3300009174 | Bacteria | 715 |
| 394 | Ga0105241_12287648 | 3300009174 | Bacteria | 538 |
| 395 | Ga0105242_10000650 | 3300009176 | Bacteria | 27213 |
| 396 | Ga0105242_10130986 | 3300009176 | Bacteria | 2165 |
| 397 | Ga0105242_11181071 | 3300009176 | Bacteria | 783 |
| 398 | Ga0105242_11542909 | 3300009176 | Bacteria | 696 |
| 399 | Ga0105242_12699092 | 3300009176 | Bacteria | 546 |
| 400 | Ga0105242_12935617 | 3300009176 | Bacteria | 527 |
| 401 | Ga0105248_10000036 | 3300009177 | Bacteria | 187421 |
| 402 | Ga0105248_10003895 | 3300009177 | Bacteria | 16497 |
| 403 | Ga0105248_10014411 | 3300009177 | Bacteria | 8702 |
| 404 | Ga0105248_10047963 | 3300009177 | Bacteria | 4790 |
| 405 | Ga0105248_10115569 | 3300009177 | Bacteria | 3026 |
| 406 | Ga0105248_10151489 | 3300009177 | Bacteria | 2616 |
| 407 | Ga0105248_10785375 | 3300009177 | Bacteria | 1075 |
| 408 | Ga0105248_10838239 | 3300009177 | Bacteria | 1038 |
| 409 | Ga0105248_12344186 | 3300009177 | Bacteria | 608 |
| 410 | Ga0105237_10000467 | 3300009545 | Bacteria | 57237 |
| 411 | Ga0105237_10034141 | 3300009545 | Bacteria | 5152 |
| 412 | Ga0105237_10052349 | 3300009545 | Bacteria | 4098 |
| 413 | Ga0105237_10209041 | 3300009545 | Bacteria | 1952 |
| 414 | Ga0105237_10350429 | 3300009545 | Bacteria | 1481 |
| 415 | Ga0105237_11745850 | 3300009545 | Bacteria | 630 |
| 416 | Ga0105237_11890974 | 3300009545 | Bacteria | 605 |
| 417 | Ga0105238_10088868 | 3300009551 | Bacteria | 3076 |
| 418 | Ga0105238_10131894 | 3300009551 | Bacteria | 2477 |
| 419 | Ga0105238_10152187 | 3300009551 | Bacteria | 2288 |
| 420 | Ga0105238_10325317 | 3300009551 | Bacteria | 1524 |
| 421 | Ga0105238_10956875 | 3300009551 | Bacteria | 876 |
| 422 | Ga0105238_12044567 | 3300009551 | Bacteria | 607 |
| 423 | Ga0105238_12554437 | 3300009551 | Bacteria | 547 |
| 424 | Ga0105238_12633302 | 3300009551 | Bacteria | 539 |
| 425 | Ga0105249_10000046 | 3300009553 | Bacteria | 176363 |
| 426 | Ga0105249_10001186 | 3300009553 | Bacteria | 23057 |
| 427 | Ga0105249_10005021 | 3300009553 | Bacteria | 11409 |
| 428 | Ga0105249_10734696 | 3300009553 | Bacteria | 1049 |
| 429 | Ga0105249_11016856 | 3300009553 | Bacteria | 898 |
| 430 | Ga0105249_11037881 | 3300009553 | Bacteria | 889 |
| 431 | Ga0105249_11389858 | 3300009553 | Bacteria | 774 |
| 432 | Ga0105249_11852390 | 3300009553 | Bacteria | 676 |
| 433 | Ga0099796_10045462 | 3300010159 | Bacteria | 1504 |
| 434 | Ga0105239_10003093 | 3300010375 | Bacteria | 20661 |
| 435 | Ga0105239_10028730 | 3300010375 | Bacteria | 6114 |
| 436 | Ga0105239_10061068 | 3300010375 | Bacteria | 4137 |
| 437 | Ga0105239_10241758 | 3300010375 | Bacteria | 2026 |
| 438 | Ga0105239_10403057 | 3300010375 | Bacteria | 1548 |
| 439 | Ga0105239_10594153 | 3300010375 | Bacteria | 1262 |
| 440 | Ga0105239_10893469 | 3300010375 | Bacteria | 1020 |
| 441 | Ga0105239_11093110 | 3300010375 | Bacteria | 918 |
| 442 | Ga0105239_11896191 | 3300010375 | Bacteria | 691 |
| 443 | Ga0105239_12608396 | 3300010375 | Bacteria | 589 |
| 444 | Ga0105239_12861131 | 3300010375 | Bacteria | 563 |
| 445 | Ga0105239_12978285 | 3300010375 | Bacteria | 552 |
| 446 | Ga0105239_13365063 | 3300010375 | Bacteria | 520 |
| 447 | Ga0105246_10034380 | 3300011119 | Bacteria | 3377 |
| 448 | Ga0105246_10063318 | 3300011119 | Bacteria | 2579 |
| 449 | Ga0105246_10232450 | 3300011119 | Bacteria | 1453 |
| 450 | Ga0105246_11238228 | 3300011119 | Bacteria | 689 |
| 451 | Ga0105246_11800899 | 3300011119 | Bacteria | 585 |
| 452 | Ga0157344_1019660 | 3300012476 | Bacteria | 572 |
| 453 | Ga0157313_1021463 | 3300012503 | Bacteria | 663 |
| 454 | Ga0157342_1079190 | 3300012507 | Bacteria | 514 |
| 455 | Ga0157315_1005519 | 3300012508 | Bacteria | 952 |
| 456 | Ga0157373_10926876 | 3300013100 | Bacteria | 647 |
| 457 | Ga0157371_10124561 | 3300013102 | Bacteria | 1833 |
| 458 | Ga0157371_10309262 | 3300013102 | Bacteria | 1145 |
| 459 | Ga0157370_10300678 | 3300013104 | Bacteria | 1481 |
| 460 | Ga0157370_11343214 | 3300013104 | Bacteria | 644 |
| 461 | Ga0157370_11388264 | 3300013104 | Bacteria | 632 |
| 462 | Ga0157369_10051356 | 3300013105 | Bacteria | 4462 |
| 463 | Ga0157369_10110992 | 3300013105 | Bacteria | 2915 |
| 464 | Ga0157369_10498685 | 3300013105 | Bacteria | 1260 |
| 465 | Ga0157369_10748083 | 3300013105 | Bacteria | 1006 |
| 466 | Ga0157374_10032409 | 3300013296 | Bacteria | 4757 |
| 467 | Ga0157374_11664878 | 3300013296 | Bacteria | 663 |
| 468 | Ga0157374_11809434 | 3300013296 | Bacteria | 636 |
| 469 | Ga0157378_10004457 | 3300013297 | Bacteria | 12311 |
| 470 | Ga0157378_10395003 | 3300013297 | Bacteria | 1361 |
| 471 | Ga0163162_10001609 | 3300013306 | Bacteria | 21131 |
| 472 | Ga0163162_10035606 | 3300013306 | Bacteria | 4960 |
| 473 | Ga0163162_10412955 | 3300013306 | Bacteria | 1482 |
| 474 | Ga0163162_10415926 | 3300013306 | Bacteria | 1477 |
| 475 | Ga0163162_10471848 | 3300013306 | Bacteria | 1386 |
| 476 | Ga0163162_11569914 | 3300013306 | Bacteria | 750 |
| 477 | Ga0163162_12048891 | 3300013306 | Bacteria | 656 |
| 478 | Ga0157372_10004145 | 3300013307 | Bacteria | 15520 |
| 479 | Ga0157372_10219830 | 3300013307 | Bacteria | 2202 |
| 480 | Ga0157372_10298165 | 3300013307 | Bacteria | 1875 |
| 481 | Ga0157372_10323563 | 3300013307 | Bacteria | 1795 |
| 482 | Ga0157372_13131700 | 3300013307 | Bacteria | 528 |
| 483 | Ga0157375_10000419 | 3300013308 | Bacteria | 38685 |
| 484 | Ga0157375_11361671 | 3300013308 | Bacteria | 835 |
| 485 | Ga0157375_11459471 | 3300013308 | Bacteria | 807 |
| 486 | Ga0157375_12957822 | 3300013308 | Bacteria | 567 |
| 487 | Ga0163163_10039390 | 3300014325 | Bacteria | 4612 |
| 488 | Ga0163163_10177849 | 3300014325 | Bacteria | 2175 |
| 489 | Ga0163163_10564851 | 3300014325 | Bacteria | 1200 |
| 490 | Ga0163163_11018401 | 3300014325 | Bacteria | 891 |
| 491 | Ga0163163_11527267 | 3300014325 | Bacteria | 729 |
| 492 | Ga0163163_12221259 | 3300014325 | Bacteria | 608 |
| 493 | Ga0157380_10001844 | 3300014326 | Bacteria | 14014 |
| 494 | Ga0157380_10433095 | 3300014326 | Bacteria | 1258 |
| 495 | Ga0182008_10002958 | 3300014497 | Bacteria | 10453 |
| 496 | Ga0157377_10026136 | 3300014745 | Bacteria | 3121 |
| 497 | Ga0157377_11268421 | 3300014745 | Bacteria | 574 |
| 498 | Ga0157379_10029772 | 3300014968 | Bacteria | 4855 |
| 499 | Ga0157379_10132262 | 3300014968 | Bacteria | 2246 |
| 500 | Ga0157379_10214503 | 3300014968 | Bacteria | 1743 |
| 501 | Ga0157379_10314622 | 3300014968 | Bacteria | 1429 |
| 502 | Ga0157379_11341361 | 3300014968 | Bacteria | 692 |
| 503 | Ga0157376_10037960 | 3300014969 | Bacteria | 3917 |
| 504 | Ga0157376_10057401 | 3300014969 | Bacteria | 3256 |
| 505 | Ga0157376_10107119 | 3300014969 | Bacteria | 2453 |
| 506 | Ga0157376_11853195 | 3300014969 | Bacteria | 640 |
| 507 | Ga0157376_12606991 | 3300014969 | Bacteria | 545 |
| 508 | Ga0182006_1084780 | 3300015261 | Bacteria | 1150 |
| 509 | Ga0182005_1049382 | 3300015265 | Bacteria | 1144 |
| 510 | Ga0183367_1002 | 3300015688 | Bacteria | 1101531 |
| 511 | Ga0163161_10006906 | 3300017792 | Bacteria | 7852 |
| 512 | Ga0163161_10172118 | 3300017792 | Bacteria | 1656 |
| 513 | Ga0163161_10418449 | 3300017792 | Bacteria | 1077 |
| 514 | Ga0163161_10600751 | 3300017792 | Bacteria | 907 |
| 515 | Ga0163161_10636131 | 3300017792 | Bacteria | 883 |
| 516 | Ga0197907_10131781 | 3300020069 | Bacteria | 2807 |
| 517 | Ga0197907_10233448 | 3300020069 | Bacteria | 1104 |
| 518 | Ga0206356_11143445 | 3300020070 | Bacteria | 1172 |
| 519 | Ga0206351_10184192 | 3300020077 | Bacteria | 856 |
| 520 | Ga0206352_10845590 | 3300020078 | Bacteria | 584 |
| 521 | Ga0206350_11195567 | 3300020080 | Bacteria | 1100 |
| 522 | Ga0206354_10960052 | 3300020081 | Bacteria | 4048 |
| 523 | Ga0206353_11128098 | 3300020082 | Bacteria | 9314 |
| 524 | Ga0206353_11287408 | 3300020082 | Bacteria | 1112 |
| 525 | Ga0213872_10306243 | 3300021361 | Bacteria | 659 |
| 526 | Ga0213876_10009953 | 3300021384 | Bacteria | 5110 |
| 527 | Ga0213876_10011067 | 3300021384 | Bacteria | 4828 |
| 528 | Ga0213876_10023670 | 3300021384 | Bacteria | 3243 |
| 529 | Ga0213876_10572096 | 3300021384 | Bacteria | 601 |
| 530 | Ga0213875_10032905 | 3300021388 | Bacteria | 2449 |
| 531 | Ga0213875_10059850 | 3300021388 | Bacteria | 1782 |
| 532 | Ga0213875_10273228 | 3300021388 | Bacteria | 798 |
| 533 | Ga0224712_10000526 | 3300022467 | Bacteria | 7751 |
| 534 | Ga0224712_10002344 | 3300022467 | Bacteria | 4653 |
| 535 | Ga0209025_1037599 | 3300025294 | Bacteria | 2144 |
| 536 | Ga0209758_1007953 | 3300025297 | Bacteria | 7028 |
| 537 | Ga0207426_1004664 | 3300025302 | Bacteria | 6590 |
| 538 | Ga0207426_1006367 | 3300025302 | Bacteria | 5152 |
| 539 | Ga0207426_1038691 | 3300025302 | Bacteria | 1500 |
| 540 | Ga0209051_1000011 | 3300025303 | Bacteria | 610828 |
| 541 | Ga0209051_1000620 | 3300025303 | Bacteria | 40785 |
| 542 | Ga0209051_1000933 | 3300025303 | Bacteria | 28862 |
| 543 | Ga0209051_1001428 | 3300025303 | Bacteria | 20451 |
| 544 | Ga0209051_1033472 | 3300025303 | Bacteria | 1943 |
| 545 | Ga0209051_1039069 | 3300025303 | Bacteria | 1719 |
| 546 | Ga0209051_1095550 | 3300025303 | Bacteria | 814 |
| 547 | Ga0207656_10092487 | 3300025321 | Bacteria | 1375 |
| 548 | Ga0207656_10115433 | 3300025321 | Bacteria | 1245 |
| 549 | Ga0207696_1123242 | 3300025711 | Bacteria | 698 |
| 550 | Ga0207653_10045515 | 3300025885 | Bacteria | 1450 |
| 551 | Ga0207682_10340878 | 3300025893 | Bacteria | 705 |
| 552 | Ga0207692_10001940 | 3300025898 | Bacteria | 7881 |
| 553 | Ga0207692_10136975 | 3300025898 | Bacteria | 1389 |
| 554 | Ga0207692_10302969 | 3300025898 | Bacteria | 973 |
| 555 | Ga0207692_10380415 | 3300025898 | Bacteria | 876 |
| 556 | Ga0207642_10000312 | 3300025899 | Bacteria | 14664 |
| 557 | Ga0207642_10056787 | 3300025899 | Bacteria | 1797 |
| 558 | Ga0207710_10000060 | 3300025900 | Bacteria | 168230 |
| 559 | Ga0207710_10000890 | 3300025900 | Bacteria | 15991 |
| 560 | Ga0207710_10130368 | 3300025900 | Bacteria | 1207 |
| 561 | Ga0207688_10000177 | 3300025901 | Bacteria | 28125 |
| 562 | Ga0207688_10000841 | 3300025901 | Bacteria | 15432 |
| 563 | Ga0207680_10060009 | 3300025903 | Bacteria | 2313 |
| 564 | Ga0207680_10107266 | 3300025903 | Bacteria | 1805 |
| 565 | Ga0207680_10235641 | 3300025903 | Bacteria | 1259 |
| 566 | Ga0207680_10600805 | 3300025903 | Bacteria | 787 |
| 567 | Ga0207647_10014202 | 3300025904 | Bacteria | 5496 |
| 568 | Ga0207647_10028202 | 3300025904 | Bacteria | 3649 |
| 569 | Ga0207685_10001135 | 3300025905 | Bacteria | 5314 |
| 570 | Ga0207685_10010029 | 3300025905 | Bacteria | 2778 |
| 571 | Ga0207699_10126702 | 3300025906 | Bacteria | 1659 |
| 572 | Ga0207699_10282730 | 3300025906 | Bacteria | 1153 |
| 573 | Ga0207645_10042119 | 3300025907 | Bacteria | 2922 |
| 574 | Ga0207643_10540021 | 3300025908 | Bacteria | 747 |
| 575 | Ga0207643_10579470 | 3300025908 | Bacteria | 721 |
| 576 | Ga0207705_10002093 | 3300025909 | Bacteria | 15510 |
| 577 | Ga0207705_10486828 | 3300025909 | Bacteria | 957 |
| 578 | Ga0207654_10071715 | 3300025911 | Bacteria | 2060 |
| 579 | Ga0207654_10288853 | 3300025911 | Bacteria | 1111 |
| 580 | Ga0207707_10000277 | 3300025912 | Bacteria | 55264 |
| 581 | Ga0207707_10167030 | 3300025912 | Bacteria | 1923 |
| 582 | Ga0207707_11302555 | 3300025912 | Bacteria | 584 |
| 583 | Ga0207671_10009964 | 3300025914 | Bacteria | 7896 |
| 584 | Ga0207671_10018152 | 3300025914 | Bacteria | 5405 |
| 585 | Ga0207671_10027045 | 3300025914 | Bacteria | 4291 |
| 586 | Ga0207671_10151176 | 3300025914 | Bacteria | 1794 |
| 587 | Ga0207671_10821232 | 3300025914 | Bacteria | 737 |
| 588 | Ga0207671_11168870 | 3300025914 | Bacteria | 603 |
| 589 | Ga0207693_10000339 | 3300025915 | Bacteria | 43073 |
| 590 | Ga0207693_10000602 | 3300025915 | Bacteria | 32212 |
| 591 | Ga0207693_10217813 | 3300025915 | Bacteria | 1500 |
| 592 | Ga0207663_10000907 | 3300025916 | Bacteria | 13535 |
| 593 | Ga0207663_10122657 | 3300025916 | Bacteria | 1782 |
| 594 | Ga0207663_11001168 | 3300025916 | Bacteria | 670 |
| 595 | Ga0207660_10000115 | 3300025917 | Bacteria | 46447 |
| 596 | Ga0207660_10111634 | 3300025917 | Bacteria | 2058 |
| 597 | Ga0207660_10521538 | 3300025917 | Bacteria | 965 |
| 598 | Ga0207660_10831956 | 3300025917 | Bacteria | 753 |
| 599 | Ga0207660_11033446 | 3300025917 | Bacteria | 670 |
| 600 | Ga0207662_10075302 | 3300025918 | Bacteria | 2050 |
| 601 | Ga0207662_11040064 | 3300025918 | Bacteria | 582 |
| 602 | Ga0207657_10095827 | 3300025919 | Bacteria | 2469 |
| 603 | Ga0207657_10164966 | 3300025919 | Bacteria | 1797 |
| 604 | Ga0207649_11409531 | 3300025920 | Bacteria | 551 |
| 605 | Ga0207649_11674196 | 3300025920 | Bacteria | 504 |
| 606 | Ga0207652_10000333 | 3300025921 | Bacteria | 48970 |
| 607 | Ga0207652_10547270 | 3300025921 | Bacteria | 1040 |
| 608 | Ga0207646_10636104 | 3300025922 | Bacteria | 956 |
| 609 | Ga0207646_10832617 | 3300025922 | Bacteria | 821 |
| 610 | Ga0207681_10000788 | 3300025923 | Bacteria | 20865 |
| 611 | Ga0207681_10086689 | 3300025923 | Bacteria | 2225 |
| 612 | Ga0207694_10048982 | 3300025924 | Bacteria | 3270 |
| 613 | Ga0207694_10183839 | 3300025924 | Bacteria | 1696 |
| 614 | Ga0207694_10632582 | 3300025924 | Bacteria | 901 |
| 615 | Ga0207694_11119059 | 3300025924 | Bacteria | 666 |
| 616 | Ga0207650_10129186 | 3300025925 | Bacteria | 1975 |
| 617 | Ga0207659_10510272 | 3300025926 | Bacteria | 1019 |
| 618 | Ga0207659_10968259 | 3300025926 | Bacteria | 732 |
| 619 | Ga0207659_11137339 | 3300025926 | Bacteria | 671 |
| 620 | Ga0207687_10001983 | 3300025927 | Bacteria | 14066 |
| 621 | Ga0207687_10102936 | 3300025927 | Bacteria | 2105 |
| 622 | Ga0207687_10302244 | 3300025927 | Bacteria | 1289 |
| 623 | Ga0207687_10940733 | 3300025927 | Bacteria | 740 |
| 624 | Ga0207700_10070676 | 3300025928 | Bacteria | 2684 |
| 625 | Ga0207700_10181688 | 3300025928 | Bacteria | 1762 |
| 626 | Ga0207700_10206533 | 3300025928 | Bacteria | 1658 |
| 627 | Ga0207700_10271142 | 3300025928 | Bacteria | 1457 |
| 628 | Ga0207700_10298691 | 3300025928 | Bacteria | 1390 |
| 629 | Ga0207700_10461851 | 3300025928 | Bacteria | 1120 |
| 630 | Ga0207664_10068406 | 3300025929 | Bacteria | 2853 |
| 631 | Ga0207664_10324477 | 3300025929 | Bacteria | 1359 |
| 632 | Ga0207664_10569422 | 3300025929 | Bacteria | 1017 |
| 633 | Ga0207664_10677795 | 3300025929 | Bacteria | 927 |
| 634 | Ga0207664_11686089 | 3300025929 | Bacteria | 556 |
| 635 | Ga0207644_10004647 | 3300025931 | Bacteria | 8925 |
| 636 | Ga0207644_10020065 | 3300025931 | Bacteria | 4541 |
| 637 | Ga0207644_10207081 | 3300025931 | Bacteria | 1549 |
| 638 | Ga0207690_10024212 | 3300025932 | Bacteria | 3800 |
| 639 | Ga0207690_10061631 | 3300025932 | Bacteria | 2551 |
| 640 | Ga0207690_10851592 | 3300025932 | Bacteria | 755 |
| 641 | Ga0207706_10002589 | 3300025933 | Bacteria | 17618 |
| 642 | Ga0207686_10001637 | 3300025934 | Bacteria | 12508 |
| 643 | Ga0207686_10750390 | 3300025934 | Bacteria | 779 |
| 644 | Ga0207686_10789993 | 3300025934 | Bacteria | 760 |
| 645 | Ga0207709_10001393 | 3300025935 | Bacteria | 16930 |
| 646 | Ga0207709_10074674 | 3300025935 | Bacteria | 2164 |
| 647 | Ga0207709_10183433 | 3300025935 | Bacteria | 1480 |
| 648 | Ga0207709_10222341 | 3300025935 | Bacteria | 1362 |
| 649 | Ga0207709_10326906 | 3300025935 | Bacteria | 1150 |
| 650 | Ga0207709_11668838 | 3300025935 | Bacteria | 530 |
| 651 | Ga0207670_10012017 | 3300025936 | Bacteria | 5046 |
| 652 | Ga0207670_10739642 | 3300025936 | Bacteria | 816 |
| 653 | Ga0207670_11054097 | 3300025936 | Bacteria | 685 |
| 654 | Ga0207669_10000205 | 3300025937 | Bacteria | 26813 |
| 655 | Ga0207669_10211685 | 3300025937 | Bacteria | 1415 |
| 656 | Ga0207669_10655942 | 3300025937 | Bacteria | 859 |
| 657 | Ga0207669_10744014 | 3300025937 | Bacteria | 809 |
| 658 | Ga0207669_11018226 | 3300025937 | Bacteria | 696 |
| 659 | Ga0207669_11532880 | 3300025937 | Bacteria | 568 |
| 660 | Ga0207669_11791100 | 3300025937 | Bacteria | 525 |
| 661 | Ga0207704_10000618 | 3300025938 | Bacteria | 15725 |
| 662 | Ga0207704_10209532 | 3300025938 | Bacteria | 1433 |
| 663 | Ga0207704_10361902 | 3300025938 | Bacteria | 1133 |
| 664 | Ga0207704_11617637 | 3300025938 | Bacteria | 556 |
| 665 | Ga0207665_10008088 | 3300025939 | Bacteria | 6941 |
| 666 | Ga0207665_10011512 | 3300025939 | Bacteria | 5811 |
| 667 | Ga0207665_10142777 | 3300025939 | Bacteria | 1709 |
| 668 | Ga0207691_10548394 | 3300025940 | Bacteria | 980 |
| 669 | Ga0207711_10000073 | 3300025941 | Bacteria | 107878 |
| 670 | Ga0207711_10061372 | 3300025941 | Bacteria | 3241 |
| 671 | Ga0207711_10157899 | 3300025941 | Bacteria | 2051 |
| 672 | Ga0207711_10536245 | 3300025941 | Bacteria | 1091 |
| 673 | Ga0207711_10731525 | 3300025941 | Bacteria | 922 |
| 674 | Ga0207711_11955454 | 3300025941 | Bacteria | 529 |
| 675 | Ga0207689_10133901 | 3300025942 | Bacteria | 2040 |
| 676 | Ga0207689_11283094 | 3300025942 | Bacteria | 615 |
| 677 | Ga0207661_10086949 | 3300025944 | Bacteria | 2595 |
| 678 | Ga0207661_10290851 | 3300025944 | Bacteria | 1462 |
| 679 | Ga0207661_10627582 | 3300025944 | Bacteria | 987 |
| 680 | Ga0207661_10735585 | 3300025944 | Bacteria | 908 |
| 681 | Ga0207661_10932794 | 3300025944 | Bacteria | 800 |
| 682 | Ga0207661_11837205 | 3300025944 | Bacteria | 551 |
| 683 | Ga0207679_11528043 | 3300025945 | Bacteria | 612 |
| 684 | Ga0207667_10183276 | 3300025949 | Bacteria | 2149 |
| 685 | Ga0207667_10328404 | 3300025949 | Bacteria | 1562 |
| 686 | Ga0207667_10705552 | 3300025949 | Bacteria | 1011 |
| 687 | Ga0207667_11257202 | 3300025949 | Bacteria | 718 |
| 688 | Ga0207651_10223155 | 3300025960 | Bacteria | 1525 |
| 689 | Ga0207651_10270943 | 3300025960 | Bacteria | 1398 |
| 690 | Ga0207712_10000042 | 3300025961 | Bacteria | 176338 |
| 691 | Ga0207712_10072184 | 3300025961 | Bacteria | 2485 |
| 692 | Ga0207712_10754948 | 3300025961 | Bacteria | 852 |
| 693 | Ga0207712_12019647 | 3300025961 | Bacteria | 516 |
| 694 | Ga0207668_10006306 | 3300025972 | Bacteria | 7010 |
| 695 | Ga0207668_10013064 | 3300025972 | Bacteria | 5102 |
| 696 | Ga0207668_10048285 | 3300025972 | Bacteria | 2920 |
| 697 | Ga0207668_10753972 | 3300025972 | Bacteria | 859 |
| 698 | Ga0207640_10003341 | 3300025981 | Bacteria | 8643 |
| 699 | Ga0207640_10131790 | 3300025981 | Bacteria | 1808 |
| 700 | Ga0207640_10477580 | 3300025981 | Bacteria | 1033 |
| 701 | Ga0207640_10671311 | 3300025981 | Bacteria | 885 |
| 702 | Ga0207658_10000449 | 3300025986 | Bacteria | 38511 |
| 703 | Ga0207658_10000664 | 3300025986 | Bacteria | 30027 |
| 704 | Ga0207658_10003954 | 3300025986 | Bacteria | 10411 |
| 705 | Ga0207658_10004460 | 3300025986 | Bacteria | 9728 |
| 706 | Ga0207658_10069437 | 3300025986 | Bacteria | 2662 |
| 707 | Ga0207658_10451997 | 3300025986 | Bacteria | 1137 |
| 708 | Ga0207658_10852948 | 3300025986 | Bacteria | 828 |
| 709 | Ga0207658_11072789 | 3300025986 | Bacteria | 735 |
| 710 | Ga0207658_11902673 | 3300025986 | Bacteria | 542 |
| 711 | Ga0207677_10016196 | 3300026023 | Bacteria | 4407 |
| 712 | Ga0207677_10257633 | 3300026023 | Bacteria | 1420 |
| 713 | Ga0207703_10002964 | 3300026035 | Bacteria | 14391 |
| 714 | Ga0207703_10059815 | 3300026035 | Bacteria | 3113 |
| 715 | Ga0207703_10063785 | 3300026035 | Bacteria | 3022 |
| 716 | Ga0207703_10065586 | 3300026035 | Bacteria | 2984 |
| 717 | Ga0207703_10151622 | 3300026035 | Bacteria | 2022 |
| 718 | Ga0207703_10414917 | 3300026035 | Bacteria | 1252 |
| 719 | Ga0207703_10731486 | 3300026035 | Bacteria | 942 |
| 720 | Ga0207703_11092095 | 3300026035 | Bacteria | 766 |
| 721 | Ga0207639_10038681 | 3300026041 | Bacteria | 3550 |
| 722 | Ga0207639_10379569 | 3300026041 | Bacteria | 1269 |
| 723 | Ga0207639_10793787 | 3300026041 | Bacteria | 882 |
| 724 | Ga0207639_10973081 | 3300026041 | Bacteria | 794 |
| 725 | Ga0207678_10007047 | 3300026067 | Bacteria | 9982 |
| 726 | Ga0207678_10118193 | 3300026067 | Bacteria | 2262 |
| 727 | Ga0207678_10122695 | 3300026067 | Bacteria | 2217 |
| 728 | Ga0207678_10795511 | 3300026067 | Bacteria | 835 |
| 729 | Ga0207678_10930460 | 3300026067 | Bacteria | 769 |
| 730 | Ga0207678_11078487 | 3300026067 | Bacteria | 711 |
| 731 | Ga0207678_11382732 | 3300026067 | Bacteria | 622 |
| 732 | Ga0207708_10003891 | 3300026075 | Bacteria | 10992 |
| 733 | Ga0207708_10041519 | 3300026075 | Bacteria | 3507 |
| 734 | Ga0207708_10738176 | 3300026075 | Bacteria | 844 |
| 735 | Ga0207702_10903480 | 3300026078 | Bacteria | 875 |
| 736 | Ga0207702_12014144 | 3300026078 | Bacteria | 568 |
| 737 | Ga0207641_10001094 | 3300026088 | Bacteria | 27248 |
| 738 | Ga0207641_10015008 | 3300026088 | Bacteria | 6350 |
| 739 | Ga0207641_10027939 | 3300026088 | Bacteria | 4659 |
| 740 | Ga0207641_10070874 | 3300026088 | Bacteria | 2996 |
| 741 | Ga0207641_10094126 | 3300026088 | Bacteria | 2627 |
| 742 | Ga0207641_10468585 | 3300026088 | Bacteria | 1219 |
| 743 | Ga0207641_11917341 | 3300026088 | Bacteria | 594 |
| 744 | Ga0207648_10000623 | 3300026089 | Bacteria | 39688 |
| 745 | Ga0207648_10047022 | 3300026089 | Bacteria | 3783 |
| 746 | Ga0207648_11638071 | 3300026089 | Bacteria | 605 |
| 747 | Ga0207676_10017255 | 3300026095 | Bacteria | 5232 |
| 748 | Ga0207676_10203343 | 3300026095 | Bacteria | 1752 |
| 749 | Ga0207676_10343914 | 3300026095 | Bacteria | 1377 |
| 750 | Ga0207676_10985563 | 3300026095 | Bacteria | 830 |
| 751 | Ga0207676_11040120 | 3300026095 | Bacteria | 808 |
| 752 | Ga0207676_11369694 | 3300026095 | Bacteria | 703 |
| 753 | Ga0207676_11741940 | 3300026095 | Bacteria | 621 |
| 754 | Ga0207676_11947419 | 3300026095 | Bacteria | 586 |
| 755 | Ga0207674_10296717 | 3300026116 | Bacteria | 1565 |
| 756 | Ga0207674_10500764 | 3300026116 | Bacteria | 1174 |
| 757 | Ga0207675_100001672 | 3300026118 | Bacteria | 22194 |
| 758 | Ga0207675_100533225 | 3300026118 | Bacteria | 1171 |
| 759 | Ga0207675_101185188 | 3300026118 | Bacteria | 784 |
| 760 | Ga0207675_101475440 | 3300026118 | Bacteria | 701 |
| 761 | Ga0207683_10000539 | 3300026121 | Bacteria | 35044 |
| 762 | Ga0207683_10017378 | 3300026121 | Bacteria | 6130 |
| 763 | Ga0207683_10105161 | 3300026121 | Bacteria | 2523 |
| 764 | Ga0207683_10383305 | 3300026121 | Bacteria | 1292 |
| 765 | Ga0207683_10495393 | 3300026121 | Bacteria | 1128 |
| 766 | Ga0207683_10507853 | 3300026121 | Bacteria | 1114 |
| 767 | Ga0207683_10717855 | 3300026121 | Bacteria | 927 |
| 768 | Ga0207698_10047163 | 3300026142 | Bacteria | 3261 |
| 769 | Ga0207698_10102226 | 3300026142 | Bacteria | 2379 |
| 770 | Ga0207698_10678063 | 3300026142 | Bacteria | 1024 |
| 771 | Ga0209371_1029382 | 3300027312 | Bacteria | 1215 |
| 772 | Ga0209179_1045200 | 3300027512 | Bacteria | 934 |
| 773 | Ga0209282_1241770 | 3300027666 | Bacteria | 803 |
| 774 | Ga0209813_10018444 | 3300027866 | Bacteria | 1928 |
| 775 | Ga0209813_10142005 | 3300027866 | Bacteria | 853 |
| 776 | Ga0207428_10336973 | 3300027907 | Bacteria | 1111 |
| 777 | Ga0207428_10532992 | 3300027907 | Bacteria | 850 |
| 778 | Ga0207428_10570865 | 3300027907 | Bacteria | 817 |
| 779 | Ga0268266_10007218 | 3300028379 | Bacteria | 10050 |
| 780 | Ga0268266_10012919 | 3300028379 | Bacteria | 7204 |
| 781 | Ga0268266_10020977 | 3300028379 | Bacteria | 5569 |
| 782 | Ga0268266_10102670 | 3300028379 | Bacteria | 2522 |
| 783 | Ga0268266_10156772 | 3300028379 | Bacteria | 2057 |
| 784 | Ga0268265_10000051 | 3300028380 | Bacteria | 174968 |
| 785 | Ga0268265_10003445 | 3300028380 | Bacteria | 11383 |
| 786 | Ga0268265_10076517 | 3300028380 | Bacteria | 2625 |
| 787 | Ga0268265_10493002 | 3300028380 | Bacteria | 1153 |
| 788 | Ga0268264_10000108 | 3300028381 | Bacteria | 208791 |
| 789 | Ga0268264_10009938 | 3300028381 | Bacteria | 7877 |
| 790 | Ga0268264_10197392 | 3300028381 | Bacteria | 1838 |
| 791 | Ga0268264_10774917 | 3300028381 | Bacteria | 957 |
| 792 | Ga0307517_10004659 | 3300028786 | Bacteria | 21023 |
| 793 | Ga0307517_10036222 | 3300028786 | Bacteria | 5556 |
| 794 | Ga0307517_10265146 | 3300028786 | Bacteria | 993 |
| 795 | Ga0307515_10001177 | 3300028794 | Bacteria | 59836 |
| 796 | Ga0307515_10083676 | 3300028794 | Bacteria | 4110 |
| 797 | Ga0307515_10346614 | 3300028794 | Bacteria | 1134 |
| 798 | Ga0268256_1023853 | 3300030500 | Bacteria | 1580 |
| 799 | Ga0307511_10028203 | 3300030521 | Bacteria | 5104 |
| 800 | Ga0307511_10062540 | 3300030521 | Bacteria | 2824 |
| 801 | Ga0307511_10132506 | 3300030521 | Bacteria | 1496 |
| 802 | Ga0307511_10235476 | 3300030521 | Bacteria | 900 |
| 803 | Ga0307511_10263096 | 3300030521 | Bacteria | 815 |
| 804 | Ga0307511_10276655 | 3300030521 | Bacteria | 780 |
| 805 | Ga0307511_10309783 | 3300030521 | Bacteria | 706 |
| 806 | Ga0307512_10037650 | 3300030522 | Bacteria | 4081 |
| 807 | Ga0307512_10064598 | 3300030522 | Bacteria | 2785 |
| 808 | Ga0307512_10182988 | 3300030522 | Bacteria | 1173 |
| 809 | Ga0314311_1190625 | 3300030733 | Bacteria | 661 |
| 810 | Ga0316180_1107973 | 3300030736 | Bacteria | 928 |
| 811 | Ga0316182_1311333 | 3300030745 | Bacteria | 580 |
| 812 | Ga0265327_10000021 | 3300031251 | Bacteria | 417788 |
| 813 | Ga0265327_10000071 | 3300031251 | Bacteria | 215502 |
| 814 | Ga0265327_10000630 | 3300031251 | Bacteria | 57536 |
| 815 | Ga0265327_10021466 | 3300031251 | Bacteria | 3896 |
| 816 | Ga0307513_10032651 | 3300031456 | Bacteria | 5866 |
| 817 | Ga0307513_10033269 | 3300031456 | Bacteria | 5796 |
| 818 | Ga0307513_10119884 | 3300031456 | Bacteria | 2601 |
| 819 | Ga0307513_10511978 | 3300031456 | Bacteria | 916 |
| 820 | Ga0307509_10169325 | 3300031507 | Bacteria | 2066 |
| 821 | Ga0307509_10206018 | 3300031507 | Bacteria | 1797 |
| 822 | Ga0307509_10338394 | 3300031507 | Bacteria | 1233 |
| 823 | Ga0307509_10441087 | 3300031507 | Bacteria | 998 |
| 824 | Ga0307408_100304208 | 3300031548 | Bacteria | 1337 |
| 825 | Ga0307408_101344318 | 3300031548 | Bacteria | 671 |
| 826 | Ga0307508_10001775 | 3300031616 | Bacteria | 23968 |
| 827 | Ga0307508_10005680 | 3300031616 | Bacteria | 11819 |
| 828 | Ga0307508_10020650 | 3300031616 | Bacteria | 5981 |
| 829 | Ga0307508_10063849 | 3300031616 | Bacteria | 3248 |
| 830 | Ga0307508_10075163 | 3300031616 | Bacteria | 2956 |
| 831 | Ga0307508_10117382 | 3300031616 | Bacteria | 2262 |
| 832 | Ga0307514_10036472 | 3300031649 | Bacteria | 3907 |
| 833 | Ga0307514_10119090 | 3300031649 | Bacteria | 1847 |
| 834 | Ga0307514_10190602 | 3300031649 | Bacteria | 1306 |
| 835 | Ga0316579_10047194 | 3300031691 | Bacteria | 2011 |
| 836 | Ga0316579_10445263 | 3300031691 | Bacteria | 627 |
| 837 | Ga0316576_10069280 | 3300031727 | Bacteria | 2600 |
| 838 | Ga0316576_10557500 | 3300031727 | Bacteria | 839 |
| 839 | Ga0316578_10007838 | 3300031728 | Bacteria | 5392 |
| 840 | Ga0316578_10054210 | 3300031728 | Bacteria | 2351 |
| 841 | Ga0316578_10155229 | 3300031728 | Bacteria | 1379 |
| 842 | Ga0316578_10695755 | 3300031728 | Bacteria | 592 |
| 843 | Ga0307516_10007060 | 3300031730 | Bacteria | 12997 |
| 844 | Ga0307516_10023113 | 3300031730 | Bacteria | 6378 |
| 845 | Ga0307516_10048980 | 3300031730 | Bacteria | 4156 |
| 846 | Ga0307405_10106270 | 3300031731 | Bacteria | 1893 |
| 847 | Ga0307405_10763497 | 3300031731 | Bacteria | 807 |
| 848 | Ga0307405_11497678 | 3300031731 | Bacteria | 593 |
| 849 | Ga0316577_10196594 | 3300031733 | Bacteria | 1140 |
| 850 | Ga0316577_10698771 | 3300031733 | Bacteria | 576 |
| 851 | Ga0307413_10179235 | 3300031824 | Bacteria | 1509 |
| 852 | Ga0307413_10760075 | 3300031824 | Bacteria | 811 |
| 853 | Ga0307413_10963802 | 3300031824 | Bacteria | 729 |
| 854 | Ga0307518_10156737 | 3300031838 | Bacteria | 1569 |
| 855 | Ga0307410_10005427 | 3300031852 | Bacteria | 6747 |
| 856 | Ga0307410_10050900 | 3300031852 | Bacteria | 2789 |
| 857 | Ga0307410_10097846 | 3300031852 | Bacteria | 2097 |
| 858 | Ga0307410_10154260 | 3300031852 | Bacteria | 1713 |
| 859 | Ga0307410_11219754 | 3300031852 | Bacteria | 656 |
| 860 | Ga0307406_10986100 | 3300031901 | Bacteria | 722 |
| 861 | Ga0307406_11413939 | 3300031901 | Bacteria | 610 |
| 862 | Ga0307407_10015605 | 3300031903 | Bacteria | 3762 |
| 863 | Ga0307407_11702345 | 3300031903 | Bacteria | 502 |
| 864 | Ga0307412_10273546 | 3300031911 | Bacteria | 1323 |
| 865 | Ga0307412_11572325 | 3300031911 | Bacteria | 600 |
| 866 | Ga0307409_100037553 | 3300031995 | Bacteria | 3572 |
| 867 | Ga0307409_100205427 | 3300031995 | Bacteria | 1766 |
| 868 | Ga0307409_100326649 | 3300031995 | Bacteria | 1438 |
| 869 | Ga0307409_100387209 | 3300031995 | Bacteria | 1331 |
| 870 | Ga0307409_100641406 | 3300031995 | Bacteria | 1055 |
| 871 | Ga0307409_100815775 | 3300031995 | Bacteria | 941 |
| 872 | Ga0307409_102087345 | 3300031995 | Bacteria | 596 |
| 873 | Ga0307409_102616151 | 3300031995 | Bacteria | 533 |
| 874 | Ga0307416_100056416 | 3300032002 | Bacteria | 3170 |
| 875 | Ga0307416_100107718 | 3300032002 | Bacteria | 2446 |
| 876 | Ga0307416_100436088 | 3300032002 | Bacteria | 1359 |
| 877 | Ga0307416_101380328 | 3300032002 | Bacteria | 810 |
| 878 | Ga0307416_101534811 | 3300032002 | Bacteria | 772 |
| 879 | Ga0307416_103859158 | 3300032002 | Bacteria | 502 |
| 880 | Ga0307411_10140216 | 3300032005 | Bacteria | 1782 |
| 881 | Ga0307411_10196819 | 3300032005 | Bacteria | 1544 |
| 882 | Ga0307411_10561258 | 3300032005 | Bacteria | 976 |
| 883 | Ga0307415_100728871 | 3300032126 | Bacteria | 898 |
| 884 | Ga0307415_100940326 | 3300032126 | Bacteria | 799 |
| 885 | Ga0307415_101508448 | 3300032126 | Bacteria | 643 |
| 886 | Ga0316583_10012794 | 3300032133 | Bacteria | 3028 |
| 887 | Ga0316585_10026058 | 3300032137 | Bacteria | 1816 |
| 888 | Ga0316585_10140083 | 3300032137 | Bacteria | 798 |
| 889 | Ga0316580_10179792 | 3300032139 | Bacteria | 650 |
| 890 | Ga0316580_10284486 | 3300032139 | Bacteria | 513 |
| 891 | Ga0316593_10251358 | 3300032168 | Unclassified | 662 |
| 892 | Ga0307507_10000732 | 3300033179 | Bacteria | 72083 |
| 893 | Ga0307507_10642080 | 3300033179 | Bacteria | 540 |
| 894 | Ga0307510_10035723 | 3300033180 | Bacteria | 5543 |
| 895 | Ga0307510_10088739 | 3300033180 | Bacteria | 2949 |
| 896 | Ga0307510_10284835 | 3300033180 | Bacteria | 1121 |
| 897 | Ga0307510_10416505 | 3300033180 | Bacteria | 786 |
| 898 | Ga0307510_10651932 | 3300033180 | Bacteria | 511 |
| 899 | Ga0316596_1054270 | 3300033541 | Bacteria | 1063 |
| 900 | Ga0373930_0210188 | 3300034816 | Bacteria | 509 |
| 901 | Ga0373938_0069430 | 3300034957 | Bacteria | 839 |
| 902 | Ga0373928_0105733 | 3300035084 | Bacteria | 739 |
| 903 | Ga0373929_0151968 | 3300035085 | Bacteria | 621 |
| 904 | Ga0373940_0078051 | 3300035088 | Bacteria | 974 |
| 905 | Ga0373951_0066451 | 3300035091 | Bacteria | 911 |
| 906 | Ga0373932_0036929 | 3300035112 | Bacteria | 1390 |
| 907 | Ga0373939_0420583 | 3300035114 | Bacteria | 557 |
| 908 | Ga0373960_0036799 | 3300035121 | Bacteria | 1396 |
| 909 | Ga0373942_0032327 | 3300035207 | Bacteria | 1389 |
| 910 | Ga0373942_0078542 | 3300035207 | Bacteria | 976 |
| 911 | Ga0373961_0094945 | 3300035241 | Bacteria | 958 |
| 912 | Ga0373962_0012789 | 3300035242 | Bacteria | 2119 |
| 913 | Ga0373962_0013224 | 3300035242 | Bacteria | 2087 |
| 914 | Ga0316574_0078180 | 3300035398 | Bacteria | 2098 |
| 915 | Ga0316574_0122232 | 3300035398 | Unclassified | 1672 |
| 916 | Ga0373924_0452019 | 3300035410 | Bacteria | 576 |
| 917 | Ga0373931_0011218 | 3300035691 | Bacteria | 4325 |
| 918 | Ga0316582_0204345 | 3300036647 | Bacteria | 1348 |
| 919 | Ga0316582_0430407 | 3300036647 | Bacteria | 909 |
| 920 | Ga0316584_0053682 | 3300036712 | Bacteria | 3016 |
| 921 | Ga0316584_0086906 | 3300036712 | Bacteria | 2340 |
| 922 | Ga0316584_0421280 | 3300036712 | Bacteria | 948 |
| 923 | Ga0395899_0013414 | 3300037312 | Bacteria | 6270 |
| 924 | Ga0395899_0748419 | 3300037312 | Bacteria | 609 |
| 925 | Ga0395900_0075741 | 3300037418 | Bacteria | 3459 |
| 926 | Ga0395900_0427612 | 3300037418 | Bacteria | 1284 |
| 927 | Ga0395898_0006692 | 3300037466 | Bacteria | 12285 |
| 928 | Ga0395898_0017702 | 3300037466 | Bacteria | 7272 |
| 929 | Ga0395905_0069865 | 3300037471 | Bacteria | 3290 |
| 930 | Ga0395905_0528676 | 3300037471 | Bacteria | 1080 |
| 931 | Ga0395905_0686939 | 3300037471 | Bacteria | 926 |
| 932 | Ga0316581_0167237 | 3300037588 | Bacteria | 678 |
| 933 | Ga0436364_0195317 | 3300037853 | Bacteria | 14583 |
| 934 | Ga0436364_0229870 | 3300037853 | Bacteria | 2546 |
| 935 | Ga0436364_1150617 | 3300037853 | Bacteria | 1209 |
| 936 | Ga0436364_1291536 | 3300037853 | Bacteria | 16625 |
| 937 | Ga0395901_0100975 | 3300038443 | Bacteria | 3027 |
| 938 | Ga0395901_0550223 | 3300038443 | Bacteria | 1170 |
| 939 | Ga0436365_0678211 | 3300039437 | Bacteria | 16182 |
| 940 | Ga0436365_0939033 | 3300039437 | Bacteria | 60216 |
| 941 | Ga0436365_0941882 | 3300039437 | Bacteria | 1214 |
| 942 | Ga0436365_1035060 | 3300039437 | Bacteria | 5579 |
| 943 | Ga0436365_1714810 | 3300039437 | Bacteria | 1471 |
| 944 | Ga0436365_1908396 | 3300039437 | Bacteria | 15438 |
| 945 | Ga0436360_0804941 | 3300039438 | Bacteria | 1061 |
| 946 | Ga0436361_0716923 | 3300039447 | Bacteria | 2117 |
| 947 | Ga0436361_1194425 | 3300039447 | Bacteria | 888 |
| 948 | Ga0436363_0444811 | 3300039450 | Bacteria | 1813 |
| 949 | Ga0436363_0754104 | 3300039450 | Bacteria | 1265 |
| 950 | Ga0436363_1331240 | 3300039450 | Bacteria | 1950 |
| 951 | Ga0436363_1709932 | 3300039450 | Bacteria | 972 |
| 952 | Ga0436362_0757592 | 3300039453 | Bacteria | 756 |
| 953 | Ga0436362_1212714 | 3300039453 | Bacteria | 721 |
| 954 | Ga0439439_0009171 | 3300041406 | Bacteria | 2348 |
| 955 | Ga0439439_0047088 | 3300041406 | Bacteria | 1126 |
| 956 | Ga0439461_0013378 | 3300041410 | Bacteria | 1548 |
| 957 | Ga0439461_0014671 | 3300041410 | Bacteria | 1493 |
| 958 | Ga0439461_0024659 | 3300041410 | Bacteria | 1217 |
| 959 | Ga0439466_0003274 | 3300041411 | Bacteria | 6307 |
| 960 | Ga0439466_0008207 | 3300041411 | Bacteria | 3937 |
| 961 | Ga0439466_0013164 | 3300041411 | Bacteria | 3031 |
| 962 | Ga0439466_0035103 | 3300041411 | Bacteria | 1697 |
| 963 | Ga0439465_0011614 | 3300041413 | Bacteria | 2764 |
| 964 | Ga0439465_0013051 | 3300041413 | Bacteria | 2595 |
| 965 | Ga0439465_0034846 | 3300041413 | Bacteria | 1612 |
| 966 | Ga0439465_0131683 | 3300041413 | Bacteria | 883 |
| 967 | Ga0439465_0336671 | 3300041413 | Bacteria | 568 |
| 968 | Ga0451787_711011 | 3300041441 | Bacteria | 502 |
| 969 | Ga0451789_0165262 | 3300041443 | Bacteria | 581 |
| 970 | Ga0451789_0361298 | 3300041443 | Bacteria | 696 |
| 971 | Ga0451789_0982272 | 3300041443 | Bacteria | 577 |
| 972 | Ga0451791_0176299 | 3300041451 | Bacteria | 1522 |
| 973 | Ga0451791_0923786 | 3300041451 | Bacteria | 903 |
| 974 | Ga0451793_0050578 | 3300041452 | Bacteria | 966 |
| 975 | Ga0451793_0165491 | 3300041452 | Bacteria | 967 |
| 976 | Ga0451793_0382258 | 3300041452 | Bacteria | 801 |
| 977 | Ga0451797_0462824 | 3300041453 | Bacteria | 600 |
| 978 | Ga0451797_0777865 | 3300041453 | Bacteria | 1023 |
| 979 | Ga0451798_1003370 | 3300041458 | Bacteria | 524 |
| 980 | Ga0451800_0949963 | 3300041459 | Bacteria | 1239 |
| 981 | Ga0451802_0290968 | 3300041460 | Bacteria | 794 |
| 982 | Ga0451802_1000802 | 3300041460 | Bacteria | 687 |
| 983 | Ga0451806_545077 | 3300041462 | Bacteria | 916 |
| 984 | Ga0451804_0768388 | 3300041463 | Bacteria | 516 |
| 985 | Ga0451807_1186087 | 3300041486 | Bacteria | 539 |
| 986 | Ga0451807_1334898 | 3300041486 | Bacteria | 1116 |
| 987 | Ga0451807_2088134 | 3300041486 | Bacteria | 856 |
| 988 | Ga0451833_0440069 | 3300041491 | Bacteria | 1317 |
| 989 | Ga0451835_0852016 | 3300041492 | Bacteria | 1378 |
| 990 | Ga0451837_0509056 | 3300041494 | Bacteria | 2339 |
| 991 | Ga0451839_0168767 | 3300041496 | Bacteria | 744 |
| 992 | Ga0451841_0295423 | 3300041498 | Bacteria | 777 |
| 993 | Ga0451841_1253551 | 3300041498 | Bacteria | 678 |
| 994 | Ga0451845_0166486 | 3300041501 | Bacteria | 1212 |
| 995 | Ga0451851_1033401 | 3300041507 | Bacteria | 972 |
| 996 | Ga0451843_0901391 | 3300041509 | Bacteria | 522 |
| 997 | Ga0451843_1680136 | 3300041509 | Bacteria | 1500 |
| 998 | Ga0451853_0050097 | 3300041512 | Bacteria | 501 |
| 999 | Ga0451853_0425702 | 3300041512 | Bacteria | 546 |
| 1000 | Ga0451853_0450169 | 3300041512 | Bacteria | 694 |
| 1001 | Ga0451853_1037975 | 3300041512 | Bacteria | 999 |
| 1002 | Ga0451853_2284613 | 3300041512 | Bacteria | 504 |
| 1003 | Ga0451853_3283147 | 3300041512 | Bacteria | 1546 |
| 1004 | Ga0451853_3835888 | 3300041512 | Bacteria | 2103 |
| 1005 | Ga0451853_3894526 | 3300041512 | Bacteria | 2740 |
| 1006 | Ga0439431_0007821 | 3300041997 | Bacteria | 2390 |
| 1007 | Ga0439431_0100112 | 3300041997 | Bacteria | 796 |
| 1008 | Ga0439433_0008537 | 3300041999 | Bacteria | 2224 |
| 1009 | Ga0439433_0014215 | 3300041999 | Bacteria | 1752 |
| 1010 | Ga0439442_016793 | 3300042002 | Bacteria | 1510 |
| 1011 | Ga0439442_024566 | 3300042002 | Bacteria | 1254 |
| 1012 | Ga0439445_0001826 | 3300042004 | Bacteria | 4689 |
| 1013 | Ga0439445_0101398 | 3300042004 | Bacteria | 816 |
| 1014 | Ga0439445_0135614 | 3300042004 | Bacteria | 712 |
| 1015 | Ga0439445_0147093 | 3300042004 | Bacteria | 685 |
| 1016 | Ga0439445_0262242 | 3300042004 | Bacteria | 517 |
| 1017 | Ga0439448_0004693 | 3300042005 | Bacteria | 3868 |
| 1018 | Ga0439448_0130866 | 3300042005 | Bacteria | 865 |
| 1019 | Ga0439448_0175236 | 3300042005 | Bacteria | 749 |
| 1020 | Ga0439448_0234069 | 3300042005 | Bacteria | 647 |
| 1021 | Ga0439449_0069372 | 3300042007 | Bacteria | 1299 |
| 1022 | Ga0439450_069576 | 3300042008 | Bacteria | 862 |
| 1023 | Ga0439454_050955 | 3300042011 | Bacteria | 699 |
| 1024 | Ga0439455_0075109 | 3300042012 | Bacteria | 912 |
| 1025 | Ga0439455_0197971 | 3300042012 | Bacteria | 581 |
| 1026 | Ga0439457_000455 | 3300042014 | Bacteria | 11799 |
| 1027 | Ga0439457_000479 | 3300042014 | Bacteria | 11535 |
| 1028 | Ga0439457_044746 | 3300042014 | Bacteria | 988 |
| 1029 | Ga0439462_0024184 | 3300042015 | Bacteria | 1594 |
| 1030 | Ga0439463_161594 | 3300042016 | Bacteria | 581 |
| 1031 | Ga0450890_011941 | 3300042127 | Bacteria | 1124 |
| 1032 | Ga0450894_000142 | 3300042131 | Bacteria | 12667 |
| 1033 | Ga0450895_001889 | 3300042132 | Bacteria | 1513 |
| 1034 | Ga0450898_023027 | 3300042134 | Bacteria | 1106 |
| 1035 | Ga0450898_034090 | 3300042134 | Bacteria | 944 |
| 1036 | Ga0450900_015664 | 3300042136 | Bacteria | 1021 |
| 1037 | Ga0450903_000121 | 3300042138 | Bacteria | 16870 |
| 1038 | Ga0450906_002225 | 3300042145 | Bacteria | 4239 |
| 1039 | Ga0439458_0001134 | 3300042157 | Bacteria | 6769 |
| 1040 | Ga0439458_0025509 | 3300042157 | Bacteria | 1387 |
| 1041 | Ga0450908_070131 | 3300042184 | Bacteria | 622 |
| 1042 | Ga0439434_0010812 | 3300042435 | Bacteria | 2693 |
| 1043 | Ga0439434_0016765 | 3300042435 | Bacteria | 2190 |
| 1044 | Ga0439434_0018207 | 3300042435 | Bacteria | 2101 |
| 1045 | Ga0439435_0023314 | 3300042436 | Bacteria | 1624 |
| 1046 | Ga0439435_0290320 | 3300042436 | Bacteria | 558 |
| 1047 | Ga0439459_0003093 | 3300042438 | Bacteria | 2614 |
| 1048 | Ga0450901_024223 | 3300042533 | Bacteria | 658 |
| 1049 | Ga0451577_0101787 | 3300042876 | Bacteria | 2567 |
| 1050 | Ga0439440_0260273 | 3300042993 | Bacteria | 531 |
| 1051 | Ga0466969_0000470 | 3300044656 | Bacteria | 22150 |
| 1052 | Ga0466969_0005382 | 3300044656 | Bacteria | 6810 |
| 1053 | Ga0466969_0009133 | 3300044656 | Bacteria | 5257 |
| 1054 | Ga0466969_0020850 | 3300044656 | Bacteria | 3391 |
| 1055 | Ga0466969_0034108 | 3300044656 | Bacteria | 2579 |
| 1056 | Ga0466969_0056244 | 3300044656 | Bacteria | 1921 |
| 1057 | Ga0466969_0063027 | 3300044656 | Bacteria | 1797 |
| 1058 | Ga0466969_0106363 | 3300044656 | Bacteria | 1316 |
| 1059 | Ga0466969_0345685 | 3300044656 | Bacteria | 673 |
| 1060 | Ga0466972_0005853 | 3300044658 | Bacteria | 6165 |
| 1061 | Ga0466972_0036904 | 3300044658 | Bacteria | 2389 |
| 1062 | Ga0466972_0038891 | 3300044658 | Bacteria | 2323 |
| 1063 | Ga0466972_0095647 | 3300044658 | Bacteria | 1407 |
| 1064 | Ga0466972_0119432 | 3300044658 | Bacteria | 1244 |
| 1065 | Ga0466972_0120005 | 3300044658 | Bacteria | 1240 |
| 1066 | Ga0466972_0132419 | 3300044658 | Bacteria | 1174 |
| 1067 | Ga0466972_0152676 | 3300044658 | Bacteria | 1085 |
| 1068 | Ga0466972_0246199 | 3300044658 | Bacteria | 836 |
| 1069 | Ga0466972_0341192 | 3300044658 | Bacteria | 700 |
| 1070 | Ga0466965_0005281 | 3300044683 | Bacteria | 5810 |
| 1071 | Ga0466965_0008504 | 3300044683 | Bacteria | 4749 |
| 1072 | Ga0466965_0023201 | 3300044683 | Bacteria | 2995 |
| 1073 | Ga0466965_0023923 | 3300044683 | Bacteria | 2952 |
| 1074 | Ga0466965_0065885 | 3300044683 | Bacteria | 1815 |
| 1075 | Ga0466965_0077985 | 3300044683 | Bacteria | 1673 |
| 1076 | Ga0466965_0112919 | 3300044683 | Bacteria | 1397 |
| 1077 | Ga0466965_0291718 | 3300044683 | Bacteria | 883 |
| 1078 | Ga0466965_0561309 | 3300044683 | Bacteria | 645 |
| 1079 | Ga0466966_0002225 | 3300044684 | Bacteria | 12619 |
| 1080 | Ga0466966_0002809 | 3300044684 | Bacteria | 11457 |
| 1081 | Ga0466966_0002940 | 3300044684 | Bacteria | 11227 |
| 1082 | Ga0466966_0003767 | 3300044684 | Bacteria | 10000 |
| 1083 | Ga0466966_0007557 | 3300044684 | Bacteria | 7200 |
| 1084 | Ga0466966_0010373 | 3300044684 | Bacteria | 6185 |
| 1085 | Ga0466966_0056388 | 3300044684 | Bacteria | 2485 |
| 1086 | Ga0466966_0074389 | 3300044684 | Bacteria | 2123 |
| 1087 | Ga0466966_0092900 | 3300044684 | Bacteria | 1871 |
| 1088 | Ga0466966_0653277 | 3300044684 | Bacteria | 633 |
| 1089 | Ga0466961_0002350 | 3300044693 | Bacteria | 11760 |
| 1090 | Ga0466961_0004001 | 3300044693 | Bacteria | 9225 |
| 1091 | Ga0466961_0006257 | 3300044693 | Bacteria | 7559 |
| 1092 | Ga0466961_0008642 | 3300044693 | Bacteria | 6491 |
| 1093 | Ga0466961_0020414 | 3300044693 | Bacteria | 4261 |
| 1094 | Ga0466961_0032599 | 3300044693 | Bacteria | 3348 |
| 1095 | Ga0466961_0136461 | 3300044693 | Bacteria | 1537 |
| 1096 | Ga0466961_0162770 | 3300044693 | Bacteria | 1390 |
| 1097 | Ga0466961_0259254 | 3300044693 | Bacteria | 1066 |
| 1098 | Ga0466961_0385157 | 3300044693 | Bacteria | 851 |
| 1099 | Ga0466961_0746316 | 3300044693 | Bacteria | 585 |
| 1100 | Ga0466961_0917618 | 3300044693 | Bacteria | 521 |
| 1101 | Ga0466961_0926254 | 3300044693 | Bacteria | 518 |
| 1102 | Ga0466963_0000656 | 3300044694 | Bacteria | 16684 |
| 1103 | Ga0466963_0002324 | 3300044694 | Bacteria | 10596 |
| 1104 | Ga0466963_0062229 | 3300044694 | Bacteria | 2497 |
| 1105 | Ga0466963_0097726 | 3300044694 | Bacteria | 2006 |
| 1106 | Ga0466963_0117681 | 3300044694 | Bacteria | 1827 |
| 1107 | Ga0466963_0215321 | 3300044694 | Bacteria | 1345 |
| 1108 | Ga0466963_0286500 | 3300044694 | Bacteria | 1158 |
| 1109 | Ga0466963_0375967 | 3300044694 | Bacteria | 1001 |
| 1110 | Ga0466963_0821591 | 3300044694 | Bacteria | 655 |
| 1111 | Ga0466964_0065505 | 3300044706 | Bacteria | 1522 |
| 1112 | Ga0466964_0120091 | 3300044706 | Bacteria | 1184 |
| 1113 | Ga0466964_0139210 | 3300044706 | Bacteria | 1114 |
| 1114 | Ga0466964_0658092 | 3300044706 | Bacteria | 580 |
| 1115 | Ga0466971_0000161 | 3300044719 | Bacteria | 25159 |
| 1116 | Ga0466971_0009498 | 3300044719 | Bacteria | 4246 |
| 1117 | Ga0466971_0010470 | 3300044719 | Bacteria | 4053 |
| 1118 | Ga0466971_0037329 | 3300044719 | Bacteria | 2177 |
| 1119 | Ga0466971_0038008 | 3300044719 | Bacteria | 2159 |
| 1120 | Ga0466971_0104911 | 3300044719 | Bacteria | 1301 |
| 1121 | Ga0466971_0194357 | 3300044719 | Bacteria | 956 |
| 1122 | Ga0466971_0204873 | 3300044719 | Bacteria | 932 |
| 1123 | Ga0466971_0245318 | 3300044719 | Bacteria | 852 |
| 1124 | Ga0466968_0003026 | 3300044735 | Bacteria | 6208 |
| 1125 | Ga0466968_0004670 | 3300044735 | Bacteria | 5129 |
| 1126 | Ga0466968_0017639 | 3300044735 | Bacteria | 2856 |
| 1127 | Ga0466968_0078172 | 3300044735 | Bacteria | 1450 |
| 1128 | Ga0466968_0087905 | 3300044735 | Bacteria | 1373 |
| 1129 | Ga0466968_0133985 | 3300044735 | Bacteria | 1129 |
| 1130 | Ga0466968_0204497 | 3300044735 | Bacteria | 926 |
| 1131 | Ga0466970_0002119 | 3300044765 | Bacteria | 9580 |
| 1132 | Ga0466970_0004779 | 3300044765 | Bacteria | 6691 |
| 1133 | Ga0466970_0008021 | 3300044765 | Bacteria | 5300 |
| 1134 | Ga0466970_0010155 | 3300044765 | Bacteria | 4771 |
| 1135 | Ga0466970_0101681 | 3300044765 | Bacteria | 1565 |
| 1136 | Ga0466970_0102256 | 3300044765 | Bacteria | 1561 |
| 1137 | Ga0466970_0293933 | 3300044765 | Bacteria | 915 |
| 1138 | Ga0466970_0629606 | 3300044765 | Bacteria | 623 |
| 1139 | Ga0466970_0897168 | 3300044765 | Bacteria | 521 |
| 1140 | Ga0466957_0001267 | 3300044842 | Bacteria | 13152 |
| 1141 | Ga0466957_0006730 | 3300044842 | Bacteria | 6496 |
| 1142 | Ga0466957_0019108 | 3300044842 | Bacteria | 4029 |
| 1143 | Ga0466957_0023478 | 3300044842 | Bacteria | 3646 |
| 1144 | Ga0466957_0071734 | 3300044842 | Bacteria | 2143 |
| 1145 | Ga0466957_0087858 | 3300044842 | Bacteria | 1944 |
| 1146 | Ga0466957_0144044 | 3300044842 | Bacteria | 1537 |
| 1147 | Ga0466957_0164351 | 3300044842 | Bacteria | 1443 |
| 1148 | Ga0466957_0337919 | 3300044842 | Bacteria | 1019 |
| 1149 | Ga0466957_0458162 | 3300044842 | Bacteria | 879 |
| 1150 | Ga0466957_0653684 | 3300044842 | Bacteria | 739 |
| 1151 | Ga0466957_0721896 | 3300044842 | Bacteria | 704 |
| 1152 | Ga0466960_0000046 | 3300044901 | Bacteria | 40430 |
| 1153 | Ga0466960_0001009 | 3300044901 | Bacteria | 10066 |
| 1154 | Ga0466960_0002661 | 3300044901 | Bacteria | 6738 |
| 1155 | Ga0466960_0004371 | 3300044901 | Bacteria | 5519 |
| 1156 | Ga0466960_0051070 | 3300044901 | Bacteria | 1996 |
| 1157 | Ga0466960_0178961 | 3300044901 | Bacteria | 1148 |
| 1158 | Ga0466960_0585153 | 3300044901 | Bacteria | 661 |
| 1159 | Ga0466959_0001597 | 3300045049 | Bacteria | 13978 |
| 1160 | Ga0466959_0002075 | 3300045049 | Bacteria | 12675 |
| 1161 | Ga0466959_0005630 | 3300045049 | Bacteria | 8617 |
| 1162 | Ga0466959_0019524 | 3300045049 | Bacteria | 4984 |
| 1163 | Ga0466959_0026773 | 3300045049 | Bacteria | 4276 |
| 1164 | Ga0466959_0027848 | 3300045049 | Bacteria | 4192 |
| 1165 | Ga0466959_0045345 | 3300045049 | Bacteria | 3238 |
| 1166 | Ga0466959_0050561 | 3300045049 | Bacteria | 3051 |
| 1167 | Ga0466959_0064953 | 3300045049 | Bacteria | 2649 |
| 1168 | Ga0466959_0116305 | 3300045049 | Bacteria | 1904 |
| 1169 | Ga0466959_0426793 | 3300045049 | Bacteria | 899 |
| 1170 | Ga0466958_0008122 | 3300045836 | Bacteria | 5808 |
| 1171 | Ga0466958_0033877 | 3300045836 | Bacteria | 3045 |
| 1172 | Ga0466958_0210873 | 3300045836 | Bacteria | 1237 |
| 1173 | Ga0466958_0588526 | 3300045836 | Bacteria | 723 |
| 1174 | Ga0466958_0675144 | 3300045836 | Bacteria | 673 |
| 1175 | Ga0466958_0823610 | 3300045836 | Bacteria | 605 |
| 1176 | Ga0466958_0984515 | 3300045836 | Bacteria | 550 |
| 1177 | Ga0466967_0000098 | 3300045976 | Bacteria | 31328 |
| 1178 | Ga0466967_0001175 | 3300045976 | Bacteria | 14690 |
| 1179 | Ga0466967_0004167 | 3300045976 | Bacteria | 9677 |
| 1180 | Ga0466967_0013920 | 3300045976 | Bacteria | 6240 |
| 1181 | Ga0466967_0015885 | 3300045976 | Bacteria | 5917 |
| 1182 | Ga0466967_0039775 | 3300045976 | Bacteria | 4045 |
| 1183 | Ga0466967_0044157 | 3300045976 | Bacteria | 3864 |
| 1184 | Ga0466967_0052656 | 3300045976 | Bacteria | 3574 |
| 1185 | Ga0466967_0090102 | 3300045976 | Bacteria | 2786 |
| 1186 | Ga0466967_0108859 | 3300045976 | Bacteria | 2543 |
| 1187 | Ga0466967_0206462 | 3300045976 | Bacteria | 1862 |
| 1188 | Ga0466967_0213462 | 3300045976 | Bacteria | 1831 |
| 1189 | Ga0466967_0254036 | 3300045976 | Bacteria | 1680 |
| 1190 | Ga0466967_0317645 | 3300045976 | Bacteria | 1501 |
| 1191 | Ga0466967_0808390 | 3300045976 | Bacteria | 931 |
| 1192 | Ga0466967_1448479 | 3300045976 | Bacteria | 684 |
| 1193 | Ga0466967_1667304 | 3300045976 | Bacteria | 635 |
| 1194 | Ga0466967_1936721 | 3300045976 | Bacteria | 586 |
| 1195 | Ga0495617_002450 | 3300046452 | Bacteria | 7374 |
| 1196 | Ga0495627_032876 | 3300046453 | Bacteria | 1630 |
| 1197 | Ga0495592_0005902 | 3300046454 | Bacteria | 9091 |
| 1198 | Ga0495592_0011481 | 3300046454 | Bacteria | 6705 |
| 1199 | Ga0495592_0017511 | 3300046454 | Bacteria | 5443 |
| 1200 | Ga0495592_0043495 | 3300046454 | Bacteria | 3360 |
| 1201 | Ga0495592_0232869 | 3300046454 | Bacteria | 1225 |
| 1202 | Ga0495592_0693649 | 3300046454 | Bacteria | 613 |
| 1203 | Ga0495603_0002752 | 3300046455 | Bacteria | 10360 |
| 1204 | Ga0495603_0005893 | 3300046455 | Bacteria | 7323 |
| 1205 | Ga0495603_0026486 | 3300046455 | Bacteria | 3502 |
| 1206 | Ga0495603_0027817 | 3300046455 | Bacteria | 3410 |
| 1207 | Ga0495603_0057695 | 3300046455 | Bacteria | 2296 |
| 1208 | Ga0495603_0058400 | 3300046455 | Bacteria | 2281 |
| 1209 | Ga0495603_0090468 | 3300046455 | Bacteria | 1790 |
| 1210 | Ga0495603_0324172 | 3300046455 | Bacteria | 884 |
| 1211 | Ga0495590_0167759 | 3300046457 | Bacteria | 799 |
| 1212 | Ga0495629_0007791 | 3300046459 | Bacteria | 7882 |
| 1213 | Ga0495629_0019021 | 3300046459 | Bacteria | 4912 |
| 1214 | Ga0495629_0036510 | 3300046459 | Bacteria | 3468 |
| 1215 | Ga0495629_0038099 | 3300046459 | Bacteria | 3388 |
| 1216 | Ga0495629_0050864 | 3300046459 | Bacteria | 2901 |
| 1217 | Ga0495629_0199262 | 3300046459 | Bacteria | 1384 |
| 1218 | Ga0495629_0625817 | 3300046459 | Bacteria | 718 |
| 1219 | Ga0495629_0879766 | 3300046459 | Bacteria | 588 |
| 1220 | Ga0495638_0006268 | 3300046460 | Bacteria | 8682 |
| 1221 | Ga0495638_0037802 | 3300046460 | Bacteria | 3070 |
| 1222 | Ga0495638_0047159 | 3300046460 | Bacteria | 2703 |
| 1223 | Ga0495638_0069235 | 3300046460 | Bacteria | 2163 |
| 1224 | Ga0495638_0372591 | 3300046460 | Bacteria | 748 |
| 1225 | Ga0495641_0036692 | 3300046461 | Bacteria | 2302 |
| 1226 | Ga0495651_0001691 | 3300046462 | Bacteria | 17058 |
| 1227 | Ga0495651_0002270 | 3300046462 | Bacteria | 14836 |
| 1228 | Ga0495651_0020919 | 3300046462 | Bacteria | 5080 |
| 1229 | Ga0495651_0032656 | 3300046462 | Bacteria | 4059 |
| 1230 | Ga0495653_0009684 | 3300046463 | Bacteria | 7879 |
| 1231 | Ga0495653_0125804 | 3300046463 | Bacteria | 1820 |
| 1232 | Ga0495580_0007503 | 3300046472 | Bacteria | 8764 |
| 1233 | Ga0495580_0093565 | 3300046472 | Bacteria | 2091 |
| 1234 | Ga0495580_0295347 | 3300046472 | Bacteria | 1104 |
| 1235 | Ga0495582_0015462 | 3300046473 | Bacteria | 4192 |
| 1236 | Ga0495582_0020967 | 3300046473 | Bacteria | 3579 |
| 1237 | Ga0495582_0123656 | 3300046473 | Bacteria | 1459 |
| 1238 | Ga0495582_0286903 | 3300046473 | Bacteria | 945 |
| 1239 | Ga0495605_0040643 | 3300046474 | Bacteria | 2320 |
| 1240 | Ga0495605_0136378 | 3300046474 | Bacteria | 1103 |
| 1241 | Ga0495639_0035778 | 3300046475 | Bacteria | 2222 |
| 1242 | Ga0495639_0152229 | 3300046475 | Bacteria | 1116 |
| 1243 | Ga0495662_0003027 | 3300046476 | Bacteria | 8480 |
| 1244 | Ga0495662_0003988 | 3300046476 | Bacteria | 7436 |
| 1245 | Ga0495662_0004401 | 3300046476 | Bacteria | 7073 |
| 1246 | Ga0495662_0030461 | 3300046476 | Bacteria | 2604 |
| 1247 | Ga0495662_0578598 | 3300046476 | Bacteria | 549 |
| 1248 | Ga0495664_0002306 | 3300046477 | Bacteria | 10231 |
| 1249 | Ga0495664_0006527 | 3300046477 | Bacteria | 6447 |
| 1250 | Ga0495664_0168961 | 3300046477 | Bacteria | 1327 |
| 1251 | Ga0495664_0638228 | 3300046477 | Bacteria | 631 |
| 1252 | Ga0495584_0489469 | 3300046491 | Bacteria | 626 |
| 1253 | Ga0495585_0006843 | 3300046492 | Bacteria | 7033 |
| 1254 | Ga0495585_0011896 | 3300046492 | Bacteria | 5138 |
| 1255 | Ga0495585_0056441 | 3300046492 | Bacteria | 2169 |
| 1256 | Ga0495585_0084605 | 3300046492 | Bacteria | 1715 |
| 1257 | Ga0495594_0012495 | 3300046499 | Bacteria | 4423 |
| 1258 | Ga0495594_0019099 | 3300046499 | Bacteria | 3640 |
| 1259 | Ga0495594_0036869 | 3300046499 | Bacteria | 2668 |
| 1260 | Ga0495594_0067391 | 3300046499 | Bacteria | 1986 |
| 1261 | Ga0495594_0105804 | 3300046499 | Bacteria | 1584 |
| 1262 | Ga0495594_0425777 | 3300046499 | Bacteria | 755 |
| 1263 | Ga0495596_0007205 | 3300046500 | Bacteria | 5032 |
| 1264 | Ga0495607_0027724 | 3300046501 | Bacteria | 3499 |
| 1265 | Ga0495607_0116405 | 3300046501 | Bacteria | 1410 |
| 1266 | Ga0495583_0030647 | 3300046506 | Bacteria | 2616 |
| 1267 | Ga0495583_0152135 | 3300046506 | Bacteria | 958 |
| 1268 | Ga0495583_0188811 | 3300046506 | Bacteria | 841 |
| 1269 | Ga0495583_0249917 | 3300046506 | Bacteria | 711 |
| 1270 | Ga0495606_0024751 | 3300046507 | Bacteria | 4317 |
| 1271 | Ga0495606_0040870 | 3300046507 | Bacteria | 3113 |
| 1272 | Ga0495608_0001723 | 3300046511 | Bacteria | 15662 |
| 1273 | Ga0495608_0029184 | 3300046511 | Bacteria | 3745 |
| 1274 | Ga0495608_0273468 | 3300046511 | Bacteria | 1050 |
| 1275 | Ga0495608_0570525 | 3300046511 | Bacteria | 681 |
| 1276 | Ga0495616_0034448 | 3300046513 | Bacteria | 2630 |
| 1277 | Ga0495618_0020219 | 3300046514 | Bacteria | 4100 |
| 1278 | Ga0495618_0029070 | 3300046514 | Bacteria | 3446 |
| 1279 | Ga0495618_0085032 | 3300046514 | Bacteria | 2021 |
| 1280 | Ga0495618_0251534 | 3300046514 | Bacteria | 1108 |
| 1281 | Ga0495620_0175873 | 3300046515 | Bacteria | 828 |
| 1282 | Ga0495620_0197374 | 3300046515 | Bacteria | 774 |
| 1283 | Ga0495628_0001384 | 3300046516 | Bacteria | 22247 |
| 1284 | Ga0495628_0012481 | 3300046516 | Bacteria | 7162 |
| 1285 | Ga0495628_0026361 | 3300046516 | Bacteria | 4740 |
| 1286 | Ga0495628_0050390 | 3300046516 | Bacteria | 3293 |
| 1287 | Ga0495628_0149375 | 3300046516 | Bacteria | 1780 |
| 1288 | Ga0495630_0048762 | 3300046517 | Bacteria | 3169 |
| 1289 | Ga0495630_0265887 | 3300046517 | Bacteria | 1310 |
| 1290 | Ga0495630_0324468 | 3300046517 | Bacteria | 1177 |
| 1291 | Ga0495630_0613214 | 3300046517 | Bacteria | 834 |
| 1292 | Ga0495631_0003549 | 3300046518 | Bacteria | 8528 |
| 1293 | Ga0495631_0472694 | 3300046518 | Bacteria | 534 |
| 1294 | Ga0495632_0028374 | 3300046519 | Bacteria | 2921 |
| 1295 | Ga0495632_0430800 | 3300046519 | Bacteria | 574 |
| 1296 | Ga0495637_0006755 | 3300046520 | Bacteria | 5740 |
| 1297 | Ga0495643_0007275 | 3300046522 | Bacteria | 7155 |
| 1298 | Ga0495643_0085567 | 3300046522 | Bacteria | 1634 |
| 1299 | Ga0495644_0157588 | 3300046523 | Bacteria | 870 |
| 1300 | Ga0495648_0069856 | 3300046524 | Bacteria | 2042 |
| 1301 | Ga0495648_0112305 | 3300046524 | Bacteria | 1480 |
| 1302 | Ga0495648_0204897 | 3300046524 | Bacteria | 984 |
| 1303 | Ga0495648_0413244 | 3300046524 | Bacteria | 600 |
| 1304 | Ga0495666_0000571 | 3300046526 | Bacteria | 16465 |
| 1305 | Ga0495666_0024248 | 3300046526 | Bacteria | 2997 |
| 1306 | Ga0495666_0138843 | 3300046526 | Bacteria | 1134 |
| 1307 | Ga0495666_0481718 | 3300046526 | Bacteria | 555 |
| 1308 | Ga0495642_0082291 | 3300046528 | Bacteria | 1357 |
| 1309 | Ga0495652_0002119 | 3300046529 | Bacteria | 20914 |
| 1310 | Ga0495652_0018989 | 3300046529 | Bacteria | 6124 |
| 1311 | Ga0495652_0024558 | 3300046529 | Bacteria | 5334 |
| 1312 | Ga0495652_0069396 | 3300046529 | Bacteria | 2950 |
| 1313 | Ga0495652_0072250 | 3300046529 | Bacteria | 2876 |
| 1314 | Ga0495654_0007357 | 3300046530 | Bacteria | 6159 |
| 1315 | Ga0495665_0005483 | 3300046531 | Bacteria | 6832 |
| 1316 | Ga0495665_0509134 | 3300046531 | Bacteria | 606 |
| 1317 | Ga0495640_0005626 | 3300046533 | Bacteria | 9968 |
| 1318 | Ga0495640_0013818 | 3300046533 | Bacteria | 6132 |
| 1319 | Ga0495640_0016680 | 3300046533 | Bacteria | 5493 |
| 1320 | Ga0495640_0017644 | 3300046533 | Bacteria | 5312 |
| 1321 | Ga0495640_0142738 | 3300046533 | Bacteria | 1543 |
| 1322 | Ga0495640_0182550 | 3300046533 | Bacteria | 1336 |
| 1323 | Ga0495640_0913821 | 3300046533 | Bacteria | 520 |
| 1324 | Ga0495586_0246189 | 3300046535 | Bacteria | 1019 |
| 1325 | Ga0495587_0079197 | 3300046536 | Bacteria | 1905 |
| 1326 | Ga0495587_0199871 | 3300046536 | Bacteria | 1130 |
| 1327 | Ga0495587_0705976 | 3300046536 | Bacteria | 553 |
| 1328 | Ga0495609_0004676 | 3300046538 | Bacteria | 7418 |
| 1329 | Ga0495597_0031747 | 3300046542 | Bacteria | 2400 |
| 1330 | Ga0495597_0229000 | 3300046542 | Bacteria | 736 |
| 1331 | Ga0495597_0302666 | 3300046542 | Bacteria | 620 |
| 1332 | Ga0495645_0024216 | 3300046543 | Bacteria | 4404 |
| 1333 | Ga0495645_0028167 | 3300046543 | Bacteria | 4081 |
| 1334 | Ga0495645_0045978 | 3300046543 | Bacteria | 3183 |
| 1335 | Ga0495645_0101595 | 3300046543 | Bacteria | 2044 |
| 1336 | Ga0495645_0888778 | 3300046543 | Bacteria | 529 |
| 1337 | Ga0495622_0005380 | 3300046557 | Bacteria | 5944 |
| 1338 | Ga0495622_0015971 | 3300046557 | Bacteria | 3491 |
| 1339 | Ga0495622_0056033 | 3300046557 | Bacteria | 1828 |
| 1340 | Ga0495633_0031583 | 3300046558 | Bacteria | 2565 |
| 1341 | Ga0495667_0033930 | 3300046559 | Bacteria | 3413 |
| 1342 | Ga0495667_0153082 | 3300046559 | Bacteria | 1484 |
| 1343 | Ga0495667_0323018 | 3300046559 | Bacteria | 976 |
| 1344 | Ga0495656_0329388 | 3300046615 | Bacteria | 788 |
| 1345 | Ga0495668_0000123 | 3300046616 | Bacteria | 115173 |
| 1346 | Ga0495668_0036571 | 3300046616 | Bacteria | 2751 |
| 1347 | Ga0495668_0651628 | 3300046616 | Bacteria | 582 |
| 1348 | Ga0495634_0006120 | 3300046642 | Bacteria | 9162 |
| 1349 | Ga0495634_0010265 | 3300046642 | Bacteria | 6861 |
| 1350 | Ga0495634_0050187 | 3300046642 | Bacteria | 2803 |
| 1351 | Ga0495634_0213792 | 3300046642 | Bacteria | 1192 |
| 1352 | Ga0495634_0276759 | 3300046642 | Bacteria | 1020 |
| 1353 | Ga0495634_0382681 | 3300046642 | Bacteria | 838 |
| 1354 | Ga0495611_0057795 | 3300046648 | Bacteria | 1758 |
| 1355 | Ga0495611_0215774 | 3300046648 | Bacteria | 893 |
| 1356 | Ga0495625_0005807 | 3300046660 | Bacteria | 11145 |
| 1357 | Ga0495625_0029488 | 3300046660 | Bacteria | 4102 |
| 1358 | Ga0495625_0238937 | 3300046660 | Bacteria | 1183 |
| 1359 | Ga0495635_0002565 | 3300046663 | Bacteria | 12433 |
| 1360 | Ga0495635_0004355 | 3300046663 | Bacteria | 9800 |
| 1361 | Ga0495635_0066218 | 3300046663 | Bacteria | 2477 |
| 1362 | Ga0495635_0071866 | 3300046663 | Bacteria | 2371 |
| 1363 | Ga0495635_0088357 | 3300046663 | Bacteria | 2121 |
| 1364 | Ga0495635_0341668 | 3300046663 | Bacteria | 1000 |
| 1365 | Ga0495635_0375901 | 3300046663 | Bacteria | 946 |
| 1366 | Ga0495659_0219554 | 3300046664 | Bacteria | 785 |
| 1367 | Ga0495659_0562685 | 3300046664 | Bacteria | 504 |
| 1368 | Ga0495661_0023540 | 3300046665 | Bacteria | 3997 |
| 1369 | Ga0495661_0175298 | 3300046665 | Bacteria | 1140 |
| 1370 | Ga0495588_0003543 | 3300046674 | Bacteria | 6816 |
| 1371 | Ga0495588_0003986 | 3300046674 | Bacteria | 6486 |
| 1372 | Ga0495588_0005355 | 3300046674 | Bacteria | 5704 |
| 1373 | Ga0495588_0010107 | 3300046674 | Bacteria | 4377 |
| 1374 | Ga0495657_0003629 | 3300046675 | Bacteria | 12539 |
| 1375 | Ga0495657_0007083 | 3300046675 | Bacteria | 8700 |
| 1376 | Ga0495657_0008037 | 3300046675 | Bacteria | 8088 |
| 1377 | Ga0495657_0008501 | 3300046675 | Bacteria | 7848 |
| 1378 | Ga0495599_0049987 | 3300046678 | Bacteria | 2621 |
| 1379 | Ga0495599_0064358 | 3300046678 | Bacteria | 2290 |
| 1380 | Ga0495599_0326318 | 3300046678 | Bacteria | 923 |
| 1381 | Ga0495623_0059476 | 3300046679 | Bacteria | 2399 |
| 1382 | Ga0495623_0075257 | 3300046679 | Bacteria | 2097 |
| 1383 | Ga0495623_0135461 | 3300046679 | Bacteria | 1470 |
| 1384 | Ga0495623_0363063 | 3300046679 | Bacteria | 786 |
| 1385 | Ga0495646_0000855 | 3300046680 | Bacteria | 17256 |
| 1386 | Ga0495646_0010343 | 3300046680 | Bacteria | 5933 |
| 1387 | Ga0495646_0051847 | 3300046680 | Bacteria | 2481 |
| 1388 | Ga0495646_0094322 | 3300046680 | Bacteria | 1723 |
| 1389 | Ga0495646_0620530 | 3300046680 | Bacteria | 548 |
| 1390 | Ga0495658_0002176 | 3300046683 | Bacteria | 9917 |
| 1391 | Ga0495658_0112189 | 3300046683 | Bacteria | 1640 |
| 1392 | Ga0495658_0538936 | 3300046683 | Bacteria | 747 |
| 1393 | Ga0495669_0356984 | 3300046684 | Bacteria | 707 |
| 1394 | Ga0495613_0001664 | 3300046689 | Bacteria | 16910 |
| 1395 | Ga0495613_0006878 | 3300046689 | Bacteria | 8487 |
| 1396 | Ga0495613_0007886 | 3300046689 | Bacteria | 7917 |
| 1397 | Ga0495613_0017322 | 3300046689 | Bacteria | 5368 |
| 1398 | Ga0495613_0042788 | 3300046689 | Bacteria | 3350 |
| 1399 | Ga0495613_0056747 | 3300046689 | Bacteria | 2875 |
| 1400 | Ga0495613_0085162 | 3300046689 | Bacteria | 2294 |
| 1401 | Ga0495613_0096472 | 3300046689 | Bacteria | 2138 |
| 1402 | Ga0495613_0539877 | 3300046689 | Bacteria | 781 |
| 1403 | Ga0495624_0075201 | 3300046690 | Bacteria | 2098 |
| 1404 | Ga0495624_0199910 | 3300046690 | Bacteria | 1214 |
| 1405 | Ga0495624_0706154 | 3300046690 | Bacteria | 598 |
| 1406 | Ga0495670_0055508 | 3300046691 | Bacteria | 1986 |
| 1407 | Ga0495670_0058872 | 3300046691 | Bacteria | 1928 |
| 1408 | Ga0495670_0176563 | 3300046691 | Bacteria | 1126 |
| 1409 | Ga0495671_0013941 | 3300046692 | Bacteria | 4335 |
| 1410 | Ga0495671_0030234 | 3300046692 | Bacteria | 2775 |
| 1411 | Ga0495671_0147806 | 3300046692 | Bacteria | 1144 |
| 1412 | Ga0495649_0031220 | 3300046694 | Bacteria | 2938 |
| 1413 | Ga0495649_0171518 | 3300046694 | Bacteria | 1135 |
| 1414 | Ga0495649_0183630 | 3300046694 | Bacteria | 1090 |
| 1415 | Ga0495649_0247873 | 3300046694 | Bacteria | 915 |
| 1416 | Ga0495649_0584368 | 3300046694 | Bacteria | 552 |
| 1417 | Ga0495589_0036165 | 3300046794 | Bacteria | 2476 |
| 1418 | Ga0495589_0042640 | 3300046794 | Bacteria | 2261 |
| 1419 | Ga0495589_0436546 | 3300046794 | Bacteria | 600 |
| 1420 | Ga0495600_0003542 | 3300046809 | Bacteria | 9186 |
| 1421 | Ga0495600_0010402 | 3300046809 | Bacteria | 5777 |
| 1422 | Ga0495600_0017095 | 3300046809 | Bacteria | 4611 |
| 1423 | Ga0495600_0051070 | 3300046809 | Bacteria | 2699 |
| 1424 | Ga0495600_0350712 | 3300046809 | Bacteria | 924 |
| 1425 | Ga0495660_0031126 | 3300046810 | Bacteria | 3002 |
| 1426 | Ga0495660_0038922 | 3300046810 | Bacteria | 2642 |
| 1427 | Ga0495581_0011118 | 3300047315 | Bacteria | 5201 |
| 1428 | Ga0495581_0053853 | 3300047315 | Bacteria | 2323 |
| 1429 | Ga0495581_0081771 | 3300047315 | Bacteria | 1870 |
| 1430 | Ga0495581_0096503 | 3300047315 | Bacteria | 1716 |
| 1431 | Ga0495604_0002351 | 3300047317 | Bacteria | 15156 |
| 1432 | Ga0495604_0004817 | 3300047317 | Bacteria | 10702 |
| 1433 | Ga0495604_0007383 | 3300047317 | Bacteria | 8710 |
| 1434 | Ga0495604_0063067 | 3300047317 | Bacteria | 2828 |
| 1435 | Ga0495604_0285633 | 3300047317 | Bacteria | 1113 |
| 1436 | Ga0495636_0007700 | 3300047318 | Bacteria | 4236 |
| 1437 | Ga0495636_0036875 | 3300047318 | Bacteria | 2018 |
| 1438 | Ga0495636_0037499 | 3300047318 | Bacteria | 2002 |
| 1439 | Ga0495636_0087387 | 3300047318 | Bacteria | 1349 |
| 1440 | Ga0495674_0067245 | 3300047319 | Bacteria | 3105 |
| 1441 | Ga0495674_0070922 | 3300047319 | Bacteria | 3010 |
| 1442 | Ga0495674_0119479 | 3300047319 | Bacteria | 2227 |
| 1443 | Ga0495674_0268767 | 3300047319 | Bacteria | 1400 |
| 1444 | Ga0495674_0283155 | 3300047319 | Bacteria | 1358 |
| 1445 | Ga0495672_0010127 | 3300047320 | Bacteria | 6743 |
| 1446 | Ga0495672_0028030 | 3300047320 | Bacteria | 3570 |
| 1447 | Ga0495676_0001590 | 3300047321 | Bacteria | 19706 |
| 1448 | Ga0495676_0002415 | 3300047321 | Bacteria | 16590 |
| 1449 | Ga0495676_0147379 | 3300047321 | Bacteria | 1679 |
| 1450 | Ga0495676_0290392 | 3300047321 | Bacteria | 1105 |
| 1451 | Ga0495680_0178410 | 3300047322 | Bacteria | 1534 |
| 1452 | Ga0495680_0452211 | 3300047322 | Bacteria | 879 |
| 1453 | Ga0495683_0000766 | 3300047323 | Bacteria | 23099 |
| 1454 | Ga0495683_0021951 | 3300047323 | Bacteria | 3286 |
| 1455 | Ga0495687_001147 | 3300047443 | Bacteria | 25643 |
| 1456 | Ga0495687_003306 | 3300047443 | Bacteria | 11824 |
| 1457 | Ga0495687_039955 | 3300047443 | Bacteria | 2071 |
| 1458 | Ga0495687_140261 | 3300047443 | Bacteria | 841 |
| 1459 | Ga0495675_0011687 | 3300047444 | Bacteria | 5512 |
| 1460 | Ga0495675_0021916 | 3300047444 | Bacteria | 4070 |
| 1461 | Ga0495675_0030965 | 3300047444 | Bacteria | 3414 |
| 1462 | Ga0495675_0059587 | 3300047444 | Bacteria | 2420 |
| 1463 | Ga0495675_0059974 | 3300047444 | Bacteria | 2412 |
| 1464 | Ga0495675_0174278 | 3300047444 | Bacteria | 1320 |
| 1465 | Ga0495675_0390066 | 3300047444 | Bacteria | 813 |
| 1466 | Ga0495679_011002 | 3300047446 | Bacteria | 3519 |
| 1467 | Ga0495685_001275 | 3300047447 | Bacteria | 7695 |
| 1468 | Ga0495685_006034 | 3300047447 | Bacteria | 3959 |
| 1469 | Ga0495685_081645 | 3300047447 | Bacteria | 1076 |
| 1470 | Ga0495685_108302 | 3300047447 | Bacteria | 915 |
| 1471 | Ga0495673_0000456 | 3300047469 | Bacteria | 44587 |
| 1472 | Ga0495681_0003151 | 3300047470 | Bacteria | 11550 |
| 1473 | Ga0495681_0020011 | 3300047470 | Bacteria | 3639 |
| 1474 | Ga0495684_0123494 | 3300047471 | Bacteria | 1948 |
| 1475 | Ga0495684_0157647 | 3300047471 | Bacteria | 1695 |
| 1476 | Ga0495686_0000637 | 3300047472 | Bacteria | 48296 |
| 1477 | Ga0495686_0063634 | 3300047472 | Bacteria | 2285 |
| 1478 | Ga0495686_0232025 | 3300047472 | Bacteria | 1044 |
| 1479 | Ga0495593_0001812 | 3300047673 | Bacteria | 12696 |
| 1480 | Ga0495593_0055656 | 3300047673 | Bacteria | 2081 |
| 1481 | Ga0495593_0346380 | 3300047673 | Bacteria | 742 |
| 1482 | Ga0495602_0055166 | 3300048088 | Bacteria | 3501 |
| 1483 | Ga0495602_0199002 | 3300048088 | Bacteria | 1530 |
| 1484 | Ga0495602_0397105 | 3300048088 | Bacteria | 984 |
| 1485 | Ga0495602_0518465 | 3300048088 | Bacteria | 830 |
| 1486 | Ga0495602_0531111 | 3300048088 | Bacteria | 818 |
| 1487 | Ga0495602_1102216 | 3300048088 | Bacteria | 520 |
| 1488 | Ga0495614_0000229 | 3300048089 | Bacteria | 21780 |
| 1489 | Ga0495614_0009446 | 3300048089 | Bacteria | 4311 |
| 1490 | Ga0495614_0122938 | 3300048089 | Bacteria | 1145 |
| 1491 | Ga0495626_0020580 | 3300048091 | Bacteria | 3285 |
| 1492 | Ga0495626_0066961 | 3300048091 | Bacteria | 1623 |
| 1493 | Ga0495626_0153541 | 3300048091 | Bacteria | 969 |
| 1494 | Ga0496100_0000067 | 3300048903 | Bacteria | 58703 |
| 1495 | Ga0496100_0000461 | 3300048903 | Bacteria | 19507 |
| 1496 | Ga0496100_0004004 | 3300048903 | Bacteria | 7749 |
| 1497 | Ga0496100_0004747 | 3300048903 | Bacteria | 7250 |
| 1498 | Ga0496100_0007759 | 3300048903 | Bacteria | 5947 |
| 1499 | Ga0496100_0096240 | 3300048903 | Bacteria | 2031 |
| 1500 | Ga0496100_0148167 | 3300048903 | Bacteria | 1671 |
| 1501 | Ga0496100_0249001 | 3300048903 | Bacteria | 1314 |
| 1502 | Ga0496100_0295276 | 3300048903 | Bacteria | 1212 |
| 1503 | Ga0496100_0449650 | 3300048903 | Bacteria | 987 |
| 1504 | Ga0496100_0546531 | 3300048903 | Bacteria | 896 |
| 1505 | Ga0496101_0000099 | 3300048904 | Bacteria | 90235 |
| 1506 | Ga0496101_0000108 | 3300048904 | Bacteria | 86290 |
| 1507 | Ga0496101_0000750 | 3300048904 | Bacteria | 19213 |
| 1508 | Ga0496101_0000793 | 3300048904 | Bacteria | 18695 |
| 1509 | Ga0496101_0015063 | 3300048904 | Bacteria | 5205 |
| 1510 | Ga0496101_0098732 | 3300048904 | Bacteria | 2182 |
| 1511 | Ga0496101_0112323 | 3300048904 | Bacteria | 2052 |
| 1512 | Ga0496101_0162987 | 3300048904 | Bacteria | 1711 |
| 1513 | Ga0496101_0768929 | 3300048904 | Bacteria | 760 |
| 1514 | Ga0496101_0852392 | 3300048904 | Bacteria | 718 |
| 1515 | Ga0496101_1140795 | 3300048904 | Bacteria | 612 |
| 1516 | Ga0496102_0000005 | 3300048905 | Bacteria | 481937 |
| 1517 | Ga0496102_0000390 | 3300048905 | Bacteria | 51759 |
| 1518 | Ga0496102_0003032 | 3300048905 | Bacteria | 14221 |
| 1519 | Ga0496102_0006978 | 3300048905 | Bacteria | 9635 |
| 1520 | Ga0496102_0030945 | 3300048905 | Bacteria | 4794 |
| 1521 | Ga0496102_0051773 | 3300048905 | Bacteria | 3740 |
| 1522 | Ga0496102_0093526 | 3300048905 | Bacteria | 2785 |
| 1523 | Ga0496102_0140005 | 3300048905 | Bacteria | 2268 |
| 1524 | Ga0496102_0143275 | 3300048905 | Bacteria | 2241 |
| 1525 | Ga0496102_0211602 | 3300048905 | Bacteria | 1828 |
| 1526 | Ga0496102_0216993 | 3300048905 | Bacteria | 1803 |
| 1527 | Ga0496102_0437293 | 3300048905 | Bacteria | 1228 |
| 1528 | Ga0496102_0504239 | 3300048905 | Bacteria | 1132 |
| 1529 | Ga0496102_1061507 | 3300048905 | Bacteria | 730 |
| 1530 | Ga0496102_1595120 | 3300048905 | Bacteria | 571 |
| 1531 | Ga0496103_0000002 | 3300048906 | Bacteria | 605387 |
| 1532 | Ga0496103_0000116 | 3300048906 | Bacteria | 86969 |
| 1533 | Ga0496103_0000663 | 3300048906 | Bacteria | 25925 |
| 1534 | Ga0496103_0001688 | 3300048906 | Bacteria | 14442 |
| 1535 | Ga0496103_0017503 | 3300048906 | Bacteria | 4290 |
| 1536 | Ga0496103_0488755 | 3300048906 | Bacteria | 788 |
| 1537 | Ga0496104_0007517 | 3300048907 | Bacteria | 9631 |
| 1538 | Ga0496104_0011507 | 3300048907 | Bacteria | 7929 |
| 1539 | Ga0496104_0044914 | 3300048907 | Bacteria | 4153 |
| 1540 | Ga0496104_0046988 | 3300048907 | Bacteria | 4068 |
| 1541 | Ga0496104_0659991 | 3300048907 | Bacteria | 955 |
| 1542 | Ga0496104_1474620 | 3300048907 | Bacteria | 583 |
| 1543 | Ga0496105_0064390 | 3300048908 | Bacteria | 3025 |
| 1544 | Ga0496105_0176837 | 3300048908 | Bacteria | 1748 |
| 1545 | Ga0496105_0327777 | 3300048908 | Bacteria | 1226 |
| 1546 | Ga0496105_0501550 | 3300048908 | Bacteria | 953 |
| 1547 | Ga0496105_0508548 | 3300048908 | Bacteria | 945 |
| 1548 | Ga0496105_0953297 | 3300048908 | Bacteria | 644 |
| 1549 | Ga0496106_0000424 | 3300048909 | Bacteria | 30065 |
| 1550 | Ga0496106_0001149 | 3300048909 | Bacteria | 19609 |
| 1551 | Ga0496106_0001741 | 3300048909 | Bacteria | 16250 |
| 1552 | Ga0496106_0002018 | 3300048909 | Bacteria | 15276 |
| 1553 | Ga0496106_0016794 | 3300048909 | Bacteria | 5415 |
| 1554 | Ga0496106_0177217 | 3300048909 | Bacteria | 1691 |
| 1555 | Ga0496106_0212106 | 3300048909 | Bacteria | 1543 |
| 1556 | Ga0496106_0234277 | 3300048909 | Bacteria | 1466 |
| 1557 | Ga0496106_0318636 | 3300048909 | Bacteria | 1248 |
| 1558 | Ga0496106_0624970 | 3300048909 | Bacteria | 862 |
| 1559 | Ga0496106_0846820 | 3300048909 | Bacteria | 724 |
| 1560 | Ga0496106_1472165 | 3300048909 | Bacteria | 524 |
| 1561 | Ga0496107_0000079 | 3300048910 | Bacteria | 46405 |
| 1562 | Ga0496107_0000254 | 3300048910 | Bacteria | 28236 |
| 1563 | Ga0496107_0014513 | 3300048910 | Bacteria | 5514 |
| 1564 | Ga0496107_0214834 | 3300048910 | Bacteria | 1430 |
| 1565 | Ga0496107_0247435 | 3300048910 | Bacteria | 1327 |
| 1566 | Ga0496107_0275597 | 3300048910 | Bacteria | 1252 |
| 1567 | Ga0496107_0706240 | 3300048910 | Bacteria | 741 |
| 1568 | Ga0496108_0005688 | 3300048911 | Bacteria | 10091 |
| 1569 | Ga0496108_0011641 | 3300048911 | Bacteria | 7156 |
| 1570 | Ga0496108_0033237 | 3300048911 | Bacteria | 4285 |
| 1571 | Ga0496108_0071519 | 3300048911 | Bacteria | 2927 |
| 1572 | Ga0496108_0110258 | 3300048911 | Bacteria | 2353 |
| 1573 | Ga0496108_0137681 | 3300048911 | Bacteria | 2102 |
| 1574 | Ga0496108_0174780 | 3300048911 | Bacteria | 1859 |
| 1575 | Ga0496108_0259237 | 3300048911 | Bacteria | 1513 |
| 1576 | Ga0496108_0326318 | 3300048911 | Bacteria | 1338 |
| 1577 | Ga0496108_1260981 | 3300048911 | Bacteria | 623 |
| 1578 | Ga0496109_0000159 | 3300048912 | Bacteria | 66124 |
| 1579 | Ga0496109_0002268 | 3300048912 | Bacteria | 15983 |
| 1580 | Ga0496109_0010817 | 3300048912 | Bacteria | 7812 |
| 1581 | Ga0496109_0023653 | 3300048912 | Bacteria | 5454 |
| 1582 | Ga0496109_0038336 | 3300048912 | Bacteria | 4332 |
| 1583 | Ga0496109_0182877 | 3300048912 | Bacteria | 1969 |
| 1584 | Ga0496109_0418659 | 3300048912 | Bacteria | 1266 |
| 1585 | Ga0496109_0608141 | 3300048912 | Bacteria | 1029 |
| 1586 | Ga0496109_1250478 | 3300048912 | Bacteria | 679 |
| 1587 | Ga0496109_1291365 | 3300048912 | Bacteria | 666 |
| 1588 | Ga0496109_1468055 | 3300048912 | Bacteria | 617 |
| 1589 | Ga0496110_0006109 | 3300048913 | Bacteria | 9492 |
| 1590 | Ga0496110_0085523 | 3300048913 | Bacteria | 2815 |
| 1591 | Ga0496110_0141431 | 3300048913 | Bacteria | 2176 |
| 1592 | Ga0496110_0168926 | 3300048913 | Bacteria | 1984 |
| 1593 | Ga0496110_0253450 | 3300048913 | Bacteria | 1602 |
| 1594 | Ga0496110_0267707 | 3300048913 | Bacteria | 1556 |
| 1595 | Ga0496110_0338005 | 3300048913 | Bacteria | 1372 |
| 1596 | Ga0496110_0554183 | 3300048913 | Bacteria | 1045 |
| 1597 | Ga0496110_1247954 | 3300048913 | Bacteria | 652 |
| 1598 | Ga0496110_1524752 | 3300048913 | Bacteria | 578 |
| 1599 | Ga0496110_1882754 | 3300048913 | Bacteria | 508 |
| 1600 | Ga0496111_0022716 | 3300048914 | Bacteria | 4395 |
| 1601 | Ga0496111_0196695 | 3300048914 | Bacteria | 1499 |
| 1602 | Ga0496111_0298905 | 3300048914 | Bacteria | 1193 |
| 1603 | Ga0496111_0852906 | 3300048914 | Bacteria | 657 |
| 1604 | Ga0496112_0017534 | 3300048915 | Bacteria | 6729 |
| 1605 | Ga0496112_0018053 | 3300048915 | Bacteria | 6639 |
| 1606 | Ga0496112_0018650 | 3300048915 | Bacteria | 6539 |
| 1607 | Ga0496112_0042682 | 3300048915 | Bacteria | 4438 |
| 1608 | Ga0496112_0062477 | 3300048915 | Bacteria | 3673 |
| 1609 | Ga0496112_0083572 | 3300048915 | Bacteria | 3158 |
| 1610 | Ga0496112_0159776 | 3300048915 | Bacteria | 2220 |
| 1611 | Ga0496112_0285554 | 3300048915 | Bacteria | 1596 |
| 1612 | Ga0496112_1156227 | 3300048915 | Bacteria | 691 |
| 1613 | Ga0496113_0001013 | 3300048916 | Bacteria | 15097 |
| 1614 | Ga0496113_0021243 | 3300048916 | Bacteria | 4577 |
| 1615 | Ga0496113_0295987 | 3300048916 | Bacteria | 1295 |
| 1616 | Ga0496113_0356646 | 3300048916 | Bacteria | 1173 |
| 1617 | Ga0496113_0674981 | 3300048916 | Bacteria | 826 |
| 1618 | Ga0496113_0712255 | 3300048916 | Bacteria | 800 |
| 1619 | Ga0496113_1437271 | 3300048916 | Bacteria | 533 |
| 1620 | Ga0496114_0000116 | 3300048917 | Bacteria | 57632 |
| 1621 | Ga0496114_0000711 | 3300048917 | Bacteria | 24724 |
| 1622 | Ga0496114_0001235 | 3300048917 | Bacteria | 19335 |
| 1623 | Ga0496114_0086311 | 3300048917 | Bacteria | 2659 |
| 1624 | Ga0496114_0099480 | 3300048917 | Bacteria | 2481 |
| 1625 | Ga0496114_0183417 | 3300048917 | Bacteria | 1828 |
| 1626 | Ga0496114_0245998 | 3300048917 | Bacteria | 1573 |
| 1627 | Ga0496114_0489472 | 3300048917 | Bacteria | 1088 |
| 1628 | Ga0496114_0646605 | 3300048917 | Bacteria | 930 |
| 1629 | Ga0496114_0818518 | 3300048917 | Bacteria | 810 |
| 1630 | Ga0496115_0002425 | 3300048918 | Bacteria | 13379 |
| 1631 | Ga0496115_0015061 | 3300048918 | Bacteria | 5861 |
| 1632 | Ga0496115_0021113 | 3300048918 | Bacteria | 5026 |
| 1633 | Ga0496115_0425739 | 3300048918 | Bacteria | 1075 |
| 1634 | Ga0496115_1219552 | 3300048918 | Bacteria | 564 |
| 1635 | Ga0496116_0000034 | 3300048919 | Bacteria | 409567 |
| 1636 | Ga0496116_0001408 | 3300048919 | Bacteria | 27021 |
| 1637 | Ga0496116_0002098 | 3300048919 | Bacteria | 21291 |
| 1638 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 1639 | Ga0496117_0001155 | 3300048920 | Bacteria | 39752 |
| 1640 | Ga0496117_0028583 | 3300048920 | Bacteria | 4315 |
| 1641 | Ga0496117_0618140 | 3300048920 | Bacteria | 504 |
| 1642 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 1643 | Ga0496118_0000165 | 3300048921 | Bacteria | 119376 |
| 1644 | Ga0496118_0000348 | 3300048921 | Bacteria | 78668 |
| 1645 | Ga0496118_0029623 | 3300048921 | Bacteria | 4586 |
| 1646 | Ga0496119_0000669 | 3300048922 | Bacteria | 45985 |
| 1647 | Ga0496119_0003552 | 3300048922 | Bacteria | 16090 |
| 1648 | Ga0496119_0010241 | 3300048922 | Bacteria | 7906 |
| 1649 | Ga0496119_0205331 | 3300048922 | Bacteria | 1017 |
| 1650 | Ga0496119_0388086 | 3300048922 | Bacteria | 668 |
| 1651 | Ga0496120_0000594 | 3300048923 | Bacteria | 54781 |
| 1652 | Ga0496120_0002960 | 3300048923 | Bacteria | 16171 |
| 1653 | Ga0496120_0009506 | 3300048923 | Bacteria | 6884 |
| 1654 | Ga0496120_0027390 | 3300048923 | Bacteria | 3507 |
| 1655 | Ga0496120_0265903 | 3300048923 | Bacteria | 799 |
| 1656 | Ga0496120_0350103 | 3300048923 | Bacteria | 664 |
| 1657 | Ga0496121_0000016 | 3300048924 | Bacteria | 562911 |
| 1658 | Ga0496121_0001920 | 3300048924 | Bacteria | 33194 |
| 1659 | Ga0496121_0003113 | 3300048924 | Bacteria | 23968 |
| 1660 | Ga0496121_0785925 | 3300048924 | Bacteria | 561 |
| 1661 | Ga0496122_0000284 | 3300048925 | Bacteria | 113244 |
| 1662 | Ga0496122_0003418 | 3300048925 | Bacteria | 20891 |
| 1663 | Ga0496122_0016911 | 3300048925 | Bacteria | 6855 |
| 1664 | Ga0496122_0296743 | 3300048925 | Bacteria | 874 |
| 1665 | Ga0496123_0003511 | 3300048926 | Bacteria | 17464 |
| 1666 | Ga0496123_0008217 | 3300048926 | Bacteria | 9623 |
| 1667 | Ga0496123_0024695 | 3300048926 | Bacteria | 4558 |
| 1668 | Ga0496124_0000015 | 3300048927 | Bacteria | 460700 |
| 1669 | Ga0496124_0238890 | 3300048927 | Bacteria | 1352 |
| 1670 | Ga0496124_0252667 | 3300048927 | Bacteria | 1303 |
| 1671 | Ga0496125_0000021 | 3300048928 | Bacteria | 460688 |
| 1672 | Ga0496125_0037430 | 3300048928 | Bacteria | 4218 |
| 1673 | Ga0496125_0094243 | 3300048928 | Bacteria | 2231 |
| 1674 | Ga0496125_0274510 | 3300048928 | Bacteria | 1048 |
| 1675 | Ga0496125_0448140 | 3300048928 | Bacteria | 740 |
| 1676 | Ga0496125_0626679 | 3300048928 | Bacteria | 583 |
| 1677 | Ga0496126_0000015 | 3300048929 | Bacteria | 663212 |
| 1678 | Ga0496126_0000178 | 3300048929 | Bacteria | 145079 |
| 1679 | Ga0496126_0000807 | 3300048929 | Bacteria | 56090 |
| 1680 | Ga0496126_0003990 | 3300048929 | Bacteria | 18027 |
| 1681 | Ga0496126_0012073 | 3300048929 | Bacteria | 8877 |
| 1682 | Ga0496126_0029817 | 3300048929 | Bacteria | 5179 |
| 1683 | Ga0496126_0038286 | 3300048929 | Bacteria | 4464 |
| 1684 | Ga0496126_0258251 | 3300048929 | Bacteria | 1450 |
| 1685 | Ga0496126_0594121 | 3300048929 | Bacteria | 873 |
| 1686 | Ga0496126_0888023 | 3300048929 | Bacteria | 677 |
| 1687 | Ga0501305_105422 | 3300049161 | Bacteria | 529 |
| 1688 | Ga0495678_007860 | 3300049459 | Bacteria | 5478 |
| 1689 | Ga0495682_0030079 | 3300049460 | Bacteria | 2010 |
| 1690 | Ga0501031_0001068 | 3300049568 | Bacteria | 16636 |
| 1691 | Ga0501031_0014602 | 3300049568 | Bacteria | 5106 |
| 1692 | Ga0501031_0020290 | 3300049568 | Bacteria | 4333 |
| 1693 | Ga0501031_0050342 | 3300049568 | Bacteria | 2714 |
| 1694 | Ga0501031_0978008 | 3300049568 | Bacteria | 541 |
| 1695 | Ga0501032_0000686 | 3300049569 | Bacteria | 27531 |
| 1696 | Ga0501032_0001416 | 3300049569 | Bacteria | 19040 |
| 1697 | Ga0501032_0003137 | 3300049569 | Bacteria | 12721 |
| 1698 | Ga0501032_0018870 | 3300049569 | Bacteria | 4826 |
| 1699 | Ga0501032_0050349 | 3300049569 | Bacteria | 2809 |
| 1700 | Ga0501032_0343667 | 3300049569 | Bacteria | 961 |
| 1701 | Ga0501032_0583938 | 3300049569 | Bacteria | 711 |
| 1702 | Ga0501032_1057408 | 3300049569 | Bacteria | 509 |
| 1703 | Ga0501033_0013223 | 3300049570 | Bacteria | 6288 |
| 1704 | Ga0501033_0014277 | 3300049570 | Bacteria | 6036 |
| 1705 | Ga0501033_0035727 | 3300049570 | Bacteria | 3725 |
| 1706 | Ga0501033_0049148 | 3300049570 | Bacteria | 3131 |
| 1707 | Ga0501033_0052208 | 3300049570 | Bacteria | 3030 |
| 1708 | Ga0501033_0071252 | 3300049570 | Bacteria | 2553 |
| 1709 | Ga0501033_0187722 | 3300049570 | Bacteria | 1480 |
| 1710 | Ga0501033_0207894 | 3300049570 | Bacteria | 1396 |
| 1711 | Ga0501034_0000700 | 3300049571 | Bacteria | 50894 |
| 1712 | Ga0501034_0000987 | 3300049571 | Bacteria | 40823 |
| 1713 | Ga0501034_0001101 | 3300049571 | Bacteria | 38016 |
| 1714 | Ga0501034_0008658 | 3300049571 | Bacteria | 10734 |
| 1715 | Ga0501034_0018578 | 3300049571 | Bacteria | 7127 |
| 1716 | Ga0501034_0055651 | 3300049571 | Bacteria | 3980 |
| 1717 | Ga0501034_0080810 | 3300049571 | Bacteria | 3254 |
| 1718 | Ga0501034_0153981 | 3300049571 | Bacteria | 2274 |
| 1719 | Ga0501034_0158112 | 3300049571 | Bacteria | 2239 |
| 1720 | Ga0501034_0255631 | 3300049571 | Bacteria | 1696 |
| 1721 | Ga0501034_0304551 | 3300049571 | Bacteria | 1529 |
| 1722 | Ga0501034_0932102 | 3300049571 | Bacteria | 755 |
| 1723 | Ga0501034_0975050 | 3300049571 | Bacteria | 732 |
| 1724 | Ga0501036_0001560 | 3300049572 | Bacteria | 17694 |
| 1725 | Ga0501036_0004005 | 3300049572 | Bacteria | 11846 |
| 1726 | Ga0501036_0010187 | 3300049572 | Bacteria | 7746 |
| 1727 | Ga0501036_0011832 | 3300049572 | Bacteria | 7234 |
| 1728 | Ga0501036_0034998 | 3300049572 | Bacteria | 4248 |
| 1729 | Ga0501036_0088645 | 3300049572 | Bacteria | 2614 |
| 1730 | Ga0501036_0200542 | 3300049572 | Bacteria | 1678 |
| 1731 | Ga0501036_0275877 | 3300049572 | Bacteria | 1407 |
| 1732 | Ga0501036_1415193 | 3300049572 | Bacteria | 563 |
| 1733 | Ga0501037_0000796 | 3300049573 | Bacteria | 23665 |
| 1734 | Ga0501037_0001087 | 3300049573 | Bacteria | 20162 |
| 1735 | Ga0501037_0003517 | 3300049573 | Bacteria | 11374 |
| 1736 | Ga0501037_0020048 | 3300049573 | Bacteria | 4936 |
| 1737 | Ga0501037_0073888 | 3300049573 | Bacteria | 2478 |
| 1738 | Ga0501037_0143192 | 3300049573 | Bacteria | 1710 |
| 1739 | Ga0501037_0410221 | 3300049573 | Bacteria | 928 |
| 1740 | Ga0501037_0417484 | 3300049573 | Bacteria | 919 |
| 1741 | Ga0501038_0001242 | 3300049574 | Bacteria | 23113 |
| 1742 | Ga0501038_0021854 | 3300049574 | Bacteria | 5738 |
| 1743 | Ga0501038_0022452 | 3300049574 | Bacteria | 5654 |
| 1744 | Ga0501038_0022934 | 3300049574 | Bacteria | 5587 |
| 1745 | Ga0501038_0128585 | 3300049574 | Bacteria | 2082 |
| 1746 | Ga0501038_0229890 | 3300049574 | Bacteria | 1476 |
| 1747 | Ga0501038_0235105 | 3300049574 | Bacteria | 1456 |
| 1748 | Ga0501038_0680683 | 3300049574 | Bacteria | 772 |
| 1749 | Ga0501039_0001950 | 3300049575 | Bacteria | 15298 |
| 1750 | Ga0501039_0004622 | 3300049575 | Bacteria | 10408 |
| 1751 | Ga0501039_0014245 | 3300049575 | Bacteria | 6088 |
| 1752 | Ga0501039_0062350 | 3300049575 | Bacteria | 2888 |
| 1753 | Ga0501039_0073151 | 3300049575 | Bacteria | 2663 |
| 1754 | Ga0501039_0083420 | 3300049575 | Bacteria | 2489 |
| 1755 | Ga0501039_0420405 | 3300049575 | Bacteria | 1050 |
| 1756 | Ga0501039_0482092 | 3300049575 | Bacteria | 974 |
| 1757 | Ga0501039_1502394 | 3300049575 | Bacteria | 518 |
| 1758 | Ga0501040_0002076 | 3300049576 | Bacteria | 12897 |
| 1759 | Ga0501040_0004277 | 3300049576 | Bacteria | 9287 |
| 1760 | Ga0501040_0012616 | 3300049576 | Bacteria | 5541 |
| 1761 | Ga0501040_0182649 | 3300049576 | Bacteria | 1487 |
| 1762 | Ga0501040_0320419 | 3300049576 | Bacteria | 1109 |
| 1763 | Ga0501041_0000883 | 3300049577 | Bacteria | 16205 |
| 1764 | Ga0501041_0011660 | 3300049577 | Bacteria | 5201 |
| 1765 | Ga0501041_0180918 | 3300049577 | Bacteria | 1320 |
| 1766 | Ga0501042_0009170 | 3300049578 | Bacteria | 6579 |
| 1767 | Ga0501042_0031635 | 3300049578 | Bacteria | 3743 |
| 1768 | Ga0501042_0069336 | 3300049578 | Bacteria | 2521 |
| 1769 | Ga0501043_0000867 | 3300049579 | Bacteria | 26805 |
| 1770 | Ga0501043_0002585 | 3300049579 | Bacteria | 15295 |
| 1771 | Ga0501043_0005384 | 3300049579 | Bacteria | 10336 |
| 1772 | Ga0501043_0006178 | 3300049579 | Bacteria | 9623 |
| 1773 | Ga0501043_0026492 | 3300049579 | Bacteria | 4547 |
| 1774 | Ga0501043_0038502 | 3300049579 | Bacteria | 3759 |
| 1775 | Ga0501043_0093226 | 3300049579 | Bacteria | 2368 |
| 1776 | Ga0501043_0236408 | 3300049579 | Bacteria | 1410 |
| 1777 | Ga0501043_0343251 | 3300049579 | Bacteria | 1135 |
| 1778 | Ga0501043_0507562 | 3300049579 | Bacteria | 900 |
| 1779 | Ga0501043_0584666 | 3300049579 | Bacteria | 826 |
| 1780 | Ga0501046_0002722 | 3300049580 | Bacteria | 16457 |
| 1781 | Ga0501046_0003795 | 3300049580 | Bacteria | 13830 |
| 1782 | Ga0501046_0013539 | 3300049580 | Bacteria | 6901 |
| 1783 | Ga0501046_0055300 | 3300049580 | Bacteria | 3120 |
| 1784 | Ga0501046_0073322 | 3300049580 | Bacteria | 2657 |
| 1785 | Ga0501047_0000216 | 3300049581 | Bacteria | 69275 |
| 1786 | Ga0501047_0000544 | 3300049581 | Bacteria | 40681 |
| 1787 | Ga0501047_0002484 | 3300049581 | Bacteria | 17594 |
| 1788 | Ga0501047_0027108 | 3300049581 | Bacteria | 5519 |
| 1789 | Ga0501047_0034178 | 3300049581 | Bacteria | 4909 |
| 1790 | Ga0501047_0045820 | 3300049581 | Bacteria | 4227 |
| 1791 | Ga0501047_0068246 | 3300049581 | Bacteria | 3425 |
| 1792 | Ga0501047_0271380 | 3300049581 | Bacteria | 1542 |
| 1793 | Ga0501047_0295297 | 3300049581 | Bacteria | 1464 |
| 1794 | Ga0501047_0335490 | 3300049581 | Bacteria | 1350 |
| 1795 | Ga0501047_0604000 | 3300049581 | Bacteria | 918 |
| 1796 | Ga0501047_0771746 | 3300049581 | Bacteria | 777 |
| 1797 | Ga0501047_1361502 | 3300049581 | Bacteria | 524 |
| 1798 | Ga0501048_0002418 | 3300049582 | Bacteria | 14247 |
| 1799 | Ga0501048_0002590 | 3300049582 | Bacteria | 13851 |
| 1800 | Ga0501048_0003490 | 3300049582 | Bacteria | 11951 |
| 1801 | Ga0501048_0199309 | 3300049582 | Bacteria | 1419 |
| 1802 | Ga0501067_0002500 | 3300049583 | Bacteria | 10156 |
| 1803 | Ga0501068_0000652 | 3300049584 | Bacteria | 17789 |
| 1804 | Ga0501068_0192534 | 3300049584 | Bacteria | 1292 |
| 1805 | Ga0501068_0872184 | 3300049584 | Bacteria | 592 |
| 1806 | Ga0501068_1123447 | 3300049584 | Bacteria | 520 |
| 1807 | Ga0501069_0005601 | 3300049585 | Bacteria | 6532 |
| 1808 | Ga0501069_0012698 | 3300049585 | Bacteria | 4483 |
| 1809 | Ga0501069_0165863 | 3300049585 | Bacteria | 1273 |
| 1810 | Ga0501069_0238129 | 3300049585 | Bacteria | 1060 |
| 1811 | Ga0501069_0532726 | 3300049585 | Bacteria | 702 |
| 1812 | Ga0501069_0585736 | 3300049585 | Bacteria | 669 |
| 1813 | Ga0501069_0945461 | 3300049585 | Bacteria | 525 |
| 1814 | Ga0501070_0000456 | 3300049586 | Bacteria | 37018 |
| 1815 | Ga0501070_0000766 | 3300049586 | Bacteria | 29273 |
| 1816 | Ga0501070_0007603 | 3300049586 | Bacteria | 9201 |
| 1817 | Ga0501070_0108283 | 3300049586 | Bacteria | 2296 |
| 1818 | Ga0501070_0326560 | 3300049586 | Bacteria | 1247 |
| 1819 | Ga0501070_0505795 | 3300049586 | Bacteria | 970 |
| 1820 | Ga0501070_0600534 | 3300049586 | Bacteria | 877 |
| 1821 | Ga0501070_0656884 | 3300049586 | Bacteria | 832 |
| 1822 | Ga0501070_1493345 | 3300049586 | Bacteria | 511 |
| 1823 | Ga0501071_0006265 | 3300049587 | Bacteria | 7718 |
| 1824 | Ga0501071_0011659 | 3300049587 | Bacteria | 5933 |
| 1825 | Ga0501072_0002534 | 3300049588 | Bacteria | 13689 |
| 1826 | Ga0501072_0005287 | 3300049588 | Bacteria | 9832 |
| 1827 | Ga0501072_0776204 | 3300049588 | Bacteria | 751 |
| 1828 | Ga0501073_0055489 | 3300049589 | Bacteria | 2772 |
| 1829 | Ga0501073_0057778 | 3300049589 | Bacteria | 2711 |
| 1830 | Ga0501073_0073139 | 3300049589 | Bacteria | 2387 |
| 1831 | Ga0501073_0137798 | 3300049589 | Bacteria | 1691 |
| 1832 | Ga0501073_0224702 | 3300049589 | Bacteria | 1297 |
| 1833 | Ga0501074_0006059 | 3300049590 | Bacteria | 8725 |
| 1834 | Ga0501074_0006068 | 3300049590 | Bacteria | 8722 |
| 1835 | Ga0501074_0199426 | 3300049590 | Bacteria | 1426 |
| 1836 | Ga0501074_1138889 | 3300049590 | Bacteria | 548 |
| 1837 | Ga0501075_0013356 | 3300049591 | Bacteria | 5860 |
| 1838 | Ga0501076_0006709 | 3300049592 | Bacteria | 8350 |
| 1839 | Ga0501076_0089498 | 3300049592 | Bacteria | 2474 |
| 1840 | Ga0501076_1756910 | 3300049592 | Bacteria | 509 |
| 1841 | Ga0501077_0015072 | 3300049593 | Bacteria | 4860 |
| 1842 | Ga0501077_0129275 | 3300049593 | Bacteria | 1601 |
| 1843 | Ga0501077_0184382 | 3300049593 | Bacteria | 1326 |
| 1844 | Ga0501235_024973 | 3300049669 | Bacteria | 1336 |
| 1845 | Ga0501225_0088809 | 3300049705 | Bacteria | 894 |
| 1846 | Ga0501079_0023146 | 3300049741 | Bacteria | 4769 |
| 1847 | Ga0501079_0029937 | 3300049741 | Bacteria | 4182 |
| 1848 | Ga0501080_0015534 | 3300049742 | Bacteria | 7020 |
| 1849 | Ga0501080_0053708 | 3300049742 | Bacteria | 3752 |
| 1850 | Ga0501080_0056741 | 3300049742 | Bacteria | 3646 |
| 1851 | Ga0501080_0114961 | 3300049742 | Bacteria | 2495 |
| 1852 | Ga0501080_0191273 | 3300049742 | Bacteria | 1880 |
| 1853 | Ga0501080_0691588 | 3300049742 | Bacteria | 900 |
| 1854 | Ga0501080_0717311 | 3300049742 | Bacteria | 881 |
| 1855 | Ga0501080_0974738 | 3300049742 | Bacteria | 736 |
| 1856 | Ga0501081_0138955 | 3300049743 | Bacteria | 1740 |
| 1857 | Ga0501081_0273584 | 3300049743 | Bacteria | 1236 |
| 1858 | Ga0501081_0336567 | 3300049743 | Bacteria | 1111 |
| 1859 | Ga0501081_0991854 | 3300049743 | Bacteria | 635 |
| 1860 | Ga0501083_0001307 | 3300049744 | Bacteria | 16868 |
| 1861 | Ga0501083_0178532 | 3300049744 | Bacteria | 1387 |
| 1862 | Ga0501266_088690 | 3300049763 | Bacteria | 534 |
| 1863 | Ga0501282_003648 | 3300049778 | Bacteria | 1658 |
| 1864 | Ga0501035_0000870 | 3300049822 | Bacteria | 32141 |
| 1865 | Ga0501035_0001097 | 3300049822 | Bacteria | 28352 |
| 1866 | Ga0501035_0001386 | 3300049822 | Bacteria | 24909 |
| 1867 | Ga0501035_0004451 | 3300049822 | Bacteria | 13296 |
| 1868 | Ga0501035_0010236 | 3300049822 | Bacteria | 8701 |
| 1869 | Ga0501035_0018724 | 3300049822 | Bacteria | 6377 |
| 1870 | Ga0501035_0020892 | 3300049822 | Bacteria | 6016 |
| 1871 | Ga0501035_0090680 | 3300049822 | Bacteria | 2690 |
| 1872 | Ga0501035_0101450 | 3300049822 | Bacteria | 2525 |
| 1873 | Ga0501035_0179268 | 3300049822 | Bacteria | 1826 |
| 1874 | Ga0501035_0429294 | 3300049822 | Bacteria | 1096 |
| 1875 | Ga0501035_0753361 | 3300049822 | Bacteria | 781 |
| 1876 | Ga0501044_0001367 | 3300049823 | Bacteria | 28613 |
| 1877 | Ga0501044_0002317 | 3300049823 | Bacteria | 21701 |
| 1878 | Ga0501044_0004810 | 3300049823 | Bacteria | 15100 |
| 1879 | Ga0501044_0007119 | 3300049823 | Bacteria | 12303 |
| 1880 | Ga0501044_0019900 | 3300049823 | Bacteria | 7169 |
| 1881 | Ga0501044_0049478 | 3300049823 | Bacteria | 4338 |
| 1882 | Ga0501044_0053350 | 3300049823 | Bacteria | 4159 |
| 1883 | Ga0501044_0086075 | 3300049823 | Bacteria | 3175 |
| 1884 | Ga0501044_0102858 | 3300049823 | Bacteria | 2871 |
| 1885 | Ga0501044_0104234 | 3300049823 | Bacteria | 2850 |
| 1886 | Ga0501044_0121019 | 3300049823 | Bacteria | 2618 |
| 1887 | Ga0501044_0160265 | 3300049823 | Bacteria | 2227 |
| 1888 | Ga0501044_0197226 | 3300049823 | Bacteria | 1972 |
| 1889 | Ga0501044_0357273 | 3300049823 | Bacteria | 1379 |
| 1890 | Ga0501044_0516620 | 3300049823 | Bacteria | 1094 |
| 1891 | Ga0501044_0604048 | 3300049823 | Bacteria | 990 |
| 1892 | Ga0501045_0003212 | 3300049824 | Bacteria | 11175 |
| 1893 | Ga0501045_0016064 | 3300049824 | Bacteria | 5311 |
| 1894 | Ga0501045_0099953 | 3300049824 | Bacteria | 2147 |
| 1895 | Ga0501045_0781291 | 3300049824 | Bacteria | 703 |
| 1896 | Ga0501045_1393037 | 3300049824 | Bacteria | 509 |
| 1897 | Ga0501212_039845 | 3300049851 | Bacteria | 775 |
| 1898 | nmdc:mga03683_109749_c1 | 3300050489 | Bacteria | 1219 |
| 1899 | nmdc:mga03683_196946_c1 | 3300050489 | Bacteria | 923 |
| 1900 | nmdc:mga03683_21413_c1 | 3300050489 | Bacteria | 2492 |
| 1901 | nmdc:mga03683_255613_c1 | 3300050489 | Bacteria | 814 |
| 1902 | nmdc:mga03683_317642_c1 | 3300050489 | Bacteria | 733 |
| 1903 | nmdc:mga03683_49387_c1 | 3300050489 | Bacteria | 1751 |
| 1904 | nmdc:mga03n38_102027_c1 | 3300050490 | Bacteria | 1385 |
| 1905 | nmdc:mga03n38_104021_c1 | 3300050490 | Bacteria | 1373 |
| 1906 | nmdc:mga03n38_107_c1 | 3300050490 | Bacteria | 17345 |
| 1907 | nmdc:mga03n38_109159_c1 | 3300050490 | Bacteria | 1345 |
| 1908 | nmdc:mga03n38_133580_c1 | 3300050490 | Bacteria | 1232 |
| 1909 | nmdc:mga03n38_135101_c1 | 3300050490 | Bacteria | 1226 |
| 1910 | nmdc:mga03n38_138478_c1 | 3300050490 | Bacteria | 1213 |
| 1911 | nmdc:mga03n38_213599_c1 | 3300050490 | Bacteria | 1004 |
| 1912 | nmdc:mga03n38_2914_c1 | 3300050490 | Bacteria | 5393 |
| 1913 | nmdc:mga03n38_298421_c1 | 3300050490 | Bacteria | 865 |
| 1914 | nmdc:mga03n38_32904_c1 | 3300050490 | Bacteria | 2201 |
| 1915 | nmdc:mga03n38_33091_c1 | 3300050490 | Bacteria | 2196 |
| 1916 | nmdc:mga03n38_336384_c1 | 3300050490 | Bacteria | 819 |
| 1917 | nmdc:mga03n38_349407_c1 | 3300050490 | Bacteria | 804 |
| 1918 | nmdc:mga03n38_483979_c1 | 3300050490 | Bacteria | 692 |
| 1919 | nmdc:mga03n38_5259_c1 | 3300050490 | Bacteria | 4389 |
| 1920 | nmdc:mga03n38_538692_c1 | 3300050490 | Bacteria | 659 |
| 1921 | nmdc:mga03n38_89173_c1 | 3300050490 | Bacteria | 1465 |
| 1922 | nmdc:mga03n38_94257_c1 | 3300050490 | Bacteria | 1432 |
| 1923 | nmdc:mga00v17_108812_c1 | 3300050491 | Bacteria | 1756 |
| 1924 | nmdc:mga00v17_11148_c1 | 3300050491 | Bacteria | 4934 |
| 1925 | nmdc:mga00v17_112072_c1 | 3300050491 | Bacteria | 1731 |
| 1926 | nmdc:mga00v17_117929_c1 | 3300050491 | Bacteria | 1688 |
| 1927 | nmdc:mga00v17_158503_c1 | 3300050491 | Bacteria | 1456 |
| 1928 | nmdc:mga00v17_18215_c1 | 3300050491 | Bacteria | 3984 |
| 1929 | nmdc:mga00v17_214437_c1 | 3300050491 | Bacteria | 1246 |
| 1930 | nmdc:mga00v17_2226_c1 | 3300050491 | Bacteria | 9956 |
| 1931 | nmdc:mga00v17_235637_c1 | 3300050491 | Bacteria | 1186 |
| 1932 | nmdc:mga00v17_260368_c1 | 3300050491 | Bacteria | 1125 |
| 1933 | nmdc:mga00v17_279242_c1 | 3300050491 | Bacteria | 1084 |
| 1934 | nmdc:mga00v17_293564_c1 | 3300050491 | Bacteria | 1056 |
| 1935 | nmdc:mga00v17_329288_c1 | 3300050491 | Bacteria | 992 |
| 1936 | nmdc:mga00v17_45291_c1 | 3300050491 | Bacteria | 2657 |
| 1937 | nmdc:mga00v17_541992_c1 | 3300050491 | Bacteria | 753 |
| 1938 | nmdc:mga00v17_653229_c1 | 3300050491 | Bacteria | 676 |
| 1939 | nmdc:mga00v17_742439_c1 | 3300050491 | Bacteria | 628 |
| 1940 | nmdc:mga00v17_97638_c1 | 3300050491 | Bacteria | 1852 |
| 1941 | nmdc:mga0yw44_22775_c1 | 3300050492 | Bacteria | 3518 |
| 1942 | nmdc:mga0yw44_242484_c1 | 3300050492 | Bacteria | 1198 |
| 1943 | nmdc:mga0yw44_2716_c1 | 3300050492 | Bacteria | 7644 |
| 1944 | nmdc:mga0yw44_290519_c1 | 3300050492 | Bacteria | 1094 |
| 1945 | nmdc:mga0yw44_35428_c1 | 3300050492 | Bacteria | 2933 |
| 1946 | nmdc:mga0yw44_448239_c1 | 3300050492 | Bacteria | 874 |
| 1947 | nmdc:mga0yw44_480209_c1 | 3300050492 | Bacteria | 843 |
| 1948 | nmdc:mga0yw44_61750_c1 | 3300050492 | Bacteria | 2300 |
| 1949 | nmdc:mga0yw44_622061_c1 | 3300050492 | Bacteria | 734 |
| 1950 | nmdc:mga0yw44_659728_c1 | 3300050492 | Bacteria | 711 |
| 1951 | nmdc:mga0yw44_739956_c1 | 3300050492 | Bacteria | 668 |
| 1952 | nmdc:mga0yw44_756391_c1 | 3300050492 | Bacteria | 660 |
| 1953 | nmdc:mga0yw44_826811_c1 | 3300050492 | Bacteria | 629 |
| 1954 | nmdc:mga0yw44_99428_c1 | 3300050492 | Bacteria | 1851 |
| 1955 | nmdc:mga06z11_100757_c1 | 3300050494 | Bacteria | 1584 |
| 1956 | nmdc:mga06z11_241786_c1 | 3300050494 | Bacteria | 1060 |
| 1957 | nmdc:mga06z11_31001_c1 | 3300050494 | Bacteria | 2593 |
| 1958 | nmdc:mga06z11_464827_c1 | 3300050494 | Bacteria | 765 |
| 1959 | nmdc:mga06z11_515432_c1 | 3300050494 | Bacteria | 725 |
| 1960 | nmdc:mga06z11_528606_c1 | 3300050494 | Bacteria | 715 |
| 1961 | nmdc:mga06z11_533_c1 | 3300050494 | Bacteria | 14010 |
| 1962 | nmdc:mga06z11_920561_c1 | 3300050494 | Bacteria | 533 |
| 1963 | nmdc:mga04h51_195285_c1 | 3300050495 | Bacteria | 793 |
| 1964 | nmdc:mga04h51_23177_c1 | 3300050495 | Bacteria | 1888 |
| 1965 | nmdc:mga07m45_116413_c1 | 3300050496 | Bacteria | 1542 |
| 1966 | nmdc:mga07m45_14311_c1 | 3300050496 | Bacteria | 4223 |
| 1967 | nmdc:mga07m45_161483_c1 | 3300050496 | Bacteria | 1301 |
| 1968 | nmdc:mga07m45_298273_c1 | 3300050496 | Bacteria | 937 |
| 1969 | nmdc:mga07m45_45821_c1 | 3300050496 | Bacteria | 2456 |
| 1970 | nmdc:mga07m45_70843_c1 | 3300050496 | Bacteria | 1983 |
| 1971 | nmdc:mga07m45_83179_c1 | 3300050496 | Bacteria | 1829 |
| 1972 | nmdc:mga05p37_15340_c1 | 3300050507 | Bacteria | 9205 |
| 1973 | nmdc:mga05p37_86594_c1 | 3300050507 | Bacteria | 3861 |
| 1974 | nmdc:mga09592_684227_c1 | 3300050508 | Bacteria | 874 |
| 1975 | nmdc:mga0qj67_73761_c1 | 3300050509 | Bacteria | 2726 |
| 1976 | nmdc:mga0qj67_86419_c1 | 3300050509 | Bacteria | 2516 |
| 1977 | nmdc:mga08y16_1386578_c1 | 3300050511 | Bacteria | 667 |
| 1978 | nmdc:mga08y16_1621178_c1 | 3300050511 | Bacteria | 604 |
| 1979 | nmdc:mga08y16_760492_c1 | 3300050511 | Bacteria | 964 |
| 1980 | nmdc:mga0a205_235559_c1 | 3300050515 | Bacteria | 1712 |
| 1981 | nmdc:mga0sz30_105066_c1 | 3300050516 | Bacteria | 1235 |
| 1982 | nmdc:mga0sz30_114790_c1 | 3300050516 | Bacteria | 1181 |
| 1983 | nmdc:mga0sz30_214035_c1 | 3300050516 | Bacteria | 856 |
| 1984 | nmdc:mga0sz30_21480_c1 | 3300050516 | Bacteria | 2613 |
| 1985 | nmdc:mga0sz30_247555_c1 | 3300050516 | Bacteria | 793 |
| 1986 | nmdc:mga0sz30_25097_c1 | 3300050516 | Bacteria | 2437 |
| 1987 | nmdc:mga0sz30_338778_c1 | 3300050516 | Bacteria | 672 |
| 1988 | nmdc:mga0sz30_358061_c1 | 3300050516 | Bacteria | 652 |
| 1989 | nmdc:mga0sz30_38126_c1 | 3300050516 | Bacteria | 1599 |
| 1990 | nmdc:mga0sz30_38437_c1 | 3300050516 | Bacteria | 2005 |
| 1991 | nmdc:mga0sz30_395087_c1 | 3300050516 | Bacteria | 619 |
| 1992 | nmdc:mga0sz30_451939_c1 | 3300050516 | Bacteria | 577 |
| 1993 | nmdc:mga0sz30_465596_c1 | 3300050516 | Bacteria | 568 |
| 1994 | nmdc:mga0sz30_62206_c2 | 3300050516 | Bacteria | 620 |
| 1995 | nmdc:mga0sz30_70896_c1 | 3300050516 | Bacteria | 1500 |
| 1996 | Ga0495601_0026650 | 3300053077 | Bacteria | 3570 |
| 1997 | Ga0495601_0038926 | 3300053077 | Bacteria | 2975 |
| 1998 | Ga0495601_0073237 | 3300053077 | Bacteria | 2189 |
| 1999 | Ga0495612_0005779 | 3300053078 | Bacteria | 5107 |
| 2000 | Ga0495612_0087117 | 3300053078 | Bacteria | 1318 |
| 2001 | Ga0500610_0011119 | 3300053079 | Bacteria | 4084 |
| 2002 | Ga0500610_0147176 | 3300053079 | Bacteria | 1184 |
| 2003 | Ga0500610_0284705 | 3300053079 | Bacteria | 739 |
| 2004 | Ga0500635_0465480 | 3300053080 | Bacteria | 501 |
| 2005 | Ga0495655_0093937 | 3300053083 | Bacteria | 878 |
| 2006 | Ga0495655_0324614 | 3300053083 | Bacteria | 534 |
| 2007 | Ga0495655_0367919 | 3300053083 | Bacteria | 506 |
| 2008 | Ga0495595_0407764 | 3300053084 | Bacteria | 689 |
| 2009 | Ga0495619_0007645 | 3300053085 | Bacteria | 6842 |
| 2010 | Ga0495619_0133108 | 3300053085 | Bacteria | 1709 |
| 2011 | Ga0495619_0209860 | 3300053085 | Bacteria | 1349 |
| 2012 | Ga0495619_0772303 | 3300053085 | Bacteria | 651 |
| 2013 | Ga0500578_0185326 | 3300053086 | Bacteria | 1281 |
| 2014 | Ga0500578_0250628 | 3300053086 | Bacteria | 1067 |
| 2015 | Ga0500578_0361070 | 3300053086 | Bacteria | 846 |
| 2016 | Ga0500643_004993 | 3300053087 | Bacteria | 5826 |
| 2017 | Ga0500643_034977 | 3300053087 | Bacteria | 1510 |
| 2018 | Ga0500643_040244 | 3300053087 | Bacteria | 1377 |
| 2019 | Ga0500643_042530 | 3300053087 | Bacteria | 1329 |
| 2020 | Ga0500581_203034 | 3300053089 | Bacteria | 878 |
| 2021 | Ga0500583_0211859 | 3300053092 | Bacteria | 962 |
| 2022 | Ga0500583_0318492 | 3300053092 | Bacteria | 759 |
| 2023 | Ga0500651_0722005 | 3300053093 | Bacteria | 531 |
| 2024 | Ga0500566_0114405 | 3300053094 | Bacteria | 1462 |
| 2025 | Ga0500640_000199 | 3300053095 | Bacteria | 12879 |
| 2026 | Ga0500641_0119258 | 3300053096 | Bacteria | 1137 |
| 2027 | Ga0500650_0052766 | 3300053098 | Bacteria | 1891 |
| 2028 | Ga0500654_032949 | 3300053099 | Bacteria | 3082 |
| 2029 | Ga0500654_187819 | 3300053099 | Bacteria | 646 |
| 2030 | Ga0500553_034430 | 3300053101 | Bacteria | 2517 |
| 2031 | Ga0500556_0025034 | 3300053104 | Bacteria | 1967 |
| 2032 | Ga0500556_0115219 | 3300053104 | Bacteria | 1045 |
| 2033 | Ga0500558_214684 | 3300053106 | Bacteria | 659 |
| 2034 | Ga0500560_000605 | 3300053107 | Bacteria | 5226 |
| 2035 | Ga0500560_015926 | 3300053107 | Bacteria | 2041 |
| 2036 | Ga0500560_042009 | 3300053107 | Bacteria | 1438 |
| 2037 | Ga0500562_037695 | 3300053108 | Bacteria | 1283 |
| 2038 | Ga0500562_163035 | 3300053108 | Bacteria | 606 |
| 2039 | Ga0500569_000808 | 3300053109 | Bacteria | 5512 |
| 2040 | Ga0500572_027614 | 3300053111 | Bacteria | 1556 |
| 2041 | Ga0500572_259794 | 3300053111 | Bacteria | 564 |
| 2042 | Ga0500594_0187516 | 3300053118 | Bacteria | 676 |
| 2043 | Ga0500595_063465 | 3300053119 | Bacteria | 1110 |
| 2044 | Ga0500608_054416 | 3300053122 | Bacteria | 1920 |
| 2045 | Ga0500614_041281 | 3300053123 | Bacteria | 1174 |
| 2046 | Ga0500618_152749 | 3300053125 | Bacteria | 527 |
| 2047 | Ga0500621_029543 | 3300053126 | Bacteria | 2170 |
| 2048 | Ga0500628_004395 | 3300053129 | Bacteria | 2334 |
| 2049 | Ga0500628_030134 | 3300053129 | Bacteria | 1171 |
| 2050 | Ga0500652_001721 | 3300053131 | Bacteria | 6627 |
| 2051 | Ga0500652_010700 | 3300053131 | Bacteria | 3154 |
| 2052 | Ga0500652_176044 | 3300053131 | Bacteria | 878 |
| 2053 | Ga0500652_269688 | 3300053131 | Bacteria | 668 |
| 2054 | Ga0500655_055522 | 3300053133 | Bacteria | 793 |
| 2055 | Ga0500658_0021304 | 3300053134 | Bacteria | 2453 |
| 2056 | Ga0500559_0146159 | 3300053136 | Bacteria | 1109 |
| 2057 | Ga0500559_0193688 | 3300053136 | Bacteria | 958 |
| 2058 | Ga0500559_0529806 | 3300053136 | Bacteria | 539 |
| 2059 | Ga0500561_0000789 | 3300053137 | Bacteria | 5034 |
| 2060 | Ga0500573_0005248 | 3300053140 | Bacteria | 6925 |
| 2061 | Ga0500573_0024372 | 3300053140 | Bacteria | 3479 |
| 2062 | Ga0500573_0052240 | 3300053140 | Bacteria | 2350 |
| 2063 | Ga0500573_0446074 | 3300053140 | Bacteria | 599 |
| 2064 | Ga0500579_044854 | 3300053143 | Bacteria | 2751 |
| 2065 | Ga0500586_026498 | 3300053145 | Bacteria | 1878 |
| 2066 | Ga0500586_198010 | 3300053145 | Bacteria | 661 |
| 2067 | Ga0500588_0035717 | 3300053146 | Bacteria | 1465 |
| 2068 | Ga0500588_0306182 | 3300053146 | Bacteria | 602 |
| 2069 | Ga0500600_0022759 | 3300053149 | Bacteria | 3748 |
| 2070 | Ga0500603_037368 | 3300053150 | Bacteria | 1281 |
| 2071 | Ga0500616_0041089 | 3300053153 | Bacteria | 2483 |
| 2072 | Ga0500616_0055332 | 3300053153 | Bacteria | 2075 |
| 2073 | Ga0500616_0141584 | 3300053153 | Bacteria | 1123 |
| 2074 | Ga0500620_283881 | 3300053155 | Bacteria | 541 |
| 2075 | Ga0500627_0085476 | 3300053158 | Bacteria | 1409 |
| 2076 | Ga0500633_0022892 | 3300053160 | Bacteria | 1920 |
| 2077 | Ga0500633_0254976 | 3300053160 | Bacteria | 651 |
| 2078 | Ga0500634_0039494 | 3300053161 | Bacteria | 2564 |
| 2079 | Ga0500634_0134890 | 3300053161 | Bacteria | 1179 |
| 2080 | Ga0500645_000032 | 3300053730 | Bacteria | 119506 |
| 2081 | Ga0500645_172225 | 3300053730 | Bacteria | 591 |
| 2082 | Ga0500656_030485 | 3300053732 | Bacteria | 715 |
| 2083 | Ga0500587_003192 | 3300053739 | Bacteria | 2308 |
| 2084 | Ga0501084_0001814 | 3300054114 | Bacteria | 17044 |
| 2085 | Ga0501084_0025061 | 3300054114 | Bacteria | 4977 |
| 2086 | Ga0587073_0223576 | 3300059492 | Bacteria | 577 |
| 2087 | Ga0587080_095102 | 3300059503 | Bacteria | 630 |
| 2088 | Ga0587083_0054650 | 3300059505 | Bacteria | 881 |
| 2089 | Ga0587099_061417 | 3300059622 | Bacteria | 519 |
| 2090 | Ga0587122_008489 | 3300059628 | Bacteria | 932 |
| 2091 | Ga0587067_042151 | 3300059640 | Bacteria | 891 |
| 2092 | Ga0587069_121145 | 3300059642 | Bacteria | 555 |
| 2093 | Ga0587114_057507 | 3300059655 | Bacteria | 674 |
| 2094 | Ga0501082_0003705 | 3300060353 | Bacteria | 13353 |
| 2095 | Ga0501082_0104495 | 3300060353 | Bacteria | 2450 |
| 2096 | Ga0466962_0000056 | 3300061719 | Bacteria | 46579 |
| 2097 | Ga0466962_0000729 | 3300061719 | Bacteria | 14725 |
| 2098 | Ga0466962_0003557 | 3300061719 | Bacteria | 7420 |
| 2099 | Ga0466962_0007132 | 3300061719 | Bacteria | 5352 |
| 2100 | Ga0466962_0017444 | 3300061719 | Bacteria | 3456 |
| 2101 | Ga0466962_0086224 | 3300061719 | Bacteria | 1503 |
| 2102 | Ga0466962_0434474 | 3300061719 | Bacteria | 660 |
| 2103 | Ga0530510_0034383 | 3300061734 | Bacteria | 3651 |
| 2104 | 2523384142 | 2523231044 | Bacteria | 6434991 |
| 2105 | 2547410063 | 2547132111 | Bacteria | 8013147 |
| 2106 | 2552108214 | 2551306166 | Bacteria | 9731570 |
| 2107 | 2554256882 | 2554235005 | Bacteria | 6457341 |
| 2108 | 2566996612 | 2565956761 | Bacteria | 6601618 |
| 2109 | 2585299419 | 2582581312 | Bacteria | 7308206 |
| 2110 | 2585308196 | 2582581313 | Bacteria | 10042643 |
| 2111 | 2585319180 | 2582581314 | Bacteria | 11452267 |
| 2112 | 2616696887 | 2616644814 | Bacteria | 11555299 |
| 2113 | 2616902026 | 2616644941 | Bacteria | 8510691 |
| 2114 | 2643764858 | 2643221548 | Bacteria | 8053412 |
| 2115 | 2643902801 | 2643221578 | Bacteria | 9213798 |
| 2116 | 2643942076 | 2643221587 | Bacteria | 7586415 |
| 2117 | 2644017240 | 2643221601 | Bacteria | 7493239 |
| 2118 | 2644173799 | 2643221631 | Bacteria | 8168043 |
| 2119 | 2644261701 | 2643221647 | Bacteria | 10741251 |
| 2120 | 2644389735 | 2643221670 | Bacteria | 6497041 |
| 2121 | 2644404690 | 2643221673 | Bacteria | 9196637 |
| 2122 | 2644429159 | 2643221677 | Bacteria | 7584031 |
| 2123 | 2644439224 | 2643221678 | Bacteria | 9540101 |
| 2124 | 2644461302 | 2643221682 | Bacteria | 6743283 |
| 2125 | 2644489447 | 2643221687 | Bacteria | 6500351 |
| 2126 | 2644516043 | 2643221692 | Bacteria | 7282860 |
| 2127 | 2644633411 | 2643221714 | Bacteria | 9015452 |
| 2128 | 2644636251 | 2643221715 | Bacteria | 6671032 |
| 2129 | 2731908880 | 2731639228 | Bacteria | 4187555 |
| 2130 | 2738667089 | 2738541264 | Bacteria | 5935393 |
| 2131 | 2738708748 | 2738541274 | Bacteria | 6909446 |
| 2132 | 2738891350 | 2738541308 | Bacteria | 7020677 |
| 2133 | 2739145933 | 2738541356 | Bacteria | 5935017 |
| 2134 | 2739205425 | 2738543005 | Bacteria | 5278128 |
| 2135 | 2744957629 | 2744054611 | Bacteria | 5611514 |
| 2136 | 2753037133 | 2751185725 | Bacteria | 5740550 |
| 2137 | 2753325002 | 2751185792 | Bacteria | 5739090 |
| 2138 | 2768643405 | 2767802112 | Bacteria | 6465194 |
| 2139 | 2784589629 | 2784132148 | Bacteria | 8627943 |
| 2140 | 2785341974 | 2784746763 | Bacteria | 9783172 |
| 2141 | 2785370673 | 2784746768 | Bacteria | 10036182 |
| 2142 | 2786671856 | 2786546132 | Bacteria | 10419719 |
| 2143 | 2793980307 | 2791355406 | Bacteria | 11364898 |
| 2144 | 2799186689 | 2799112218 | Bacteria | 4315149 |
| 2145 | 2808843229 | 2808606359 | Bacteria | 9866990 |
| 2146 | 2808912818 | 2808606375 | Bacteria | 9466072 |
| 2147 | 2808921578 | 2808606375 | Bacteria | 9466072 |
| 2148 | 2809233309 | 2808606448 | Bacteria | 8656184 |
| 2149 | 2811845196 | 2808606982 | Bacteria | 7791042 |
| 2150 | 2812356819 | 2811994879 | Bacteria | 9313447 |
| 2151 | 2812479534 | 2811994917 | Bacteria | 7761064 |
| 2152 | 2819695309 | 2818991463 | Bacteria | 7948711 |
| 2153 | 2842138795 | 2842134933 | Bacteria | 5847019 |
| 2154 | 2842891061 | 2842888712 | Bacteria | 4279094 |
| 2155 | 2852640433 | 2852635781 | Bacteria | 8251373 |
| 2156 | 2862181685 | 2862178590 | Bacteria | 8583590 |
| 2157 | 2862286758 | 2862281513 | Bacteria | 9621493 |
| 2158 | 2862292195 | 2862290372 | Bacteria | 7471434 |
| 2159 | 2862387714 | 2862382967 | Bacteria | 10317375 |
| 2160 | 2862514387 | 2862507626 | Bacteria | 9425308 |
| 2161 | 2862578278 | 2862574272 | Bacteria | 10567477 |
| 2162 | 2863411665 | 2863404153 | Bacteria | 9672205 |
| 2163 | 2867434711 | 2867428634 | Bacteria | 9590268 |
| 2164 | 2867479144 | 2867475112 | Bacteria | 6909112 |
| 2165 | 2868090607 | 2868088558 | Bacteria | 7609351 |
| 2166 | 2873154776 | 2873151551 | Bacteria | 8625867 |
| 2167 | 2877679915 | 2877676314 | Bacteria | 9512378 |
| 2168 | 2902798010 | 2902792274 | Bacteria | 7270173 |
| 2169 | 2902799094 | 2902792274 | Bacteria | 7270173 |
| 2170 | 2902804392 | 2902799365 | Bacteria | 5419524 |
| 2171 | 2902812375 | 2902810491 | Bacteria | 6794147 |
| 2172 | 2902815770 | 2902810491 | Bacteria | 6794147 |
| 2173 | 2902842212 | 2902837492 | Bacteria | 6697721 |
| 2174 | 2904539130 | 2904535858 | Bacteria | 6308016 |
| 2175 | 2912718561 | 2912715099 | Bacteria | 9460473 |
| 2176 | 2912762042 | 2912757875 | Bacteria | 7940295 |
| 2177 | 2918505723 | 2918501144 | Bacteria | 8668083 |
| 2178 | 2919475444 | 2919468124 | Bacteria | 9133025 |
| 2179 | 2922555798 | 2922554459 | Bacteria | 6683962 |
| 2180 | 2928144860 | 2928142448 | Bacteria | 5288925 |
| 2181 | 2929214382 | 2929212328 | Bacteria | 7708288 |
| 2182 | 2935394868 | 2935390628 | Bacteria | 7043367 |
| 2183 | 2939586269 | 2939582691 | Bacteria | 7088898 |
| 2184 | 2946048700 | 2946045630 | Bacteria | 8527308 |
| 2185 | 2946069053 | 2946064051 | Bacteria | 8957905 |
| 2186 | 2946077000 | 2946072368 | Bacteria | 8999607 |
| 2187 | 2947227885 | 2947224130 | Bacteria | 9938529 |
| 2188 | 2954003032 | 2954002825 | Bacteria | 9173742 |
| 2189 | 2954384870 | 2954380949 | Bacteria | 10050426 |
| 2190 | 2954678133 | 2954673503 | Bacteria | 9685905 |
| 2191 | 2954686025 | 2954682443 | Bacteria | 9862841 |
| 2192 | 2954695683 | 2954691527 | Bacteria | 10720516 |
| 2193 | 2954710876 | 2954701450 | Bacteria | 10834262 |
| 2194 | 2954715099 | 2954711539 | Bacteria | 10867210 |
| 2195 | 2954725041 | 2954721474 | Bacteria | 10456478 |
| 2196 | 2954736777 | 2954731030 | Bacteria | 10243860 |
| 2197 | 2954743974 | 2954740390 | Bacteria | 10229294 |
| 2198 | 2954755624 | 2954749733 | Bacteria | 10366972 |
| 2199 | 2954762914 | 2954759201 | Bacteria | 9358192 |
| 2200 | 2966601543 | 2966598605 | Bacteria | 7676064 |
| 2201 | 2974319892 | 2974315732 | Bacteria | 4602776 |
| 2202 | 2984523764 | 2984523437 | Bacteria | 4508481 |
| 2203 | 2990045362 | 2990044586 | Bacteria | 6603797 |
| 2204 | 2990062205 | 2990059506 | Bacteria | 9321252 |
| 2205 | 2995468636 | 2995463766 | Bacteria | 8577691 |
| 2206 | 2997458156 | 2997451912 | Bacteria | 8492419 |
| 2207 | 2997606378 | 2997600082 | Bacteria | 9896405 |
| 2208 | 3001890491 | 3001889506 | Bacteria | 2975194 |
| 2209 | 3006326300 | 3006321560 | Bacteria | 8247479 |
| 2210 | 3006393465 | 3006393351 | Bacteria | 6615579 |
| 2211 | 3006492632 | 3006486233 | Bacteria | 8157040 |
| 2212 | 3006499677 | 3006493962 | Bacteria | 8825450 |
| 2213 | 8008566438 | 8008558824 | Bacteria | 10610750 |
| 2214 | 8008577889 | 8008574985 | Bacteria | 7815457 |
| 2215 | 8023626424 | 8023623736 | Bacteria | 8593882 |
| 2216 | 8025484836 | 8025478263 | Bacteria | 8209203 |
| 2217 | 8025534831 | 8025530807 | Bacteria | 8495698 |
| 2218 | 8033689151 | 8033684223 | Bacteria | 6906479 |
| 2219 | 8047719891 | 8047710418 | Bacteria | 11023148 |
| 2220 | 8047897061 | 8047893842 | Bacteria | 11723082 |
| 2221 | 8048134681 | 8048127548 | Bacteria | 11053136 |
| 2222 | 8048361891 | 8048356638 | Bacteria | 11044339 |
| 2223 | 8048374045 | 8048369669 | Bacteria | 11666822 |
| 2224 | 8048384181 | 8048379754 | Bacteria | 11877923 |
| 2225 | 8048410734 | 8048406513 | Bacteria | 8936924 |
| 2226 | 8053948525 | 8053945823 | Bacteria | 8962862 |
| 2227 | 8054160729 | 8054160619 | Bacteria | 7783213 |
| 2228 | 8056448877 | 8056447290 | Bacteria | 7680491 |
| 2229 | 8056667953 | 8056667051 | Bacteria | 6953971 |
| 2230 | 8056833872 | 8056829672 | Bacteria | 9045328 |
| 2231 | Ga0501081_1435834 | |||
| 2232 | LJNas_1001325 | |||
| 2233 | JGI24739J22299_10017756 | |||
| 2234 | JGI24737J22298_10020298 | |||
| 2235 | JGI24743J22301_10007900 | |||
| 2236 | JGI24750J21931_1001262 | |||
| 2237 | JGI24750J21931_1025756 | |||
| 2238 | JGI24745J21846_1004116 | |||
| 2239 | JGI24748J21848_1003666 | |||
| 2240 | JGI24738J21930_10004342 | |||
| 2241 | JGI24749J21850_1003699 | |||
| 2242 | JGI24744J21845_10000088 | |||
| 2243 | JGI24744J21845_10002005 | |||
| 2244 | JGI24744J21845_10002298 | |||
| 2245 | JGI24034J26672_10035846 | |||
| 2246 | JGI24742J22300_10000958 | |||
| 2247 | JGI24742J22300_10028088 | |||
| 2248 | JGI24751J29686_10037569 | |||
| 2249 | JGI25153J46596_10083828 | |||
| 2250 | rootH1_10017056 | |||
| 2251 | rootH2_10032831 | |||
| 2252 | rootL2_10002375 | |||
| 2253 | rootH1_10061150 | |||
| 2254 | JGI25160J50197_1015644 | |||
| 2255 | JGI25160J50197_1022123 | |||
| 2256 | JGI25160J50197_1050490 | |||
| 2257 | JGI25160J50197_1096305 | |||
| 2258 | Ga0006562J51391_1101924 | |||
| 2259 | Ga0055540_1000003 | |||
| 2260 | Ga0055540_1003721 | |||
| 2261 | Ga0055540_1005958 | |||
| 2262 | Ga0055540_1006423 | |||
| 2263 | Ga0055540_1012991 | |||
| 2264 | Ga0055540_1060386 | |||
| 2265 | Ga0070658_10000319 | |||
| 2266 | Ga0070658_10168973 | |||
| 2267 | Ga0070658_11043273 | |||
| 2268 | Ga0070676_10005021 | |||
| 2269 | Ga0070683_100255133 | |||
| 2270 | Ga0070683_100544285 | |||
| 2271 | Ga0070683_102219522 | |||
| 2272 | Ga0070690_100066359 | |||
| 2273 | Ga0070690_100514413 | |||
| 2274 | Ga0070670_100341739 | |||
| 2275 | Ga0070670_101463295 | |||
| 2276 | Ga0070677_10131461 | |||
| 2277 | Ga0068869_100078270 | |||
| 2278 | Ga0068869_102158052 | |||
| 2279 | Ga0070666_10114765 | |||
| 2280 | Ga0070666_10206198 | |||
| 2281 | Ga0070666_10589613 | |||
| 2282 | Ga0070680_100000061 | |||
| 2283 | Ga0070680_100238798 | |||
| 2284 | Ga0070680_101437996 | |||
| 2285 | Ga0070682_100071052 | |||
| 2286 | Ga0070682_100286998 | |||
| 2287 | Ga0070682_100841066 | |||
| 2288 | Ga0070682_101277581 | |||
| 2289 | Ga0070682_101512840 | |||
| 2290 | Ga0068868_100001480 | |||
| 2291 | Ga0070660_100110954 | |||
| 2292 | Ga0070660_100361827 | |||
| 2293 | Ga0070689_100020932 | |||
| 2294 | Ga0070689_100706067 | |||
| 2295 | Ga0070691_10002982 | |||
| 2296 | Ga0070691_11041401 | |||
| 2297 | Ga0070687_100186584 | |||
| 2298 | Ga0070687_100198977 | |||
| 2299 | Ga0070661_100990318 | |||
| 2300 | Ga0070692_10095309 | |||
| 2301 | Ga0070692_10401231 | |||
| 2302 | Ga0070668_100001192 | |||
| 2303 | Ga0070668_100006438 | |||
| 2304 | Ga0070668_100068621 | |||
| 2305 | Ga0070668_101492986 | |||
| 2306 | Ga0070669_100004569 | |||
| 2307 | Ga0070669_100099405 | |||
| 2308 | Ga0070675_101430454 | |||
| 2309 | Ga0070671_100047031 | |||
| 2310 | Ga0070674_100000187 | |||
| 2311 | Ga0070674_100025474 | |||
| 2312 | Ga0070674_100300932 | |||
| 2313 | Ga0070674_100495203 | |||
| 2314 | Ga0070673_100102120 | |||
| 2315 | Ga0070688_101080451 | |||
| 2316 | Ga0070659_100018793 | |||
| 2317 | Ga0070659_100026599 | |||
| 2318 | Ga0070659_100436784 | |||
| 2319 | Ga0070667_100000056 | |||
| 2320 | Ga0070667_100000854 | |||
| 2321 | Ga0070667_100003985 | |||
| 2322 | Ga0070667_100025316 | |||
| 2323 | Ga0070667_100221674 | |||
| 2324 | Ga0070667_100591567 | |||
| 2325 | Ga0070703_10053183 | |||
| 2326 | Ga0070709_10032314 | |||
| 2327 | Ga0070709_10130230 | |||
| 2328 | Ga0070714_100016403 | |||
| 2329 | Ga0070714_100065097 | |||
| 2330 | Ga0070714_100252503 | |||
| 2331 | Ga0070714_100348335 | |||
| 2332 | Ga0070714_100451848 | |||
| 2333 | Ga0070714_100863902 | |||
| 2334 | Ga0070714_101432416 | |||
| 2335 | Ga0070714_101507705 | |||
| 2336 | Ga0070713_100015655 | |||
| 2337 | Ga0070713_100080518 | |||
| 2338 | Ga0070713_100215794 | |||
| 2339 | Ga0070713_100265185 | |||
| 2340 | Ga0070713_100361968 | |||
| 2341 | Ga0070713_100629163 | |||
| 2342 | Ga0070710_10000277 | |||
| 2343 | Ga0070710_10044347 | |||
| 2344 | Ga0070710_10168660 | |||
| 2345 | Ga0070710_10370702 | |||
| 2346 | Ga0070701_10034333 | |||
| 2347 | Ga0070711_100000493 | |||
| 2348 | Ga0070711_100029466 | |||
| 2349 | Ga0070711_100253283 | |||
| 2350 | Ga0070711_100885304 | |||
| 2351 | Ga0070705_100200449 | |||
| 2352 | Ga0070705_100263554 | |||
| 2353 | Ga0070700_100289210 | |||
| 2354 | Ga0070694_100008280 | |||
| 2355 | Ga0070694_100118065 | |||
| 2356 | Ga0070708_100297322 | |||
| 2357 | Ga0070663_100042981 | |||
| 2358 | Ga0070663_100362811 | |||
| 2359 | Ga0070663_100429842 | |||
| 2360 | Ga0070663_101210567 | |||
| 2361 | Ga0070663_101289937 | |||
| 2362 | Ga0070678_100000280 | |||
| 2363 | Ga0070678_100247043 | |||
| 2364 | Ga0070678_100300022 | |||
| 2365 | Ga0070678_100982985 | |||
| 2366 | Ga0070678_101874325 | |||
| 2367 | Ga0070662_100001491 | |||
| 2368 | Ga0070662_101359820 | |||
| 2369 | Ga0070681_10001025 | |||
| 2370 | Ga0070681_10754339 | |||
| 2371 | Ga0070681_11539087 | |||
| 2372 | Ga0068867_100002048 | |||
| 2373 | Ga0070685_10119192 | |||
| 2374 | Ga0070685_10148015 | |||
| 2375 | Ga0070685_10838994 | |||
| 2376 | Ga0070679_100001551 | |||
| 2377 | Ga0070684_100169163 | |||
| 2378 | Ga0070697_100880770 | |||
| 2379 | Ga0068853_100001367 | |||
| 2380 | Ga0068853_100084260 | |||
| 2381 | Ga0068853_100142792 | |||
| 2382 | Ga0068853_100570000 | |||
| 2383 | Ga0068853_101643301 | |||
| 2384 | Ga0070672_100249143 | |||
| 2385 | Ga0070672_100569437 | |||
| 2386 | Ga0070695_100008891 | |||
| 2387 | Ga0070695_100267175 | |||
| 2388 | Ga0070696_100002977 | |||
| 2389 | Ga0070696_100854901 | |||
| 2390 | Ga0070693_100021947 | |||
| 2391 | Ga0070693_100098763 | |||
| 2392 | Ga0070693_100531666 | |||
| 2393 | Ga0070693_101023388 | |||
| 2394 | Ga0070665_100011296 | |||
| 2395 | Ga0070665_100039320 | |||
| 2396 | Ga0070665_100083036 | |||
| 2397 | Ga0070665_100230350 | |||
| 2398 | Ga0070665_100316153 | |||
| 2399 | Ga0070665_100825882 | |||
| 2400 | Ga0070665_101327790 | |||
| 2401 | Ga0070665_102564412 | |||
| 2402 | Ga0070704_100001052 | |||
| 2403 | Ga0070704_100019306 | |||
| 2404 | Ga0070704_100819551 | |||
| 2405 | Ga0068855_100244028 | |||
| 2406 | Ga0068855_100417642 | |||
| 2407 | Ga0068855_100590408 | |||
| 2408 | Ga0068855_100596191 | |||
| 2409 | Ga0068855_100745022 | |||
| 2410 | Ga0068855_101397090 | |||
| 2411 | Ga0068855_102602693 | |||
| 2412 | Ga0070664_101013283 | |||
| 2413 | Ga0068857_100597961 | |||
| 2414 | Ga0068854_100000458 | |||
| 2415 | Ga0068854_100020918 | |||
| 2416 | Ga0068854_100252151 | |||
| 2417 | Ga0068856_100203470 | |||
| 2418 | Ga0070702_100000308 | |||
| 2419 | Ga0070702_100148986 | |||
| 2420 | Ga0070702_100956426 | |||
| 2421 | Ga0068852_100063059 | |||
| 2422 | Ga0068852_100154194 | |||
| 2423 | Ga0068852_101270523 | |||
| 2424 | Ga0068852_101980594 | |||
| 2425 | Ga0068859_100000751 | |||
| 2426 | Ga0068859_100039348 | |||
| 2427 | Ga0068859_100206485 | |||
| 2428 | Ga0068864_100132511 | |||
| 2429 | Ga0068864_100468211 | |||
| 2430 | Ga0068864_101863702 | |||
| 2431 | Ga0068864_102197808 | |||
| 2432 | Ga0068866_10000187 | |||
| 2433 | Ga0068866_10029932 | |||
| 2434 | Ga0068866_10533620 | |||
| 2435 | Ga0068866_11223904 | |||
| 2436 | Ga0068861_100000195 | |||
| 2437 | Ga0068861_100225745 | |||
| 2438 | Ga0068861_101604859 | |||
| 2439 | Ga0068851_10393066 | |||
| 2440 | Ga0068870_10747542 | |||
| 2441 | Ga0068863_100018953 | |||
| 2442 | Ga0068863_100081670 | |||
| 2443 | Ga0068863_100128462 | |||
| 2444 | Ga0068863_100207411 | |||
| 2445 | Ga0068863_101773287 | |||
| 2446 | Ga0068858_100006827 | |||
| 2447 | Ga0068858_100015158 | |||
| 2448 | Ga0068858_100106856 | |||
| 2449 | Ga0068858_100269146 | |||
| 2450 | Ga0068858_100447887 | |||
| 2451 | Ga0068858_100999124 | |||
| 2452 | Ga0068858_101387952 | |||
| 2453 | Ga0068858_102180194 | |||
| 2454 | Ga0068860_100000092 | |||
| 2455 | Ga0068860_100001932 | |||
| 2456 | Ga0068860_100157374 | |||
| 2457 | Ga0068862_100000035 | |||
| 2458 | Ga0068862_100006561 | |||
| 2459 | Ga0068862_100074824 | |||
| 2460 | Ga0068862_101578887 | |||
| 2461 | Ga0081455_10024172 | |||
| 2462 | Ga0081455_10031920 | |||
| 2463 | Ga0081455_10034690 | |||
| 2464 | Ga0081455_10091239 | |||
| 2465 | Ga0081455_10192807 | |||
| 2466 | Ga0081455_10273175 | |||
| 2467 | Ga0081538_10136302 | |||
| 2468 | Ga0081540_1047146 | |||
| 2469 | Ga0081539_10045318 | |||
| 2470 | Ga0081539_10050996 | |||
| 2471 | Ga0070717_10212312 | |||
| 2472 | Ga0070717_10384114 | |||
| 2473 | Ga0075365_10004705 | |||
| 2474 | Ga0075365_10019404 | |||
| 2475 | Ga0075365_10024575 | |||
| 2476 | Ga0075365_10082992 | |||
| 2477 | Ga0075365_10197265 | |||
| 2478 | Ga0075365_10292279 | |||
| 2479 | Ga0075365_10470498 | |||
| 2480 | Ga0075365_10635542 | |||
| 2481 | Ga0075365_10963222 | |||
| 2482 | Ga0075365_11198904 | |||
| 2483 | Ga0075368_10007123 | |||
| 2484 | Ga0075368_10251780 | |||
| 2485 | Ga0075368_10293280 | |||
| 2486 | Ga0075368_10480886 | |||
| 2487 | Ga0075363_100000383 | |||
| 2488 | Ga0075363_100000613 | |||
| 2489 | Ga0075363_100002816 | |||
| 2490 | Ga0075363_100012126 | |||
| 2491 | Ga0075363_100026851 | |||
| 2492 | Ga0075363_100032534 | |||
| 2493 | Ga0075363_100076456 | |||
| 2494 | Ga0075363_100099522 | |||
| 2495 | Ga0075363_100135422 | |||
| 2496 | Ga0075363_100190303 | |||
| 2497 | Ga0075363_100213308 | |||
| 2498 | Ga0075363_100274408 | |||
| 2499 | Ga0075363_100279189 | |||
| 2500 | Ga0075363_100292455 | |||
| 2501 | Ga0075363_100299583 | |||
| 2502 | Ga0075363_100328371 | |||
| 2503 | Ga0075363_100472321 | |||
| 2504 | Ga0075364_10003028 | |||
| 2505 | Ga0075364_10035907 | |||
| 2506 | Ga0075364_10043671 | |||
| 2507 | Ga0075364_10044294 | |||
| 2508 | Ga0075364_10066923 | |||
| 2509 | Ga0075364_10092827 | |||
| 2510 | Ga0075364_10132230 | |||
| 2511 | Ga0075364_10134790 | |||
| 2512 | Ga0075364_10143695 | |||
| 2513 | Ga0075364_10199940 | |||
| 2514 | Ga0075364_10266749 | |||
| 2515 | Ga0075364_10433398 | |||
| 2516 | Ga0075364_10626454 | |||
| 2517 | Ga0075364_10628202 | |||
| 2518 | Ga0075364_10682480 | |||
| 2519 | Ga0075364_10869353 | |||
| 2520 | Ga0075364_10946726 | |||
| 2521 | Ga0075364_11009446 | |||
| 2522 | Ga0070715_10053904 | |||
| 2523 | Ga0070715_10071980 | |||
| 2524 | Ga0070716_100024573 | |||
| 2525 | Ga0070716_100639733 | |||
| 2526 | Ga0070712_100001061 | |||
| 2527 | Ga0070712_100005282 | |||
| 2528 | Ga0075362_10015901 | |||
| 2529 | Ga0075362_10072661 | |||
| 2530 | Ga0075362_10083764 | |||
| 2531 | Ga0075362_10126789 | |||
| 2532 | Ga0075362_10289765 | |||
| 2533 | Ga0075362_10352118 | |||
| 2534 | Ga0075367_10002885 | |||
| 2535 | Ga0075367_10042461 | |||
| 2536 | Ga0075367_10186612 | |||
| 2537 | Ga0075367_10233147 | |||
| 2538 | Ga0075367_10260938 | |||
| 2539 | Ga0075367_10399203 | |||
| 2540 | Ga0075367_10546065 | |||
| 2541 | Ga0075367_10559833 | |||
| 2542 | Ga0075369_10001505 | |||
| 2543 | Ga0075369_10018446 | |||
| 2544 | Ga0075369_10021403 | |||
| 2545 | Ga0075369_10026182 | |||
| 2546 | Ga0075369_10061574 | |||
| 2547 | Ga0075369_10105102 | |||
| 2548 | Ga0075369_10118627 | |||
| 2549 | Ga0075369_10154077 | |||
| 2550 | Ga0075369_10200650 | |||
| 2551 | Ga0075369_10271899 | |||
| 2552 | Ga0097621_100132479 | |||
| 2553 | Ga0097621_100392623 | |||
| 2554 | Ga0097621_100494859 | |||
| 2555 | Ga0075370_10001408 | |||
| 2556 | Ga0075370_10001448 | |||
| 2557 | Ga0075370_10008954 | |||
| 2558 | Ga0075370_10097924 | |||
| 2559 | Ga0075370_10104498 | |||
| 2560 | Ga0075370_10186332 | |||
| 2561 | Ga0075370_10257482 | |||
| 2562 | Ga0075370_10398205 | |||
| 2563 | Ga0075370_10620621 | |||
| 2564 | Ga0075370_10648252 | |||
| 2565 | Ga0075370_10664947 | |||
| 2566 | Ga0068871_100174821 | |||
| 2567 | Ga0075428_100015023 | |||
| 2568 | Ga0075430_100259087 | |||
| 2569 | Ga0075431_101575367 | |||
| 2570 | Ga0075433_10984058 | |||
| 2571 | Ga0075433_11130050 | |||
| 2572 | Ga0075433_11760735 | |||
| 2573 | Ga0075429_100558479 | |||
| 2574 | Ga0068865_100001276 | |||
| 2575 | Ga0068865_100032758 | |||
| 2576 | Ga0068865_100630967 | |||
| 2577 | Ga0097620_100000751 | |||
| 2578 | Ga0097620_100039348 | |||
| 2579 | Ga0097620_100206491 | |||
| 2580 | Ga0099826_10257458 | |||
| 2581 | Ga0075435_100931273 | |||
| 2582 | Ga0099794_10681931 | |||
| 2583 | Ga0099795_10038450 | |||
| 2584 | Ga0105251_10120384 | |||
| 2585 | Ga0105244_10181460 | |||
| 2586 | Ga0105250_10016382 | |||
| 2587 | Ga0105250_10034275 | |||
| 2588 | Ga0105250_10170611 | |||
| 2589 | Ga0105240_10619898 | |||
| 2590 | Ga0105240_10956301 | |||
| 2591 | Ga0111539_10409140 | |||
| 2592 | Ga0111539_10828184 | |||
| 2593 | Ga0111539_11548544 | |||
| 2594 | Ga0105245_10000870 | |||
| 2595 | Ga0105245_10152899 | |||
| 2596 | Ga0105245_10166509 | |||
| 2597 | Ga0105245_10370949 | |||
| 2598 | Ga0105245_10476371 | |||
| 2599 | Ga0105245_10881421 | |||
| 2600 | Ga0105245_11742491 | |||
| 2601 | Ga0105247_10000062 | |||
| 2602 | Ga0105247_10000637 | |||
| 2603 | Ga0105247_10021071 | |||
| 2604 | Ga0105247_10075913 | |||
| 2605 | Ga0105247_10140167 | |||
| 2606 | Ga0105247_10250979 | |||
| 2607 | Ga0105247_10761866 | |||
| 2608 | Ga0114129_10093305 | |||
| 2609 | Ga0114129_10148224 | |||
| 2610 | Ga0114129_10265638 | |||
| 2611 | Ga0105243_10001020 | |||
| 2612 | Ga0105243_10074007 | |||
| 2613 | Ga0105243_10190530 | |||
| 2614 | Ga0105243_10283666 | |||
| 2615 | Ga0105243_10509827 | |||
| 2616 | Ga0105243_11285122 | |||
| 2617 | Ga0105243_11528518 | |||
| 2618 | Ga0105243_12183366 | |||
| 2619 | Ga0105241_10062601 | |||
| 2620 | Ga0105241_10183888 | |||
| 2621 | Ga0105241_10806709 | |||
| 2622 | Ga0105241_11212921 | |||
| 2623 | Ga0105241_12287648 | |||
| 2624 | Ga0105242_10000650 | |||
| 2625 | Ga0105242_10130986 | |||
| 2626 | Ga0105242_11181071 | |||
| 2627 | Ga0105242_11542909 | |||
| 2628 | Ga0105242_12699092 | |||
| 2629 | Ga0105242_12935617 | |||
| 2630 | Ga0105248_10000036 | |||
| 2631 | Ga0105248_10003895 | |||
| 2632 | Ga0105248_10014411 | |||
| 2633 | Ga0105248_10047963 | |||
| 2634 | Ga0105248_10115569 | |||
| 2635 | Ga0105248_10151489 | |||
| 2636 | Ga0105248_10785375 | |||
| 2637 | Ga0105248_10838239 | |||
| 2638 | Ga0105248_12344186 | |||
| 2639 | Ga0105237_10000467 | |||
| 2640 | Ga0105237_10034141 | |||
| 2641 | Ga0105237_10052349 | |||
| 2642 | Ga0105237_10209041 | |||
| 2643 | Ga0105237_10350429 | |||
| 2644 | Ga0105237_11745850 | |||
| 2645 | Ga0105237_11890974 | |||
| 2646 | Ga0105238_10088868 | |||
| 2647 | Ga0105238_10131894 | |||
| 2648 | Ga0105238_10152187 | |||
| 2649 | Ga0105238_10325317 | |||
| 2650 | Ga0105238_10956875 | |||
| 2651 | Ga0105238_12044567 | |||
| 2652 | Ga0105238_12554437 | |||
| 2653 | Ga0105238_12633302 | |||
| 2654 | Ga0105249_10000046 | |||
| 2655 | Ga0105249_10001186 | |||
| 2656 | Ga0105249_10005021 | |||
| 2657 | Ga0105249_10734696 | |||
| 2658 | Ga0105249_11016856 | |||
| 2659 | Ga0105249_11037881 | |||
| 2660 | Ga0105249_11389858 | |||
| 2661 | Ga0105249_11852390 | |||
| 2662 | Ga0099796_10045462 | |||
| 2663 | Ga0105239_10003093 | |||
| 2664 | Ga0105239_10028730 | |||
| 2665 | Ga0105239_10061068 | |||
| 2666 | Ga0105239_10241758 | |||
| 2667 | Ga0105239_10403057 | |||
| 2668 | Ga0105239_10594153 | |||
| 2669 | Ga0105239_10893469 | |||
| 2670 | Ga0105239_11093110 | |||
| 2671 | Ga0105239_11896191 | |||
| 2672 | Ga0105239_12608396 | |||
| 2673 | Ga0105239_12861131 | |||
| 2674 | Ga0105239_12978285 | |||
| 2675 | Ga0105239_13365063 | |||
| 2676 | Ga0105246_10034380 | |||
| 2677 | Ga0105246_10063318 | |||
| 2678 | Ga0105246_10232450 | |||
| 2679 | Ga0105246_11238228 | |||
| 2680 | Ga0105246_11800899 | |||
| 2681 | Ga0157344_1019660 | |||
| 2682 | Ga0157313_1021463 | |||
| 2683 | Ga0157342_1079190 | |||
| 2684 | Ga0157315_1005519 | |||
| 2685 | Ga0157373_10926876 | |||
| 2686 | Ga0157371_10124561 | |||
| 2687 | Ga0157371_10309262 | |||
| 2688 | Ga0157370_10300678 | |||
| 2689 | Ga0157370_11343214 | |||
| 2690 | Ga0157370_11388264 | |||
| 2691 | Ga0157369_10051356 | |||
| 2692 | Ga0157369_10110992 | |||
| 2693 | Ga0157369_10498685 | |||
| 2694 | Ga0157369_10748083 | |||
| 2695 | Ga0157374_10032409 | |||
| 2696 | Ga0157374_11664878 | |||
| 2697 | Ga0157374_11809434 | |||
| 2698 | Ga0157378_10004457 | |||
| 2699 | Ga0157378_10395003 | |||
| 2700 | Ga0163162_10001609 | |||
| 2701 | Ga0163162_10035606 | |||
| 2702 | Ga0163162_10412955 | |||
| 2703 | Ga0163162_10415926 | |||
| 2704 | Ga0163162_10471848 | |||
| 2705 | Ga0163162_11569914 | |||
| 2706 | Ga0163162_12048891 | |||
| 2707 | Ga0157372_10004145 | |||
| 2708 | Ga0157372_10219830 | |||
| 2709 | Ga0157372_10298165 | |||
| 2710 | Ga0157372_10323563 | |||
| 2711 | Ga0157372_13131700 | |||
| 2712 | Ga0157375_10000419 | |||
| 2713 | Ga0157375_11361671 | |||
| 2714 | Ga0157375_11459471 | |||
| 2715 | Ga0157375_12957822 | |||
| 2716 | Ga0163163_10039390 | |||
| 2717 | Ga0163163_10177849 | |||
| 2718 | Ga0163163_10564851 | |||
| 2719 | Ga0163163_11018401 | |||
| 2720 | Ga0163163_11527267 | |||
| 2721 | Ga0163163_12221259 | |||
| 2722 | Ga0157380_10001844 | |||
| 2723 | Ga0157380_10433095 | |||
| 2724 | Ga0182008_10002958 | |||
| 2725 | Ga0157377_10026136 | |||
| 2726 | Ga0157377_11268421 | |||
| 2727 | Ga0157379_10029772 | |||
| 2728 | Ga0157379_10132262 | |||
| 2729 | Ga0157379_10214503 | |||
| 2730 | Ga0157379_10314622 | |||
| 2731 | Ga0157379_11341361 | |||
| 2732 | Ga0157376_10037960 | |||
| 2733 | Ga0157376_10057401 | |||
| 2734 | Ga0157376_10107119 | |||
| 2735 | Ga0157376_11853195 | |||
| 2736 | Ga0157376_12606991 | |||
| 2737 | Ga0182006_1084780 | |||
| 2738 | Ga0182005_1049382 | |||
| 2739 | Ga0183367_1002 | |||
| 2740 | Ga0163161_10006906 | |||
| 2741 | Ga0163161_10172118 | |||
| 2742 | Ga0163161_10418449 | |||
| 2743 | Ga0163161_10600751 | |||
| 2744 | Ga0163161_10636131 | |||
| 2745 | Ga0197907_10131781 | |||
| 2746 | Ga0197907_10233448 | |||
| 2747 | Ga0206356_11143445 | |||
| 2748 | Ga0206351_10184192 | |||
| 2749 | Ga0206352_10845590 | |||
| 2750 | Ga0206350_11195567 | |||
| 2751 | Ga0206354_10960052 | |||
| 2752 | Ga0206353_11128098 | |||
| 2753 | Ga0206353_11287408 | |||
| 2754 | Ga0213872_10306243 | |||
| 2755 | Ga0213876_10009953 | |||
| 2756 | Ga0213876_10011067 | |||
| 2757 | Ga0213876_10023670 | |||
| 2758 | Ga0213876_10572096 | |||
| 2759 | Ga0213875_10032905 | |||
| 2760 | Ga0213875_10059850 | |||
| 2761 | Ga0213875_10273228 | |||
| 2762 | Ga0224712_10000526 | |||
| 2763 | Ga0224712_10002344 | |||
| 2764 | Ga0209025_1037599 | |||
| 2765 | Ga0209758_1007953 | |||
| 2766 | Ga0207426_1004664 | |||
| 2767 | Ga0207426_1006367 | |||
| 2768 | Ga0207426_1038691 | |||
| 2769 | Ga0209051_1000011 | |||
| 2770 | Ga0209051_1000620 | |||
| 2771 | Ga0209051_1000933 | |||
| 2772 | Ga0209051_1001428 | |||
| 2773 | Ga0209051_1033472 | |||
| 2774 | Ga0209051_1039069 | |||
| 2775 | Ga0209051_1095550 | |||
| 2776 | Ga0207656_10092487 | |||
| 2777 | Ga0207656_10115433 | |||
| 2778 | Ga0207696_1123242 | |||
| 2779 | Ga0207653_10045515 | |||
| 2780 | Ga0207682_10340878 | |||
| 2781 | Ga0207692_10001940 | |||
| 2782 | Ga0207692_10136975 | |||
| 2783 | Ga0207692_10302969 | |||
| 2784 | Ga0207692_10380415 | |||
| 2785 | Ga0207642_10000312 | |||
| 2786 | Ga0207642_10056787 | |||
| 2787 | Ga0207710_10000060 | |||
| 2788 | Ga0207710_10000890 | |||
| 2789 | Ga0207710_10130368 | |||
| 2790 | Ga0207688_10000177 | |||
| 2791 | Ga0207688_10000841 | |||
| 2792 | Ga0207680_10060009 | |||
| 2793 | Ga0207680_10107266 | |||
| 2794 | Ga0207680_10235641 | |||
| 2795 | Ga0207680_10600805 | |||
| 2796 | Ga0207647_10014202 | |||
| 2797 | Ga0207647_10028202 | |||
| 2798 | Ga0207685_10001135 | |||
| 2799 | Ga0207685_10010029 | |||
| 2800 | Ga0207699_10126702 | |||
| 2801 | Ga0207699_10282730 | |||
| 2802 | Ga0207645_10042119 | |||
| 2803 | Ga0207643_10540021 | |||
| 2804 | Ga0207643_10579470 | |||
| 2805 | Ga0207705_10002093 | |||
| 2806 | Ga0207705_10486828 | |||
| 2807 | Ga0207654_10071715 | |||
| 2808 | Ga0207654_10288853 | |||
| 2809 | Ga0207707_10000277 | |||
| 2810 | Ga0207707_10167030 | |||
| 2811 | Ga0207707_11302555 | |||
| 2812 | Ga0207671_10009964 | |||
| 2813 | Ga0207671_10018152 | |||
| 2814 | Ga0207671_10027045 | |||
| 2815 | Ga0207671_10151176 | |||
| 2816 | Ga0207671_10821232 | |||
| 2817 | Ga0207671_11168870 | |||
| 2818 | Ga0207693_10000339 | |||
| 2819 | Ga0207693_10000602 | |||
| 2820 | Ga0207693_10217813 | |||
| 2821 | Ga0207663_10000907 | |||
| 2822 | Ga0207663_10122657 | |||
| 2823 | Ga0207663_11001168 | |||
| 2824 | Ga0207660_10000115 | |||
| 2825 | Ga0207660_10111634 | |||
| 2826 | Ga0207660_10521538 | |||
| 2827 | Ga0207660_10831956 | |||
| 2828 | Ga0207660_11033446 | |||
| 2829 | Ga0207662_10075302 | |||
| 2830 | Ga0207662_11040064 | |||
| 2831 | Ga0207657_10095827 | |||
| 2832 | Ga0207657_10164966 | |||
| 2833 | Ga0207649_11409531 | |||
| 2834 | Ga0207649_11674196 | |||
| 2835 | Ga0207652_10000333 | |||
| 2836 | Ga0207652_10547270 | |||
| 2837 | Ga0207646_10636104 | |||
| 2838 | Ga0207646_10832617 | |||
| 2839 | Ga0207681_10000788 | |||
| 2840 | Ga0207681_10086689 | |||
| 2841 | Ga0207694_10048982 | |||
| 2842 | Ga0207694_10183839 | |||
| 2843 | Ga0207694_10632582 | |||
| 2844 | Ga0207694_11119059 | |||
| 2845 | Ga0207650_10129186 | |||
| 2846 | Ga0207659_10510272 | |||
| 2847 | Ga0207659_10968259 | |||
| 2848 | Ga0207659_11137339 | |||
| 2849 | Ga0207687_10001983 | |||
| 2850 | Ga0207687_10102936 | |||
| 2851 | Ga0207687_10302244 | |||
| 2852 | Ga0207687_10940733 | |||
| 2853 | Ga0207700_10070676 | |||
| 2854 | Ga0207700_10181688 | |||
| 2855 | Ga0207700_10206533 | |||
| 2856 | Ga0207700_10271142 | |||
| 2857 | Ga0207700_10298691 | |||
| 2858 | Ga0207700_10461851 | |||
| 2859 | Ga0207664_10068406 | |||
| 2860 | Ga0207664_10324477 | |||
| 2861 | Ga0207664_10569422 | |||
| 2862 | Ga0207664_10677795 | |||
| 2863 | Ga0207664_11686089 | |||
| 2864 | Ga0207644_10004647 | |||
| 2865 | Ga0207644_10020065 | |||
| 2866 | Ga0207644_10207081 | |||
| 2867 | Ga0207690_10024212 | |||
| 2868 | Ga0207690_10061631 | |||
| 2869 | Ga0207690_10851592 | |||
| 2870 | Ga0207706_10002589 | |||
| 2871 | Ga0207686_10001637 | |||
| 2872 | Ga0207686_10750390 | |||
| 2873 | Ga0207686_10789993 | |||
| 2874 | Ga0207709_10001393 | |||
| 2875 | Ga0207709_10074674 | |||
| 2876 | Ga0207709_10183433 | |||
| 2877 | Ga0207709_10222341 | |||
| 2878 | Ga0207709_10326906 | |||
| 2879 | Ga0207709_11668838 | |||
| 2880 | Ga0207670_10012017 | |||
| 2881 | Ga0207670_10739642 | |||
| 2882 | Ga0207670_11054097 | |||
| 2883 | Ga0207669_10000205 | |||
| 2884 | Ga0207669_10211685 | |||
| 2885 | Ga0207669_10655942 | |||
| 2886 | Ga0207669_10744014 | |||
| 2887 | Ga0207669_11018226 | |||
| 2888 | Ga0207669_11532880 | |||
| 2889 | Ga0207669_11791100 | |||
| 2890 | Ga0207704_10000618 | |||
| 2891 | Ga0207704_10209532 | |||
| 2892 | Ga0207704_10361902 | |||
| 2893 | Ga0207704_11617637 | |||
| 2894 | Ga0207665_10008088 | |||
| 2895 | Ga0207665_10011512 | |||
| 2896 | Ga0207665_10142777 | |||
| 2897 | Ga0207691_10548394 | |||
| 2898 | Ga0207711_10000073 | |||
| 2899 | Ga0207711_10061372 | |||
| 2900 | Ga0207711_10157899 | |||
| 2901 | Ga0207711_10536245 | |||
| 2902 | Ga0207711_10731525 | |||
| 2903 | Ga0207711_11955454 | |||
| 2904 | Ga0207689_10133901 | |||
| 2905 | Ga0207689_11283094 | |||
| 2906 | Ga0207661_10086949 | |||
| 2907 | Ga0207661_10290851 | |||
| 2908 | Ga0207661_10627582 | |||
| 2909 | Ga0207661_10735585 | |||
| 2910 | Ga0207661_10932794 | |||
| 2911 | Ga0207661_11837205 | |||
| 2912 | Ga0207679_11528043 | |||
| 2913 | Ga0207667_10183276 | |||
| 2914 | Ga0207667_10328404 | |||
| 2915 | Ga0207667_10705552 | |||
| 2916 | Ga0207667_11257202 | |||
| 2917 | Ga0207651_10223155 | |||
| 2918 | Ga0207651_10270943 | |||
| 2919 | Ga0207712_10000042 | |||
| 2920 | Ga0207712_10072184 | |||
| 2921 | Ga0207712_10754948 | |||
| 2922 | Ga0207712_12019647 | |||
| 2923 | Ga0207668_10006306 | |||
| 2924 | Ga0207668_10013064 | |||
| 2925 | Ga0207668_10048285 | |||
| 2926 | Ga0207668_10753972 | |||
| 2927 | Ga0207640_10003341 | |||
| 2928 | Ga0207640_10131790 | |||
| 2929 | Ga0207640_10477580 | |||
| 2930 | Ga0207640_10671311 | |||
| 2931 | Ga0207658_10000449 | |||
| 2932 | Ga0207658_10000664 | |||
| 2933 | Ga0207658_10003954 | |||
| 2934 | Ga0207658_10004460 | |||
| 2935 | Ga0207658_10069437 | |||
| 2936 | Ga0207658_10451997 | |||
| 2937 | Ga0207658_10852948 | |||
| 2938 | Ga0207658_11072789 | |||
| 2939 | Ga0207658_11902673 | |||
| 2940 | Ga0207677_10016196 | |||
| 2941 | Ga0207677_10257633 | |||
| 2942 | Ga0207703_10002964 | |||
| 2943 | Ga0207703_10059815 | |||
| 2944 | Ga0207703_10063785 | |||
| 2945 | Ga0207703_10065586 | |||
| 2946 | Ga0207703_10151622 | |||
| 2947 | Ga0207703_10414917 | |||
| 2948 | Ga0207703_10731486 | |||
| 2949 | Ga0207703_11092095 | |||
| 2950 | Ga0207639_10038681 | |||
| 2951 | Ga0207639_10379569 | |||
| 2952 | Ga0207639_10793787 | |||
| 2953 | Ga0207639_10973081 | |||
| 2954 | Ga0207678_10007047 | |||
| 2955 | Ga0207678_10118193 | |||
| 2956 | Ga0207678_10122695 | |||
| 2957 | Ga0207678_10795511 | |||
| 2958 | Ga0207678_10930460 | |||
| 2959 | Ga0207678_11078487 | |||
| 2960 | Ga0207678_11382732 | |||
| 2961 | Ga0207708_10003891 | |||
| 2962 | Ga0207708_10041519 | |||
| 2963 | Ga0207708_10738176 | |||
| 2964 | Ga0207702_10903480 | |||
| 2965 | Ga0207702_12014144 | |||
| 2966 | Ga0207641_10001094 | |||
| 2967 | Ga0207641_10015008 | |||
| 2968 | Ga0207641_10027939 | |||
| 2969 | Ga0207641_10070874 | |||
| 2970 | Ga0207641_10094126 | |||
| 2971 | Ga0207641_10468585 | |||
| 2972 | Ga0207641_11917341 | |||
| 2973 | Ga0207648_10000623 | |||
| 2974 | Ga0207648_10047022 | |||
| 2975 | Ga0207648_11638071 | |||
| 2976 | Ga0207676_10017255 | |||
| 2977 | Ga0207676_10203343 | |||
| 2978 | Ga0207676_10343914 | |||
| 2979 | Ga0207676_10985563 | |||
| 2980 | Ga0207676_11040120 | |||
| 2981 | Ga0207676_11369694 | |||
| 2982 | Ga0207676_11741940 | |||
| 2983 | Ga0207676_11947419 | |||
| 2984 | Ga0207674_10296717 | |||
| 2985 | Ga0207674_10500764 | |||
| 2986 | Ga0207675_100001672 | |||
| 2987 | Ga0207675_100533225 | |||
| 2988 | Ga0207675_101185188 | |||
| 2989 | Ga0207675_101475440 | |||
| 2990 | Ga0207683_10000539 | |||
| 2991 | Ga0207683_10017378 | |||
| 2992 | Ga0207683_10105161 | |||
| 2993 | Ga0207683_10383305 | |||
| 2994 | Ga0207683_10495393 | |||
| 2995 | Ga0207683_10507853 | |||
| 2996 | Ga0207683_10717855 | |||
| 2997 | Ga0207698_10047163 | |||
| 2998 | Ga0207698_10102226 | |||
| 2999 | Ga0207698_10678063 | |||
| 3000 | Ga0209371_1029382 | |||
| 3001 | Ga0209179_1045200 | |||
| 3002 | Ga0209282_1241770 | |||
| 3003 | Ga0209813_10018444 | |||
| 3004 | Ga0209813_10142005 | |||
| 3005 | Ga0207428_10336973 | |||
| 3006 | Ga0207428_10532992 | |||
| 3007 | Ga0207428_10570865 | |||
| 3008 | Ga0268266_10007218 | |||
| 3009 | Ga0268266_10012919 | |||
| 3010 | Ga0268266_10020977 | |||
| 3011 | Ga0268266_10102670 | |||
| 3012 | Ga0268266_10156772 | |||
| 3013 | Ga0268265_10000051 | |||
| 3014 | Ga0268265_10003445 | |||
| 3015 | Ga0268265_10076517 | |||
| 3016 | Ga0268265_10493002 | |||
| 3017 | Ga0268264_10000108 | |||
| 3018 | Ga0268264_10009938 | |||
| 3019 | Ga0268264_10197392 | |||
| 3020 | Ga0268264_10774917 | |||
| 3021 | Ga0307517_10004659 | |||
| 3022 | Ga0307517_10036222 | |||
| 3023 | Ga0307517_10265146 | |||
| 3024 | Ga0307515_10001177 | |||
| 3025 | Ga0307515_10083676 | |||
| 3026 | Ga0307515_10346614 | |||
| 3027 | Ga0268256_1023853 | |||
| 3028 | Ga0307511_10028203 | |||
| 3029 | Ga0307511_10062540 | |||
| 3030 | Ga0307511_10132506 | |||
| 3031 | Ga0307511_10235476 | |||
| 3032 | Ga0307511_10263096 | |||
| 3033 | Ga0307511_10276655 | |||
| 3034 | Ga0307511_10309783 | |||
| 3035 | Ga0307512_10037650 | |||
| 3036 | Ga0307512_10064598 | |||
| 3037 | Ga0307512_10182988 | |||
| 3038 | Ga0314311_1190625 | |||
| 3039 | Ga0316180_1107973 | |||
| 3040 | Ga0316182_1311333 | |||
| 3041 | Ga0265327_10000021 | |||
| 3042 | Ga0265327_10000071 | |||
| 3043 | Ga0265327_10000630 | |||
| 3044 | Ga0265327_10021466 | |||
| 3045 | Ga0307513_10032651 | |||
| 3046 | Ga0307513_10033269 | |||
| 3047 | Ga0307513_10119884 | |||
| 3048 | Ga0307513_10511978 | |||
| 3049 | Ga0307509_10169325 | |||
| 3050 | Ga0307509_10206018 | |||
| 3051 | Ga0307509_10338394 | |||
| 3052 | Ga0307509_10441087 | |||
| 3053 | Ga0307408_100304208 | |||
| 3054 | Ga0307408_101344318 | |||
| 3055 | Ga0307508_10001775 | |||
| 3056 | Ga0307508_10005680 | |||
| 3057 | Ga0307508_10020650 | |||
| 3058 | Ga0307508_10063849 | |||
| 3059 | Ga0307508_10075163 | |||
| 3060 | Ga0307508_10117382 | |||
| 3061 | Ga0307514_10036472 | |||
| 3062 | Ga0307514_10119090 | |||
| 3063 | Ga0307514_10190602 | |||
| 3064 | Ga0316579_10047194 | |||
| 3065 | Ga0316579_10445263 | |||
| 3066 | Ga0316576_10069280 | |||
| 3067 | Ga0316576_10557500 | |||
| 3068 | Ga0316578_10007838 | |||
| 3069 | Ga0316578_10054210 | |||
| 3070 | Ga0316578_10155229 | |||
| 3071 | Ga0316578_10695755 | |||
| 3072 | Ga0307516_10007060 | |||
| 3073 | Ga0307516_10023113 | |||
| 3074 | Ga0307516_10048980 | |||
| 3075 | Ga0307405_10106270 | |||
| 3076 | Ga0307405_10763497 | |||
| 3077 | Ga0307405_11497678 | |||
| 3078 | Ga0316577_10196594 | |||
| 3079 | Ga0316577_10698771 | |||
| 3080 | Ga0307413_10179235 | |||
| 3081 | Ga0307413_10760075 | |||
| 3082 | Ga0307413_10963802 | |||
| 3083 | Ga0307518_10156737 | |||
| 3084 | Ga0307410_10005427 | |||
| 3085 | Ga0307410_10050900 | |||
| 3086 | Ga0307410_10097846 | |||
| 3087 | Ga0307410_10154260 | |||
| 3088 | Ga0307410_11219754 | |||
| 3089 | Ga0307406_10986100 | |||
| 3090 | Ga0307406_11413939 | |||
| 3091 | Ga0307407_10015605 | |||
| 3092 | Ga0307407_11702345 | |||
| 3093 | Ga0307412_10273546 | |||
| 3094 | Ga0307412_11572325 | |||
| 3095 | Ga0307409_100037553 | |||
| 3096 | Ga0307409_100205427 | |||
| 3097 | Ga0307409_100326649 | |||
| 3098 | Ga0307409_100387209 | |||
| 3099 | Ga0307409_100641406 | |||
| 3100 | Ga0307409_100815775 | |||
| 3101 | Ga0307409_102087345 | |||
| 3102 | Ga0307409_102616151 | |||
| 3103 | Ga0307416_100056416 | |||
| 3104 | Ga0307416_100107718 | |||
| 3105 | Ga0307416_100436088 | |||
| 3106 | Ga0307416_101380328 | |||
| 3107 | Ga0307416_101534811 | |||
| 3108 | Ga0307416_103859158 | |||
| 3109 | Ga0307411_10140216 | |||
| 3110 | Ga0307411_10196819 | |||
| 3111 | Ga0307411_10561258 | |||
| 3112 | Ga0307415_100728871 | |||
| 3113 | Ga0307415_100940326 | |||
| 3114 | Ga0307415_101508448 | |||
| 3115 | Ga0316583_10012794 | |||
| 3116 | Ga0316585_10026058 | |||
| 3117 | Ga0316585_10140083 | |||
| 3118 | Ga0316580_10179792 | |||
| 3119 | Ga0316580_10284486 | |||
| 3120 | Ga0316593_10251358 | |||
| 3121 | Ga0307507_10000732 | |||
| 3122 | Ga0307507_10642080 | |||
| 3123 | Ga0307510_10035723 | |||
| 3124 | Ga0307510_10088739 | |||
| 3125 | Ga0307510_10284835 | |||
| 3126 | Ga0307510_10416505 | |||
| 3127 | Ga0307510_10651932 | |||
| 3128 | Ga0316596_1054270 | |||
| 3129 | Ga0373930_0210188 | |||
| 3130 | Ga0373938_0069430 | |||
| 3131 | Ga0373928_0105733 | |||
| 3132 | Ga0373929_0151968 | |||
| 3133 | Ga0373940_0078051 | |||
| 3134 | Ga0373951_0066451 | |||
| 3135 | Ga0373932_0036929 | |||
| 3136 | Ga0373939_0420583 | |||
| 3137 | Ga0373960_0036799 | |||
| 3138 | Ga0373942_0032327 | |||
| 3139 | Ga0373942_0078542 | |||
| 3140 | Ga0373961_0094945 | |||
| 3141 | Ga0373962_0012789 | |||
| 3142 | Ga0373962_0013224 | |||
| 3143 | Ga0316574_0078180 | |||
| 3144 | Ga0316574_0122232 | |||
| 3145 | Ga0373924_0452019 | |||
| 3146 | Ga0373931_0011218 | |||
| 3147 | Ga0316582_0204345 | |||
| 3148 | Ga0316582_0430407 | |||
| 3149 | Ga0316584_0053682 | |||
| 3150 | Ga0316584_0086906 | |||
| 3151 | Ga0316584_0421280 | |||
| 3152 | Ga0395899_0013414 | |||
| 3153 | Ga0395899_0748419 | |||
| 3154 | Ga0395900_0075741 | |||
| 3155 | Ga0395900_0427612 | |||
| 3156 | Ga0395898_0006692 | |||
| 3157 | Ga0395898_0017702 | |||
| 3158 | Ga0395905_0069865 | |||
| 3159 | Ga0395905_0528676 | |||
| 3160 | Ga0395905_0686939 | |||
| 3161 | Ga0316581_0167237 | |||
| 3162 | Ga0436364_0195317 | |||
| 3163 | Ga0436364_0229870 | |||
| 3164 | Ga0436364_1150617 | |||
| 3165 | Ga0436364_1291536 | |||
| 3166 | Ga0395901_0100975 | |||
| 3167 | Ga0395901_0550223 | |||
| 3168 | Ga0436365_0678211 | |||
| 3169 | Ga0436365_0939033 | |||
| 3170 | Ga0436365_0941882 | |||
| 3171 | Ga0436365_1035060 | |||
| 3172 | Ga0436365_1714810 | |||
| 3173 | Ga0436365_1908396 | |||
| 3174 | Ga0436360_0804941 | |||
| 3175 | Ga0436361_0716923 | |||
| 3176 | Ga0436361_1194425 | |||
| 3177 | Ga0436363_0444811 | |||
| 3178 | Ga0436363_0754104 | |||
| 3179 | Ga0436363_1331240 | |||
| 3180 | Ga0436363_1709932 | |||
| 3181 | Ga0436362_0757592 | |||
| 3182 | Ga0436362_1212714 | |||
| 3183 | Ga0439439_0009171 | |||
| 3184 | Ga0439439_0047088 | |||
| 3185 | Ga0439461_0013378 | |||
| 3186 | Ga0439461_0014671 | |||
| 3187 | Ga0439461_0024659 | |||
| 3188 | Ga0439466_0003274 | |||
| 3189 | Ga0439466_0008207 | |||
| 3190 | Ga0439466_0013164 | |||
| 3191 | Ga0439466_0035103 | |||
| 3192 | Ga0439465_0011614 | |||
| 3193 | Ga0439465_0013051 | |||
| 3194 | Ga0439465_0034846 | |||
| 3195 | Ga0439465_0131683 | |||
| 3196 | Ga0439465_0336671 | |||
| 3197 | Ga0451787_711011 | |||
| 3198 | Ga0451789_0165262 | |||
| 3199 | Ga0451789_0361298 | |||
| 3200 | Ga0451789_0982272 | |||
| 3201 | Ga0451791_0176299 | |||
| 3202 | Ga0451791_0923786 | |||
| 3203 | Ga0451793_0050578 | |||
| 3204 | Ga0451793_0165491 | |||
| 3205 | Ga0451793_0382258 | |||
| 3206 | Ga0451797_0462824 | |||
| 3207 | Ga0451797_0777865 | |||
| 3208 | Ga0451798_1003370 | |||
| 3209 | Ga0451800_0949963 | |||
| 3210 | Ga0451802_0290968 | |||
| 3211 | Ga0451802_1000802 | |||
| 3212 | Ga0451806_545077 | |||
| 3213 | Ga0451804_0768388 | |||
| 3214 | Ga0451807_1186087 | |||
| 3215 | Ga0451807_1334898 | |||
| 3216 | Ga0451807_2088134 | |||
| 3217 | Ga0451833_0440069 | |||
| 3218 | Ga0451835_0852016 | |||
| 3219 | Ga0451837_0509056 | |||
| 3220 | Ga0451839_0168767 | |||
| 3221 | Ga0451841_0295423 | |||
| 3222 | Ga0451841_1253551 | |||
| 3223 | Ga0451845_0166486 | |||
| 3224 | Ga0451851_1033401 | |||
| 3225 | Ga0451843_0901391 | |||
| 3226 | Ga0451843_1680136 | |||
| 3227 | Ga0451853_0050097 | |||
| 3228 | Ga0451853_0425702 | |||
| 3229 | Ga0451853_0450169 | |||
| 3230 | Ga0451853_1037975 | |||
| 3231 | Ga0451853_2284613 | |||
| 3232 | Ga0451853_3283147 | |||
| 3233 | Ga0451853_3835888 | |||
| 3234 | Ga0451853_3894526 | |||
| 3235 | Ga0439431_0007821 | |||
| 3236 | Ga0439431_0100112 | |||
| 3237 | Ga0439433_0008537 | |||
| 3238 | Ga0439433_0014215 | |||
| 3239 | Ga0439442_016793 | |||
| 3240 | Ga0439442_024566 | |||
| 3241 | Ga0439445_0001826 | |||
| 3242 | Ga0439445_0101398 | |||
| 3243 | Ga0439445_0135614 | |||
| 3244 | Ga0439445_0147093 | |||
| 3245 | Ga0439445_0262242 | |||
| 3246 | Ga0439448_0004693 | |||
| 3247 | Ga0439448_0130866 | |||
| 3248 | Ga0439448_0175236 | |||
| 3249 | Ga0439448_0234069 | |||
| 3250 | Ga0439449_0069372 | |||
| 3251 | Ga0439450_069576 | |||
| 3252 | Ga0439454_050955 | |||
| 3253 | Ga0439455_0075109 | |||
| 3254 | Ga0439455_0197971 | |||
| 3255 | Ga0439457_000455 | |||
| 3256 | Ga0439457_000479 | |||
| 3257 | Ga0439457_044746 | |||
| 3258 | Ga0439462_0024184 | |||
| 3259 | Ga0439463_161594 | |||
| 3260 | Ga0450890_011941 | |||
| 3261 | Ga0450894_000142 | |||
| 3262 | Ga0450895_001889 | |||
| 3263 | Ga0450898_023027 | |||
| 3264 | Ga0450898_034090 | |||
| 3265 | Ga0450900_015664 | |||
| 3266 | Ga0450903_000121 | |||
| 3267 | Ga0450906_002225 | |||
| 3268 | Ga0439458_0001134 | |||
| 3269 | Ga0439458_0025509 | |||
| 3270 | Ga0450908_070131 | |||
| 3271 | Ga0439434_0010812 | |||
| 3272 | Ga0439434_0016765 | |||
| 3273 | Ga0439434_0018207 | |||
| 3274 | Ga0439435_0023314 | |||
| 3275 | Ga0439435_0290320 | |||
| 3276 | Ga0439459_0003093 | |||
| 3277 | Ga0450901_024223 | |||
| 3278 | Ga0451577_0101787 | |||
| 3279 | Ga0439440_0260273 | |||
| 3280 | Ga0466969_0000470 | |||
| 3281 | Ga0466969_0005382 | |||
| 3282 | Ga0466969_0009133 | |||
| 3283 | Ga0466969_0020850 | |||
| 3284 | Ga0466969_0034108 | |||
| 3285 | Ga0466969_0056244 | |||
| 3286 | Ga0466969_0063027 | |||
| 3287 | Ga0466969_0106363 | |||
| 3288 | Ga0466969_0345685 | |||
| 3289 | Ga0466972_0005853 | |||
| 3290 | Ga0466972_0036904 | |||
| 3291 | Ga0466972_0038891 | |||
| 3292 | Ga0466972_0095647 | |||
| 3293 | Ga0466972_0119432 | |||
| 3294 | Ga0466972_0120005 | |||
| 3295 | Ga0466972_0132419 | |||
| 3296 | Ga0466972_0152676 | |||
| 3297 | Ga0466972_0246199 | |||
| 3298 | Ga0466972_0341192 | |||
| 3299 | Ga0466965_0005281 | |||
| 3300 | Ga0466965_0008504 | |||
| 3301 | Ga0466965_0023201 | |||
| 3302 | Ga0466965_0023923 | |||
| 3303 | Ga0466965_0065885 | |||
| 3304 | Ga0466965_0077985 | |||
| 3305 | Ga0466965_0112919 | |||
| 3306 | Ga0466965_0291718 | |||
| 3307 | Ga0466965_0561309 | |||
| 3308 | Ga0466966_0002225 | |||
| 3309 | Ga0466966_0002809 | |||
| 3310 | Ga0466966_0002940 | |||
| 3311 | Ga0466966_0003767 | |||
| 3312 | Ga0466966_0007557 | |||
| 3313 | Ga0466966_0010373 | |||
| 3314 | Ga0466966_0056388 | |||
| 3315 | Ga0466966_0074389 | |||
| 3316 | Ga0466966_0092900 | |||
| 3317 | Ga0466966_0653277 | |||
| 3318 | Ga0466961_0002350 | |||
| 3319 | Ga0466961_0004001 | |||
| 3320 | Ga0466961_0006257 | |||
| 3321 | Ga0466961_0008642 | |||
| 3322 | Ga0466961_0020414 | |||
| 3323 | Ga0466961_0032599 | |||
| 3324 | Ga0466961_0136461 | |||
| 3325 | Ga0466961_0162770 | |||
| 3326 | Ga0466961_0259254 | |||
| 3327 | Ga0466961_0385157 | |||
| 3328 | Ga0466961_0746316 | |||
| 3329 | Ga0466961_0917618 | |||
| 3330 | Ga0466961_0926254 | |||
| 3331 | Ga0466963_0000656 | |||
| 3332 | Ga0466963_0002324 | |||
| 3333 | Ga0466963_0062229 | |||
| 3334 | Ga0466963_0097726 | |||
| 3335 | Ga0466963_0117681 | |||
| 3336 | Ga0466963_0215321 | |||
| 3337 | Ga0466963_0286500 | |||
| 3338 | Ga0466963_0375967 | |||
| 3339 | Ga0466963_0821591 | |||
| 3340 | Ga0466964_0065505 | |||
| 3341 | Ga0466964_0120091 | |||
| 3342 | Ga0466964_0139210 | |||
| 3343 | Ga0466964_0658092 | |||
| 3344 | Ga0466971_0000161 | |||
| 3345 | Ga0466971_0009498 | |||
| 3346 | Ga0466971_0010470 | |||
| 3347 | Ga0466971_0037329 | |||
| 3348 | Ga0466971_0038008 | |||
| 3349 | Ga0466971_0104911 | |||
| 3350 | Ga0466971_0194357 | |||
| 3351 | Ga0466971_0204873 | |||
| 3352 | Ga0466971_0245318 | |||
| 3353 | Ga0466968_0003026 | |||
| 3354 | Ga0466968_0004670 | |||
| 3355 | Ga0466968_0017639 | |||
| 3356 | Ga0466968_0078172 | |||
| 3357 | Ga0466968_0087905 | |||
| 3358 | Ga0466968_0133985 | |||
| 3359 | Ga0466968_0204497 | |||
| 3360 | Ga0466970_0002119 | |||
| 3361 | Ga0466970_0004779 | |||
| 3362 | Ga0466970_0008021 | |||
| 3363 | Ga0466970_0010155 | |||
| 3364 | Ga0466970_0101681 | |||
| 3365 | Ga0466970_0102256 | |||
| 3366 | Ga0466970_0293933 | |||
| 3367 | Ga0466970_0629606 | |||
| 3368 | Ga0466970_0897168 | |||
| 3369 | Ga0466957_0001267 | |||
| 3370 | Ga0466957_0006730 | |||
| 3371 | Ga0466957_0019108 | |||
| 3372 | Ga0466957_0023478 | |||
| 3373 | Ga0466957_0071734 | |||
| 3374 | Ga0466957_0087858 | |||
| 3375 | Ga0466957_0144044 | |||
| 3376 | Ga0466957_0164351 | |||
| 3377 | Ga0466957_0337919 | |||
| 3378 | Ga0466957_0458162 | |||
| 3379 | Ga0466957_0653684 | |||
| 3380 | Ga0466957_0721896 | |||
| 3381 | Ga0466960_0000046 | |||
| 3382 | Ga0466960_0001009 | |||
| 3383 | Ga0466960_0002661 | |||
| 3384 | Ga0466960_0004371 | |||
| 3385 | Ga0466960_0051070 | |||
| 3386 | Ga0466960_0178961 | |||
| 3387 | Ga0466960_0585153 | |||
| 3388 | Ga0466959_0001597 | |||
| 3389 | Ga0466959_0002075 | |||
| 3390 | Ga0466959_0005630 | |||
| 3391 | Ga0466959_0019524 | |||
| 3392 | Ga0466959_0026773 | |||
| 3393 | Ga0466959_0027848 | |||
| 3394 | Ga0466959_0045345 | |||
| 3395 | Ga0466959_0050561 | |||
| 3396 | Ga0466959_0064953 | |||
| 3397 | Ga0466959_0116305 | |||
| 3398 | Ga0466959_0426793 | |||
| 3399 | Ga0466958_0008122 | |||
| 3400 | Ga0466958_0033877 | |||
| 3401 | Ga0466958_0210873 | |||
| 3402 | Ga0466958_0588526 | |||
| 3403 | Ga0466958_0675144 | |||
| 3404 | Ga0466958_0823610 | |||
| 3405 | Ga0466958_0984515 | |||
| 3406 | Ga0466967_0000098 | |||
| 3407 | Ga0466967_0001175 | |||
| 3408 | Ga0466967_0004167 | |||
| 3409 | Ga0466967_0013920 | |||
| 3410 | Ga0466967_0015885 | |||
| 3411 | Ga0466967_0039775 | |||
| 3412 | Ga0466967_0044157 | |||
| 3413 | Ga0466967_0052656 | |||
| 3414 | Ga0466967_0090102 | |||
| 3415 | Ga0466967_0108859 | |||
| 3416 | Ga0466967_0206462 | |||
| 3417 | Ga0466967_0213462 | |||
| 3418 | Ga0466967_0254036 | |||
| 3419 | Ga0466967_0317645 | |||
| 3420 | Ga0466967_0808390 | |||
| 3421 | Ga0466967_1448479 | |||
| 3422 | Ga0466967_1667304 | |||
| 3423 | Ga0466967_1936721 | |||
| 3424 | Ga0495617_002450 | |||
| 3425 | Ga0495627_032876 | |||
| 3426 | Ga0495592_0005902 | |||
| 3427 | Ga0495592_0011481 | |||
| 3428 | Ga0495592_0017511 | |||
| 3429 | Ga0495592_0043495 | |||
| 3430 | Ga0495592_0232869 | |||
| 3431 | Ga0495592_0693649 | |||
| 3432 | Ga0495603_0002752 | |||
| 3433 | Ga0495603_0005893 | |||
| 3434 | Ga0495603_0026486 | |||
| 3435 | Ga0495603_0027817 | |||
| 3436 | Ga0495603_0057695 | |||
| 3437 | Ga0495603_0058400 | |||
| 3438 | Ga0495603_0090468 | |||
| 3439 | Ga0495603_0324172 | |||
| 3440 | Ga0495590_0167759 | |||
| 3441 | Ga0495629_0007791 | |||
| 3442 | Ga0495629_0019021 | |||
| 3443 | Ga0495629_0036510 | |||
| 3444 | Ga0495629_0038099 | |||
| 3445 | Ga0495629_0050864 | |||
| 3446 | Ga0495629_0199262 | |||
| 3447 | Ga0495629_0625817 | |||
| 3448 | Ga0495629_0879766 | |||
| 3449 | Ga0495638_0006268 | |||
| 3450 | Ga0495638_0037802 | |||
| 3451 | Ga0495638_0047159 | |||
| 3452 | Ga0495638_0069235 | |||
| 3453 | Ga0495638_0372591 | |||
| 3454 | Ga0495641_0036692 | |||
| 3455 | Ga0495651_0001691 | |||
| 3456 | Ga0495651_0002270 | |||
| 3457 | Ga0495651_0020919 | |||
| 3458 | Ga0495651_0032656 | |||
| 3459 | Ga0495653_0009684 | |||
| 3460 | Ga0495653_0125804 | |||
| 3461 | Ga0495580_0007503 | |||
| 3462 | Ga0495580_0093565 | |||
| 3463 | Ga0495580_0295347 | |||
| 3464 | Ga0495582_0015462 | |||
| 3465 | Ga0495582_0020967 | |||
| 3466 | Ga0495582_0123656 | |||
| 3467 | Ga0495582_0286903 | |||
| 3468 | Ga0495605_0040643 | |||
| 3469 | Ga0495605_0136378 | |||
| 3470 | Ga0495639_0035778 | |||
| 3471 | Ga0495639_0152229 | |||
| 3472 | Ga0495662_0003027 | |||
| 3473 | Ga0495662_0003988 | |||
| 3474 | Ga0495662_0004401 | |||
| 3475 | Ga0495662_0030461 | |||
| 3476 | Ga0495662_0578598 | |||
| 3477 | Ga0495664_0002306 | |||
| 3478 | Ga0495664_0006527 | |||
| 3479 | Ga0495664_0168961 | |||
| 3480 | Ga0495664_0638228 | |||
| 3481 | Ga0495584_0489469 | |||
| 3482 | Ga0495585_0006843 | |||
| 3483 | Ga0495585_0011896 | |||
| 3484 | Ga0495585_0056441 | |||
| 3485 | Ga0495585_0084605 | |||
| 3486 | Ga0495594_0012495 | |||
| 3487 | Ga0495594_0019099 | |||
| 3488 | Ga0495594_0036869 | |||
| 3489 | Ga0495594_0067391 | |||
| 3490 | Ga0495594_0105804 | |||
| 3491 | Ga0495594_0425777 | |||
| 3492 | Ga0495596_0007205 | |||
| 3493 | Ga0495607_0027724 | |||
| 3494 | Ga0495607_0116405 | |||
| 3495 | Ga0495583_0030647 | |||
| 3496 | Ga0495583_0152135 | |||
| 3497 | Ga0495583_0188811 | |||
| 3498 | Ga0495583_0249917 | |||
| 3499 | Ga0495606_0024751 | |||
| 3500 | Ga0495606_0040870 | |||
| 3501 | Ga0495608_0001723 | |||
| 3502 | Ga0495608_0029184 | |||
| 3503 | Ga0495608_0273468 | |||
| 3504 | Ga0495608_0570525 | |||
| 3505 | Ga0495616_0034448 | |||
| 3506 | Ga0495618_0020219 | |||
| 3507 | Ga0495618_0029070 | |||
| 3508 | Ga0495618_0085032 | |||
| 3509 | Ga0495618_0251534 | |||
| 3510 | Ga0495620_0175873 | |||
| 3511 | Ga0495620_0197374 | |||
| 3512 | Ga0495628_0001384 | |||
| 3513 | Ga0495628_0012481 | |||
| 3514 | Ga0495628_0026361 | |||
| 3515 | Ga0495628_0050390 | |||
| 3516 | Ga0495628_0149375 | |||
| 3517 | Ga0495630_0048762 | |||
| 3518 | Ga0495630_0265887 | |||
| 3519 | Ga0495630_0324468 | |||
| 3520 | Ga0495630_0613214 | |||
| 3521 | Ga0495631_0003549 | |||
| 3522 | Ga0495631_0472694 | |||
| 3523 | Ga0495632_0028374 | |||
| 3524 | Ga0495632_0430800 | |||
| 3525 | Ga0495637_0006755 | |||
| 3526 | Ga0495643_0007275 | |||
| 3527 | Ga0495643_0085567 | |||
| 3528 | Ga0495644_0157588 | |||
| 3529 | Ga0495648_0069856 | |||
| 3530 | Ga0495648_0112305 | |||
| 3531 | Ga0495648_0204897 | |||
| 3532 | Ga0495648_0413244 | |||
| 3533 | Ga0495666_0000571 | |||
| 3534 | Ga0495666_0024248 | |||
| 3535 | Ga0495666_0138843 | |||
| 3536 | Ga0495666_0481718 | |||
| 3537 | Ga0495642_0082291 | |||
| 3538 | Ga0495652_0002119 | |||
| 3539 | Ga0495652_0018989 | |||
| 3540 | Ga0495652_0024558 | |||
| 3541 | Ga0495652_0069396 | |||
| 3542 | Ga0495652_0072250 | |||
| 3543 | Ga0495654_0007357 | |||
| 3544 | Ga0495665_0005483 | |||
| 3545 | Ga0495665_0509134 | |||
| 3546 | Ga0495640_0005626 | |||
| 3547 | Ga0495640_0013818 | |||
| 3548 | Ga0495640_0016680 | |||
| 3549 | Ga0495640_0017644 | |||
| 3550 | Ga0495640_0142738 | |||
| 3551 | Ga0495640_0182550 | |||
| 3552 | Ga0495640_0913821 | |||
| 3553 | Ga0495586_0246189 | |||
| 3554 | Ga0495587_0079197 | |||
| 3555 | Ga0495587_0199871 | |||
| 3556 | Ga0495587_0705976 | |||
| 3557 | Ga0495609_0004676 | |||
| 3558 | Ga0495597_0031747 | |||
| 3559 | Ga0495597_0229000 | |||
| 3560 | Ga0495597_0302666 | |||
| 3561 | Ga0495645_0024216 | |||
| 3562 | Ga0495645_0028167 | |||
| 3563 | Ga0495645_0045978 | |||
| 3564 | Ga0495645_0101595 | |||
| 3565 | Ga0495645_0888778 | |||
| 3566 | Ga0495622_0005380 | |||
| 3567 | Ga0495622_0015971 | |||
| 3568 | Ga0495622_0056033 | |||
| 3569 | Ga0495633_0031583 | |||
| 3570 | Ga0495667_0033930 | |||
| 3571 | Ga0495667_0153082 | |||
| 3572 | Ga0495667_0323018 | |||
| 3573 | Ga0495656_0329388 | |||
| 3574 | Ga0495668_0000123 | |||
| 3575 | Ga0495668_0036571 | |||
| 3576 | Ga0495668_0651628 | |||
| 3577 | Ga0495634_0006120 | |||
| 3578 | Ga0495634_0010265 | |||
| 3579 | Ga0495634_0050187 | |||
| 3580 | Ga0495634_0213792 | |||
| 3581 | Ga0495634_0276759 | |||
| 3582 | Ga0495634_0382681 | |||
| 3583 | Ga0495611_0057795 | |||
| 3584 | Ga0495611_0215774 | |||
| 3585 | Ga0495625_0005807 | |||
| 3586 | Ga0495625_0029488 | |||
| 3587 | Ga0495625_0238937 | |||
| 3588 | Ga0495635_0002565 | |||
| 3589 | Ga0495635_0004355 | |||
| 3590 | Ga0495635_0066218 | |||
| 3591 | Ga0495635_0071866 | |||
| 3592 | Ga0495635_0088357 | |||
| 3593 | Ga0495635_0341668 | |||
| 3594 | Ga0495635_0375901 | |||
| 3595 | Ga0495659_0219554 | |||
| 3596 | Ga0495659_0562685 | |||
| 3597 | Ga0495661_0023540 | |||
| 3598 | Ga0495661_0175298 | |||
| 3599 | Ga0495588_0003543 | |||
| 3600 | Ga0495588_0003986 | |||
| 3601 | Ga0495588_0005355 | |||
| 3602 | Ga0495588_0010107 | |||
| 3603 | Ga0495657_0003629 | |||
| 3604 | Ga0495657_0007083 | |||
| 3605 | Ga0495657_0008037 | |||
| 3606 | Ga0495657_0008501 | |||
| 3607 | Ga0495599_0049987 | |||
| 3608 | Ga0495599_0064358 | |||
| 3609 | Ga0495599_0326318 | |||
| 3610 | Ga0495623_0059476 | |||
| 3611 | Ga0495623_0075257 | |||
| 3612 | Ga0495623_0135461 | |||
| 3613 | Ga0495623_0363063 | |||
| 3614 | Ga0495646_0000855 | |||
| 3615 | Ga0495646_0010343 | |||
| 3616 | Ga0495646_0051847 | |||
| 3617 | Ga0495646_0094322 | |||
| 3618 | Ga0495646_0620530 | |||
| 3619 | Ga0495658_0002176 | |||
| 3620 | Ga0495658_0112189 | |||
| 3621 | Ga0495658_0538936 | |||
| 3622 | Ga0495669_0356984 | |||
| 3623 | Ga0495613_0001664 | |||
| 3624 | Ga0495613_0006878 | |||
| 3625 | Ga0495613_0007886 | |||
| 3626 | Ga0495613_0017322 | |||
| 3627 | Ga0495613_0042788 | |||
| 3628 | Ga0495613_0056747 | |||
| 3629 | Ga0495613_0085162 | |||
| 3630 | Ga0495613_0096472 | |||
| 3631 | Ga0495613_0539877 | |||
| 3632 | Ga0495624_0075201 | |||
| 3633 | Ga0495624_0199910 | |||
| 3634 | Ga0495624_0706154 | |||
| 3635 | Ga0495670_0055508 | |||
| 3636 | Ga0495670_0058872 | |||
| 3637 | Ga0495670_0176563 | |||
| 3638 | Ga0495671_0013941 | |||
| 3639 | Ga0495671_0030234 | |||
| 3640 | Ga0495671_0147806 | |||
| 3641 | Ga0495649_0031220 | |||
| 3642 | Ga0495649_0171518 | |||
| 3643 | Ga0495649_0183630 | |||
| 3644 | Ga0495649_0247873 | |||
| 3645 | Ga0495649_0584368 | |||
| 3646 | Ga0495589_0036165 | |||
| 3647 | Ga0495589_0042640 | |||
| 3648 | Ga0495589_0436546 | |||
| 3649 | Ga0495600_0003542 | |||
| 3650 | Ga0495600_0010402 | |||
| 3651 | Ga0495600_0017095 | |||
| 3652 | Ga0495600_0051070 | |||
| 3653 | Ga0495600_0350712 | |||
| 3654 | Ga0495660_0031126 | |||
| 3655 | Ga0495660_0038922 | |||
| 3656 | Ga0495581_0011118 | |||
| 3657 | Ga0495581_0053853 | |||
| 3658 | Ga0495581_0081771 | |||
| 3659 | Ga0495581_0096503 | |||
| 3660 | Ga0495604_0002351 | |||
| 3661 | Ga0495604_0004817 | |||
| 3662 | Ga0495604_0007383 | |||
| 3663 | Ga0495604_0063067 | |||
| 3664 | Ga0495604_0285633 | |||
| 3665 | Ga0495636_0007700 | |||
| 3666 | Ga0495636_0036875 | |||
| 3667 | Ga0495636_0037499 | |||
| 3668 | Ga0495636_0087387 | |||
| 3669 | Ga0495674_0067245 | |||
| 3670 | Ga0495674_0070922 | |||
| 3671 | Ga0495674_0119479 | |||
| 3672 | Ga0495674_0268767 | |||
| 3673 | Ga0495674_0283155 | |||
| 3674 | Ga0495672_0010127 | |||
| 3675 | Ga0495672_0028030 | |||
| 3676 | Ga0495676_0001590 | |||
| 3677 | Ga0495676_0002415 | |||
| 3678 | Ga0495676_0147379 | |||
| 3679 | Ga0495676_0290392 | |||
| 3680 | Ga0495680_0178410 | |||
| 3681 | Ga0495680_0452211 | |||
| 3682 | Ga0495683_0000766 | |||
| 3683 | Ga0495683_0021951 | |||
| 3684 | Ga0495687_001147 | |||
| 3685 | Ga0495687_003306 | |||
| 3686 | Ga0495687_039955 | |||
| 3687 | Ga0495687_140261 | |||
| 3688 | Ga0495675_0011687 | |||
| 3689 | Ga0495675_0021916 | |||
| 3690 | Ga0495675_0030965 | |||
| 3691 | Ga0495675_0059587 | |||
| 3692 | Ga0495675_0059974 | |||
| 3693 | Ga0495675_0174278 | |||
| 3694 | Ga0495675_0390066 | |||
| 3695 | Ga0495679_011002 | |||
| 3696 | Ga0495685_001275 | |||
| 3697 | Ga0495685_006034 | |||
| 3698 | Ga0495685_081645 | |||
| 3699 | Ga0495685_108302 | |||
| 3700 | Ga0495673_0000456 | |||
| 3701 | Ga0495681_0003151 | |||
| 3702 | Ga0495681_0020011 | |||
| 3703 | Ga0495684_0123494 | |||
| 3704 | Ga0495684_0157647 | |||
| 3705 | Ga0495686_0000637 | |||
| 3706 | Ga0495686_0063634 | |||
| 3707 | Ga0495686_0232025 | |||
| 3708 | Ga0495593_0001812 | |||
| 3709 | Ga0495593_0055656 | |||
| 3710 | Ga0495593_0346380 | |||
| 3711 | Ga0495602_0055166 | |||
| 3712 | Ga0495602_0199002 | |||
| 3713 | Ga0495602_0397105 | |||
| 3714 | Ga0495602_0518465 | |||
| 3715 | Ga0495602_0531111 | |||
| 3716 | Ga0495602_1102216 | |||
| 3717 | Ga0495614_0000229 | |||
| 3718 | Ga0495614_0009446 | |||
| 3719 | Ga0495614_0122938 | |||
| 3720 | Ga0495626_0020580 | |||
| 3721 | Ga0495626_0066961 | |||
| 3722 | Ga0495626_0153541 | |||
| 3723 | Ga0496100_0000067 | |||
| 3724 | Ga0496100_0000461 | |||
| 3725 | Ga0496100_0004004 | |||
| 3726 | Ga0496100_0004747 | |||
| 3727 | Ga0496100_0007759 | |||
| 3728 | Ga0496100_0096240 | |||
| 3729 | Ga0496100_0148167 | |||
| 3730 | Ga0496100_0249001 | |||
| 3731 | Ga0496100_0295276 | |||
| 3732 | Ga0496100_0449650 | |||
| 3733 | Ga0496100_0546531 | |||
| 3734 | Ga0496101_0000099 | |||
| 3735 | Ga0496101_0000108 | |||
| 3736 | Ga0496101_0000750 | |||
| 3737 | Ga0496101_0000793 | |||
| 3738 | Ga0496101_0015063 | |||
| 3739 | Ga0496101_0098732 | |||
| 3740 | Ga0496101_0112323 | |||
| 3741 | Ga0496101_0162987 | |||
| 3742 | Ga0496101_0768929 | |||
| 3743 | Ga0496101_0852392 | |||
| 3744 | Ga0496101_1140795 | |||
| 3745 | Ga0496102_0000005 | |||
| 3746 | Ga0496102_0000390 | |||
| 3747 | Ga0496102_0003032 | |||
| 3748 | Ga0496102_0006978 | |||
| 3749 | Ga0496102_0030945 | |||
| 3750 | Ga0496102_0051773 | |||
| 3751 | Ga0496102_0093526 | |||
| 3752 | Ga0496102_0140005 | |||
| 3753 | Ga0496102_0143275 | |||
| 3754 | Ga0496102_0211602 | |||
| 3755 | Ga0496102_0216993 | |||
| 3756 | Ga0496102_0437293 | |||
| 3757 | Ga0496102_0504239 | |||
| 3758 | Ga0496102_1061507 | |||
| 3759 | Ga0496102_1595120 | |||
| 3760 | Ga0496103_0000002 | |||
| 3761 | Ga0496103_0000116 | |||
| 3762 | Ga0496103_0000663 | |||
| 3763 | Ga0496103_0001688 | |||
| 3764 | Ga0496103_0017503 | |||
| 3765 | Ga0496103_0488755 | |||
| 3766 | Ga0496104_0007517 | |||
| 3767 | Ga0496104_0011507 | |||
| 3768 | Ga0496104_0044914 | |||
| 3769 | Ga0496104_0046988 | |||
| 3770 | Ga0496104_0659991 | |||
| 3771 | Ga0496104_1474620 | |||
| 3772 | Ga0496105_0064390 | |||
| 3773 | Ga0496105_0176837 | |||
| 3774 | Ga0496105_0327777 | |||
| 3775 | Ga0496105_0501550 | |||
| 3776 | Ga0496105_0508548 | |||
| 3777 | Ga0496105_0953297 | |||
| 3778 | Ga0496106_0000424 | |||
| 3779 | Ga0496106_0001149 | |||
| 3780 | Ga0496106_0001741 | |||
| 3781 | Ga0496106_0002018 | |||
| 3782 | Ga0496106_0016794 | |||
| 3783 | Ga0496106_0177217 | |||
| 3784 | Ga0496106_0212106 | |||
| 3785 | Ga0496106_0234277 | |||
| 3786 | Ga0496106_0318636 | |||
| 3787 | Ga0496106_0624970 | |||
| 3788 | Ga0496106_0846820 | |||
| 3789 | Ga0496106_1472165 | |||
| 3790 | Ga0496107_0000079 | |||
| 3791 | Ga0496107_0000254 | |||
| 3792 | Ga0496107_0014513 | |||
| 3793 | Ga0496107_0214834 | |||
| 3794 | Ga0496107_0247435 | |||
| 3795 | Ga0496107_0275597 | |||
| 3796 | Ga0496107_0706240 | |||
| 3797 | Ga0496108_0005688 | |||
| 3798 | Ga0496108_0011641 | |||
| 3799 | Ga0496108_0033237 | |||
| 3800 | Ga0496108_0071519 | |||
| 3801 | Ga0496108_0110258 | |||
| 3802 | Ga0496108_0137681 | |||
| 3803 | Ga0496108_0174780 | |||
| 3804 | Ga0496108_0259237 | |||
| 3805 | Ga0496108_0326318 | |||
| 3806 | Ga0496108_1260981 | |||
| 3807 | Ga0496109_0000159 | |||
| 3808 | Ga0496109_0002268 | |||
| 3809 | Ga0496109_0010817 | |||
| 3810 | Ga0496109_0023653 | |||
| 3811 | Ga0496109_0038336 | |||
| 3812 | Ga0496109_0182877 | |||
| 3813 | Ga0496109_0418659 | |||
| 3814 | Ga0496109_0608141 | |||
| 3815 | Ga0496109_1250478 | |||
| 3816 | Ga0496109_1291365 | |||
| 3817 | Ga0496109_1468055 | |||
| 3818 | Ga0496110_0006109 | |||
| 3819 | Ga0496110_0085523 | |||
| 3820 | Ga0496110_0141431 | |||
| 3821 | Ga0496110_0168926 | |||
| 3822 | Ga0496110_0253450 | |||
| 3823 | Ga0496110_0267707 | |||
| 3824 | Ga0496110_0338005 | |||
| 3825 | Ga0496110_0554183 | |||
| 3826 | Ga0496110_1247954 | |||
| 3827 | Ga0496110_1524752 | |||
| 3828 | Ga0496110_1882754 | |||
| 3829 | Ga0496111_0022716 | |||
| 3830 | Ga0496111_0196695 | |||
| 3831 | Ga0496111_0298905 | |||
| 3832 | Ga0496111_0852906 | |||
| 3833 | Ga0496112_0017534 | |||
| 3834 | Ga0496112_0018053 | |||
| 3835 | Ga0496112_0018650 | |||
| 3836 | Ga0496112_0042682 | |||
| 3837 | Ga0496112_0062477 | |||
| 3838 | Ga0496112_0083572 | |||
| 3839 | Ga0496112_0159776 | |||
| 3840 | Ga0496112_0285554 | |||
| 3841 | Ga0496112_1156227 | |||
| 3842 | Ga0496113_0001013 | |||
| 3843 | Ga0496113_0021243 | |||
| 3844 | Ga0496113_0295987 | |||
| 3845 | Ga0496113_0356646 | |||
| 3846 | Ga0496113_0674981 | |||
| 3847 | Ga0496113_0712255 | |||
| 3848 | Ga0496113_1437271 | |||
| 3849 | Ga0496114_0000116 | |||
| 3850 | Ga0496114_0000711 | |||
| 3851 | Ga0496114_0001235 | |||
| 3852 | Ga0496114_0086311 | |||
| 3853 | Ga0496114_0099480 | |||
| 3854 | Ga0496114_0183417 | |||
| 3855 | Ga0496114_0245998 | |||
| 3856 | Ga0496114_0489472 | |||
| 3857 | Ga0496114_0646605 | |||
| 3858 | Ga0496114_0818518 | |||
| 3859 | Ga0496115_0002425 | |||
| 3860 | Ga0496115_0015061 | |||
| 3861 | Ga0496115_0021113 | |||
| 3862 | Ga0496115_0425739 | |||
| 3863 | Ga0496115_1219552 | |||
| 3864 | Ga0496116_0000034 | |||
| 3865 | Ga0496116_0001408 | |||
| 3866 | Ga0496116_0002098 | |||
| 3867 | Ga0496117_0000003 | |||
| 3868 | Ga0496117_0001155 | |||
| 3869 | Ga0496117_0028583 | |||
| 3870 | Ga0496117_0618140 | |||
| 3871 | Ga0496118_0000001 | |||
| 3872 | Ga0496118_0000165 | |||
| 3873 | Ga0496118_0000348 | |||
| 3874 | Ga0496118_0029623 | |||
| 3875 | Ga0496119_0000669 | |||
| 3876 | Ga0496119_0003552 | |||
| 3877 | Ga0496119_0010241 | |||
| 3878 | Ga0496119_0205331 | |||
| 3879 | Ga0496119_0388086 | |||
| 3880 | Ga0496120_0000594 | |||
| 3881 | Ga0496120_0002960 | |||
| 3882 | Ga0496120_0009506 | |||
| 3883 | Ga0496120_0027390 | |||
| 3884 | Ga0496120_0265903 | |||
| 3885 | Ga0496120_0350103 | |||
| 3886 | Ga0496121_0000016 | |||
| 3887 | Ga0496121_0001920 | |||
| 3888 | Ga0496121_0003113 | |||
| 3889 | Ga0496121_0785925 | |||
| 3890 | Ga0496122_0000284 | |||
| 3891 | Ga0496122_0003418 | |||
| 3892 | Ga0496122_0016911 | |||
| 3893 | Ga0496122_0296743 | |||
| 3894 | Ga0496123_0003511 | |||
| 3895 | Ga0496123_0008217 | |||
| 3896 | Ga0496123_0024695 | |||
| 3897 | Ga0496124_0000015 | |||
| 3898 | Ga0496124_0238890 | |||
| 3899 | Ga0496124_0252667 | |||
| 3900 | Ga0496125_0000021 | |||
| 3901 | Ga0496125_0037430 | |||
| 3902 | Ga0496125_0094243 | |||
| 3903 | Ga0496125_0274510 | |||
| 3904 | Ga0496125_0448140 | |||
| 3905 | Ga0496125_0626679 | |||
| 3906 | Ga0496126_0000015 | |||
| 3907 | Ga0496126_0000178 | |||
| 3908 | Ga0496126_0000807 | |||
| 3909 | Ga0496126_0003990 | |||
| 3910 | Ga0496126_0012073 | |||
| 3911 | Ga0496126_0029817 | |||
| 3912 | Ga0496126_0038286 | |||
| 3913 | Ga0496126_0258251 | |||
| 3914 | Ga0496126_0594121 | |||
| 3915 | Ga0496126_0888023 | |||
| 3916 | Ga0501305_105422 | |||
| 3917 | Ga0495678_007860 | |||
| 3918 | Ga0495682_0030079 | |||
| 3919 | Ga0501031_0001068 | |||
| 3920 | Ga0501031_0014602 | |||
| 3921 | Ga0501031_0020290 | |||
| 3922 | Ga0501031_0050342 | |||
| 3923 | Ga0501031_0978008 | |||
| 3924 | Ga0501032_0000686 | |||
| 3925 | Ga0501032_0001416 | |||
| 3926 | Ga0501032_0003137 | |||
| 3927 | Ga0501032_0018870 | |||
| 3928 | Ga0501032_0050349 | |||
| 3929 | Ga0501032_0343667 | |||
| 3930 | Ga0501032_0583938 | |||
| 3931 | Ga0501032_1057408 | |||
| 3932 | Ga0501033_0013223 | |||
| 3933 | Ga0501033_0014277 | |||
| 3934 | Ga0501033_0035727 | |||
| 3935 | Ga0501033_0049148 | |||
| 3936 | Ga0501033_0052208 | |||
| 3937 | Ga0501033_0071252 | |||
| 3938 | Ga0501033_0187722 | |||
| 3939 | Ga0501033_0207894 | |||
| 3940 | Ga0501034_0000700 | |||
| 3941 | Ga0501034_0000987 | |||
| 3942 | Ga0501034_0001101 | |||
| 3943 | Ga0501034_0008658 | |||
| 3944 | Ga0501034_0018578 | |||
| 3945 | Ga0501034_0055651 | |||
| 3946 | Ga0501034_0080810 | |||
| 3947 | Ga0501034_0153981 | |||
| 3948 | Ga0501034_0158112 | |||
| 3949 | Ga0501034_0255631 | |||
| 3950 | Ga0501034_0304551 | |||
| 3951 | Ga0501034_0932102 | |||
| 3952 | Ga0501034_0975050 | |||
| 3953 | Ga0501036_0001560 | |||
| 3954 | Ga0501036_0004005 | |||
| 3955 | Ga0501036_0010187 | |||
| 3956 | Ga0501036_0011832 | |||
| 3957 | Ga0501036_0034998 | |||
| 3958 | Ga0501036_0088645 | |||
| 3959 | Ga0501036_0200542 | |||
| 3960 | Ga0501036_0275877 | |||
| 3961 | Ga0501036_1415193 | |||
| 3962 | Ga0501037_0000796 | |||
| 3963 | Ga0501037_0001087 | |||
| 3964 | Ga0501037_0003517 | |||
| 3965 | Ga0501037_0020048 | |||
| 3966 | Ga0501037_0073888 | |||
| 3967 | Ga0501037_0143192 | |||
| 3968 | Ga0501037_0410221 | |||
| 3969 | Ga0501037_0417484 | |||
| 3970 | Ga0501038_0001242 | |||
| 3971 | Ga0501038_0021854 | |||
| 3972 | Ga0501038_0022452 | |||
| 3973 | Ga0501038_0022934 | |||
| 3974 | Ga0501038_0128585 | |||
| 3975 | Ga0501038_0229890 | |||
| 3976 | Ga0501038_0235105 | |||
| 3977 | Ga0501038_0680683 | |||
| 3978 | Ga0501039_0001950 | |||
| 3979 | Ga0501039_0004622 | |||
| 3980 | Ga0501039_0014245 | |||
| 3981 | Ga0501039_0062350 | |||
| 3982 | Ga0501039_0073151 | |||
| 3983 | Ga0501039_0083420 | |||
| 3984 | Ga0501039_0420405 | |||
| 3985 | Ga0501039_0482092 | |||
| 3986 | Ga0501039_1502394 | |||
| 3987 | Ga0501040_0002076 | |||
| 3988 | Ga0501040_0004277 | |||
| 3989 | Ga0501040_0012616 | |||
| 3990 | Ga0501040_0182649 | |||
| 3991 | Ga0501040_0320419 | |||
| 3992 | Ga0501041_0000883 | |||
| 3993 | Ga0501041_0011660 | |||
| 3994 | Ga0501041_0180918 | |||
| 3995 | Ga0501042_0009170 | |||
| 3996 | Ga0501042_0031635 | |||
| 3997 | Ga0501042_0069336 | |||
| 3998 | Ga0501043_0000867 | |||
| 3999 | Ga0501043_0002585 | |||
| 4000 | Ga0501043_0005384 | |||
| 4001 | Ga0501043_0006178 | |||
| 4002 | Ga0501043_0026492 | |||
| 4003 | Ga0501043_0038502 | |||
| 4004 | Ga0501043_0093226 | |||
| 4005 | Ga0501043_0236408 | |||
| 4006 | Ga0501043_0343251 | |||
| 4007 | Ga0501043_0507562 | |||
| 4008 | Ga0501043_0584666 | |||
| 4009 | Ga0501046_0002722 | |||
| 4010 | Ga0501046_0003795 | |||
| 4011 | Ga0501046_0013539 | |||
| 4012 | Ga0501046_0055300 | |||
| 4013 | Ga0501046_0073322 | |||
| 4014 | Ga0501047_0000216 | |||
| 4015 | Ga0501047_0000544 | |||
| 4016 | Ga0501047_0002484 | |||
| 4017 | Ga0501047_0027108 | |||
| 4018 | Ga0501047_0034178 | |||
| 4019 | Ga0501047_0045820 | |||
| 4020 | Ga0501047_0068246 | |||
| 4021 | Ga0501047_0271380 | |||
| 4022 | Ga0501047_0295297 | |||
| 4023 | Ga0501047_0335490 | |||
| 4024 | Ga0501047_0604000 | |||
| 4025 | Ga0501047_0771746 | |||
| 4026 | Ga0501047_1361502 | |||
| 4027 | Ga0501048_0002418 | |||
| 4028 | Ga0501048_0002590 | |||
| 4029 | Ga0501048_0003490 | |||
| 4030 | Ga0501048_0199309 | |||
| 4031 | Ga0501067_0002500 | |||
| 4032 | Ga0501068_0000652 | |||
| 4033 | Ga0501068_0192534 | |||
| 4034 | Ga0501068_0872184 | |||
| 4035 | Ga0501068_1123447 | |||
| 4036 | Ga0501069_0005601 | |||
| 4037 | Ga0501069_0012698 | |||
| 4038 | Ga0501069_0165863 | |||
| 4039 | Ga0501069_0238129 | |||
| 4040 | Ga0501069_0532726 | |||
| 4041 | Ga0501069_0585736 | |||
| 4042 | Ga0501069_0945461 | |||
| 4043 | Ga0501070_0000456 | |||
| 4044 | Ga0501070_0000766 | |||
| 4045 | Ga0501070_0007603 | |||
| 4046 | Ga0501070_0108283 | |||
| 4047 | Ga0501070_0326560 | |||
| 4048 | Ga0501070_0505795 | |||
| 4049 | Ga0501070_0600534 | |||
| 4050 | Ga0501070_0656884 | |||
| 4051 | Ga0501070_1493345 | |||
| 4052 | Ga0501071_0006265 | |||
| 4053 | Ga0501071_0011659 | |||
| 4054 | Ga0501072_0002534 | |||
| 4055 | Ga0501072_0005287 | |||
| 4056 | Ga0501072_0776204 | |||
| 4057 | Ga0501073_0055489 | |||
| 4058 | Ga0501073_0057778 | |||
| 4059 | Ga0501073_0073139 | |||
| 4060 | Ga0501073_0137798 | |||
| 4061 | Ga0501073_0224702 | |||
| 4062 | Ga0501074_0006059 | |||
| 4063 | Ga0501074_0006068 | |||
| 4064 | Ga0501074_0199426 | |||
| 4065 | Ga0501074_1138889 | |||
| 4066 | Ga0501075_0013356 | |||
| 4067 | Ga0501076_0006709 | |||
| 4068 | Ga0501076_0089498 | |||
| 4069 | Ga0501076_1756910 | |||
| 4070 | Ga0501077_0015072 | |||
| 4071 | Ga0501077_0129275 | |||
| 4072 | Ga0501077_0184382 | |||
| 4073 | Ga0501235_024973 | |||
| 4074 | Ga0501225_0088809 | |||
| 4075 | Ga0501079_0023146 | |||
| 4076 | Ga0501079_0029937 | |||
| 4077 | Ga0501080_0015534 | |||
| 4078 | Ga0501080_0053708 | |||
| 4079 | Ga0501080_0056741 | |||
| 4080 | Ga0501080_0114961 | |||
| 4081 | Ga0501080_0191273 | |||
| 4082 | Ga0501080_0691588 | |||
| 4083 | Ga0501080_0717311 | |||
| 4084 | Ga0501080_0974738 | |||
| 4085 | Ga0501081_0138955 | |||
| 4086 | Ga0501081_0273584 | |||
| 4087 | Ga0501081_0336567 | |||
| 4088 | Ga0501081_0991854 | |||
| 4089 | Ga0501083_0001307 | |||
| 4090 | Ga0501083_0178532 | |||
| 4091 | Ga0501266_088690 | |||
| 4092 | Ga0501282_003648 | |||
| 4093 | Ga0501035_0000870 | |||
| 4094 | Ga0501035_0001097 | |||
| 4095 | Ga0501035_0001386 | |||
| 4096 | Ga0501035_0004451 | |||
| 4097 | Ga0501035_0010236 | |||
| 4098 | Ga0501035_0018724 | |||
| 4099 | Ga0501035_0020892 | |||
| 4100 | Ga0501035_0090680 | |||
| 4101 | Ga0501035_0101450 | |||
| 4102 | Ga0501035_0179268 | |||
| 4103 | Ga0501035_0429294 | |||
| 4104 | Ga0501035_0753361 | |||
| 4105 | Ga0501044_0001367 | |||
| 4106 | Ga0501044_0002317 | |||
| 4107 | Ga0501044_0004810 | |||
| 4108 | Ga0501044_0007119 | |||
| 4109 | Ga0501044_0019900 | |||
| 4110 | Ga0501044_0049478 | |||
| 4111 | Ga0501044_0053350 | |||
| 4112 | Ga0501044_0086075 | |||
| 4113 | Ga0501044_0102858 | |||
| 4114 | Ga0501044_0104234 | |||
| 4115 | Ga0501044_0121019 | |||
| 4116 | Ga0501044_0160265 | |||
| 4117 | Ga0501044_0197226 | |||
| 4118 | Ga0501044_0357273 | |||
| 4119 | Ga0501044_0516620 | |||
| 4120 | Ga0501044_0604048 | |||
| 4121 | Ga0501045_0003212 | |||
| 4122 | Ga0501045_0016064 | |||
| 4123 | Ga0501045_0099953 | |||
| 4124 | Ga0501045_0781291 | |||
| 4125 | Ga0501045_1393037 | |||
| 4126 | Ga0501212_039845 | |||
| 4127 | nmdc:mga03683_109749_c1 | |||
| 4128 | nmdc:mga03683_196946_c1 | |||
| 4129 | nmdc:mga03683_21413_c1 | |||
| 4130 | nmdc:mga03683_255613_c1 | |||
| 4131 | nmdc:mga03683_317642_c1 | |||
| 4132 | nmdc:mga03683_49387_c1 | |||
| 4133 | nmdc:mga03n38_102027_c1 | |||
| 4134 | nmdc:mga03n38_104021_c1 | |||
| 4135 | nmdc:mga03n38_107_c1 | |||
| 4136 | nmdc:mga03n38_109159_c1 | |||
| 4137 | nmdc:mga03n38_133580_c1 | |||
| 4138 | nmdc:mga03n38_135101_c1 | |||
| 4139 | nmdc:mga03n38_138478_c1 | |||
| 4140 | nmdc:mga03n38_213599_c1 | |||
| 4141 | nmdc:mga03n38_2914_c1 | |||
| 4142 | nmdc:mga03n38_298421_c1 | |||
| 4143 | nmdc:mga03n38_32904_c1 | |||
| 4144 | nmdc:mga03n38_33091_c1 | |||
| 4145 | nmdc:mga03n38_336384_c1 | |||
| 4146 | nmdc:mga03n38_349407_c1 | |||
| 4147 | nmdc:mga03n38_483979_c1 | |||
| 4148 | nmdc:mga03n38_5259_c1 | |||
| 4149 | nmdc:mga03n38_538692_c1 | |||
| 4150 | nmdc:mga03n38_89173_c1 | |||
| 4151 | nmdc:mga03n38_94257_c1 | |||
| 4152 | nmdc:mga00v17_108812_c1 | |||
| 4153 | nmdc:mga00v17_11148_c1 | |||
| 4154 | nmdc:mga00v17_112072_c1 | |||
| 4155 | nmdc:mga00v17_117929_c1 | |||
| 4156 | nmdc:mga00v17_158503_c1 | |||
| 4157 | nmdc:mga00v17_18215_c1 | |||
| 4158 | nmdc:mga00v17_214437_c1 | |||
| 4159 | nmdc:mga00v17_2226_c1 | |||
| 4160 | nmdc:mga00v17_235637_c1 | |||
| 4161 | nmdc:mga00v17_260368_c1 | |||
| 4162 | nmdc:mga00v17_279242_c1 | |||
| 4163 | nmdc:mga00v17_293564_c1 | |||
| 4164 | nmdc:mga00v17_329288_c1 | |||
| 4165 | nmdc:mga00v17_45291_c1 | |||
| 4166 | nmdc:mga00v17_541992_c1 | |||
| 4167 | nmdc:mga00v17_653229_c1 | |||
| 4168 | nmdc:mga00v17_742439_c1 | |||
| 4169 | nmdc:mga00v17_97638_c1 | |||
| 4170 | nmdc:mga0yw44_22775_c1 | |||
| 4171 | nmdc:mga0yw44_242484_c1 | |||
| 4172 | nmdc:mga0yw44_2716_c1 | |||
| 4173 | nmdc:mga0yw44_290519_c1 | |||
| 4174 | nmdc:mga0yw44_35428_c1 | |||
| 4175 | nmdc:mga0yw44_448239_c1 | |||
| 4176 | nmdc:mga0yw44_480209_c1 | |||
| 4177 | nmdc:mga0yw44_61750_c1 | |||
| 4178 | nmdc:mga0yw44_622061_c1 | |||
| 4179 | nmdc:mga0yw44_659728_c1 | |||
| 4180 | nmdc:mga0yw44_739956_c1 | |||
| 4181 | nmdc:mga0yw44_756391_c1 | |||
| 4182 | nmdc:mga0yw44_826811_c1 | |||
| 4183 | nmdc:mga0yw44_99428_c1 | |||
| 4184 | nmdc:mga06z11_100757_c1 | |||
| 4185 | nmdc:mga06z11_241786_c1 | |||
| 4186 | nmdc:mga06z11_31001_c1 | |||
| 4187 | nmdc:mga06z11_464827_c1 | |||
| 4188 | nmdc:mga06z11_515432_c1 | |||
| 4189 | nmdc:mga06z11_528606_c1 | |||
| 4190 | nmdc:mga06z11_533_c1 | |||
| 4191 | nmdc:mga06z11_920561_c1 | |||
| 4192 | nmdc:mga04h51_195285_c1 | |||
| 4193 | nmdc:mga04h51_23177_c1 | |||
| 4194 | nmdc:mga07m45_116413_c1 | |||
| 4195 | nmdc:mga07m45_14311_c1 | |||
| 4196 | nmdc:mga07m45_161483_c1 | |||
| 4197 | nmdc:mga07m45_298273_c1 | |||
| 4198 | nmdc:mga07m45_45821_c1 | |||
| 4199 | nmdc:mga07m45_70843_c1 | |||
| 4200 | nmdc:mga07m45_83179_c1 | |||
| 4201 | nmdc:mga05p37_15340_c1 | |||
| 4202 | nmdc:mga05p37_86594_c1 | |||
| 4203 | nmdc:mga09592_684227_c1 | |||
| 4204 | nmdc:mga0qj67_73761_c1 | |||
| 4205 | nmdc:mga0qj67_86419_c1 | |||
| 4206 | nmdc:mga08y16_1386578_c1 | |||
| 4207 | nmdc:mga08y16_1621178_c1 | |||
| 4208 | nmdc:mga08y16_760492_c1 | |||
| 4209 | nmdc:mga0a205_235559_c1 | |||
| 4210 | nmdc:mga0sz30_105066_c1 | |||
| 4211 | nmdc:mga0sz30_114790_c1 | |||
| 4212 | nmdc:mga0sz30_214035_c1 | |||
| 4213 | nmdc:mga0sz30_21480_c1 | |||
| 4214 | nmdc:mga0sz30_247555_c1 | |||
| 4215 | nmdc:mga0sz30_25097_c1 | |||
| 4216 | nmdc:mga0sz30_338778_c1 | |||
| 4217 | nmdc:mga0sz30_358061_c1 | |||
| 4218 | nmdc:mga0sz30_38126_c1 | |||
| 4219 | nmdc:mga0sz30_38437_c1 | |||
| 4220 | nmdc:mga0sz30_395087_c1 | |||
| 4221 | nmdc:mga0sz30_451939_c1 | |||
| 4222 | nmdc:mga0sz30_465596_c1 | |||
| 4223 | nmdc:mga0sz30_62206_c2 | |||
| 4224 | nmdc:mga0sz30_70896_c1 | |||
| 4225 | Ga0495601_0026650 | |||
| 4226 | Ga0495601_0038926 | |||
| 4227 | Ga0495601_0073237 | |||
| 4228 | Ga0495612_0005779 | |||
| 4229 | Ga0495612_0087117 | |||
| 4230 | Ga0500610_0011119 | |||
| 4231 | Ga0500610_0147176 | |||
| 4232 | Ga0500610_0284705 | |||
| 4233 | Ga0500635_0465480 | |||
| 4234 | Ga0495655_0093937 | |||
| 4235 | Ga0495655_0324614 | |||
| 4236 | Ga0495655_0367919 | |||
| 4237 | Ga0495595_0407764 | |||
| 4238 | Ga0495619_0007645 | |||
| 4239 | Ga0495619_0133108 | |||
| 4240 | Ga0495619_0209860 | |||
| 4241 | Ga0495619_0772303 | |||
| 4242 | Ga0500578_0185326 | |||
| 4243 | Ga0500578_0250628 | |||
| 4244 | Ga0500578_0361070 | |||
| 4245 | Ga0500643_004993 | |||
| 4246 | Ga0500643_034977 | |||
| 4247 | Ga0500643_040244 | |||
| 4248 | Ga0500643_042530 | |||
| 4249 | Ga0500581_203034 | |||
| 4250 | Ga0500583_0211859 | |||
| 4251 | Ga0500583_0318492 | |||
| 4252 | Ga0500651_0722005 | |||
| 4253 | Ga0500566_0114405 | |||
| 4254 | Ga0500640_000199 | |||
| 4255 | Ga0500641_0119258 | |||
| 4256 | Ga0500650_0052766 | |||
| 4257 | Ga0500654_032949 | |||
| 4258 | Ga0500654_187819 | |||
| 4259 | Ga0500553_034430 | |||
| 4260 | Ga0500556_0025034 | |||
| 4261 | Ga0500556_0115219 | |||
| 4262 | Ga0500558_214684 | |||
| 4263 | Ga0500560_000605 | |||
| 4264 | Ga0500560_015926 | |||
| 4265 | Ga0500560_042009 | |||
| 4266 | Ga0500562_037695 | |||
| 4267 | Ga0500562_163035 | |||
| 4268 | Ga0500569_000808 | |||
| 4269 | Ga0500572_027614 | |||
| 4270 | Ga0500572_259794 | |||
| 4271 | Ga0500594_0187516 | |||
| 4272 | Ga0500595_063465 | |||
| 4273 | Ga0500608_054416 | |||
| 4274 | Ga0500614_041281 | |||
| 4275 | Ga0500618_152749 | |||
| 4276 | Ga0500621_029543 | |||
| 4277 | Ga0500628_004395 | |||
| 4278 | Ga0500628_030134 | |||
| 4279 | Ga0500652_001721 | |||
| 4280 | Ga0500652_010700 | |||
| 4281 | Ga0500652_176044 | |||
| 4282 | Ga0500652_269688 | |||
| 4283 | Ga0500655_055522 | |||
| 4284 | Ga0500658_0021304 | |||
| 4285 | Ga0500559_0146159 | |||
| 4286 | Ga0500559_0193688 | |||
| 4287 | Ga0500559_0529806 | |||
| 4288 | Ga0500561_0000789 | |||
| 4289 | Ga0500573_0005248 | |||
| 4290 | Ga0500573_0024372 | |||
| 4291 | Ga0500573_0052240 | |||
| 4292 | Ga0500573_0446074 | |||
| 4293 | Ga0500579_044854 | |||
| 4294 | Ga0500586_026498 | |||
| 4295 | Ga0500586_198010 | |||
| 4296 | Ga0500588_0035717 | |||
| 4297 | Ga0500588_0306182 | |||
| 4298 | Ga0500600_0022759 | |||
| 4299 | Ga0500603_037368 | |||
| 4300 | Ga0500616_0041089 | |||
| 4301 | Ga0500616_0055332 | |||
| 4302 | Ga0500616_0141584 | |||
| 4303 | Ga0500620_283881 | |||
| 4304 | Ga0500627_0085476 | |||
| 4305 | Ga0500633_0022892 | |||
| 4306 | Ga0500633_0254976 | |||
| 4307 | Ga0500634_0039494 | |||
| 4308 | Ga0500634_0134890 | |||
| 4309 | Ga0500645_000032 | |||
| 4310 | Ga0500645_172225 | |||
| 4311 | Ga0500656_030485 | |||
| 4312 | Ga0500587_003192 | |||
| 4313 | Ga0501084_0001814 | |||
| 4314 | Ga0501084_0025061 | |||
| 4315 | Ga0587073_0223576 | |||
| 4316 | Ga0587080_095102 | |||
| 4317 | Ga0587083_0054650 | |||
| 4318 | Ga0587099_061417 | |||
| 4319 | Ga0587122_008489 | |||
| 4320 | Ga0587067_042151 | |||
| 4321 | Ga0587069_121145 | |||
| 4322 | Ga0587114_057507 | |||
| 4323 | Ga0501082_0003705 | |||
| 4324 | Ga0501082_0104495 | |||
| 4325 | Ga0466962_0000056 | |||
| 4326 | Ga0466962_0000729 | |||
| 4327 | Ga0466962_0003557 | |||
| 4328 | Ga0466962_0007132 | |||
| 4329 | Ga0466962_0017444 | |||
| 4330 | Ga0466962_0086224 | |||
| 4331 | Ga0466962_0434474 | |||
| 4332 | Ga0530510_0034383 | |||
| 4333 | 2523384142 | |||
| 4334 | 2547410063 | |||
| 4335 | 2552108214 | |||
| 4336 | 2554256882 | |||
| 4337 | 2566996612 | |||
| 4338 | 2585299419 | |||
| 4339 | 2585308196 | |||
| 4340 | 2585319180 | |||
| 4341 | 2616696887 | |||
| 4342 | 2616902026 | |||
| 4343 | 2643764858 | |||
| 4344 | 2643902801 | |||
| 4345 | 2643942076 | |||
| 4346 | 2644017240 | |||
| 4347 | 2644173799 | |||
| 4348 | 2644261701 | |||
| 4349 | 2644389735 | |||
| 4350 | 2644404690 | |||
| 4351 | 2644429159 | |||
| 4352 | 2644439224 | |||
| 4353 | 2644461302 | |||
| 4354 | 2644489447 | |||
| 4355 | 2644516043 | |||
| 4356 | 2644633411 | |||
| 4357 | 2644636251 | |||
| 4358 | 2731908880 | |||
| 4359 | 2738667089 | |||
| 4360 | 2738708748 | |||
| 4361 | 2738891350 | |||
| 4362 | 2739145933 | |||
| 4363 | 2739205425 | |||
| 4364 | 2744957629 | |||
| 4365 | 2753037133 | |||
| 4366 | 2753325002 | |||
| 4367 | 2768643405 | |||
| 4368 | 2784589629 | |||
| 4369 | 2785341974 | |||
| 4370 | 2785370673 | |||
| 4371 | 2786671856 | |||
| 4372 | 2793980307 | |||
| 4373 | 2799186689 | |||
| 4374 | 2808843229 | |||
| 4375 | 2808912818 | |||
| 4376 | 2808921578 | |||
| 4377 | 2809233309 | |||
| 4378 | 2811845196 | |||
| 4379 | 2812356819 | |||
| 4380 | 2812479534 | |||
| 4381 | 2819695309 | |||
| 4382 | 2842138795 | |||
| 4383 | 2842891061 | |||
| 4384 | 2852640433 | |||
| 4385 | 2862181685 | |||
| 4386 | 2862286758 | |||
| 4387 | 2862292195 | |||
| 4388 | 2862387714 | |||
| 4389 | 2862514387 | |||
| 4390 | 2862578278 | |||
| 4391 | 2863411665 | |||
| 4392 | 2867434711 | |||
| 4393 | 2867479144 | |||
| 4394 | 2868090607 | |||
| 4395 | 2873154776 | |||
| 4396 | 2877679915 | |||
| 4397 | 2902798010 | |||
| 4398 | 2902799094 | |||
| 4399 | 2902804392 | |||
| 4400 | 2902812375 | |||
| 4401 | 2902815770 | |||
| 4402 | 2902842212 | |||
| 4403 | 2904539130 | |||
| 4404 | 2912718561 | |||
| 4405 | 2912762042 | |||
| 4406 | 2918505723 | |||
| 4407 | 2919475444 | |||
| 4408 | 2922555798 | |||
| 4409 | 2928144860 | |||
| 4410 | 2929214382 | |||
| 4411 | 2935394868 | |||
| 4412 | 2939586269 | |||
| 4413 | 2946048700 | |||
| 4414 | 2946069053 | |||
| 4415 | 2946077000 | |||
| 4416 | 2947227885 | |||
| 4417 | 2954003032 | |||
| 4418 | 2954384870 | |||
| 4419 | 2954678133 | |||
| 4420 | 2954686025 | |||
| 4421 | 2954695683 | |||
| 4422 | 2954710876 | |||
| 4423 | 2954715099 | |||
| 4424 | 2954725041 | |||
| 4425 | 2954736777 | |||
| 4426 | 2954743974 | |||
| 4427 | 2954755624 | |||
| 4428 | 2954762914 | |||
| 4429 | 2966601543 | |||
| 4430 | 2974319892 | |||
| 4431 | 2984523764 | |||
| 4432 | 2990045362 | |||
| 4433 | 2990062205 | |||
| 4434 | 2995468636 | |||
| 4435 | 2997458156 | |||
| 4436 | 2997606378 | |||
| 4437 | 3001890491 | |||
| 4438 | 3006326300 | |||
| 4439 | 3006393465 | |||
| 4440 | 3006492632 | |||
| 4441 | 3006499677 | |||
| 4442 | 8008566438 | |||
| 4443 | 8008577889 | |||
| 4444 | 8023626424 | |||
| 4445 | 8025484836 | |||
| 4446 | 8025534831 | |||
| 4447 | 8033689151 | |||
| 4448 | 8047719891 | |||
| 4449 | 8047897061 | |||
| 4450 | 8048134681 | |||
| 4451 | 8048361891 | |||
| 4452 | 8048374045 | |||
| 4453 | 8048384181 | |||
| 4454 | 8048410734 | |||
| 4455 | 8053948525 | |||
| 4456 | 8054160729 | |||
| 4457 | 8056448877 | |||
| 4458 | 8056667953 | |||
| 4459 | 8056833872 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7su2-assembly1.cif.gz_C | crystal structure of a co-bound ridc1 variant | 0.9678 | 7 | 45 |
| 7rwx-assembly1.cif.gz_B-2 | crystal structure of a zn-bound ridc1 variant in the presence of reductant | 0.966 | 7 | 45 |
| 6dy4-assembly2.cif.gz_D | fe(ii)-bound structure of the engineered cyt cb562 variant, ch2e | 0.9643 | 7 | 45 |
| 5l31-assembly1.cif.gz_B | crystal structure of an engineered metal-free ridc1 variant containing five disulfide bonds. | 0.963 | 7 | 45 |
| 4er9-assembly1.cif.gz_A | crystal structure of cytochrome b562 from salmonella enterica subsp. enterica serovar typhimurium str. 14028s | 0.9626 | 6 | 45 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9XK79_1_97_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9694 | 7 | 84 | 1.10.287.3510 |
| 2qlaA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 | 0.9667 | 7 | 45 | 1.20.120.10 |
| 4er9A00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 | 0.9626 | 6 | 45 | 1.20.120.10 |
| 2bc5B00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 | 0.9597 | 7 | 45 | 1.20.120.10 |
| 3nmiE00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 | 0.956 | 7 | 45 | 1.20.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E0M9H2-F1-model_v4 | NADH-quinone oxidoreductase subunit NuoK | 0.9959 | 1 | 73 |
GO:0016651
GO:0030964 GO:0042773 |
| AF-A0A0C9LSE0-F1-model_v4 | NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) | 0.9856 | 3 | 84 |
GO:0005886
GO:0030964 GO:0042773 GO:0048038 GO:0050136 |
| AF-A0A4P5XI80-F1-model_v4 | NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) | 0.9824 | 3 | 84 |
GO:0005886
GO:0030964 GO:0042773 GO:0048038 GO:0050136 |
| AF-A0A7C3TW05-F1-model_v4 | NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) | 0.9794 | 3 | 84 |
GO:0005886
GO:0030964 GO:0042773 GO:0048038 GO:0050136 |
| AF-A0A0R2U7Q2-F1-model_v4 | NADH:ubiquinone oxidoreductase subunit K (EC 1.6.5.11) | 0.9775 | 1 | 79 |
GO:0016651
GO:0030964 GO:0042773 GO:0048038 |