F496572

General Info

Members Datasets Scaffolds Average Seq Length
2229 741 4459 99

Family's Representative Sequence

Representative Sequence 3300049743|Ga0501081_1435834|Ga0501081_1435834_84_389
Length 95
Sequence MRTPIGYFLVVSAMLFSIGTIGVLVRRNALIIFMSVELQLNAVNLALVAFSRMHGELNGQVLAFFSLVVAGLAIIVTVFRRRHSASVDDASVLRG

Samples

Sample ID Description Type Environment
1 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
8 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
95 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
97 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
98 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
99 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
100 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
101 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
102 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
103 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
104 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
105 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
106 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
107 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
108 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
109 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
110 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
111 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
112 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
113 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
114 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
115 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
116 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
117 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
119 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
120 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
121 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
122 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
123 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
124 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
128 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
129 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
138 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
139 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
140 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
141 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
142 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
143 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
144 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
145 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
146 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
147 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
148 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
149 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
150 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
151 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
152 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
153 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
154 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
155 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
156 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
157 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
158 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
159 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
160 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
161 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
162 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
163 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
167 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
171 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
172 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
173 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
175 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
176 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
177 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
247 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
248 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
249 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
253 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
254 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
255 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
256 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
257 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
258 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
259 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
260 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
261 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
262 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
263 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
264 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
265 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
266 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
267 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
268 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
269 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
270 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
271 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
272 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
273 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
274 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
275 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
276 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
277 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
278 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
279 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
280 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
281 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
282 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
283 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
284 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
285 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
287 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
288 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
290 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
291 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
292 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
293 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
294 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
295 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
296 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
297 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
298 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
299 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
300 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
301 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
302 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
303 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
304 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
305 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
306 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
307 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
308 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
309 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
310 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
311 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
312 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
313 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
314 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
315 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
316 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
317 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
318 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
319 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
320 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
321 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
322 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
323 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
324 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
325 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
326 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
327 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
328 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
329 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
330 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
331 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
332 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
333 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
334 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
335 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
336 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
337 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
338 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
339 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
340 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
341 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
342 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
343 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
344 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
345 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
346 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
347 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
348 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
349 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
350 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
351 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
352 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
353 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
354 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
355 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
356 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
357 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
358 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
359 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
360 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
361 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
362 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
363 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
364 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
365 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
366 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
367 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
368 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
369 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
370 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
371 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
372 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
373 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
374 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
375 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
376 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
377 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
378 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
379 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
380 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
381 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
382 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
383 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
384 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
385 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
386 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
387 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
388 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
389 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
390 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
391 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
392 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
393 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
394 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
395 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
396 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
397 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
398 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
399 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
400 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
401 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
402 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
403 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
404 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
405 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
406 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
407 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
408 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
409 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
410 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
411 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
412 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
413 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
414 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
415 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
416 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
417 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
418 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
419 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
420 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
421 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
422 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
423 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
424 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
425 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
426 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
427 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
428 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
429 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
430 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
431 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
432 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
433 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
434 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
435 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
436 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
437 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
438 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
439 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
440 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
441 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
442 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
443 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
444 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
445 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
446 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
447 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
448 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
449 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
450 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
451 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
452 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
453 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
454 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
455 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
456 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
457 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
458 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
459 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
460 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
461 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
462 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
463 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
464 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
465 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
466 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
467 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
468 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
469 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
470 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
471 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
472 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
473 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
474 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
475 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
476 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
477 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
478 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
479 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
480 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
481 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
482 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
483 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
484 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
485 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
486 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
487 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
488 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
489 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
490 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
491 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
492 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
493 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
494 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
495 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
496 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
497 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
498 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
499 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
500 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
501 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
502 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
503 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
504 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
505 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
506 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
507 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
508 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
509 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
510 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
511 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
512 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
513 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
514 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
515 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
516 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
517 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
518 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
519 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
520 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
521 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
522 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
523 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
524 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
525 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
526 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
527 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
528 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
529 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
530 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
531 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
532 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
533 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
534 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
535 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
536 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
537 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
538 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
539 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
540 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
541 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
542 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
543 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
544 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
545 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
546 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
547 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
548 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
549 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
550 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
551 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
552 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
553 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
554 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
555 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
556 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
557 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
558 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
559 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
560 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
561 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
562 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
563 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
564 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
565 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
566 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
567 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
568 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
569 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
570 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
571 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
572 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
573 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
574 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
575 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
576 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
577 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
578 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
579 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
580 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
581 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
582 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
583 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
584 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
585 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
586 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
587 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
588 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
589 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
590 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
591 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
592 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
593 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
594 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
595 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
596 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
597 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
598 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
599 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
600 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
601 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
602 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
603 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
604 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
605 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
606 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
607 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
608 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
609 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
610 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
611 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
612 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
613 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
614 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
615 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
616 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
617 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
618 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
619 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
620 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
621 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
622 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
623 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
624 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
625 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
626 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
627 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
628 2643221548 Streptomyces sp. Root55 Isolate Unclassified
629 2643221578 Streptomyces sp. Root63 Isolate Unclassified
630 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
631 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
632 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
633 2643221647 Streptomyces sp. Root369 Isolate Unclassified
634 2643221670 Streptomyces sp. Root431 Isolate Unclassified
635 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
636 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
637 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
638 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
639 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
640 2643221692 Nocardia sp. Root136 Isolate Unclassified
641 2643221714 Streptomyces sp. Root264 Isolate Unclassified
642 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
643 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
644 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
645 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
646 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
647 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
648 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
649 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
650 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
651 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
652 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
653 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
654 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
655 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
656 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
657 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
658 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
659 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
660 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
661 2808606448 Streptomyces sp. 193411 Isolate Unclassified
662 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
663 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
664 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
665 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
666 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
667 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
668 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
669 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
670 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
671 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
672 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
673 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
674 2862574272 Streptomyces sp. AcE210 Isolate Nodule
675 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
676 2867428634 Streptomyces sp. RP5T Isolate Unclassified
677 2867475112 Streptomyces sp. TM32 Isolate Unclassified
678 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
679 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
680 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
681 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
682 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
683 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
684 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
685 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
686 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
687 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
688 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
689 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
690 2922554459 Rhodococcus sp. 66b Isolate Unclassified
691 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
692 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
693 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
694 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
695 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
696 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
697 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
698 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
699 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
700 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
701 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
702 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
703 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
704 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
705 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
706 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
707 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
708 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
709 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
710 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
711 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
712 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
713 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
714 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
715 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
716 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
717 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
718 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
719 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
720 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
721 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
722 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
723 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
724 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
725 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
726 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
727 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
728 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
729 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
730 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
731 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
732 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
733 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
734 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
735 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
736 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
737 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
738 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
739 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
740 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
741 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.27
Metatranscriptomes 1.03
Isolates 5.7

Biome Distribution

Category Percentage (%)
Aerial Root 0.04
Bulb 0
Endosphere 12.25
Nodule 0.27
Rhizoplane 7.27
Rhizosphere 71.02
Stem 0
Stem Tuber 0
Unclassified 0.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501081_1435834 3300049743 Bacteria 524
2 LJNas_1001325 3300000546 Bacteria 3615
3 JGI24739J22299_10017756 3300001989 Bacteria 2564
4 JGI24737J22298_10020298 3300001990 Bacteria 2121
5 JGI24743J22301_10007900 3300001991 Bacteria 1856
6 JGI24750J21931_1001262 3300002070 Bacteria 3204
7 JGI24750J21931_1025756 3300002070 Bacteria 844
8 JGI24745J21846_1004116 3300002073 Bacteria 1546
9 JGI24748J21848_1003666 3300002074 Bacteria 1757
10 JGI24738J21930_10004342 3300002075 Bacteria 3487
11 JGI24749J21850_1003699 3300002076 Bacteria 2139
12 JGI24744J21845_10000088 3300002077 Bacteria 11973
13 JGI24744J21845_10002005 3300002077 Bacteria 4117
14 JGI24744J21845_10002298 3300002077 Bacteria 3895
15 JGI24034J26672_10035846 3300002239 Bacteria 821
16 JGI24742J22300_10000958 3300002244 Bacteria 4421
17 JGI24742J22300_10028088 3300002244 Bacteria 976
18 JGI24751J29686_10037569 3300002459 Bacteria 1002
19 JGI25153J46596_10083828 3300003215 Bacteria 787
20 rootH1_10017056 3300003316 Bacteria 1229
21 rootH1_10017056 3300003323 Bacteria 40617
22 rootH2_10032831 3300003320 Bacteria 1759
23 rootL2_10002375 3300003322 Bacteria 2847
24 rootH1_10061150 3300003323 Bacteria 2895
25 JGI25160J50197_1015644 3300003354 Bacteria 2482
26 JGI25160J50197_1022123 3300003354 Bacteria 1871
27 JGI25160J50197_1050490 3300003354 Bacteria 886
28 JGI25160J50197_1096305 3300003354 Bacteria 531
29 Ga0006562J51391_1101924 3300003578 Bacteria 1620
30 Ga0055540_1000003 3300003792 Bacteria 428375
31 Ga0055540_1003721 3300003792 Bacteria 7211
32 Ga0055540_1005958 3300003792 Bacteria 4956
33 Ga0055540_1006423 3300003792 Bacteria 4673
34 Ga0055540_1012991 3300003792 Bacteria 2573
35 Ga0055540_1060386 3300003792 Bacteria 759
36 Ga0070658_10000319 3300005327 Bacteria 41203
37 Ga0070658_10168973 3300005327 Bacteria 1837
38 Ga0070658_11043273 3300005327 Bacteria 711
39 Ga0070676_10005021 3300005328 Bacteria 7011
40 Ga0070683_100255133 3300005329 Bacteria 1668
41 Ga0070683_100544285 3300005329 Bacteria 1110
42 Ga0070683_102219522 3300005329 Bacteria 527
43 Ga0070690_100066359 3300005330 Bacteria 2336
44 Ga0070690_100514413 3300005330 Bacteria 898
45 Ga0070670_100341739 3300005331 Bacteria 1314
46 Ga0070670_101463295 3300005331 Bacteria 627
47 Ga0070677_10131461 3300005333 Bacteria 1143
48 Ga0068869_100078270 3300005334 Bacteria 2462
49 Ga0068869_102158052 3300005334 Bacteria 501
50 Ga0070666_10114765 3300005335 Bacteria 1865
51 Ga0070666_10206198 3300005335 Bacteria 1384
52 Ga0070666_10589613 3300005335 Bacteria 811
53 Ga0070680_100000061 3300005336 Bacteria 56357
54 Ga0070680_100238798 3300005336 Bacteria 1536
55 Ga0070680_101437996 3300005336 Bacteria 597
56 Ga0070682_100071052 3300005337 Bacteria 2227
57 Ga0070682_100286998 3300005337 Bacteria 1202
58 Ga0070682_100841066 3300005337 Bacteria 749
59 Ga0070682_101277581 3300005337 Bacteria 623
60 Ga0070682_101512840 3300005337 Bacteria 577
61 Ga0068868_100001480 3300005338 Bacteria 16204
62 Ga0070660_100110954 3300005339 Bacteria 2182
63 Ga0070660_100361827 3300005339 Bacteria 1196
64 Ga0070689_100020932 3300005340 Bacteria 4862
65 Ga0070689_100706067 3300005340 Bacteria 881
66 Ga0070691_10002982 3300005341 Bacteria 7578
67 Ga0070691_11041401 3300005341 Bacteria 513
68 Ga0070687_100186584 3300005343 Bacteria 1246
69 Ga0070687_100198977 3300005343 Bacteria 1213
70 Ga0070661_100990318 3300005344 Bacteria 697
71 Ga0070692_10095309 3300005345 Bacteria 1624
72 Ga0070692_10401231 3300005345 Bacteria 866
73 Ga0070668_100001192 3300005347 Bacteria 18433
74 Ga0070668_100006438 3300005347 Bacteria 8708
75 Ga0070668_100068621 3300005347 Bacteria 2756
76 Ga0070668_101492986 3300005347 Bacteria 618
77 Ga0070669_100004569 3300005353 Bacteria 9993
78 Ga0070669_100099405 3300005353 Bacteria 2193
79 Ga0070675_101430454 3300005354 Bacteria 637
80 Ga0070671_100047031 3300005355 Bacteria 3589
81 Ga0070674_100000187 3300005356 Bacteria 29321
82 Ga0070674_100025474 3300005356 Bacteria 3851
83 Ga0070674_100300932 3300005356 Bacteria 1279
84 Ga0070674_100495203 3300005356 Bacteria 1017
85 Ga0070673_100102120 3300005364 Bacteria 2364
86 Ga0070688_101080451 3300005365 Bacteria 641
87 Ga0070659_100018793 3300005366 Bacteria 5217
88 Ga0070659_100026599 3300005366 Bacteria 4453
89 Ga0070659_100436784 3300005366 Bacteria 1109
90 Ga0070667_100000056 3300005367 Bacteria 150952
91 Ga0070667_100000854 3300005367 Bacteria 28370
92 Ga0070667_100003985 3300005367 Bacteria 12518
93 Ga0070667_100025316 3300005367 Bacteria 4933
94 Ga0070667_100221674 3300005367 Bacteria 1683
95 Ga0070667_100591567 3300005367 Bacteria 1022
96 Ga0070703_10053183 3300005406 Bacteria 1302
97 Ga0070709_10032314 3300005434 Bacteria 3155
98 Ga0070709_10130230 3300005434 Bacteria 1717
99 Ga0070714_100016403 3300005435 Bacteria 5979
100 Ga0070714_100065097 3300005435 Bacteria 3139
101 Ga0070714_100252503 3300005435 Bacteria 1631
102 Ga0070714_100348335 3300005435 Bacteria 1391
103 Ga0070714_100451848 3300005435 Bacteria 1221
104 Ga0070714_100863902 3300005435 Bacteria 878
105 Ga0070714_101432416 3300005435 Bacteria 675
106 Ga0070714_101507705 3300005435 Bacteria 657
107 Ga0070713_100015655 3300005436 Bacteria 5680
108 Ga0070713_100080518 3300005436 Bacteria 2777
109 Ga0070713_100215794 3300005436 Bacteria 1739
110 Ga0070713_100265185 3300005436 Bacteria 1571
111 Ga0070713_100361968 3300005436 Bacteria 1348
112 Ga0070713_100629163 3300005436 Bacteria 1021
113 Ga0070710_10000277 3300005437 Bacteria 24255
114 Ga0070710_10044347 3300005437 Bacteria 2467
115 Ga0070710_10168660 3300005437 Bacteria 1362
116 Ga0070710_10370702 3300005437 Bacteria 953
117 Ga0070701_10034333 3300005438 Bacteria 2540
118 Ga0070711_100000493 3300005439 Bacteria 20558
119 Ga0070711_100029466 3300005439 Bacteria 3622
120 Ga0070711_100253283 3300005439 Bacteria 1382
121 Ga0070711_100885304 3300005439 Bacteria 761
122 Ga0070705_100200449 3300005440 Bacteria 1368
123 Ga0070705_100263554 3300005440 Bacteria 1217
124 Ga0070700_100289210 3300005441 Bacteria 1191
125 Ga0070694_100008280 3300005444 Bacteria 6359
126 Ga0070694_100118065 3300005444 Bacteria 1899
127 Ga0070708_100297322 3300005445 Bacteria 1520
128 Ga0070663_100042981 3300005455 Bacteria 3178
129 Ga0070663_100362811 3300005455 Bacteria 1176
130 Ga0070663_100429842 3300005455 Bacteria 1085
131 Ga0070663_101210567 3300005455 Bacteria 664
132 Ga0070663_101289937 3300005455 Bacteria 644
133 Ga0070678_100000280 3300005456 Bacteria 23679
134 Ga0070678_100247043 3300005456 Bacteria 1495
135 Ga0070678_100300022 3300005456 Bacteria 1365
136 Ga0070678_100982985 3300005456 Bacteria 775
137 Ga0070678_101874325 3300005456 Bacteria 566
138 Ga0070662_100001491 3300005457 Bacteria 14399
139 Ga0070662_101359820 3300005457 Bacteria 611
140 Ga0070681_10001025 3300005458 Bacteria 23693
141 Ga0070681_10754339 3300005458 Bacteria 890
142 Ga0070681_11539087 3300005458 Bacteria 590
143 Ga0068867_100002048 3300005459 Bacteria 14123
144 Ga0070685_10119192 3300005466 Bacteria 1637
145 Ga0070685_10148015 3300005466 Bacteria 1485
146 Ga0070685_10838994 3300005466 Bacteria 680
147 Ga0070679_100001551 3300005530 Bacteria 20538
148 Ga0070684_100169163 3300005535 Bacteria 1985
149 Ga0070697_100880770 3300005536 Bacteria 794
150 Ga0068853_100001367 3300005539 Bacteria 17604
151 Ga0068853_100084260 3300005539 Bacteria 2785
152 Ga0068853_100142792 3300005539 Bacteria 2150
153 Ga0068853_100570000 3300005539 Bacteria 1074
154 Ga0068853_101643301 3300005539 Bacteria 623
155 Ga0070672_100249143 3300005543 Bacteria 1496
156 Ga0070672_100569437 3300005543 Bacteria 985
157 Ga0070695_100008891 3300005545 Bacteria 5966
158 Ga0070695_100267175 3300005545 Bacteria 1252
159 Ga0070696_100002977 3300005546 Bacteria 11251
160 Ga0070696_100854901 3300005546 Bacteria 752
161 Ga0070693_100021947 3300005547 Bacteria 3389
162 Ga0070693_100098763 3300005547 Bacteria 1775
163 Ga0070693_100531666 3300005547 Bacteria 839
164 Ga0070693_101023388 3300005547 Bacteria 626
165 Ga0070665_100011296 3300005548 Bacteria 9031
166 Ga0070665_100039320 3300005548 Bacteria 4756
167 Ga0070665_100083036 3300005548 Bacteria 3209
168 Ga0070665_100230350 3300005548 Bacteria 1853
169 Ga0070665_100316153 3300005548 Bacteria 1566
170 Ga0070665_100825882 3300005548 Bacteria 940
171 Ga0070665_101327790 3300005548 Bacteria 729
172 Ga0070665_102564412 3300005548 Bacteria 511
173 Ga0070704_100001052 3300005549 Bacteria 14260
174 Ga0070704_100019306 3300005549 Bacteria 4378
175 Ga0070704_100819551 3300005549 Bacteria 833
176 Ga0068855_100244028 3300005563 Bacteria 2006
177 Ga0068855_100417642 3300005563 Bacteria 1468
178 Ga0068855_100590408 3300005563 Bacteria 1199
179 Ga0068855_100596191 3300005563 Bacteria 1192
180 Ga0068855_100745022 3300005563 Bacteria 1045
181 Ga0068855_101397090 3300005563 Bacteria 722
182 Ga0068855_102602693 3300005563 Bacteria 502
183 Ga0070664_101013283 3300005564 Bacteria 781
184 Ga0068857_100597961 3300005577 Bacteria 1043
185 Ga0068854_100000458 3300005578 Bacteria 25182
186 Ga0068854_100020918 3300005578 Bacteria 4433
187 Ga0068854_100252151 3300005578 Bacteria 1410
188 Ga0068856_100203470 3300005614 Bacteria 1994
189 Ga0070702_100000308 3300005615 Bacteria 16864
190 Ga0070702_100148986 3300005615 Bacteria 1499
191 Ga0070702_100956426 3300005615 Bacteria 675
192 Ga0068852_100063059 3300005616 Bacteria 3226
193 Ga0068852_100154194 3300005616 Bacteria 2138
194 Ga0068852_101270523 3300005616 Bacteria 758
195 Ga0068852_101980594 3300005616 Bacteria 605
196 Ga0068859_100000751 3300005617 Bacteria 32654
197 Ga0068859_100039348 3300005617 Bacteria 4743
198 Ga0068859_100206485 3300005617 Bacteria 2050
199 Ga0068864_100132511 3300005618 Bacteria 2241
200 Ga0068864_100468211 3300005618 Bacteria 1208
201 Ga0068864_101863702 3300005618 Bacteria 607
202 Ga0068864_102197808 3300005618 Bacteria 558
203 Ga0068866_10000187 3300005718 Bacteria 29090
204 Ga0068866_10029932 3300005718 Bacteria 2608
205 Ga0068866_10533620 3300005718 Bacteria 782
206 Ga0068866_11223904 3300005718 Bacteria 543
207 Ga0068861_100000195 3300005719 Bacteria 32550
208 Ga0068861_100225745 3300005719 Bacteria 1585
209 Ga0068861_101604859 3300005719 Bacteria 641
210 Ga0068851_10393066 3300005834 Bacteria 815
211 Ga0068870_10747542 3300005840 Bacteria 679
212 Ga0068863_100018953 3300005841 Bacteria 6585
213 Ga0068863_100081670 3300005841 Bacteria 3062
214 Ga0068863_100128462 3300005841 Bacteria 2419
215 Ga0068863_100207411 3300005841 Bacteria 1886
216 Ga0068863_101773287 3300005841 Bacteria 627
217 Ga0068858_100006827 3300005842 Bacteria 11104
218 Ga0068858_100015158 3300005842 Bacteria 7250
219 Ga0068858_100106856 3300005842 Bacteria 2612
220 Ga0068858_100269146 3300005842 Bacteria 1621
221 Ga0068858_100447887 3300005842 Bacteria 1244
222 Ga0068858_100999124 3300005842 Bacteria 820
223 Ga0068858_101387952 3300005842 Bacteria 692
224 Ga0068858_102180194 3300005842 Bacteria 548
225 Ga0068860_100000092 3300005843 Bacteria 150190
226 Ga0068860_100001932 3300005843 Bacteria 21940
227 Ga0068860_100157374 3300005843 Bacteria 2190
228 Ga0068862_100000035 3300005844 Bacteria 174953
229 Ga0068862_100006561 3300005844 Bacteria 9653
230 Ga0068862_100074824 3300005844 Bacteria 2928
231 Ga0068862_101578887 3300005844 Bacteria 663
232 Ga0081455_10024172 3300005937 Bacteria 5635
233 Ga0081455_10031920 3300005937 Bacteria 4755
234 Ga0081455_10034690 3300005937 Bacteria 4517
235 Ga0081455_10091239 3300005937 Bacteria 2468
236 Ga0081455_10192807 3300005937 Bacteria 1533
237 Ga0081455_10273175 3300005937 Bacteria 1225
238 Ga0081538_10136302 3300005981 Bacteria 1142
239 Ga0081540_1047146 3300005983 Bacteria 2169
240 Ga0081539_10045318 3300005985 Bacteria 2530
241 Ga0081539_10050996 3300005985 Bacteria 2336
242 Ga0070717_10212312 3300006028 Bacteria 1699
243 Ga0070717_10384114 3300006028 Bacteria 1259
244 Ga0075365_10004705 3300006038 Bacteria 7278
245 Ga0075365_10019404 3300006038 Bacteria 4196
246 Ga0075365_10024575 3300006038 Bacteria 3802
247 Ga0075365_10082992 3300006038 Bacteria 2174
248 Ga0075365_10197265 3300006038 Bacteria 1410
249 Ga0075365_10292279 3300006038 Bacteria 1146
250 Ga0075365_10470498 3300006038 Bacteria 888
251 Ga0075365_10635542 3300006038 Bacteria 754
252 Ga0075365_10963222 3300006038 Bacteria 601
253 Ga0075365_11198904 3300006038 Bacteria 534
254 Ga0075368_10007123 3300006042 Bacteria 3937
255 Ga0075368_10251780 3300006042 Bacteria 755
256 Ga0075368_10293280 3300006042 Bacteria 701
257 Ga0075368_10480886 3300006042 Bacteria 553
258 Ga0075363_100000383 3300006048 Bacteria 13424
259 Ga0075363_100000613 3300006048 Bacteria 11798
260 Ga0075363_100002816 3300006048 Bacteria 7228
261 Ga0075363_100012126 3300006048 Bacteria 4146
262 Ga0075363_100026851 3300006048 Bacteria 2949
263 Ga0075363_100032534 3300006048 Bacteria 2710
264 Ga0075363_100076456 3300006048 Bacteria 1825
265 Ga0075363_100099522 3300006048 Bacteria 1608
266 Ga0075363_100135422 3300006048 Bacteria 1384
267 Ga0075363_100190303 3300006048 Bacteria 1170
268 Ga0075363_100213308 3300006048 Bacteria 1105
269 Ga0075363_100274408 3300006048 Bacteria 974
270 Ga0075363_100279189 3300006048 Bacteria 966
271 Ga0075363_100292455 3300006048 Bacteria 944
272 Ga0075363_100299583 3300006048 Bacteria 933
273 Ga0075363_100328371 3300006048 Bacteria 891
274 Ga0075363_100472321 3300006048 Bacteria 743
275 Ga0075364_10003028 3300006051 Bacteria 9494
276 Ga0075364_10035907 3300006051 Bacteria 3203
277 Ga0075364_10043671 3300006051 Bacteria 2914
278 Ga0075364_10044294 3300006051 Bacteria 2894
279 Ga0075364_10066923 3300006051 Bacteria 2361
280 Ga0075364_10092827 3300006051 Bacteria 2004
281 Ga0075364_10132230 3300006051 Bacteria 1675
282 Ga0075364_10134790 3300006051 Bacteria 1659
283 Ga0075364_10143695 3300006051 Bacteria 1606
284 Ga0075364_10199940 3300006051 Bacteria 1354
285 Ga0075364_10266749 3300006051 Bacteria 1164
286 Ga0075364_10433398 3300006051 Bacteria 898
287 Ga0075364_10626454 3300006051 Bacteria 735
288 Ga0075364_10628202 3300006051 Bacteria 734
289 Ga0075364_10682480 3300006051 Bacteria 701
290 Ga0075364_10869353 3300006051 Bacteria 614
291 Ga0075364_10946726 3300006051 Bacteria 586
292 Ga0075364_11009446 3300006051 Bacteria 566
293 Ga0070715_10053904 3300006163 Bacteria 1740
294 Ga0070715_10071980 3300006163 Bacteria 1547
295 Ga0070716_100024573 3300006173 Bacteria 3208
296 Ga0070716_100639733 3300006173 Bacteria 805
297 Ga0070712_100001061 3300006175 Bacteria 16610
298 Ga0070712_100005282 3300006175 Bacteria 7992
299 Ga0075362_10015901 3300006177 Bacteria 3070
300 Ga0075362_10072661 3300006177 Bacteria 1574
301 Ga0075362_10083764 3300006177 Bacteria 1472
302 Ga0075362_10126789 3300006177 Bacteria 1211
303 Ga0075362_10289765 3300006177 Bacteria 811
304 Ga0075362_10352118 3300006177 Bacteria 737
305 Ga0075367_10002885 3300006178 Bacteria 8000
306 Ga0075367_10042461 3300006178 Bacteria 2661
307 Ga0075367_10186612 3300006178 Bacteria 1293
308 Ga0075367_10233147 3300006178 Bacteria 1153
309 Ga0075367_10260938 3300006178 Bacteria 1088
310 Ga0075367_10399203 3300006178 Bacteria 869
311 Ga0075367_10546065 3300006178 Bacteria 736
312 Ga0075367_10559833 3300006178 Bacteria 726
313 Ga0075369_10001505 3300006186 Bacteria 7959
314 Ga0075369_10018446 3300006186 Bacteria 2841
315 Ga0075369_10021403 3300006186 Bacteria 2658
316 Ga0075369_10026182 3300006186 Bacteria 2430
317 Ga0075369_10061574 3300006186 Bacteria 1638
318 Ga0075369_10105102 3300006186 Bacteria 1269
319 Ga0075369_10118627 3300006186 Bacteria 1196
320 Ga0075369_10154077 3300006186 Bacteria 1051
321 Ga0075369_10200650 3300006186 Bacteria 920
322 Ga0075369_10271899 3300006186 Bacteria 788
323 Ga0097621_100132479 3300006237 Bacteria 2123
324 Ga0097621_100392623 3300006237 Bacteria 1241
325 Ga0097621_100494859 3300006237 Bacteria 1107
326 Ga0075370_10001408 3300006353 Bacteria 10397
327 Ga0075370_10001448 3300006353 Bacteria 10304
328 Ga0075370_10008954 3300006353 Bacteria 5174
329 Ga0075370_10097924 3300006353 Bacteria 1696
330 Ga0075370_10104498 3300006353 Bacteria 1641
331 Ga0075370_10186332 3300006353 Bacteria 1222
332 Ga0075370_10257482 3300006353 Bacteria 1035
333 Ga0075370_10398205 3300006353 Bacteria 826
334 Ga0075370_10620621 3300006353 Bacteria 655
335 Ga0075370_10648252 3300006353 Bacteria 641
336 Ga0075370_10664947 3300006353 Bacteria 632
337 Ga0068871_100174821 3300006358 Bacteria 1843
338 Ga0075428_100015023 3300006844 Bacteria 8601
339 Ga0075430_100259087 3300006846 Bacteria 1441
340 Ga0075431_101575367 3300006847 Bacteria 615
341 Ga0075433_10984058 3300006852 Bacteria 735
342 Ga0075433_11130050 3300006852 Bacteria 681
343 Ga0075433_11760735 3300006852 Bacteria 533
344 Ga0075429_100558479 3300006880 Bacteria 1003
345 Ga0068865_100001276 3300006881 Bacteria 14662
346 Ga0068865_100032758 3300006881 Bacteria 3475
347 Ga0068865_100630967 3300006881 Bacteria 909
348 Ga0097620_100000751 3300006931 Bacteria 32654
349 Ga0097620_100039348 3300006931 Bacteria 4743
350 Ga0097620_100206491 3300006931 Bacteria 2050
351 Ga0099826_10257458 3300006948 Bacteria 915
352 Ga0075435_100931273 3300007076 Bacteria 758
353 Ga0099794_10681931 3300007265 Bacteria 547
354 Ga0099795_10038450 3300007788 Bacteria 1689
355 Ga0105251_10120384 3300009011 Bacteria 1192
356 Ga0105244_10181460 3300009036 Bacteria 998
357 Ga0105250_10016382 3300009092 Bacteria 3021
358 Ga0105250_10034275 3300009092 Bacteria 2037
359 Ga0105250_10170611 3300009092 Bacteria 911
360 Ga0105240_10619898 3300009093 Bacteria 1189
361 Ga0105240_10956301 3300009093 Bacteria 918
362 Ga0111539_10409140 3300009094 Bacteria 1580
363 Ga0111539_10828184 3300009094 Bacteria 1077
364 Ga0111539_11548544 3300009094 Bacteria 769
365 Ga0105245_10000870 3300009098 Bacteria 27352
366 Ga0105245_10152899 3300009098 Bacteria 2183
367 Ga0105245_10166509 3300009098 Bacteria 2095
368 Ga0105245_10370949 3300009098 Bacteria 1423
369 Ga0105245_10476371 3300009098 Bacteria 1261
370 Ga0105245_10881421 3300009098 Bacteria 936
371 Ga0105245_11742491 3300009098 Bacteria 675
372 Ga0105247_10000062 3300009101 Bacteria 126437
373 Ga0105247_10000637 3300009101 Bacteria 28051
374 Ga0105247_10021071 3300009101 Bacteria 3921
375 Ga0105247_10075913 3300009101 Bacteria 2110
376 Ga0105247_10140167 3300009101 Bacteria 1584
377 Ga0105247_10250979 3300009101 Bacteria 1209
378 Ga0105247_10761866 3300009101 Bacteria 735
379 Ga0114129_10093305 3300009147 Bacteria 4170
380 Ga0114129_10148224 3300009147 Bacteria 3213
381 Ga0114129_10265638 3300009147 Bacteria 2298
382 Ga0105243_10001020 3300009148 Bacteria 25871
383 Ga0105243_10074007 3300009148 Bacteria 2762
384 Ga0105243_10190530 3300009148 Bacteria 1791
385 Ga0105243_10283666 3300009148 Bacteria 1493
386 Ga0105243_10509827 3300009148 Bacteria 1142
387 Ga0105243_11285122 3300009148 Bacteria 748
388 Ga0105243_11528518 3300009148 Bacteria 692
389 Ga0105243_12183366 3300009148 Bacteria 590
390 Ga0105241_10062601 3300009174 Bacteria 2869
391 Ga0105241_10183888 3300009174 Bacteria 1735
392 Ga0105241_10806709 3300009174 Bacteria 865
393 Ga0105241_11212921 3300009174 Bacteria 715
394 Ga0105241_12287648 3300009174 Bacteria 538
395 Ga0105242_10000650 3300009176 Bacteria 27213
396 Ga0105242_10130986 3300009176 Bacteria 2165
397 Ga0105242_11181071 3300009176 Bacteria 783
398 Ga0105242_11542909 3300009176 Bacteria 696
399 Ga0105242_12699092 3300009176 Bacteria 546
400 Ga0105242_12935617 3300009176 Bacteria 527
401 Ga0105248_10000036 3300009177 Bacteria 187421
402 Ga0105248_10003895 3300009177 Bacteria 16497
403 Ga0105248_10014411 3300009177 Bacteria 8702
404 Ga0105248_10047963 3300009177 Bacteria 4790
405 Ga0105248_10115569 3300009177 Bacteria 3026
406 Ga0105248_10151489 3300009177 Bacteria 2616
407 Ga0105248_10785375 3300009177 Bacteria 1075
408 Ga0105248_10838239 3300009177 Bacteria 1038
409 Ga0105248_12344186 3300009177 Bacteria 608
410 Ga0105237_10000467 3300009545 Bacteria 57237
411 Ga0105237_10034141 3300009545 Bacteria 5152
412 Ga0105237_10052349 3300009545 Bacteria 4098
413 Ga0105237_10209041 3300009545 Bacteria 1952
414 Ga0105237_10350429 3300009545 Bacteria 1481
415 Ga0105237_11745850 3300009545 Bacteria 630
416 Ga0105237_11890974 3300009545 Bacteria 605
417 Ga0105238_10088868 3300009551 Bacteria 3076
418 Ga0105238_10131894 3300009551 Bacteria 2477
419 Ga0105238_10152187 3300009551 Bacteria 2288
420 Ga0105238_10325317 3300009551 Bacteria 1524
421 Ga0105238_10956875 3300009551 Bacteria 876
422 Ga0105238_12044567 3300009551 Bacteria 607
423 Ga0105238_12554437 3300009551 Bacteria 547
424 Ga0105238_12633302 3300009551 Bacteria 539
425 Ga0105249_10000046 3300009553 Bacteria 176363
426 Ga0105249_10001186 3300009553 Bacteria 23057
427 Ga0105249_10005021 3300009553 Bacteria 11409
428 Ga0105249_10734696 3300009553 Bacteria 1049
429 Ga0105249_11016856 3300009553 Bacteria 898
430 Ga0105249_11037881 3300009553 Bacteria 889
431 Ga0105249_11389858 3300009553 Bacteria 774
432 Ga0105249_11852390 3300009553 Bacteria 676
433 Ga0099796_10045462 3300010159 Bacteria 1504
434 Ga0105239_10003093 3300010375 Bacteria 20661
435 Ga0105239_10028730 3300010375 Bacteria 6114
436 Ga0105239_10061068 3300010375 Bacteria 4137
437 Ga0105239_10241758 3300010375 Bacteria 2026
438 Ga0105239_10403057 3300010375 Bacteria 1548
439 Ga0105239_10594153 3300010375 Bacteria 1262
440 Ga0105239_10893469 3300010375 Bacteria 1020
441 Ga0105239_11093110 3300010375 Bacteria 918
442 Ga0105239_11896191 3300010375 Bacteria 691
443 Ga0105239_12608396 3300010375 Bacteria 589
444 Ga0105239_12861131 3300010375 Bacteria 563
445 Ga0105239_12978285 3300010375 Bacteria 552
446 Ga0105239_13365063 3300010375 Bacteria 520
447 Ga0105246_10034380 3300011119 Bacteria 3377
448 Ga0105246_10063318 3300011119 Bacteria 2579
449 Ga0105246_10232450 3300011119 Bacteria 1453
450 Ga0105246_11238228 3300011119 Bacteria 689
451 Ga0105246_11800899 3300011119 Bacteria 585
452 Ga0157344_1019660 3300012476 Bacteria 572
453 Ga0157313_1021463 3300012503 Bacteria 663
454 Ga0157342_1079190 3300012507 Bacteria 514
455 Ga0157315_1005519 3300012508 Bacteria 952
456 Ga0157373_10926876 3300013100 Bacteria 647
457 Ga0157371_10124561 3300013102 Bacteria 1833
458 Ga0157371_10309262 3300013102 Bacteria 1145
459 Ga0157370_10300678 3300013104 Bacteria 1481
460 Ga0157370_11343214 3300013104 Bacteria 644
461 Ga0157370_11388264 3300013104 Bacteria 632
462 Ga0157369_10051356 3300013105 Bacteria 4462
463 Ga0157369_10110992 3300013105 Bacteria 2915
464 Ga0157369_10498685 3300013105 Bacteria 1260
465 Ga0157369_10748083 3300013105 Bacteria 1006
466 Ga0157374_10032409 3300013296 Bacteria 4757
467 Ga0157374_11664878 3300013296 Bacteria 663
468 Ga0157374_11809434 3300013296 Bacteria 636
469 Ga0157378_10004457 3300013297 Bacteria 12311
470 Ga0157378_10395003 3300013297 Bacteria 1361
471 Ga0163162_10001609 3300013306 Bacteria 21131
472 Ga0163162_10035606 3300013306 Bacteria 4960
473 Ga0163162_10412955 3300013306 Bacteria 1482
474 Ga0163162_10415926 3300013306 Bacteria 1477
475 Ga0163162_10471848 3300013306 Bacteria 1386
476 Ga0163162_11569914 3300013306 Bacteria 750
477 Ga0163162_12048891 3300013306 Bacteria 656
478 Ga0157372_10004145 3300013307 Bacteria 15520
479 Ga0157372_10219830 3300013307 Bacteria 2202
480 Ga0157372_10298165 3300013307 Bacteria 1875
481 Ga0157372_10323563 3300013307 Bacteria 1795
482 Ga0157372_13131700 3300013307 Bacteria 528
483 Ga0157375_10000419 3300013308 Bacteria 38685
484 Ga0157375_11361671 3300013308 Bacteria 835
485 Ga0157375_11459471 3300013308 Bacteria 807
486 Ga0157375_12957822 3300013308 Bacteria 567
487 Ga0163163_10039390 3300014325 Bacteria 4612
488 Ga0163163_10177849 3300014325 Bacteria 2175
489 Ga0163163_10564851 3300014325 Bacteria 1200
490 Ga0163163_11018401 3300014325 Bacteria 891
491 Ga0163163_11527267 3300014325 Bacteria 729
492 Ga0163163_12221259 3300014325 Bacteria 608
493 Ga0157380_10001844 3300014326 Bacteria 14014
494 Ga0157380_10433095 3300014326 Bacteria 1258
495 Ga0182008_10002958 3300014497 Bacteria 10453
496 Ga0157377_10026136 3300014745 Bacteria 3121
497 Ga0157377_11268421 3300014745 Bacteria 574
498 Ga0157379_10029772 3300014968 Bacteria 4855
499 Ga0157379_10132262 3300014968 Bacteria 2246
500 Ga0157379_10214503 3300014968 Bacteria 1743
501 Ga0157379_10314622 3300014968 Bacteria 1429
502 Ga0157379_11341361 3300014968 Bacteria 692
503 Ga0157376_10037960 3300014969 Bacteria 3917
504 Ga0157376_10057401 3300014969 Bacteria 3256
505 Ga0157376_10107119 3300014969 Bacteria 2453
506 Ga0157376_11853195 3300014969 Bacteria 640
507 Ga0157376_12606991 3300014969 Bacteria 545
508 Ga0182006_1084780 3300015261 Bacteria 1150
509 Ga0182005_1049382 3300015265 Bacteria 1144
510 Ga0183367_1002 3300015688 Bacteria 1101531
511 Ga0163161_10006906 3300017792 Bacteria 7852
512 Ga0163161_10172118 3300017792 Bacteria 1656
513 Ga0163161_10418449 3300017792 Bacteria 1077
514 Ga0163161_10600751 3300017792 Bacteria 907
515 Ga0163161_10636131 3300017792 Bacteria 883
516 Ga0197907_10131781 3300020069 Bacteria 2807
517 Ga0197907_10233448 3300020069 Bacteria 1104
518 Ga0206356_11143445 3300020070 Bacteria 1172
519 Ga0206351_10184192 3300020077 Bacteria 856
520 Ga0206352_10845590 3300020078 Bacteria 584
521 Ga0206350_11195567 3300020080 Bacteria 1100
522 Ga0206354_10960052 3300020081 Bacteria 4048
523 Ga0206353_11128098 3300020082 Bacteria 9314
524 Ga0206353_11287408 3300020082 Bacteria 1112
525 Ga0213872_10306243 3300021361 Bacteria 659
526 Ga0213876_10009953 3300021384 Bacteria 5110
527 Ga0213876_10011067 3300021384 Bacteria 4828
528 Ga0213876_10023670 3300021384 Bacteria 3243
529 Ga0213876_10572096 3300021384 Bacteria 601
530 Ga0213875_10032905 3300021388 Bacteria 2449
531 Ga0213875_10059850 3300021388 Bacteria 1782
532 Ga0213875_10273228 3300021388 Bacteria 798
533 Ga0224712_10000526 3300022467 Bacteria 7751
534 Ga0224712_10002344 3300022467 Bacteria 4653
535 Ga0209025_1037599 3300025294 Bacteria 2144
536 Ga0209758_1007953 3300025297 Bacteria 7028
537 Ga0207426_1004664 3300025302 Bacteria 6590
538 Ga0207426_1006367 3300025302 Bacteria 5152
539 Ga0207426_1038691 3300025302 Bacteria 1500
540 Ga0209051_1000011 3300025303 Bacteria 610828
541 Ga0209051_1000620 3300025303 Bacteria 40785
542 Ga0209051_1000933 3300025303 Bacteria 28862
543 Ga0209051_1001428 3300025303 Bacteria 20451
544 Ga0209051_1033472 3300025303 Bacteria 1943
545 Ga0209051_1039069 3300025303 Bacteria 1719
546 Ga0209051_1095550 3300025303 Bacteria 814
547 Ga0207656_10092487 3300025321 Bacteria 1375
548 Ga0207656_10115433 3300025321 Bacteria 1245
549 Ga0207696_1123242 3300025711 Bacteria 698
550 Ga0207653_10045515 3300025885 Bacteria 1450
551 Ga0207682_10340878 3300025893 Bacteria 705
552 Ga0207692_10001940 3300025898 Bacteria 7881
553 Ga0207692_10136975 3300025898 Bacteria 1389
554 Ga0207692_10302969 3300025898 Bacteria 973
555 Ga0207692_10380415 3300025898 Bacteria 876
556 Ga0207642_10000312 3300025899 Bacteria 14664
557 Ga0207642_10056787 3300025899 Bacteria 1797
558 Ga0207710_10000060 3300025900 Bacteria 168230
559 Ga0207710_10000890 3300025900 Bacteria 15991
560 Ga0207710_10130368 3300025900 Bacteria 1207
561 Ga0207688_10000177 3300025901 Bacteria 28125
562 Ga0207688_10000841 3300025901 Bacteria 15432
563 Ga0207680_10060009 3300025903 Bacteria 2313
564 Ga0207680_10107266 3300025903 Bacteria 1805
565 Ga0207680_10235641 3300025903 Bacteria 1259
566 Ga0207680_10600805 3300025903 Bacteria 787
567 Ga0207647_10014202 3300025904 Bacteria 5496
568 Ga0207647_10028202 3300025904 Bacteria 3649
569 Ga0207685_10001135 3300025905 Bacteria 5314
570 Ga0207685_10010029 3300025905 Bacteria 2778
571 Ga0207699_10126702 3300025906 Bacteria 1659
572 Ga0207699_10282730 3300025906 Bacteria 1153
573 Ga0207645_10042119 3300025907 Bacteria 2922
574 Ga0207643_10540021 3300025908 Bacteria 747
575 Ga0207643_10579470 3300025908 Bacteria 721
576 Ga0207705_10002093 3300025909 Bacteria 15510
577 Ga0207705_10486828 3300025909 Bacteria 957
578 Ga0207654_10071715 3300025911 Bacteria 2060
579 Ga0207654_10288853 3300025911 Bacteria 1111
580 Ga0207707_10000277 3300025912 Bacteria 55264
581 Ga0207707_10167030 3300025912 Bacteria 1923
582 Ga0207707_11302555 3300025912 Bacteria 584
583 Ga0207671_10009964 3300025914 Bacteria 7896
584 Ga0207671_10018152 3300025914 Bacteria 5405
585 Ga0207671_10027045 3300025914 Bacteria 4291
586 Ga0207671_10151176 3300025914 Bacteria 1794
587 Ga0207671_10821232 3300025914 Bacteria 737
588 Ga0207671_11168870 3300025914 Bacteria 603
589 Ga0207693_10000339 3300025915 Bacteria 43073
590 Ga0207693_10000602 3300025915 Bacteria 32212
591 Ga0207693_10217813 3300025915 Bacteria 1500
592 Ga0207663_10000907 3300025916 Bacteria 13535
593 Ga0207663_10122657 3300025916 Bacteria 1782
594 Ga0207663_11001168 3300025916 Bacteria 670
595 Ga0207660_10000115 3300025917 Bacteria 46447
596 Ga0207660_10111634 3300025917 Bacteria 2058
597 Ga0207660_10521538 3300025917 Bacteria 965
598 Ga0207660_10831956 3300025917 Bacteria 753
599 Ga0207660_11033446 3300025917 Bacteria 670
600 Ga0207662_10075302 3300025918 Bacteria 2050
601 Ga0207662_11040064 3300025918 Bacteria 582
602 Ga0207657_10095827 3300025919 Bacteria 2469
603 Ga0207657_10164966 3300025919 Bacteria 1797
604 Ga0207649_11409531 3300025920 Bacteria 551
605 Ga0207649_11674196 3300025920 Bacteria 504
606 Ga0207652_10000333 3300025921 Bacteria 48970
607 Ga0207652_10547270 3300025921 Bacteria 1040
608 Ga0207646_10636104 3300025922 Bacteria 956
609 Ga0207646_10832617 3300025922 Bacteria 821
610 Ga0207681_10000788 3300025923 Bacteria 20865
611 Ga0207681_10086689 3300025923 Bacteria 2225
612 Ga0207694_10048982 3300025924 Bacteria 3270
613 Ga0207694_10183839 3300025924 Bacteria 1696
614 Ga0207694_10632582 3300025924 Bacteria 901
615 Ga0207694_11119059 3300025924 Bacteria 666
616 Ga0207650_10129186 3300025925 Bacteria 1975
617 Ga0207659_10510272 3300025926 Bacteria 1019
618 Ga0207659_10968259 3300025926 Bacteria 732
619 Ga0207659_11137339 3300025926 Bacteria 671
620 Ga0207687_10001983 3300025927 Bacteria 14066
621 Ga0207687_10102936 3300025927 Bacteria 2105
622 Ga0207687_10302244 3300025927 Bacteria 1289
623 Ga0207687_10940733 3300025927 Bacteria 740
624 Ga0207700_10070676 3300025928 Bacteria 2684
625 Ga0207700_10181688 3300025928 Bacteria 1762
626 Ga0207700_10206533 3300025928 Bacteria 1658
627 Ga0207700_10271142 3300025928 Bacteria 1457
628 Ga0207700_10298691 3300025928 Bacteria 1390
629 Ga0207700_10461851 3300025928 Bacteria 1120
630 Ga0207664_10068406 3300025929 Bacteria 2853
631 Ga0207664_10324477 3300025929 Bacteria 1359
632 Ga0207664_10569422 3300025929 Bacteria 1017
633 Ga0207664_10677795 3300025929 Bacteria 927
634 Ga0207664_11686089 3300025929 Bacteria 556
635 Ga0207644_10004647 3300025931 Bacteria 8925
636 Ga0207644_10020065 3300025931 Bacteria 4541
637 Ga0207644_10207081 3300025931 Bacteria 1549
638 Ga0207690_10024212 3300025932 Bacteria 3800
639 Ga0207690_10061631 3300025932 Bacteria 2551
640 Ga0207690_10851592 3300025932 Bacteria 755
641 Ga0207706_10002589 3300025933 Bacteria 17618
642 Ga0207686_10001637 3300025934 Bacteria 12508
643 Ga0207686_10750390 3300025934 Bacteria 779
644 Ga0207686_10789993 3300025934 Bacteria 760
645 Ga0207709_10001393 3300025935 Bacteria 16930
646 Ga0207709_10074674 3300025935 Bacteria 2164
647 Ga0207709_10183433 3300025935 Bacteria 1480
648 Ga0207709_10222341 3300025935 Bacteria 1362
649 Ga0207709_10326906 3300025935 Bacteria 1150
650 Ga0207709_11668838 3300025935 Bacteria 530
651 Ga0207670_10012017 3300025936 Bacteria 5046
652 Ga0207670_10739642 3300025936 Bacteria 816
653 Ga0207670_11054097 3300025936 Bacteria 685
654 Ga0207669_10000205 3300025937 Bacteria 26813
655 Ga0207669_10211685 3300025937 Bacteria 1415
656 Ga0207669_10655942 3300025937 Bacteria 859
657 Ga0207669_10744014 3300025937 Bacteria 809
658 Ga0207669_11018226 3300025937 Bacteria 696
659 Ga0207669_11532880 3300025937 Bacteria 568
660 Ga0207669_11791100 3300025937 Bacteria 525
661 Ga0207704_10000618 3300025938 Bacteria 15725
662 Ga0207704_10209532 3300025938 Bacteria 1433
663 Ga0207704_10361902 3300025938 Bacteria 1133
664 Ga0207704_11617637 3300025938 Bacteria 556
665 Ga0207665_10008088 3300025939 Bacteria 6941
666 Ga0207665_10011512 3300025939 Bacteria 5811
667 Ga0207665_10142777 3300025939 Bacteria 1709
668 Ga0207691_10548394 3300025940 Bacteria 980
669 Ga0207711_10000073 3300025941 Bacteria 107878
670 Ga0207711_10061372 3300025941 Bacteria 3241
671 Ga0207711_10157899 3300025941 Bacteria 2051
672 Ga0207711_10536245 3300025941 Bacteria 1091
673 Ga0207711_10731525 3300025941 Bacteria 922
674 Ga0207711_11955454 3300025941 Bacteria 529
675 Ga0207689_10133901 3300025942 Bacteria 2040
676 Ga0207689_11283094 3300025942 Bacteria 615
677 Ga0207661_10086949 3300025944 Bacteria 2595
678 Ga0207661_10290851 3300025944 Bacteria 1462
679 Ga0207661_10627582 3300025944 Bacteria 987
680 Ga0207661_10735585 3300025944 Bacteria 908
681 Ga0207661_10932794 3300025944 Bacteria 800
682 Ga0207661_11837205 3300025944 Bacteria 551
683 Ga0207679_11528043 3300025945 Bacteria 612
684 Ga0207667_10183276 3300025949 Bacteria 2149
685 Ga0207667_10328404 3300025949 Bacteria 1562
686 Ga0207667_10705552 3300025949 Bacteria 1011
687 Ga0207667_11257202 3300025949 Bacteria 718
688 Ga0207651_10223155 3300025960 Bacteria 1525
689 Ga0207651_10270943 3300025960 Bacteria 1398
690 Ga0207712_10000042 3300025961 Bacteria 176338
691 Ga0207712_10072184 3300025961 Bacteria 2485
692 Ga0207712_10754948 3300025961 Bacteria 852
693 Ga0207712_12019647 3300025961 Bacteria 516
694 Ga0207668_10006306 3300025972 Bacteria 7010
695 Ga0207668_10013064 3300025972 Bacteria 5102
696 Ga0207668_10048285 3300025972 Bacteria 2920
697 Ga0207668_10753972 3300025972 Bacteria 859
698 Ga0207640_10003341 3300025981 Bacteria 8643
699 Ga0207640_10131790 3300025981 Bacteria 1808
700 Ga0207640_10477580 3300025981 Bacteria 1033
701 Ga0207640_10671311 3300025981 Bacteria 885
702 Ga0207658_10000449 3300025986 Bacteria 38511
703 Ga0207658_10000664 3300025986 Bacteria 30027
704 Ga0207658_10003954 3300025986 Bacteria 10411
705 Ga0207658_10004460 3300025986 Bacteria 9728
706 Ga0207658_10069437 3300025986 Bacteria 2662
707 Ga0207658_10451997 3300025986 Bacteria 1137
708 Ga0207658_10852948 3300025986 Bacteria 828
709 Ga0207658_11072789 3300025986 Bacteria 735
710 Ga0207658_11902673 3300025986 Bacteria 542
711 Ga0207677_10016196 3300026023 Bacteria 4407
712 Ga0207677_10257633 3300026023 Bacteria 1420
713 Ga0207703_10002964 3300026035 Bacteria 14391
714 Ga0207703_10059815 3300026035 Bacteria 3113
715 Ga0207703_10063785 3300026035 Bacteria 3022
716 Ga0207703_10065586 3300026035 Bacteria 2984
717 Ga0207703_10151622 3300026035 Bacteria 2022
718 Ga0207703_10414917 3300026035 Bacteria 1252
719 Ga0207703_10731486 3300026035 Bacteria 942
720 Ga0207703_11092095 3300026035 Bacteria 766
721 Ga0207639_10038681 3300026041 Bacteria 3550
722 Ga0207639_10379569 3300026041 Bacteria 1269
723 Ga0207639_10793787 3300026041 Bacteria 882
724 Ga0207639_10973081 3300026041 Bacteria 794
725 Ga0207678_10007047 3300026067 Bacteria 9982
726 Ga0207678_10118193 3300026067 Bacteria 2262
727 Ga0207678_10122695 3300026067 Bacteria 2217
728 Ga0207678_10795511 3300026067 Bacteria 835
729 Ga0207678_10930460 3300026067 Bacteria 769
730 Ga0207678_11078487 3300026067 Bacteria 711
731 Ga0207678_11382732 3300026067 Bacteria 622
732 Ga0207708_10003891 3300026075 Bacteria 10992
733 Ga0207708_10041519 3300026075 Bacteria 3507
734 Ga0207708_10738176 3300026075 Bacteria 844
735 Ga0207702_10903480 3300026078 Bacteria 875
736 Ga0207702_12014144 3300026078 Bacteria 568
737 Ga0207641_10001094 3300026088 Bacteria 27248
738 Ga0207641_10015008 3300026088 Bacteria 6350
739 Ga0207641_10027939 3300026088 Bacteria 4659
740 Ga0207641_10070874 3300026088 Bacteria 2996
741 Ga0207641_10094126 3300026088 Bacteria 2627
742 Ga0207641_10468585 3300026088 Bacteria 1219
743 Ga0207641_11917341 3300026088 Bacteria 594
744 Ga0207648_10000623 3300026089 Bacteria 39688
745 Ga0207648_10047022 3300026089 Bacteria 3783
746 Ga0207648_11638071 3300026089 Bacteria 605
747 Ga0207676_10017255 3300026095 Bacteria 5232
748 Ga0207676_10203343 3300026095 Bacteria 1752
749 Ga0207676_10343914 3300026095 Bacteria 1377
750 Ga0207676_10985563 3300026095 Bacteria 830
751 Ga0207676_11040120 3300026095 Bacteria 808
752 Ga0207676_11369694 3300026095 Bacteria 703
753 Ga0207676_11741940 3300026095 Bacteria 621
754 Ga0207676_11947419 3300026095 Bacteria 586
755 Ga0207674_10296717 3300026116 Bacteria 1565
756 Ga0207674_10500764 3300026116 Bacteria 1174
757 Ga0207675_100001672 3300026118 Bacteria 22194
758 Ga0207675_100533225 3300026118 Bacteria 1171
759 Ga0207675_101185188 3300026118 Bacteria 784
760 Ga0207675_101475440 3300026118 Bacteria 701
761 Ga0207683_10000539 3300026121 Bacteria 35044
762 Ga0207683_10017378 3300026121 Bacteria 6130
763 Ga0207683_10105161 3300026121 Bacteria 2523
764 Ga0207683_10383305 3300026121 Bacteria 1292
765 Ga0207683_10495393 3300026121 Bacteria 1128
766 Ga0207683_10507853 3300026121 Bacteria 1114
767 Ga0207683_10717855 3300026121 Bacteria 927
768 Ga0207698_10047163 3300026142 Bacteria 3261
769 Ga0207698_10102226 3300026142 Bacteria 2379
770 Ga0207698_10678063 3300026142 Bacteria 1024
771 Ga0209371_1029382 3300027312 Bacteria 1215
772 Ga0209179_1045200 3300027512 Bacteria 934
773 Ga0209282_1241770 3300027666 Bacteria 803
774 Ga0209813_10018444 3300027866 Bacteria 1928
775 Ga0209813_10142005 3300027866 Bacteria 853
776 Ga0207428_10336973 3300027907 Bacteria 1111
777 Ga0207428_10532992 3300027907 Bacteria 850
778 Ga0207428_10570865 3300027907 Bacteria 817
779 Ga0268266_10007218 3300028379 Bacteria 10050
780 Ga0268266_10012919 3300028379 Bacteria 7204
781 Ga0268266_10020977 3300028379 Bacteria 5569
782 Ga0268266_10102670 3300028379 Bacteria 2522
783 Ga0268266_10156772 3300028379 Bacteria 2057
784 Ga0268265_10000051 3300028380 Bacteria 174968
785 Ga0268265_10003445 3300028380 Bacteria 11383
786 Ga0268265_10076517 3300028380 Bacteria 2625
787 Ga0268265_10493002 3300028380 Bacteria 1153
788 Ga0268264_10000108 3300028381 Bacteria 208791
789 Ga0268264_10009938 3300028381 Bacteria 7877
790 Ga0268264_10197392 3300028381 Bacteria 1838
791 Ga0268264_10774917 3300028381 Bacteria 957
792 Ga0307517_10004659 3300028786 Bacteria 21023
793 Ga0307517_10036222 3300028786 Bacteria 5556
794 Ga0307517_10265146 3300028786 Bacteria 993
795 Ga0307515_10001177 3300028794 Bacteria 59836
796 Ga0307515_10083676 3300028794 Bacteria 4110
797 Ga0307515_10346614 3300028794 Bacteria 1134
798 Ga0268256_1023853 3300030500 Bacteria 1580
799 Ga0307511_10028203 3300030521 Bacteria 5104
800 Ga0307511_10062540 3300030521 Bacteria 2824
801 Ga0307511_10132506 3300030521 Bacteria 1496
802 Ga0307511_10235476 3300030521 Bacteria 900
803 Ga0307511_10263096 3300030521 Bacteria 815
804 Ga0307511_10276655 3300030521 Bacteria 780
805 Ga0307511_10309783 3300030521 Bacteria 706
806 Ga0307512_10037650 3300030522 Bacteria 4081
807 Ga0307512_10064598 3300030522 Bacteria 2785
808 Ga0307512_10182988 3300030522 Bacteria 1173
809 Ga0314311_1190625 3300030733 Bacteria 661
810 Ga0316180_1107973 3300030736 Bacteria 928
811 Ga0316182_1311333 3300030745 Bacteria 580
812 Ga0265327_10000021 3300031251 Bacteria 417788
813 Ga0265327_10000071 3300031251 Bacteria 215502
814 Ga0265327_10000630 3300031251 Bacteria 57536
815 Ga0265327_10021466 3300031251 Bacteria 3896
816 Ga0307513_10032651 3300031456 Bacteria 5866
817 Ga0307513_10033269 3300031456 Bacteria 5796
818 Ga0307513_10119884 3300031456 Bacteria 2601
819 Ga0307513_10511978 3300031456 Bacteria 916
820 Ga0307509_10169325 3300031507 Bacteria 2066
821 Ga0307509_10206018 3300031507 Bacteria 1797
822 Ga0307509_10338394 3300031507 Bacteria 1233
823 Ga0307509_10441087 3300031507 Bacteria 998
824 Ga0307408_100304208 3300031548 Bacteria 1337
825 Ga0307408_101344318 3300031548 Bacteria 671
826 Ga0307508_10001775 3300031616 Bacteria 23968
827 Ga0307508_10005680 3300031616 Bacteria 11819
828 Ga0307508_10020650 3300031616 Bacteria 5981
829 Ga0307508_10063849 3300031616 Bacteria 3248
830 Ga0307508_10075163 3300031616 Bacteria 2956
831 Ga0307508_10117382 3300031616 Bacteria 2262
832 Ga0307514_10036472 3300031649 Bacteria 3907
833 Ga0307514_10119090 3300031649 Bacteria 1847
834 Ga0307514_10190602 3300031649 Bacteria 1306
835 Ga0316579_10047194 3300031691 Bacteria 2011
836 Ga0316579_10445263 3300031691 Bacteria 627
837 Ga0316576_10069280 3300031727 Bacteria 2600
838 Ga0316576_10557500 3300031727 Bacteria 839
839 Ga0316578_10007838 3300031728 Bacteria 5392
840 Ga0316578_10054210 3300031728 Bacteria 2351
841 Ga0316578_10155229 3300031728 Bacteria 1379
842 Ga0316578_10695755 3300031728 Bacteria 592
843 Ga0307516_10007060 3300031730 Bacteria 12997
844 Ga0307516_10023113 3300031730 Bacteria 6378
845 Ga0307516_10048980 3300031730 Bacteria 4156
846 Ga0307405_10106270 3300031731 Bacteria 1893
847 Ga0307405_10763497 3300031731 Bacteria 807
848 Ga0307405_11497678 3300031731 Bacteria 593
849 Ga0316577_10196594 3300031733 Bacteria 1140
850 Ga0316577_10698771 3300031733 Bacteria 576
851 Ga0307413_10179235 3300031824 Bacteria 1509
852 Ga0307413_10760075 3300031824 Bacteria 811
853 Ga0307413_10963802 3300031824 Bacteria 729
854 Ga0307518_10156737 3300031838 Bacteria 1569
855 Ga0307410_10005427 3300031852 Bacteria 6747
856 Ga0307410_10050900 3300031852 Bacteria 2789
857 Ga0307410_10097846 3300031852 Bacteria 2097
858 Ga0307410_10154260 3300031852 Bacteria 1713
859 Ga0307410_11219754 3300031852 Bacteria 656
860 Ga0307406_10986100 3300031901 Bacteria 722
861 Ga0307406_11413939 3300031901 Bacteria 610
862 Ga0307407_10015605 3300031903 Bacteria 3762
863 Ga0307407_11702345 3300031903 Bacteria 502
864 Ga0307412_10273546 3300031911 Bacteria 1323
865 Ga0307412_11572325 3300031911 Bacteria 600
866 Ga0307409_100037553 3300031995 Bacteria 3572
867 Ga0307409_100205427 3300031995 Bacteria 1766
868 Ga0307409_100326649 3300031995 Bacteria 1438
869 Ga0307409_100387209 3300031995 Bacteria 1331
870 Ga0307409_100641406 3300031995 Bacteria 1055
871 Ga0307409_100815775 3300031995 Bacteria 941
872 Ga0307409_102087345 3300031995 Bacteria 596
873 Ga0307409_102616151 3300031995 Bacteria 533
874 Ga0307416_100056416 3300032002 Bacteria 3170
875 Ga0307416_100107718 3300032002 Bacteria 2446
876 Ga0307416_100436088 3300032002 Bacteria 1359
877 Ga0307416_101380328 3300032002 Bacteria 810
878 Ga0307416_101534811 3300032002 Bacteria 772
879 Ga0307416_103859158 3300032002 Bacteria 502
880 Ga0307411_10140216 3300032005 Bacteria 1782
881 Ga0307411_10196819 3300032005 Bacteria 1544
882 Ga0307411_10561258 3300032005 Bacteria 976
883 Ga0307415_100728871 3300032126 Bacteria 898
884 Ga0307415_100940326 3300032126 Bacteria 799
885 Ga0307415_101508448 3300032126 Bacteria 643
886 Ga0316583_10012794 3300032133 Bacteria 3028
887 Ga0316585_10026058 3300032137 Bacteria 1816
888 Ga0316585_10140083 3300032137 Bacteria 798
889 Ga0316580_10179792 3300032139 Bacteria 650
890 Ga0316580_10284486 3300032139 Bacteria 513
891 Ga0316593_10251358 3300032168 Unclassified 662
892 Ga0307507_10000732 3300033179 Bacteria 72083
893 Ga0307507_10642080 3300033179 Bacteria 540
894 Ga0307510_10035723 3300033180 Bacteria 5543
895 Ga0307510_10088739 3300033180 Bacteria 2949
896 Ga0307510_10284835 3300033180 Bacteria 1121
897 Ga0307510_10416505 3300033180 Bacteria 786
898 Ga0307510_10651932 3300033180 Bacteria 511
899 Ga0316596_1054270 3300033541 Bacteria 1063
900 Ga0373930_0210188 3300034816 Bacteria 509
901 Ga0373938_0069430 3300034957 Bacteria 839
902 Ga0373928_0105733 3300035084 Bacteria 739
903 Ga0373929_0151968 3300035085 Bacteria 621
904 Ga0373940_0078051 3300035088 Bacteria 974
905 Ga0373951_0066451 3300035091 Bacteria 911
906 Ga0373932_0036929 3300035112 Bacteria 1390
907 Ga0373939_0420583 3300035114 Bacteria 557
908 Ga0373960_0036799 3300035121 Bacteria 1396
909 Ga0373942_0032327 3300035207 Bacteria 1389
910 Ga0373942_0078542 3300035207 Bacteria 976
911 Ga0373961_0094945 3300035241 Bacteria 958
912 Ga0373962_0012789 3300035242 Bacteria 2119
913 Ga0373962_0013224 3300035242 Bacteria 2087
914 Ga0316574_0078180 3300035398 Bacteria 2098
915 Ga0316574_0122232 3300035398 Unclassified 1672
916 Ga0373924_0452019 3300035410 Bacteria 576
917 Ga0373931_0011218 3300035691 Bacteria 4325
918 Ga0316582_0204345 3300036647 Bacteria 1348
919 Ga0316582_0430407 3300036647 Bacteria 909
920 Ga0316584_0053682 3300036712 Bacteria 3016
921 Ga0316584_0086906 3300036712 Bacteria 2340
922 Ga0316584_0421280 3300036712 Bacteria 948
923 Ga0395899_0013414 3300037312 Bacteria 6270
924 Ga0395899_0748419 3300037312 Bacteria 609
925 Ga0395900_0075741 3300037418 Bacteria 3459
926 Ga0395900_0427612 3300037418 Bacteria 1284
927 Ga0395898_0006692 3300037466 Bacteria 12285
928 Ga0395898_0017702 3300037466 Bacteria 7272
929 Ga0395905_0069865 3300037471 Bacteria 3290
930 Ga0395905_0528676 3300037471 Bacteria 1080
931 Ga0395905_0686939 3300037471 Bacteria 926
932 Ga0316581_0167237 3300037588 Bacteria 678
933 Ga0436364_0195317 3300037853 Bacteria 14583
934 Ga0436364_0229870 3300037853 Bacteria 2546
935 Ga0436364_1150617 3300037853 Bacteria 1209
936 Ga0436364_1291536 3300037853 Bacteria 16625
937 Ga0395901_0100975 3300038443 Bacteria 3027
938 Ga0395901_0550223 3300038443 Bacteria 1170
939 Ga0436365_0678211 3300039437 Bacteria 16182
940 Ga0436365_0939033 3300039437 Bacteria 60216
941 Ga0436365_0941882 3300039437 Bacteria 1214
942 Ga0436365_1035060 3300039437 Bacteria 5579
943 Ga0436365_1714810 3300039437 Bacteria 1471
944 Ga0436365_1908396 3300039437 Bacteria 15438
945 Ga0436360_0804941 3300039438 Bacteria 1061
946 Ga0436361_0716923 3300039447 Bacteria 2117
947 Ga0436361_1194425 3300039447 Bacteria 888
948 Ga0436363_0444811 3300039450 Bacteria 1813
949 Ga0436363_0754104 3300039450 Bacteria 1265
950 Ga0436363_1331240 3300039450 Bacteria 1950
951 Ga0436363_1709932 3300039450 Bacteria 972
952 Ga0436362_0757592 3300039453 Bacteria 756
953 Ga0436362_1212714 3300039453 Bacteria 721
954 Ga0439439_0009171 3300041406 Bacteria 2348
955 Ga0439439_0047088 3300041406 Bacteria 1126
956 Ga0439461_0013378 3300041410 Bacteria 1548
957 Ga0439461_0014671 3300041410 Bacteria 1493
958 Ga0439461_0024659 3300041410 Bacteria 1217
959 Ga0439466_0003274 3300041411 Bacteria 6307
960 Ga0439466_0008207 3300041411 Bacteria 3937
961 Ga0439466_0013164 3300041411 Bacteria 3031
962 Ga0439466_0035103 3300041411 Bacteria 1697
963 Ga0439465_0011614 3300041413 Bacteria 2764
964 Ga0439465_0013051 3300041413 Bacteria 2595
965 Ga0439465_0034846 3300041413 Bacteria 1612
966 Ga0439465_0131683 3300041413 Bacteria 883
967 Ga0439465_0336671 3300041413 Bacteria 568
968 Ga0451787_711011 3300041441 Bacteria 502
969 Ga0451789_0165262 3300041443 Bacteria 581
970 Ga0451789_0361298 3300041443 Bacteria 696
971 Ga0451789_0982272 3300041443 Bacteria 577
972 Ga0451791_0176299 3300041451 Bacteria 1522
973 Ga0451791_0923786 3300041451 Bacteria 903
974 Ga0451793_0050578 3300041452 Bacteria 966
975 Ga0451793_0165491 3300041452 Bacteria 967
976 Ga0451793_0382258 3300041452 Bacteria 801
977 Ga0451797_0462824 3300041453 Bacteria 600
978 Ga0451797_0777865 3300041453 Bacteria 1023
979 Ga0451798_1003370 3300041458 Bacteria 524
980 Ga0451800_0949963 3300041459 Bacteria 1239
981 Ga0451802_0290968 3300041460 Bacteria 794
982 Ga0451802_1000802 3300041460 Bacteria 687
983 Ga0451806_545077 3300041462 Bacteria 916
984 Ga0451804_0768388 3300041463 Bacteria 516
985 Ga0451807_1186087 3300041486 Bacteria 539
986 Ga0451807_1334898 3300041486 Bacteria 1116
987 Ga0451807_2088134 3300041486 Bacteria 856
988 Ga0451833_0440069 3300041491 Bacteria 1317
989 Ga0451835_0852016 3300041492 Bacteria 1378
990 Ga0451837_0509056 3300041494 Bacteria 2339
991 Ga0451839_0168767 3300041496 Bacteria 744
992 Ga0451841_0295423 3300041498 Bacteria 777
993 Ga0451841_1253551 3300041498 Bacteria 678
994 Ga0451845_0166486 3300041501 Bacteria 1212
995 Ga0451851_1033401 3300041507 Bacteria 972
996 Ga0451843_0901391 3300041509 Bacteria 522
997 Ga0451843_1680136 3300041509 Bacteria 1500
998 Ga0451853_0050097 3300041512 Bacteria 501
999 Ga0451853_0425702 3300041512 Bacteria 546
1000 Ga0451853_0450169 3300041512 Bacteria 694
1001 Ga0451853_1037975 3300041512 Bacteria 999
1002 Ga0451853_2284613 3300041512 Bacteria 504
1003 Ga0451853_3283147 3300041512 Bacteria 1546
1004 Ga0451853_3835888 3300041512 Bacteria 2103
1005 Ga0451853_3894526 3300041512 Bacteria 2740
1006 Ga0439431_0007821 3300041997 Bacteria 2390
1007 Ga0439431_0100112 3300041997 Bacteria 796
1008 Ga0439433_0008537 3300041999 Bacteria 2224
1009 Ga0439433_0014215 3300041999 Bacteria 1752
1010 Ga0439442_016793 3300042002 Bacteria 1510
1011 Ga0439442_024566 3300042002 Bacteria 1254
1012 Ga0439445_0001826 3300042004 Bacteria 4689
1013 Ga0439445_0101398 3300042004 Bacteria 816
1014 Ga0439445_0135614 3300042004 Bacteria 712
1015 Ga0439445_0147093 3300042004 Bacteria 685
1016 Ga0439445_0262242 3300042004 Bacteria 517
1017 Ga0439448_0004693 3300042005 Bacteria 3868
1018 Ga0439448_0130866 3300042005 Bacteria 865
1019 Ga0439448_0175236 3300042005 Bacteria 749
1020 Ga0439448_0234069 3300042005 Bacteria 647
1021 Ga0439449_0069372 3300042007 Bacteria 1299
1022 Ga0439450_069576 3300042008 Bacteria 862
1023 Ga0439454_050955 3300042011 Bacteria 699
1024 Ga0439455_0075109 3300042012 Bacteria 912
1025 Ga0439455_0197971 3300042012 Bacteria 581
1026 Ga0439457_000455 3300042014 Bacteria 11799
1027 Ga0439457_000479 3300042014 Bacteria 11535
1028 Ga0439457_044746 3300042014 Bacteria 988
1029 Ga0439462_0024184 3300042015 Bacteria 1594
1030 Ga0439463_161594 3300042016 Bacteria 581
1031 Ga0450890_011941 3300042127 Bacteria 1124
1032 Ga0450894_000142 3300042131 Bacteria 12667
1033 Ga0450895_001889 3300042132 Bacteria 1513
1034 Ga0450898_023027 3300042134 Bacteria 1106
1035 Ga0450898_034090 3300042134 Bacteria 944
1036 Ga0450900_015664 3300042136 Bacteria 1021
1037 Ga0450903_000121 3300042138 Bacteria 16870
1038 Ga0450906_002225 3300042145 Bacteria 4239
1039 Ga0439458_0001134 3300042157 Bacteria 6769
1040 Ga0439458_0025509 3300042157 Bacteria 1387
1041 Ga0450908_070131 3300042184 Bacteria 622
1042 Ga0439434_0010812 3300042435 Bacteria 2693
1043 Ga0439434_0016765 3300042435 Bacteria 2190
1044 Ga0439434_0018207 3300042435 Bacteria 2101
1045 Ga0439435_0023314 3300042436 Bacteria 1624
1046 Ga0439435_0290320 3300042436 Bacteria 558
1047 Ga0439459_0003093 3300042438 Bacteria 2614
1048 Ga0450901_024223 3300042533 Bacteria 658
1049 Ga0451577_0101787 3300042876 Bacteria 2567
1050 Ga0439440_0260273 3300042993 Bacteria 531
1051 Ga0466969_0000470 3300044656 Bacteria 22150
1052 Ga0466969_0005382 3300044656 Bacteria 6810
1053 Ga0466969_0009133 3300044656 Bacteria 5257
1054 Ga0466969_0020850 3300044656 Bacteria 3391
1055 Ga0466969_0034108 3300044656 Bacteria 2579
1056 Ga0466969_0056244 3300044656 Bacteria 1921
1057 Ga0466969_0063027 3300044656 Bacteria 1797
1058 Ga0466969_0106363 3300044656 Bacteria 1316
1059 Ga0466969_0345685 3300044656 Bacteria 673
1060 Ga0466972_0005853 3300044658 Bacteria 6165
1061 Ga0466972_0036904 3300044658 Bacteria 2389
1062 Ga0466972_0038891 3300044658 Bacteria 2323
1063 Ga0466972_0095647 3300044658 Bacteria 1407
1064 Ga0466972_0119432 3300044658 Bacteria 1244
1065 Ga0466972_0120005 3300044658 Bacteria 1240
1066 Ga0466972_0132419 3300044658 Bacteria 1174
1067 Ga0466972_0152676 3300044658 Bacteria 1085
1068 Ga0466972_0246199 3300044658 Bacteria 836
1069 Ga0466972_0341192 3300044658 Bacteria 700
1070 Ga0466965_0005281 3300044683 Bacteria 5810
1071 Ga0466965_0008504 3300044683 Bacteria 4749
1072 Ga0466965_0023201 3300044683 Bacteria 2995
1073 Ga0466965_0023923 3300044683 Bacteria 2952
1074 Ga0466965_0065885 3300044683 Bacteria 1815
1075 Ga0466965_0077985 3300044683 Bacteria 1673
1076 Ga0466965_0112919 3300044683 Bacteria 1397
1077 Ga0466965_0291718 3300044683 Bacteria 883
1078 Ga0466965_0561309 3300044683 Bacteria 645
1079 Ga0466966_0002225 3300044684 Bacteria 12619
1080 Ga0466966_0002809 3300044684 Bacteria 11457
1081 Ga0466966_0002940 3300044684 Bacteria 11227
1082 Ga0466966_0003767 3300044684 Bacteria 10000
1083 Ga0466966_0007557 3300044684 Bacteria 7200
1084 Ga0466966_0010373 3300044684 Bacteria 6185
1085 Ga0466966_0056388 3300044684 Bacteria 2485
1086 Ga0466966_0074389 3300044684 Bacteria 2123
1087 Ga0466966_0092900 3300044684 Bacteria 1871
1088 Ga0466966_0653277 3300044684 Bacteria 633
1089 Ga0466961_0002350 3300044693 Bacteria 11760
1090 Ga0466961_0004001 3300044693 Bacteria 9225
1091 Ga0466961_0006257 3300044693 Bacteria 7559
1092 Ga0466961_0008642 3300044693 Bacteria 6491
1093 Ga0466961_0020414 3300044693 Bacteria 4261
1094 Ga0466961_0032599 3300044693 Bacteria 3348
1095 Ga0466961_0136461 3300044693 Bacteria 1537
1096 Ga0466961_0162770 3300044693 Bacteria 1390
1097 Ga0466961_0259254 3300044693 Bacteria 1066
1098 Ga0466961_0385157 3300044693 Bacteria 851
1099 Ga0466961_0746316 3300044693 Bacteria 585
1100 Ga0466961_0917618 3300044693 Bacteria 521
1101 Ga0466961_0926254 3300044693 Bacteria 518
1102 Ga0466963_0000656 3300044694 Bacteria 16684
1103 Ga0466963_0002324 3300044694 Bacteria 10596
1104 Ga0466963_0062229 3300044694 Bacteria 2497
1105 Ga0466963_0097726 3300044694 Bacteria 2006
1106 Ga0466963_0117681 3300044694 Bacteria 1827
1107 Ga0466963_0215321 3300044694 Bacteria 1345
1108 Ga0466963_0286500 3300044694 Bacteria 1158
1109 Ga0466963_0375967 3300044694 Bacteria 1001
1110 Ga0466963_0821591 3300044694 Bacteria 655
1111 Ga0466964_0065505 3300044706 Bacteria 1522
1112 Ga0466964_0120091 3300044706 Bacteria 1184
1113 Ga0466964_0139210 3300044706 Bacteria 1114
1114 Ga0466964_0658092 3300044706 Bacteria 580
1115 Ga0466971_0000161 3300044719 Bacteria 25159
1116 Ga0466971_0009498 3300044719 Bacteria 4246
1117 Ga0466971_0010470 3300044719 Bacteria 4053
1118 Ga0466971_0037329 3300044719 Bacteria 2177
1119 Ga0466971_0038008 3300044719 Bacteria 2159
1120 Ga0466971_0104911 3300044719 Bacteria 1301
1121 Ga0466971_0194357 3300044719 Bacteria 956
1122 Ga0466971_0204873 3300044719 Bacteria 932
1123 Ga0466971_0245318 3300044719 Bacteria 852
1124 Ga0466968_0003026 3300044735 Bacteria 6208
1125 Ga0466968_0004670 3300044735 Bacteria 5129
1126 Ga0466968_0017639 3300044735 Bacteria 2856
1127 Ga0466968_0078172 3300044735 Bacteria 1450
1128 Ga0466968_0087905 3300044735 Bacteria 1373
1129 Ga0466968_0133985 3300044735 Bacteria 1129
1130 Ga0466968_0204497 3300044735 Bacteria 926
1131 Ga0466970_0002119 3300044765 Bacteria 9580
1132 Ga0466970_0004779 3300044765 Bacteria 6691
1133 Ga0466970_0008021 3300044765 Bacteria 5300
1134 Ga0466970_0010155 3300044765 Bacteria 4771
1135 Ga0466970_0101681 3300044765 Bacteria 1565
1136 Ga0466970_0102256 3300044765 Bacteria 1561
1137 Ga0466970_0293933 3300044765 Bacteria 915
1138 Ga0466970_0629606 3300044765 Bacteria 623
1139 Ga0466970_0897168 3300044765 Bacteria 521
1140 Ga0466957_0001267 3300044842 Bacteria 13152
1141 Ga0466957_0006730 3300044842 Bacteria 6496
1142 Ga0466957_0019108 3300044842 Bacteria 4029
1143 Ga0466957_0023478 3300044842 Bacteria 3646
1144 Ga0466957_0071734 3300044842 Bacteria 2143
1145 Ga0466957_0087858 3300044842 Bacteria 1944
1146 Ga0466957_0144044 3300044842 Bacteria 1537
1147 Ga0466957_0164351 3300044842 Bacteria 1443
1148 Ga0466957_0337919 3300044842 Bacteria 1019
1149 Ga0466957_0458162 3300044842 Bacteria 879
1150 Ga0466957_0653684 3300044842 Bacteria 739
1151 Ga0466957_0721896 3300044842 Bacteria 704
1152 Ga0466960_0000046 3300044901 Bacteria 40430
1153 Ga0466960_0001009 3300044901 Bacteria 10066
1154 Ga0466960_0002661 3300044901 Bacteria 6738
1155 Ga0466960_0004371 3300044901 Bacteria 5519
1156 Ga0466960_0051070 3300044901 Bacteria 1996
1157 Ga0466960_0178961 3300044901 Bacteria 1148
1158 Ga0466960_0585153 3300044901 Bacteria 661
1159 Ga0466959_0001597 3300045049 Bacteria 13978
1160 Ga0466959_0002075 3300045049 Bacteria 12675
1161 Ga0466959_0005630 3300045049 Bacteria 8617
1162 Ga0466959_0019524 3300045049 Bacteria 4984
1163 Ga0466959_0026773 3300045049 Bacteria 4276
1164 Ga0466959_0027848 3300045049 Bacteria 4192
1165 Ga0466959_0045345 3300045049 Bacteria 3238
1166 Ga0466959_0050561 3300045049 Bacteria 3051
1167 Ga0466959_0064953 3300045049 Bacteria 2649
1168 Ga0466959_0116305 3300045049 Bacteria 1904
1169 Ga0466959_0426793 3300045049 Bacteria 899
1170 Ga0466958_0008122 3300045836 Bacteria 5808
1171 Ga0466958_0033877 3300045836 Bacteria 3045
1172 Ga0466958_0210873 3300045836 Bacteria 1237
1173 Ga0466958_0588526 3300045836 Bacteria 723
1174 Ga0466958_0675144 3300045836 Bacteria 673
1175 Ga0466958_0823610 3300045836 Bacteria 605
1176 Ga0466958_0984515 3300045836 Bacteria 550
1177 Ga0466967_0000098 3300045976 Bacteria 31328
1178 Ga0466967_0001175 3300045976 Bacteria 14690
1179 Ga0466967_0004167 3300045976 Bacteria 9677
1180 Ga0466967_0013920 3300045976 Bacteria 6240
1181 Ga0466967_0015885 3300045976 Bacteria 5917
1182 Ga0466967_0039775 3300045976 Bacteria 4045
1183 Ga0466967_0044157 3300045976 Bacteria 3864
1184 Ga0466967_0052656 3300045976 Bacteria 3574
1185 Ga0466967_0090102 3300045976 Bacteria 2786
1186 Ga0466967_0108859 3300045976 Bacteria 2543
1187 Ga0466967_0206462 3300045976 Bacteria 1862
1188 Ga0466967_0213462 3300045976 Bacteria 1831
1189 Ga0466967_0254036 3300045976 Bacteria 1680
1190 Ga0466967_0317645 3300045976 Bacteria 1501
1191 Ga0466967_0808390 3300045976 Bacteria 931
1192 Ga0466967_1448479 3300045976 Bacteria 684
1193 Ga0466967_1667304 3300045976 Bacteria 635
1194 Ga0466967_1936721 3300045976 Bacteria 586
1195 Ga0495617_002450 3300046452 Bacteria 7374
1196 Ga0495627_032876 3300046453 Bacteria 1630
1197 Ga0495592_0005902 3300046454 Bacteria 9091
1198 Ga0495592_0011481 3300046454 Bacteria 6705
1199 Ga0495592_0017511 3300046454 Bacteria 5443
1200 Ga0495592_0043495 3300046454 Bacteria 3360
1201 Ga0495592_0232869 3300046454 Bacteria 1225
1202 Ga0495592_0693649 3300046454 Bacteria 613
1203 Ga0495603_0002752 3300046455 Bacteria 10360
1204 Ga0495603_0005893 3300046455 Bacteria 7323
1205 Ga0495603_0026486 3300046455 Bacteria 3502
1206 Ga0495603_0027817 3300046455 Bacteria 3410
1207 Ga0495603_0057695 3300046455 Bacteria 2296
1208 Ga0495603_0058400 3300046455 Bacteria 2281
1209 Ga0495603_0090468 3300046455 Bacteria 1790
1210 Ga0495603_0324172 3300046455 Bacteria 884
1211 Ga0495590_0167759 3300046457 Bacteria 799
1212 Ga0495629_0007791 3300046459 Bacteria 7882
1213 Ga0495629_0019021 3300046459 Bacteria 4912
1214 Ga0495629_0036510 3300046459 Bacteria 3468
1215 Ga0495629_0038099 3300046459 Bacteria 3388
1216 Ga0495629_0050864 3300046459 Bacteria 2901
1217 Ga0495629_0199262 3300046459 Bacteria 1384
1218 Ga0495629_0625817 3300046459 Bacteria 718
1219 Ga0495629_0879766 3300046459 Bacteria 588
1220 Ga0495638_0006268 3300046460 Bacteria 8682
1221 Ga0495638_0037802 3300046460 Bacteria 3070
1222 Ga0495638_0047159 3300046460 Bacteria 2703
1223 Ga0495638_0069235 3300046460 Bacteria 2163
1224 Ga0495638_0372591 3300046460 Bacteria 748
1225 Ga0495641_0036692 3300046461 Bacteria 2302
1226 Ga0495651_0001691 3300046462 Bacteria 17058
1227 Ga0495651_0002270 3300046462 Bacteria 14836
1228 Ga0495651_0020919 3300046462 Bacteria 5080
1229 Ga0495651_0032656 3300046462 Bacteria 4059
1230 Ga0495653_0009684 3300046463 Bacteria 7879
1231 Ga0495653_0125804 3300046463 Bacteria 1820
1232 Ga0495580_0007503 3300046472 Bacteria 8764
1233 Ga0495580_0093565 3300046472 Bacteria 2091
1234 Ga0495580_0295347 3300046472 Bacteria 1104
1235 Ga0495582_0015462 3300046473 Bacteria 4192
1236 Ga0495582_0020967 3300046473 Bacteria 3579
1237 Ga0495582_0123656 3300046473 Bacteria 1459
1238 Ga0495582_0286903 3300046473 Bacteria 945
1239 Ga0495605_0040643 3300046474 Bacteria 2320
1240 Ga0495605_0136378 3300046474 Bacteria 1103
1241 Ga0495639_0035778 3300046475 Bacteria 2222
1242 Ga0495639_0152229 3300046475 Bacteria 1116
1243 Ga0495662_0003027 3300046476 Bacteria 8480
1244 Ga0495662_0003988 3300046476 Bacteria 7436
1245 Ga0495662_0004401 3300046476 Bacteria 7073
1246 Ga0495662_0030461 3300046476 Bacteria 2604
1247 Ga0495662_0578598 3300046476 Bacteria 549
1248 Ga0495664_0002306 3300046477 Bacteria 10231
1249 Ga0495664_0006527 3300046477 Bacteria 6447
1250 Ga0495664_0168961 3300046477 Bacteria 1327
1251 Ga0495664_0638228 3300046477 Bacteria 631
1252 Ga0495584_0489469 3300046491 Bacteria 626
1253 Ga0495585_0006843 3300046492 Bacteria 7033
1254 Ga0495585_0011896 3300046492 Bacteria 5138
1255 Ga0495585_0056441 3300046492 Bacteria 2169
1256 Ga0495585_0084605 3300046492 Bacteria 1715
1257 Ga0495594_0012495 3300046499 Bacteria 4423
1258 Ga0495594_0019099 3300046499 Bacteria 3640
1259 Ga0495594_0036869 3300046499 Bacteria 2668
1260 Ga0495594_0067391 3300046499 Bacteria 1986
1261 Ga0495594_0105804 3300046499 Bacteria 1584
1262 Ga0495594_0425777 3300046499 Bacteria 755
1263 Ga0495596_0007205 3300046500 Bacteria 5032
1264 Ga0495607_0027724 3300046501 Bacteria 3499
1265 Ga0495607_0116405 3300046501 Bacteria 1410
1266 Ga0495583_0030647 3300046506 Bacteria 2616
1267 Ga0495583_0152135 3300046506 Bacteria 958
1268 Ga0495583_0188811 3300046506 Bacteria 841
1269 Ga0495583_0249917 3300046506 Bacteria 711
1270 Ga0495606_0024751 3300046507 Bacteria 4317
1271 Ga0495606_0040870 3300046507 Bacteria 3113
1272 Ga0495608_0001723 3300046511 Bacteria 15662
1273 Ga0495608_0029184 3300046511 Bacteria 3745
1274 Ga0495608_0273468 3300046511 Bacteria 1050
1275 Ga0495608_0570525 3300046511 Bacteria 681
1276 Ga0495616_0034448 3300046513 Bacteria 2630
1277 Ga0495618_0020219 3300046514 Bacteria 4100
1278 Ga0495618_0029070 3300046514 Bacteria 3446
1279 Ga0495618_0085032 3300046514 Bacteria 2021
1280 Ga0495618_0251534 3300046514 Bacteria 1108
1281 Ga0495620_0175873 3300046515 Bacteria 828
1282 Ga0495620_0197374 3300046515 Bacteria 774
1283 Ga0495628_0001384 3300046516 Bacteria 22247
1284 Ga0495628_0012481 3300046516 Bacteria 7162
1285 Ga0495628_0026361 3300046516 Bacteria 4740
1286 Ga0495628_0050390 3300046516 Bacteria 3293
1287 Ga0495628_0149375 3300046516 Bacteria 1780
1288 Ga0495630_0048762 3300046517 Bacteria 3169
1289 Ga0495630_0265887 3300046517 Bacteria 1310
1290 Ga0495630_0324468 3300046517 Bacteria 1177
1291 Ga0495630_0613214 3300046517 Bacteria 834
1292 Ga0495631_0003549 3300046518 Bacteria 8528
1293 Ga0495631_0472694 3300046518 Bacteria 534
1294 Ga0495632_0028374 3300046519 Bacteria 2921
1295 Ga0495632_0430800 3300046519 Bacteria 574
1296 Ga0495637_0006755 3300046520 Bacteria 5740
1297 Ga0495643_0007275 3300046522 Bacteria 7155
1298 Ga0495643_0085567 3300046522 Bacteria 1634
1299 Ga0495644_0157588 3300046523 Bacteria 870
1300 Ga0495648_0069856 3300046524 Bacteria 2042
1301 Ga0495648_0112305 3300046524 Bacteria 1480
1302 Ga0495648_0204897 3300046524 Bacteria 984
1303 Ga0495648_0413244 3300046524 Bacteria 600
1304 Ga0495666_0000571 3300046526 Bacteria 16465
1305 Ga0495666_0024248 3300046526 Bacteria 2997
1306 Ga0495666_0138843 3300046526 Bacteria 1134
1307 Ga0495666_0481718 3300046526 Bacteria 555
1308 Ga0495642_0082291 3300046528 Bacteria 1357
1309 Ga0495652_0002119 3300046529 Bacteria 20914
1310 Ga0495652_0018989 3300046529 Bacteria 6124
1311 Ga0495652_0024558 3300046529 Bacteria 5334
1312 Ga0495652_0069396 3300046529 Bacteria 2950
1313 Ga0495652_0072250 3300046529 Bacteria 2876
1314 Ga0495654_0007357 3300046530 Bacteria 6159
1315 Ga0495665_0005483 3300046531 Bacteria 6832
1316 Ga0495665_0509134 3300046531 Bacteria 606
1317 Ga0495640_0005626 3300046533 Bacteria 9968
1318 Ga0495640_0013818 3300046533 Bacteria 6132
1319 Ga0495640_0016680 3300046533 Bacteria 5493
1320 Ga0495640_0017644 3300046533 Bacteria 5312
1321 Ga0495640_0142738 3300046533 Bacteria 1543
1322 Ga0495640_0182550 3300046533 Bacteria 1336
1323 Ga0495640_0913821 3300046533 Bacteria 520
1324 Ga0495586_0246189 3300046535 Bacteria 1019
1325 Ga0495587_0079197 3300046536 Bacteria 1905
1326 Ga0495587_0199871 3300046536 Bacteria 1130
1327 Ga0495587_0705976 3300046536 Bacteria 553
1328 Ga0495609_0004676 3300046538 Bacteria 7418
1329 Ga0495597_0031747 3300046542 Bacteria 2400
1330 Ga0495597_0229000 3300046542 Bacteria 736
1331 Ga0495597_0302666 3300046542 Bacteria 620
1332 Ga0495645_0024216 3300046543 Bacteria 4404
1333 Ga0495645_0028167 3300046543 Bacteria 4081
1334 Ga0495645_0045978 3300046543 Bacteria 3183
1335 Ga0495645_0101595 3300046543 Bacteria 2044
1336 Ga0495645_0888778 3300046543 Bacteria 529
1337 Ga0495622_0005380 3300046557 Bacteria 5944
1338 Ga0495622_0015971 3300046557 Bacteria 3491
1339 Ga0495622_0056033 3300046557 Bacteria 1828
1340 Ga0495633_0031583 3300046558 Bacteria 2565
1341 Ga0495667_0033930 3300046559 Bacteria 3413
1342 Ga0495667_0153082 3300046559 Bacteria 1484
1343 Ga0495667_0323018 3300046559 Bacteria 976
1344 Ga0495656_0329388 3300046615 Bacteria 788
1345 Ga0495668_0000123 3300046616 Bacteria 115173
1346 Ga0495668_0036571 3300046616 Bacteria 2751
1347 Ga0495668_0651628 3300046616 Bacteria 582
1348 Ga0495634_0006120 3300046642 Bacteria 9162
1349 Ga0495634_0010265 3300046642 Bacteria 6861
1350 Ga0495634_0050187 3300046642 Bacteria 2803
1351 Ga0495634_0213792 3300046642 Bacteria 1192
1352 Ga0495634_0276759 3300046642 Bacteria 1020
1353 Ga0495634_0382681 3300046642 Bacteria 838
1354 Ga0495611_0057795 3300046648 Bacteria 1758
1355 Ga0495611_0215774 3300046648 Bacteria 893
1356 Ga0495625_0005807 3300046660 Bacteria 11145
1357 Ga0495625_0029488 3300046660 Bacteria 4102
1358 Ga0495625_0238937 3300046660 Bacteria 1183
1359 Ga0495635_0002565 3300046663 Bacteria 12433
1360 Ga0495635_0004355 3300046663 Bacteria 9800
1361 Ga0495635_0066218 3300046663 Bacteria 2477
1362 Ga0495635_0071866 3300046663 Bacteria 2371
1363 Ga0495635_0088357 3300046663 Bacteria 2121
1364 Ga0495635_0341668 3300046663 Bacteria 1000
1365 Ga0495635_0375901 3300046663 Bacteria 946
1366 Ga0495659_0219554 3300046664 Bacteria 785
1367 Ga0495659_0562685 3300046664 Bacteria 504
1368 Ga0495661_0023540 3300046665 Bacteria 3997
1369 Ga0495661_0175298 3300046665 Bacteria 1140
1370 Ga0495588_0003543 3300046674 Bacteria 6816
1371 Ga0495588_0003986 3300046674 Bacteria 6486
1372 Ga0495588_0005355 3300046674 Bacteria 5704
1373 Ga0495588_0010107 3300046674 Bacteria 4377
1374 Ga0495657_0003629 3300046675 Bacteria 12539
1375 Ga0495657_0007083 3300046675 Bacteria 8700
1376 Ga0495657_0008037 3300046675 Bacteria 8088
1377 Ga0495657_0008501 3300046675 Bacteria 7848
1378 Ga0495599_0049987 3300046678 Bacteria 2621
1379 Ga0495599_0064358 3300046678 Bacteria 2290
1380 Ga0495599_0326318 3300046678 Bacteria 923
1381 Ga0495623_0059476 3300046679 Bacteria 2399
1382 Ga0495623_0075257 3300046679 Bacteria 2097
1383 Ga0495623_0135461 3300046679 Bacteria 1470
1384 Ga0495623_0363063 3300046679 Bacteria 786
1385 Ga0495646_0000855 3300046680 Bacteria 17256
1386 Ga0495646_0010343 3300046680 Bacteria 5933
1387 Ga0495646_0051847 3300046680 Bacteria 2481
1388 Ga0495646_0094322 3300046680 Bacteria 1723
1389 Ga0495646_0620530 3300046680 Bacteria 548
1390 Ga0495658_0002176 3300046683 Bacteria 9917
1391 Ga0495658_0112189 3300046683 Bacteria 1640
1392 Ga0495658_0538936 3300046683 Bacteria 747
1393 Ga0495669_0356984 3300046684 Bacteria 707
1394 Ga0495613_0001664 3300046689 Bacteria 16910
1395 Ga0495613_0006878 3300046689 Bacteria 8487
1396 Ga0495613_0007886 3300046689 Bacteria 7917
1397 Ga0495613_0017322 3300046689 Bacteria 5368
1398 Ga0495613_0042788 3300046689 Bacteria 3350
1399 Ga0495613_0056747 3300046689 Bacteria 2875
1400 Ga0495613_0085162 3300046689 Bacteria 2294
1401 Ga0495613_0096472 3300046689 Bacteria 2138
1402 Ga0495613_0539877 3300046689 Bacteria 781
1403 Ga0495624_0075201 3300046690 Bacteria 2098
1404 Ga0495624_0199910 3300046690 Bacteria 1214
1405 Ga0495624_0706154 3300046690 Bacteria 598
1406 Ga0495670_0055508 3300046691 Bacteria 1986
1407 Ga0495670_0058872 3300046691 Bacteria 1928
1408 Ga0495670_0176563 3300046691 Bacteria 1126
1409 Ga0495671_0013941 3300046692 Bacteria 4335
1410 Ga0495671_0030234 3300046692 Bacteria 2775
1411 Ga0495671_0147806 3300046692 Bacteria 1144
1412 Ga0495649_0031220 3300046694 Bacteria 2938
1413 Ga0495649_0171518 3300046694 Bacteria 1135
1414 Ga0495649_0183630 3300046694 Bacteria 1090
1415 Ga0495649_0247873 3300046694 Bacteria 915
1416 Ga0495649_0584368 3300046694 Bacteria 552
1417 Ga0495589_0036165 3300046794 Bacteria 2476
1418 Ga0495589_0042640 3300046794 Bacteria 2261
1419 Ga0495589_0436546 3300046794 Bacteria 600
1420 Ga0495600_0003542 3300046809 Bacteria 9186
1421 Ga0495600_0010402 3300046809 Bacteria 5777
1422 Ga0495600_0017095 3300046809 Bacteria 4611
1423 Ga0495600_0051070 3300046809 Bacteria 2699
1424 Ga0495600_0350712 3300046809 Bacteria 924
1425 Ga0495660_0031126 3300046810 Bacteria 3002
1426 Ga0495660_0038922 3300046810 Bacteria 2642
1427 Ga0495581_0011118 3300047315 Bacteria 5201
1428 Ga0495581_0053853 3300047315 Bacteria 2323
1429 Ga0495581_0081771 3300047315 Bacteria 1870
1430 Ga0495581_0096503 3300047315 Bacteria 1716
1431 Ga0495604_0002351 3300047317 Bacteria 15156
1432 Ga0495604_0004817 3300047317 Bacteria 10702
1433 Ga0495604_0007383 3300047317 Bacteria 8710
1434 Ga0495604_0063067 3300047317 Bacteria 2828
1435 Ga0495604_0285633 3300047317 Bacteria 1113
1436 Ga0495636_0007700 3300047318 Bacteria 4236
1437 Ga0495636_0036875 3300047318 Bacteria 2018
1438 Ga0495636_0037499 3300047318 Bacteria 2002
1439 Ga0495636_0087387 3300047318 Bacteria 1349
1440 Ga0495674_0067245 3300047319 Bacteria 3105
1441 Ga0495674_0070922 3300047319 Bacteria 3010
1442 Ga0495674_0119479 3300047319 Bacteria 2227
1443 Ga0495674_0268767 3300047319 Bacteria 1400
1444 Ga0495674_0283155 3300047319 Bacteria 1358
1445 Ga0495672_0010127 3300047320 Bacteria 6743
1446 Ga0495672_0028030 3300047320 Bacteria 3570
1447 Ga0495676_0001590 3300047321 Bacteria 19706
1448 Ga0495676_0002415 3300047321 Bacteria 16590
1449 Ga0495676_0147379 3300047321 Bacteria 1679
1450 Ga0495676_0290392 3300047321 Bacteria 1105
1451 Ga0495680_0178410 3300047322 Bacteria 1534
1452 Ga0495680_0452211 3300047322 Bacteria 879
1453 Ga0495683_0000766 3300047323 Bacteria 23099
1454 Ga0495683_0021951 3300047323 Bacteria 3286
1455 Ga0495687_001147 3300047443 Bacteria 25643
1456 Ga0495687_003306 3300047443 Bacteria 11824
1457 Ga0495687_039955 3300047443 Bacteria 2071
1458 Ga0495687_140261 3300047443 Bacteria 841
1459 Ga0495675_0011687 3300047444 Bacteria 5512
1460 Ga0495675_0021916 3300047444 Bacteria 4070
1461 Ga0495675_0030965 3300047444 Bacteria 3414
1462 Ga0495675_0059587 3300047444 Bacteria 2420
1463 Ga0495675_0059974 3300047444 Bacteria 2412
1464 Ga0495675_0174278 3300047444 Bacteria 1320
1465 Ga0495675_0390066 3300047444 Bacteria 813
1466 Ga0495679_011002 3300047446 Bacteria 3519
1467 Ga0495685_001275 3300047447 Bacteria 7695
1468 Ga0495685_006034 3300047447 Bacteria 3959
1469 Ga0495685_081645 3300047447 Bacteria 1076
1470 Ga0495685_108302 3300047447 Bacteria 915
1471 Ga0495673_0000456 3300047469 Bacteria 44587
1472 Ga0495681_0003151 3300047470 Bacteria 11550
1473 Ga0495681_0020011 3300047470 Bacteria 3639
1474 Ga0495684_0123494 3300047471 Bacteria 1948
1475 Ga0495684_0157647 3300047471 Bacteria 1695
1476 Ga0495686_0000637 3300047472 Bacteria 48296
1477 Ga0495686_0063634 3300047472 Bacteria 2285
1478 Ga0495686_0232025 3300047472 Bacteria 1044
1479 Ga0495593_0001812 3300047673 Bacteria 12696
1480 Ga0495593_0055656 3300047673 Bacteria 2081
1481 Ga0495593_0346380 3300047673 Bacteria 742
1482 Ga0495602_0055166 3300048088 Bacteria 3501
1483 Ga0495602_0199002 3300048088 Bacteria 1530
1484 Ga0495602_0397105 3300048088 Bacteria 984
1485 Ga0495602_0518465 3300048088 Bacteria 830
1486 Ga0495602_0531111 3300048088 Bacteria 818
1487 Ga0495602_1102216 3300048088 Bacteria 520
1488 Ga0495614_0000229 3300048089 Bacteria 21780
1489 Ga0495614_0009446 3300048089 Bacteria 4311
1490 Ga0495614_0122938 3300048089 Bacteria 1145
1491 Ga0495626_0020580 3300048091 Bacteria 3285
1492 Ga0495626_0066961 3300048091 Bacteria 1623
1493 Ga0495626_0153541 3300048091 Bacteria 969
1494 Ga0496100_0000067 3300048903 Bacteria 58703
1495 Ga0496100_0000461 3300048903 Bacteria 19507
1496 Ga0496100_0004004 3300048903 Bacteria 7749
1497 Ga0496100_0004747 3300048903 Bacteria 7250
1498 Ga0496100_0007759 3300048903 Bacteria 5947
1499 Ga0496100_0096240 3300048903 Bacteria 2031
1500 Ga0496100_0148167 3300048903 Bacteria 1671
1501 Ga0496100_0249001 3300048903 Bacteria 1314
1502 Ga0496100_0295276 3300048903 Bacteria 1212
1503 Ga0496100_0449650 3300048903 Bacteria 987
1504 Ga0496100_0546531 3300048903 Bacteria 896
1505 Ga0496101_0000099 3300048904 Bacteria 90235
1506 Ga0496101_0000108 3300048904 Bacteria 86290
1507 Ga0496101_0000750 3300048904 Bacteria 19213
1508 Ga0496101_0000793 3300048904 Bacteria 18695
1509 Ga0496101_0015063 3300048904 Bacteria 5205
1510 Ga0496101_0098732 3300048904 Bacteria 2182
1511 Ga0496101_0112323 3300048904 Bacteria 2052
1512 Ga0496101_0162987 3300048904 Bacteria 1711
1513 Ga0496101_0768929 3300048904 Bacteria 760
1514 Ga0496101_0852392 3300048904 Bacteria 718
1515 Ga0496101_1140795 3300048904 Bacteria 612
1516 Ga0496102_0000005 3300048905 Bacteria 481937
1517 Ga0496102_0000390 3300048905 Bacteria 51759
1518 Ga0496102_0003032 3300048905 Bacteria 14221
1519 Ga0496102_0006978 3300048905 Bacteria 9635
1520 Ga0496102_0030945 3300048905 Bacteria 4794
1521 Ga0496102_0051773 3300048905 Bacteria 3740
1522 Ga0496102_0093526 3300048905 Bacteria 2785
1523 Ga0496102_0140005 3300048905 Bacteria 2268
1524 Ga0496102_0143275 3300048905 Bacteria 2241
1525 Ga0496102_0211602 3300048905 Bacteria 1828
1526 Ga0496102_0216993 3300048905 Bacteria 1803
1527 Ga0496102_0437293 3300048905 Bacteria 1228
1528 Ga0496102_0504239 3300048905 Bacteria 1132
1529 Ga0496102_1061507 3300048905 Bacteria 730
1530 Ga0496102_1595120 3300048905 Bacteria 571
1531 Ga0496103_0000002 3300048906 Bacteria 605387
1532 Ga0496103_0000116 3300048906 Bacteria 86969
1533 Ga0496103_0000663 3300048906 Bacteria 25925
1534 Ga0496103_0001688 3300048906 Bacteria 14442
1535 Ga0496103_0017503 3300048906 Bacteria 4290
1536 Ga0496103_0488755 3300048906 Bacteria 788
1537 Ga0496104_0007517 3300048907 Bacteria 9631
1538 Ga0496104_0011507 3300048907 Bacteria 7929
1539 Ga0496104_0044914 3300048907 Bacteria 4153
1540 Ga0496104_0046988 3300048907 Bacteria 4068
1541 Ga0496104_0659991 3300048907 Bacteria 955
1542 Ga0496104_1474620 3300048907 Bacteria 583
1543 Ga0496105_0064390 3300048908 Bacteria 3025
1544 Ga0496105_0176837 3300048908 Bacteria 1748
1545 Ga0496105_0327777 3300048908 Bacteria 1226
1546 Ga0496105_0501550 3300048908 Bacteria 953
1547 Ga0496105_0508548 3300048908 Bacteria 945
1548 Ga0496105_0953297 3300048908 Bacteria 644
1549 Ga0496106_0000424 3300048909 Bacteria 30065
1550 Ga0496106_0001149 3300048909 Bacteria 19609
1551 Ga0496106_0001741 3300048909 Bacteria 16250
1552 Ga0496106_0002018 3300048909 Bacteria 15276
1553 Ga0496106_0016794 3300048909 Bacteria 5415
1554 Ga0496106_0177217 3300048909 Bacteria 1691
1555 Ga0496106_0212106 3300048909 Bacteria 1543
1556 Ga0496106_0234277 3300048909 Bacteria 1466
1557 Ga0496106_0318636 3300048909 Bacteria 1248
1558 Ga0496106_0624970 3300048909 Bacteria 862
1559 Ga0496106_0846820 3300048909 Bacteria 724
1560 Ga0496106_1472165 3300048909 Bacteria 524
1561 Ga0496107_0000079 3300048910 Bacteria 46405
1562 Ga0496107_0000254 3300048910 Bacteria 28236
1563 Ga0496107_0014513 3300048910 Bacteria 5514
1564 Ga0496107_0214834 3300048910 Bacteria 1430
1565 Ga0496107_0247435 3300048910 Bacteria 1327
1566 Ga0496107_0275597 3300048910 Bacteria 1252
1567 Ga0496107_0706240 3300048910 Bacteria 741
1568 Ga0496108_0005688 3300048911 Bacteria 10091
1569 Ga0496108_0011641 3300048911 Bacteria 7156
1570 Ga0496108_0033237 3300048911 Bacteria 4285
1571 Ga0496108_0071519 3300048911 Bacteria 2927
1572 Ga0496108_0110258 3300048911 Bacteria 2353
1573 Ga0496108_0137681 3300048911 Bacteria 2102
1574 Ga0496108_0174780 3300048911 Bacteria 1859
1575 Ga0496108_0259237 3300048911 Bacteria 1513
1576 Ga0496108_0326318 3300048911 Bacteria 1338
1577 Ga0496108_1260981 3300048911 Bacteria 623
1578 Ga0496109_0000159 3300048912 Bacteria 66124
1579 Ga0496109_0002268 3300048912 Bacteria 15983
1580 Ga0496109_0010817 3300048912 Bacteria 7812
1581 Ga0496109_0023653 3300048912 Bacteria 5454
1582 Ga0496109_0038336 3300048912 Bacteria 4332
1583 Ga0496109_0182877 3300048912 Bacteria 1969
1584 Ga0496109_0418659 3300048912 Bacteria 1266
1585 Ga0496109_0608141 3300048912 Bacteria 1029
1586 Ga0496109_1250478 3300048912 Bacteria 679
1587 Ga0496109_1291365 3300048912 Bacteria 666
1588 Ga0496109_1468055 3300048912 Bacteria 617
1589 Ga0496110_0006109 3300048913 Bacteria 9492
1590 Ga0496110_0085523 3300048913 Bacteria 2815
1591 Ga0496110_0141431 3300048913 Bacteria 2176
1592 Ga0496110_0168926 3300048913 Bacteria 1984
1593 Ga0496110_0253450 3300048913 Bacteria 1602
1594 Ga0496110_0267707 3300048913 Bacteria 1556
1595 Ga0496110_0338005 3300048913 Bacteria 1372
1596 Ga0496110_0554183 3300048913 Bacteria 1045
1597 Ga0496110_1247954 3300048913 Bacteria 652
1598 Ga0496110_1524752 3300048913 Bacteria 578
1599 Ga0496110_1882754 3300048913 Bacteria 508
1600 Ga0496111_0022716 3300048914 Bacteria 4395
1601 Ga0496111_0196695 3300048914 Bacteria 1499
1602 Ga0496111_0298905 3300048914 Bacteria 1193
1603 Ga0496111_0852906 3300048914 Bacteria 657
1604 Ga0496112_0017534 3300048915 Bacteria 6729
1605 Ga0496112_0018053 3300048915 Bacteria 6639
1606 Ga0496112_0018650 3300048915 Bacteria 6539
1607 Ga0496112_0042682 3300048915 Bacteria 4438
1608 Ga0496112_0062477 3300048915 Bacteria 3673
1609 Ga0496112_0083572 3300048915 Bacteria 3158
1610 Ga0496112_0159776 3300048915 Bacteria 2220
1611 Ga0496112_0285554 3300048915 Bacteria 1596
1612 Ga0496112_1156227 3300048915 Bacteria 691
1613 Ga0496113_0001013 3300048916 Bacteria 15097
1614 Ga0496113_0021243 3300048916 Bacteria 4577
1615 Ga0496113_0295987 3300048916 Bacteria 1295
1616 Ga0496113_0356646 3300048916 Bacteria 1173
1617 Ga0496113_0674981 3300048916 Bacteria 826
1618 Ga0496113_0712255 3300048916 Bacteria 800
1619 Ga0496113_1437271 3300048916 Bacteria 533
1620 Ga0496114_0000116 3300048917 Bacteria 57632
1621 Ga0496114_0000711 3300048917 Bacteria 24724
1622 Ga0496114_0001235 3300048917 Bacteria 19335
1623 Ga0496114_0086311 3300048917 Bacteria 2659
1624 Ga0496114_0099480 3300048917 Bacteria 2481
1625 Ga0496114_0183417 3300048917 Bacteria 1828
1626 Ga0496114_0245998 3300048917 Bacteria 1573
1627 Ga0496114_0489472 3300048917 Bacteria 1088
1628 Ga0496114_0646605 3300048917 Bacteria 930
1629 Ga0496114_0818518 3300048917 Bacteria 810
1630 Ga0496115_0002425 3300048918 Bacteria 13379
1631 Ga0496115_0015061 3300048918 Bacteria 5861
1632 Ga0496115_0021113 3300048918 Bacteria 5026
1633 Ga0496115_0425739 3300048918 Bacteria 1075
1634 Ga0496115_1219552 3300048918 Bacteria 564
1635 Ga0496116_0000034 3300048919 Bacteria 409567
1636 Ga0496116_0001408 3300048919 Bacteria 27021
1637 Ga0496116_0002098 3300048919 Bacteria 21291
1638 Ga0496117_0000003 3300048920 Bacteria 1881097
1639 Ga0496117_0001155 3300048920 Bacteria 39752
1640 Ga0496117_0028583 3300048920 Bacteria 4315
1641 Ga0496117_0618140 3300048920 Bacteria 504
1642 Ga0496118_0000001 3300048921 Bacteria 1881100
1643 Ga0496118_0000165 3300048921 Bacteria 119376
1644 Ga0496118_0000348 3300048921 Bacteria 78668
1645 Ga0496118_0029623 3300048921 Bacteria 4586
1646 Ga0496119_0000669 3300048922 Bacteria 45985
1647 Ga0496119_0003552 3300048922 Bacteria 16090
1648 Ga0496119_0010241 3300048922 Bacteria 7906
1649 Ga0496119_0205331 3300048922 Bacteria 1017
1650 Ga0496119_0388086 3300048922 Bacteria 668
1651 Ga0496120_0000594 3300048923 Bacteria 54781
1652 Ga0496120_0002960 3300048923 Bacteria 16171
1653 Ga0496120_0009506 3300048923 Bacteria 6884
1654 Ga0496120_0027390 3300048923 Bacteria 3507
1655 Ga0496120_0265903 3300048923 Bacteria 799
1656 Ga0496120_0350103 3300048923 Bacteria 664
1657 Ga0496121_0000016 3300048924 Bacteria 562911
1658 Ga0496121_0001920 3300048924 Bacteria 33194
1659 Ga0496121_0003113 3300048924 Bacteria 23968
1660 Ga0496121_0785925 3300048924 Bacteria 561
1661 Ga0496122_0000284 3300048925 Bacteria 113244
1662 Ga0496122_0003418 3300048925 Bacteria 20891
1663 Ga0496122_0016911 3300048925 Bacteria 6855
1664 Ga0496122_0296743 3300048925 Bacteria 874
1665 Ga0496123_0003511 3300048926 Bacteria 17464
1666 Ga0496123_0008217 3300048926 Bacteria 9623
1667 Ga0496123_0024695 3300048926 Bacteria 4558
1668 Ga0496124_0000015 3300048927 Bacteria 460700
1669 Ga0496124_0238890 3300048927 Bacteria 1352
1670 Ga0496124_0252667 3300048927 Bacteria 1303
1671 Ga0496125_0000021 3300048928 Bacteria 460688
1672 Ga0496125_0037430 3300048928 Bacteria 4218
1673 Ga0496125_0094243 3300048928 Bacteria 2231
1674 Ga0496125_0274510 3300048928 Bacteria 1048
1675 Ga0496125_0448140 3300048928 Bacteria 740
1676 Ga0496125_0626679 3300048928 Bacteria 583
1677 Ga0496126_0000015 3300048929 Bacteria 663212
1678 Ga0496126_0000178 3300048929 Bacteria 145079
1679 Ga0496126_0000807 3300048929 Bacteria 56090
1680 Ga0496126_0003990 3300048929 Bacteria 18027
1681 Ga0496126_0012073 3300048929 Bacteria 8877
1682 Ga0496126_0029817 3300048929 Bacteria 5179
1683 Ga0496126_0038286 3300048929 Bacteria 4464
1684 Ga0496126_0258251 3300048929 Bacteria 1450
1685 Ga0496126_0594121 3300048929 Bacteria 873
1686 Ga0496126_0888023 3300048929 Bacteria 677
1687 Ga0501305_105422 3300049161 Bacteria 529
1688 Ga0495678_007860 3300049459 Bacteria 5478
1689 Ga0495682_0030079 3300049460 Bacteria 2010
1690 Ga0501031_0001068 3300049568 Bacteria 16636
1691 Ga0501031_0014602 3300049568 Bacteria 5106
1692 Ga0501031_0020290 3300049568 Bacteria 4333
1693 Ga0501031_0050342 3300049568 Bacteria 2714
1694 Ga0501031_0978008 3300049568 Bacteria 541
1695 Ga0501032_0000686 3300049569 Bacteria 27531
1696 Ga0501032_0001416 3300049569 Bacteria 19040
1697 Ga0501032_0003137 3300049569 Bacteria 12721
1698 Ga0501032_0018870 3300049569 Bacteria 4826
1699 Ga0501032_0050349 3300049569 Bacteria 2809
1700 Ga0501032_0343667 3300049569 Bacteria 961
1701 Ga0501032_0583938 3300049569 Bacteria 711
1702 Ga0501032_1057408 3300049569 Bacteria 509
1703 Ga0501033_0013223 3300049570 Bacteria 6288
1704 Ga0501033_0014277 3300049570 Bacteria 6036
1705 Ga0501033_0035727 3300049570 Bacteria 3725
1706 Ga0501033_0049148 3300049570 Bacteria 3131
1707 Ga0501033_0052208 3300049570 Bacteria 3030
1708 Ga0501033_0071252 3300049570 Bacteria 2553
1709 Ga0501033_0187722 3300049570 Bacteria 1480
1710 Ga0501033_0207894 3300049570 Bacteria 1396
1711 Ga0501034_0000700 3300049571 Bacteria 50894
1712 Ga0501034_0000987 3300049571 Bacteria 40823
1713 Ga0501034_0001101 3300049571 Bacteria 38016
1714 Ga0501034_0008658 3300049571 Bacteria 10734
1715 Ga0501034_0018578 3300049571 Bacteria 7127
1716 Ga0501034_0055651 3300049571 Bacteria 3980
1717 Ga0501034_0080810 3300049571 Bacteria 3254
1718 Ga0501034_0153981 3300049571 Bacteria 2274
1719 Ga0501034_0158112 3300049571 Bacteria 2239
1720 Ga0501034_0255631 3300049571 Bacteria 1696
1721 Ga0501034_0304551 3300049571 Bacteria 1529
1722 Ga0501034_0932102 3300049571 Bacteria 755
1723 Ga0501034_0975050 3300049571 Bacteria 732
1724 Ga0501036_0001560 3300049572 Bacteria 17694
1725 Ga0501036_0004005 3300049572 Bacteria 11846
1726 Ga0501036_0010187 3300049572 Bacteria 7746
1727 Ga0501036_0011832 3300049572 Bacteria 7234
1728 Ga0501036_0034998 3300049572 Bacteria 4248
1729 Ga0501036_0088645 3300049572 Bacteria 2614
1730 Ga0501036_0200542 3300049572 Bacteria 1678
1731 Ga0501036_0275877 3300049572 Bacteria 1407
1732 Ga0501036_1415193 3300049572 Bacteria 563
1733 Ga0501037_0000796 3300049573 Bacteria 23665
1734 Ga0501037_0001087 3300049573 Bacteria 20162
1735 Ga0501037_0003517 3300049573 Bacteria 11374
1736 Ga0501037_0020048 3300049573 Bacteria 4936
1737 Ga0501037_0073888 3300049573 Bacteria 2478
1738 Ga0501037_0143192 3300049573 Bacteria 1710
1739 Ga0501037_0410221 3300049573 Bacteria 928
1740 Ga0501037_0417484 3300049573 Bacteria 919
1741 Ga0501038_0001242 3300049574 Bacteria 23113
1742 Ga0501038_0021854 3300049574 Bacteria 5738
1743 Ga0501038_0022452 3300049574 Bacteria 5654
1744 Ga0501038_0022934 3300049574 Bacteria 5587
1745 Ga0501038_0128585 3300049574 Bacteria 2082
1746 Ga0501038_0229890 3300049574 Bacteria 1476
1747 Ga0501038_0235105 3300049574 Bacteria 1456
1748 Ga0501038_0680683 3300049574 Bacteria 772
1749 Ga0501039_0001950 3300049575 Bacteria 15298
1750 Ga0501039_0004622 3300049575 Bacteria 10408
1751 Ga0501039_0014245 3300049575 Bacteria 6088
1752 Ga0501039_0062350 3300049575 Bacteria 2888
1753 Ga0501039_0073151 3300049575 Bacteria 2663
1754 Ga0501039_0083420 3300049575 Bacteria 2489
1755 Ga0501039_0420405 3300049575 Bacteria 1050
1756 Ga0501039_0482092 3300049575 Bacteria 974
1757 Ga0501039_1502394 3300049575 Bacteria 518
1758 Ga0501040_0002076 3300049576 Bacteria 12897
1759 Ga0501040_0004277 3300049576 Bacteria 9287
1760 Ga0501040_0012616 3300049576 Bacteria 5541
1761 Ga0501040_0182649 3300049576 Bacteria 1487
1762 Ga0501040_0320419 3300049576 Bacteria 1109
1763 Ga0501041_0000883 3300049577 Bacteria 16205
1764 Ga0501041_0011660 3300049577 Bacteria 5201
1765 Ga0501041_0180918 3300049577 Bacteria 1320
1766 Ga0501042_0009170 3300049578 Bacteria 6579
1767 Ga0501042_0031635 3300049578 Bacteria 3743
1768 Ga0501042_0069336 3300049578 Bacteria 2521
1769 Ga0501043_0000867 3300049579 Bacteria 26805
1770 Ga0501043_0002585 3300049579 Bacteria 15295
1771 Ga0501043_0005384 3300049579 Bacteria 10336
1772 Ga0501043_0006178 3300049579 Bacteria 9623
1773 Ga0501043_0026492 3300049579 Bacteria 4547
1774 Ga0501043_0038502 3300049579 Bacteria 3759
1775 Ga0501043_0093226 3300049579 Bacteria 2368
1776 Ga0501043_0236408 3300049579 Bacteria 1410
1777 Ga0501043_0343251 3300049579 Bacteria 1135
1778 Ga0501043_0507562 3300049579 Bacteria 900
1779 Ga0501043_0584666 3300049579 Bacteria 826
1780 Ga0501046_0002722 3300049580 Bacteria 16457
1781 Ga0501046_0003795 3300049580 Bacteria 13830
1782 Ga0501046_0013539 3300049580 Bacteria 6901
1783 Ga0501046_0055300 3300049580 Bacteria 3120
1784 Ga0501046_0073322 3300049580 Bacteria 2657
1785 Ga0501047_0000216 3300049581 Bacteria 69275
1786 Ga0501047_0000544 3300049581 Bacteria 40681
1787 Ga0501047_0002484 3300049581 Bacteria 17594
1788 Ga0501047_0027108 3300049581 Bacteria 5519
1789 Ga0501047_0034178 3300049581 Bacteria 4909
1790 Ga0501047_0045820 3300049581 Bacteria 4227
1791 Ga0501047_0068246 3300049581 Bacteria 3425
1792 Ga0501047_0271380 3300049581 Bacteria 1542
1793 Ga0501047_0295297 3300049581 Bacteria 1464
1794 Ga0501047_0335490 3300049581 Bacteria 1350
1795 Ga0501047_0604000 3300049581 Bacteria 918
1796 Ga0501047_0771746 3300049581 Bacteria 777
1797 Ga0501047_1361502 3300049581 Bacteria 524
1798 Ga0501048_0002418 3300049582 Bacteria 14247
1799 Ga0501048_0002590 3300049582 Bacteria 13851
1800 Ga0501048_0003490 3300049582 Bacteria 11951
1801 Ga0501048_0199309 3300049582 Bacteria 1419
1802 Ga0501067_0002500 3300049583 Bacteria 10156
1803 Ga0501068_0000652 3300049584 Bacteria 17789
1804 Ga0501068_0192534 3300049584 Bacteria 1292
1805 Ga0501068_0872184 3300049584 Bacteria 592
1806 Ga0501068_1123447 3300049584 Bacteria 520
1807 Ga0501069_0005601 3300049585 Bacteria 6532
1808 Ga0501069_0012698 3300049585 Bacteria 4483
1809 Ga0501069_0165863 3300049585 Bacteria 1273
1810 Ga0501069_0238129 3300049585 Bacteria 1060
1811 Ga0501069_0532726 3300049585 Bacteria 702
1812 Ga0501069_0585736 3300049585 Bacteria 669
1813 Ga0501069_0945461 3300049585 Bacteria 525
1814 Ga0501070_0000456 3300049586 Bacteria 37018
1815 Ga0501070_0000766 3300049586 Bacteria 29273
1816 Ga0501070_0007603 3300049586 Bacteria 9201
1817 Ga0501070_0108283 3300049586 Bacteria 2296
1818 Ga0501070_0326560 3300049586 Bacteria 1247
1819 Ga0501070_0505795 3300049586 Bacteria 970
1820 Ga0501070_0600534 3300049586 Bacteria 877
1821 Ga0501070_0656884 3300049586 Bacteria 832
1822 Ga0501070_1493345 3300049586 Bacteria 511
1823 Ga0501071_0006265 3300049587 Bacteria 7718
1824 Ga0501071_0011659 3300049587 Bacteria 5933
1825 Ga0501072_0002534 3300049588 Bacteria 13689
1826 Ga0501072_0005287 3300049588 Bacteria 9832
1827 Ga0501072_0776204 3300049588 Bacteria 751
1828 Ga0501073_0055489 3300049589 Bacteria 2772
1829 Ga0501073_0057778 3300049589 Bacteria 2711
1830 Ga0501073_0073139 3300049589 Bacteria 2387
1831 Ga0501073_0137798 3300049589 Bacteria 1691
1832 Ga0501073_0224702 3300049589 Bacteria 1297
1833 Ga0501074_0006059 3300049590 Bacteria 8725
1834 Ga0501074_0006068 3300049590 Bacteria 8722
1835 Ga0501074_0199426 3300049590 Bacteria 1426
1836 Ga0501074_1138889 3300049590 Bacteria 548
1837 Ga0501075_0013356 3300049591 Bacteria 5860
1838 Ga0501076_0006709 3300049592 Bacteria 8350
1839 Ga0501076_0089498 3300049592 Bacteria 2474
1840 Ga0501076_1756910 3300049592 Bacteria 509
1841 Ga0501077_0015072 3300049593 Bacteria 4860
1842 Ga0501077_0129275 3300049593 Bacteria 1601
1843 Ga0501077_0184382 3300049593 Bacteria 1326
1844 Ga0501235_024973 3300049669 Bacteria 1336
1845 Ga0501225_0088809 3300049705 Bacteria 894
1846 Ga0501079_0023146 3300049741 Bacteria 4769
1847 Ga0501079_0029937 3300049741 Bacteria 4182
1848 Ga0501080_0015534 3300049742 Bacteria 7020
1849 Ga0501080_0053708 3300049742 Bacteria 3752
1850 Ga0501080_0056741 3300049742 Bacteria 3646
1851 Ga0501080_0114961 3300049742 Bacteria 2495
1852 Ga0501080_0191273 3300049742 Bacteria 1880
1853 Ga0501080_0691588 3300049742 Bacteria 900
1854 Ga0501080_0717311 3300049742 Bacteria 881
1855 Ga0501080_0974738 3300049742 Bacteria 736
1856 Ga0501081_0138955 3300049743 Bacteria 1740
1857 Ga0501081_0273584 3300049743 Bacteria 1236
1858 Ga0501081_0336567 3300049743 Bacteria 1111
1859 Ga0501081_0991854 3300049743 Bacteria 635
1860 Ga0501083_0001307 3300049744 Bacteria 16868
1861 Ga0501083_0178532 3300049744 Bacteria 1387
1862 Ga0501266_088690 3300049763 Bacteria 534
1863 Ga0501282_003648 3300049778 Bacteria 1658
1864 Ga0501035_0000870 3300049822 Bacteria 32141
1865 Ga0501035_0001097 3300049822 Bacteria 28352
1866 Ga0501035_0001386 3300049822 Bacteria 24909
1867 Ga0501035_0004451 3300049822 Bacteria 13296
1868 Ga0501035_0010236 3300049822 Bacteria 8701
1869 Ga0501035_0018724 3300049822 Bacteria 6377
1870 Ga0501035_0020892 3300049822 Bacteria 6016
1871 Ga0501035_0090680 3300049822 Bacteria 2690
1872 Ga0501035_0101450 3300049822 Bacteria 2525
1873 Ga0501035_0179268 3300049822 Bacteria 1826
1874 Ga0501035_0429294 3300049822 Bacteria 1096
1875 Ga0501035_0753361 3300049822 Bacteria 781
1876 Ga0501044_0001367 3300049823 Bacteria 28613
1877 Ga0501044_0002317 3300049823 Bacteria 21701
1878 Ga0501044_0004810 3300049823 Bacteria 15100
1879 Ga0501044_0007119 3300049823 Bacteria 12303
1880 Ga0501044_0019900 3300049823 Bacteria 7169
1881 Ga0501044_0049478 3300049823 Bacteria 4338
1882 Ga0501044_0053350 3300049823 Bacteria 4159
1883 Ga0501044_0086075 3300049823 Bacteria 3175
1884 Ga0501044_0102858 3300049823 Bacteria 2871
1885 Ga0501044_0104234 3300049823 Bacteria 2850
1886 Ga0501044_0121019 3300049823 Bacteria 2618
1887 Ga0501044_0160265 3300049823 Bacteria 2227
1888 Ga0501044_0197226 3300049823 Bacteria 1972
1889 Ga0501044_0357273 3300049823 Bacteria 1379
1890 Ga0501044_0516620 3300049823 Bacteria 1094
1891 Ga0501044_0604048 3300049823 Bacteria 990
1892 Ga0501045_0003212 3300049824 Bacteria 11175
1893 Ga0501045_0016064 3300049824 Bacteria 5311
1894 Ga0501045_0099953 3300049824 Bacteria 2147
1895 Ga0501045_0781291 3300049824 Bacteria 703
1896 Ga0501045_1393037 3300049824 Bacteria 509
1897 Ga0501212_039845 3300049851 Bacteria 775
1898 nmdc:mga03683_109749_c1 3300050489 Bacteria 1219
1899 nmdc:mga03683_196946_c1 3300050489 Bacteria 923
1900 nmdc:mga03683_21413_c1 3300050489 Bacteria 2492
1901 nmdc:mga03683_255613_c1 3300050489 Bacteria 814
1902 nmdc:mga03683_317642_c1 3300050489 Bacteria 733
1903 nmdc:mga03683_49387_c1 3300050489 Bacteria 1751
1904 nmdc:mga03n38_102027_c1 3300050490 Bacteria 1385
1905 nmdc:mga03n38_104021_c1 3300050490 Bacteria 1373
1906 nmdc:mga03n38_107_c1 3300050490 Bacteria 17345
1907 nmdc:mga03n38_109159_c1 3300050490 Bacteria 1345
1908 nmdc:mga03n38_133580_c1 3300050490 Bacteria 1232
1909 nmdc:mga03n38_135101_c1 3300050490 Bacteria 1226
1910 nmdc:mga03n38_138478_c1 3300050490 Bacteria 1213
1911 nmdc:mga03n38_213599_c1 3300050490 Bacteria 1004
1912 nmdc:mga03n38_2914_c1 3300050490 Bacteria 5393
1913 nmdc:mga03n38_298421_c1 3300050490 Bacteria 865
1914 nmdc:mga03n38_32904_c1 3300050490 Bacteria 2201
1915 nmdc:mga03n38_33091_c1 3300050490 Bacteria 2196
1916 nmdc:mga03n38_336384_c1 3300050490 Bacteria 819
1917 nmdc:mga03n38_349407_c1 3300050490 Bacteria 804
1918 nmdc:mga03n38_483979_c1 3300050490 Bacteria 692
1919 nmdc:mga03n38_5259_c1 3300050490 Bacteria 4389
1920 nmdc:mga03n38_538692_c1 3300050490 Bacteria 659
1921 nmdc:mga03n38_89173_c1 3300050490 Bacteria 1465
1922 nmdc:mga03n38_94257_c1 3300050490 Bacteria 1432
1923 nmdc:mga00v17_108812_c1 3300050491 Bacteria 1756
1924 nmdc:mga00v17_11148_c1 3300050491 Bacteria 4934
1925 nmdc:mga00v17_112072_c1 3300050491 Bacteria 1731
1926 nmdc:mga00v17_117929_c1 3300050491 Bacteria 1688
1927 nmdc:mga00v17_158503_c1 3300050491 Bacteria 1456
1928 nmdc:mga00v17_18215_c1 3300050491 Bacteria 3984
1929 nmdc:mga00v17_214437_c1 3300050491 Bacteria 1246
1930 nmdc:mga00v17_2226_c1 3300050491 Bacteria 9956
1931 nmdc:mga00v17_235637_c1 3300050491 Bacteria 1186
1932 nmdc:mga00v17_260368_c1 3300050491 Bacteria 1125
1933 nmdc:mga00v17_279242_c1 3300050491 Bacteria 1084
1934 nmdc:mga00v17_293564_c1 3300050491 Bacteria 1056
1935 nmdc:mga00v17_329288_c1 3300050491 Bacteria 992
1936 nmdc:mga00v17_45291_c1 3300050491 Bacteria 2657
1937 nmdc:mga00v17_541992_c1 3300050491 Bacteria 753
1938 nmdc:mga00v17_653229_c1 3300050491 Bacteria 676
1939 nmdc:mga00v17_742439_c1 3300050491 Bacteria 628
1940 nmdc:mga00v17_97638_c1 3300050491 Bacteria 1852
1941 nmdc:mga0yw44_22775_c1 3300050492 Bacteria 3518
1942 nmdc:mga0yw44_242484_c1 3300050492 Bacteria 1198
1943 nmdc:mga0yw44_2716_c1 3300050492 Bacteria 7644
1944 nmdc:mga0yw44_290519_c1 3300050492 Bacteria 1094
1945 nmdc:mga0yw44_35428_c1 3300050492 Bacteria 2933
1946 nmdc:mga0yw44_448239_c1 3300050492 Bacteria 874
1947 nmdc:mga0yw44_480209_c1 3300050492 Bacteria 843
1948 nmdc:mga0yw44_61750_c1 3300050492 Bacteria 2300
1949 nmdc:mga0yw44_622061_c1 3300050492 Bacteria 734
1950 nmdc:mga0yw44_659728_c1 3300050492 Bacteria 711
1951 nmdc:mga0yw44_739956_c1 3300050492 Bacteria 668
1952 nmdc:mga0yw44_756391_c1 3300050492 Bacteria 660
1953 nmdc:mga0yw44_826811_c1 3300050492 Bacteria 629
1954 nmdc:mga0yw44_99428_c1 3300050492 Bacteria 1851
1955 nmdc:mga06z11_100757_c1 3300050494 Bacteria 1584
1956 nmdc:mga06z11_241786_c1 3300050494 Bacteria 1060
1957 nmdc:mga06z11_31001_c1 3300050494 Bacteria 2593
1958 nmdc:mga06z11_464827_c1 3300050494 Bacteria 765
1959 nmdc:mga06z11_515432_c1 3300050494 Bacteria 725
1960 nmdc:mga06z11_528606_c1 3300050494 Bacteria 715
1961 nmdc:mga06z11_533_c1 3300050494 Bacteria 14010
1962 nmdc:mga06z11_920561_c1 3300050494 Bacteria 533
1963 nmdc:mga04h51_195285_c1 3300050495 Bacteria 793
1964 nmdc:mga04h51_23177_c1 3300050495 Bacteria 1888
1965 nmdc:mga07m45_116413_c1 3300050496 Bacteria 1542
1966 nmdc:mga07m45_14311_c1 3300050496 Bacteria 4223
1967 nmdc:mga07m45_161483_c1 3300050496 Bacteria 1301
1968 nmdc:mga07m45_298273_c1 3300050496 Bacteria 937
1969 nmdc:mga07m45_45821_c1 3300050496 Bacteria 2456
1970 nmdc:mga07m45_70843_c1 3300050496 Bacteria 1983
1971 nmdc:mga07m45_83179_c1 3300050496 Bacteria 1829
1972 nmdc:mga05p37_15340_c1 3300050507 Bacteria 9205
1973 nmdc:mga05p37_86594_c1 3300050507 Bacteria 3861
1974 nmdc:mga09592_684227_c1 3300050508 Bacteria 874
1975 nmdc:mga0qj67_73761_c1 3300050509 Bacteria 2726
1976 nmdc:mga0qj67_86419_c1 3300050509 Bacteria 2516
1977 nmdc:mga08y16_1386578_c1 3300050511 Bacteria 667
1978 nmdc:mga08y16_1621178_c1 3300050511 Bacteria 604
1979 nmdc:mga08y16_760492_c1 3300050511 Bacteria 964
1980 nmdc:mga0a205_235559_c1 3300050515 Bacteria 1712
1981 nmdc:mga0sz30_105066_c1 3300050516 Bacteria 1235
1982 nmdc:mga0sz30_114790_c1 3300050516 Bacteria 1181
1983 nmdc:mga0sz30_214035_c1 3300050516 Bacteria 856
1984 nmdc:mga0sz30_21480_c1 3300050516 Bacteria 2613
1985 nmdc:mga0sz30_247555_c1 3300050516 Bacteria 793
1986 nmdc:mga0sz30_25097_c1 3300050516 Bacteria 2437
1987 nmdc:mga0sz30_338778_c1 3300050516 Bacteria 672
1988 nmdc:mga0sz30_358061_c1 3300050516 Bacteria 652
1989 nmdc:mga0sz30_38126_c1 3300050516 Bacteria 1599
1990 nmdc:mga0sz30_38437_c1 3300050516 Bacteria 2005
1991 nmdc:mga0sz30_395087_c1 3300050516 Bacteria 619
1992 nmdc:mga0sz30_451939_c1 3300050516 Bacteria 577
1993 nmdc:mga0sz30_465596_c1 3300050516 Bacteria 568
1994 nmdc:mga0sz30_62206_c2 3300050516 Bacteria 620
1995 nmdc:mga0sz30_70896_c1 3300050516 Bacteria 1500
1996 Ga0495601_0026650 3300053077 Bacteria 3570
1997 Ga0495601_0038926 3300053077 Bacteria 2975
1998 Ga0495601_0073237 3300053077 Bacteria 2189
1999 Ga0495612_0005779 3300053078 Bacteria 5107
2000 Ga0495612_0087117 3300053078 Bacteria 1318
2001 Ga0500610_0011119 3300053079 Bacteria 4084
2002 Ga0500610_0147176 3300053079 Bacteria 1184
2003 Ga0500610_0284705 3300053079 Bacteria 739
2004 Ga0500635_0465480 3300053080 Bacteria 501
2005 Ga0495655_0093937 3300053083 Bacteria 878
2006 Ga0495655_0324614 3300053083 Bacteria 534
2007 Ga0495655_0367919 3300053083 Bacteria 506
2008 Ga0495595_0407764 3300053084 Bacteria 689
2009 Ga0495619_0007645 3300053085 Bacteria 6842
2010 Ga0495619_0133108 3300053085 Bacteria 1709
2011 Ga0495619_0209860 3300053085 Bacteria 1349
2012 Ga0495619_0772303 3300053085 Bacteria 651
2013 Ga0500578_0185326 3300053086 Bacteria 1281
2014 Ga0500578_0250628 3300053086 Bacteria 1067
2015 Ga0500578_0361070 3300053086 Bacteria 846
2016 Ga0500643_004993 3300053087 Bacteria 5826
2017 Ga0500643_034977 3300053087 Bacteria 1510
2018 Ga0500643_040244 3300053087 Bacteria 1377
2019 Ga0500643_042530 3300053087 Bacteria 1329
2020 Ga0500581_203034 3300053089 Bacteria 878
2021 Ga0500583_0211859 3300053092 Bacteria 962
2022 Ga0500583_0318492 3300053092 Bacteria 759
2023 Ga0500651_0722005 3300053093 Bacteria 531
2024 Ga0500566_0114405 3300053094 Bacteria 1462
2025 Ga0500640_000199 3300053095 Bacteria 12879
2026 Ga0500641_0119258 3300053096 Bacteria 1137
2027 Ga0500650_0052766 3300053098 Bacteria 1891
2028 Ga0500654_032949 3300053099 Bacteria 3082
2029 Ga0500654_187819 3300053099 Bacteria 646
2030 Ga0500553_034430 3300053101 Bacteria 2517
2031 Ga0500556_0025034 3300053104 Bacteria 1967
2032 Ga0500556_0115219 3300053104 Bacteria 1045
2033 Ga0500558_214684 3300053106 Bacteria 659
2034 Ga0500560_000605 3300053107 Bacteria 5226
2035 Ga0500560_015926 3300053107 Bacteria 2041
2036 Ga0500560_042009 3300053107 Bacteria 1438
2037 Ga0500562_037695 3300053108 Bacteria 1283
2038 Ga0500562_163035 3300053108 Bacteria 606
2039 Ga0500569_000808 3300053109 Bacteria 5512
2040 Ga0500572_027614 3300053111 Bacteria 1556
2041 Ga0500572_259794 3300053111 Bacteria 564
2042 Ga0500594_0187516 3300053118 Bacteria 676
2043 Ga0500595_063465 3300053119 Bacteria 1110
2044 Ga0500608_054416 3300053122 Bacteria 1920
2045 Ga0500614_041281 3300053123 Bacteria 1174
2046 Ga0500618_152749 3300053125 Bacteria 527
2047 Ga0500621_029543 3300053126 Bacteria 2170
2048 Ga0500628_004395 3300053129 Bacteria 2334
2049 Ga0500628_030134 3300053129 Bacteria 1171
2050 Ga0500652_001721 3300053131 Bacteria 6627
2051 Ga0500652_010700 3300053131 Bacteria 3154
2052 Ga0500652_176044 3300053131 Bacteria 878
2053 Ga0500652_269688 3300053131 Bacteria 668
2054 Ga0500655_055522 3300053133 Bacteria 793
2055 Ga0500658_0021304 3300053134 Bacteria 2453
2056 Ga0500559_0146159 3300053136 Bacteria 1109
2057 Ga0500559_0193688 3300053136 Bacteria 958
2058 Ga0500559_0529806 3300053136 Bacteria 539
2059 Ga0500561_0000789 3300053137 Bacteria 5034
2060 Ga0500573_0005248 3300053140 Bacteria 6925
2061 Ga0500573_0024372 3300053140 Bacteria 3479
2062 Ga0500573_0052240 3300053140 Bacteria 2350
2063 Ga0500573_0446074 3300053140 Bacteria 599
2064 Ga0500579_044854 3300053143 Bacteria 2751
2065 Ga0500586_026498 3300053145 Bacteria 1878
2066 Ga0500586_198010 3300053145 Bacteria 661
2067 Ga0500588_0035717 3300053146 Bacteria 1465
2068 Ga0500588_0306182 3300053146 Bacteria 602
2069 Ga0500600_0022759 3300053149 Bacteria 3748
2070 Ga0500603_037368 3300053150 Bacteria 1281
2071 Ga0500616_0041089 3300053153 Bacteria 2483
2072 Ga0500616_0055332 3300053153 Bacteria 2075
2073 Ga0500616_0141584 3300053153 Bacteria 1123
2074 Ga0500620_283881 3300053155 Bacteria 541
2075 Ga0500627_0085476 3300053158 Bacteria 1409
2076 Ga0500633_0022892 3300053160 Bacteria 1920
2077 Ga0500633_0254976 3300053160 Bacteria 651
2078 Ga0500634_0039494 3300053161 Bacteria 2564
2079 Ga0500634_0134890 3300053161 Bacteria 1179
2080 Ga0500645_000032 3300053730 Bacteria 119506
2081 Ga0500645_172225 3300053730 Bacteria 591
2082 Ga0500656_030485 3300053732 Bacteria 715
2083 Ga0500587_003192 3300053739 Bacteria 2308
2084 Ga0501084_0001814 3300054114 Bacteria 17044
2085 Ga0501084_0025061 3300054114 Bacteria 4977
2086 Ga0587073_0223576 3300059492 Bacteria 577
2087 Ga0587080_095102 3300059503 Bacteria 630
2088 Ga0587083_0054650 3300059505 Bacteria 881
2089 Ga0587099_061417 3300059622 Bacteria 519
2090 Ga0587122_008489 3300059628 Bacteria 932
2091 Ga0587067_042151 3300059640 Bacteria 891
2092 Ga0587069_121145 3300059642 Bacteria 555
2093 Ga0587114_057507 3300059655 Bacteria 674
2094 Ga0501082_0003705 3300060353 Bacteria 13353
2095 Ga0501082_0104495 3300060353 Bacteria 2450
2096 Ga0466962_0000056 3300061719 Bacteria 46579
2097 Ga0466962_0000729 3300061719 Bacteria 14725
2098 Ga0466962_0003557 3300061719 Bacteria 7420
2099 Ga0466962_0007132 3300061719 Bacteria 5352
2100 Ga0466962_0017444 3300061719 Bacteria 3456
2101 Ga0466962_0086224 3300061719 Bacteria 1503
2102 Ga0466962_0434474 3300061719 Bacteria 660
2103 Ga0530510_0034383 3300061734 Bacteria 3651
2104 2523384142 2523231044 Bacteria 6434991
2105 2547410063 2547132111 Bacteria 8013147
2106 2552108214 2551306166 Bacteria 9731570
2107 2554256882 2554235005 Bacteria 6457341
2108 2566996612 2565956761 Bacteria 6601618
2109 2585299419 2582581312 Bacteria 7308206
2110 2585308196 2582581313 Bacteria 10042643
2111 2585319180 2582581314 Bacteria 11452267
2112 2616696887 2616644814 Bacteria 11555299
2113 2616902026 2616644941 Bacteria 8510691
2114 2643764858 2643221548 Bacteria 8053412
2115 2643902801 2643221578 Bacteria 9213798
2116 2643942076 2643221587 Bacteria 7586415
2117 2644017240 2643221601 Bacteria 7493239
2118 2644173799 2643221631 Bacteria 8168043
2119 2644261701 2643221647 Bacteria 10741251
2120 2644389735 2643221670 Bacteria 6497041
2121 2644404690 2643221673 Bacteria 9196637
2122 2644429159 2643221677 Bacteria 7584031
2123 2644439224 2643221678 Bacteria 9540101
2124 2644461302 2643221682 Bacteria 6743283
2125 2644489447 2643221687 Bacteria 6500351
2126 2644516043 2643221692 Bacteria 7282860
2127 2644633411 2643221714 Bacteria 9015452
2128 2644636251 2643221715 Bacteria 6671032
2129 2731908880 2731639228 Bacteria 4187555
2130 2738667089 2738541264 Bacteria 5935393
2131 2738708748 2738541274 Bacteria 6909446
2132 2738891350 2738541308 Bacteria 7020677
2133 2739145933 2738541356 Bacteria 5935017
2134 2739205425 2738543005 Bacteria 5278128
2135 2744957629 2744054611 Bacteria 5611514
2136 2753037133 2751185725 Bacteria 5740550
2137 2753325002 2751185792 Bacteria 5739090
2138 2768643405 2767802112 Bacteria 6465194
2139 2784589629 2784132148 Bacteria 8627943
2140 2785341974 2784746763 Bacteria 9783172
2141 2785370673 2784746768 Bacteria 10036182
2142 2786671856 2786546132 Bacteria 10419719
2143 2793980307 2791355406 Bacteria 11364898
2144 2799186689 2799112218 Bacteria 4315149
2145 2808843229 2808606359 Bacteria 9866990
2146 2808912818 2808606375 Bacteria 9466072
2147 2808921578 2808606375 Bacteria 9466072
2148 2809233309 2808606448 Bacteria 8656184
2149 2811845196 2808606982 Bacteria 7791042
2150 2812356819 2811994879 Bacteria 9313447
2151 2812479534 2811994917 Bacteria 7761064
2152 2819695309 2818991463 Bacteria 7948711
2153 2842138795 2842134933 Bacteria 5847019
2154 2842891061 2842888712 Bacteria 4279094
2155 2852640433 2852635781 Bacteria 8251373
2156 2862181685 2862178590 Bacteria 8583590
2157 2862286758 2862281513 Bacteria 9621493
2158 2862292195 2862290372 Bacteria 7471434
2159 2862387714 2862382967 Bacteria 10317375
2160 2862514387 2862507626 Bacteria 9425308
2161 2862578278 2862574272 Bacteria 10567477
2162 2863411665 2863404153 Bacteria 9672205
2163 2867434711 2867428634 Bacteria 9590268
2164 2867479144 2867475112 Bacteria 6909112
2165 2868090607 2868088558 Bacteria 7609351
2166 2873154776 2873151551 Bacteria 8625867
2167 2877679915 2877676314 Bacteria 9512378
2168 2902798010 2902792274 Bacteria 7270173
2169 2902799094 2902792274 Bacteria 7270173
2170 2902804392 2902799365 Bacteria 5419524
2171 2902812375 2902810491 Bacteria 6794147
2172 2902815770 2902810491 Bacteria 6794147
2173 2902842212 2902837492 Bacteria 6697721
2174 2904539130 2904535858 Bacteria 6308016
2175 2912718561 2912715099 Bacteria 9460473
2176 2912762042 2912757875 Bacteria 7940295
2177 2918505723 2918501144 Bacteria 8668083
2178 2919475444 2919468124 Bacteria 9133025
2179 2922555798 2922554459 Bacteria 6683962
2180 2928144860 2928142448 Bacteria 5288925
2181 2929214382 2929212328 Bacteria 7708288
2182 2935394868 2935390628 Bacteria 7043367
2183 2939586269 2939582691 Bacteria 7088898
2184 2946048700 2946045630 Bacteria 8527308
2185 2946069053 2946064051 Bacteria 8957905
2186 2946077000 2946072368 Bacteria 8999607
2187 2947227885 2947224130 Bacteria 9938529
2188 2954003032 2954002825 Bacteria 9173742
2189 2954384870 2954380949 Bacteria 10050426
2190 2954678133 2954673503 Bacteria 9685905
2191 2954686025 2954682443 Bacteria 9862841
2192 2954695683 2954691527 Bacteria 10720516
2193 2954710876 2954701450 Bacteria 10834262
2194 2954715099 2954711539 Bacteria 10867210
2195 2954725041 2954721474 Bacteria 10456478
2196 2954736777 2954731030 Bacteria 10243860
2197 2954743974 2954740390 Bacteria 10229294
2198 2954755624 2954749733 Bacteria 10366972
2199 2954762914 2954759201 Bacteria 9358192
2200 2966601543 2966598605 Bacteria 7676064
2201 2974319892 2974315732 Bacteria 4602776
2202 2984523764 2984523437 Bacteria 4508481
2203 2990045362 2990044586 Bacteria 6603797
2204 2990062205 2990059506 Bacteria 9321252
2205 2995468636 2995463766 Bacteria 8577691
2206 2997458156 2997451912 Bacteria 8492419
2207 2997606378 2997600082 Bacteria 9896405
2208 3001890491 3001889506 Bacteria 2975194
2209 3006326300 3006321560 Bacteria 8247479
2210 3006393465 3006393351 Bacteria 6615579
2211 3006492632 3006486233 Bacteria 8157040
2212 3006499677 3006493962 Bacteria 8825450
2213 8008566438 8008558824 Bacteria 10610750
2214 8008577889 8008574985 Bacteria 7815457
2215 8023626424 8023623736 Bacteria 8593882
2216 8025484836 8025478263 Bacteria 8209203
2217 8025534831 8025530807 Bacteria 8495698
2218 8033689151 8033684223 Bacteria 6906479
2219 8047719891 8047710418 Bacteria 11023148
2220 8047897061 8047893842 Bacteria 11723082
2221 8048134681 8048127548 Bacteria 11053136
2222 8048361891 8048356638 Bacteria 11044339
2223 8048374045 8048369669 Bacteria 11666822
2224 8048384181 8048379754 Bacteria 11877923
2225 8048410734 8048406513 Bacteria 8936924
2226 8053948525 8053945823 Bacteria 8962862
2227 8054160729 8054160619 Bacteria 7783213
2228 8056448877 8056447290 Bacteria 7680491
2229 8056667953 8056667051 Bacteria 6953971
2230 8056833872 8056829672 Bacteria 9045328
2231 Ga0501081_1435834
2232 LJNas_1001325
2233 JGI24739J22299_10017756
2234 JGI24737J22298_10020298
2235 JGI24743J22301_10007900
2236 JGI24750J21931_1001262
2237 JGI24750J21931_1025756
2238 JGI24745J21846_1004116
2239 JGI24748J21848_1003666
2240 JGI24738J21930_10004342
2241 JGI24749J21850_1003699
2242 JGI24744J21845_10000088
2243 JGI24744J21845_10002005
2244 JGI24744J21845_10002298
2245 JGI24034J26672_10035846
2246 JGI24742J22300_10000958
2247 JGI24742J22300_10028088
2248 JGI24751J29686_10037569
2249 JGI25153J46596_10083828
2250 rootH1_10017056
2251 rootH2_10032831
2252 rootL2_10002375
2253 rootH1_10061150
2254 JGI25160J50197_1015644
2255 JGI25160J50197_1022123
2256 JGI25160J50197_1050490
2257 JGI25160J50197_1096305
2258 Ga0006562J51391_1101924
2259 Ga0055540_1000003
2260 Ga0055540_1003721
2261 Ga0055540_1005958
2262 Ga0055540_1006423
2263 Ga0055540_1012991
2264 Ga0055540_1060386
2265 Ga0070658_10000319
2266 Ga0070658_10168973
2267 Ga0070658_11043273
2268 Ga0070676_10005021
2269 Ga0070683_100255133
2270 Ga0070683_100544285
2271 Ga0070683_102219522
2272 Ga0070690_100066359
2273 Ga0070690_100514413
2274 Ga0070670_100341739
2275 Ga0070670_101463295
2276 Ga0070677_10131461
2277 Ga0068869_100078270
2278 Ga0068869_102158052
2279 Ga0070666_10114765
2280 Ga0070666_10206198
2281 Ga0070666_10589613
2282 Ga0070680_100000061
2283 Ga0070680_100238798
2284 Ga0070680_101437996
2285 Ga0070682_100071052
2286 Ga0070682_100286998
2287 Ga0070682_100841066
2288 Ga0070682_101277581
2289 Ga0070682_101512840
2290 Ga0068868_100001480
2291 Ga0070660_100110954
2292 Ga0070660_100361827
2293 Ga0070689_100020932
2294 Ga0070689_100706067
2295 Ga0070691_10002982
2296 Ga0070691_11041401
2297 Ga0070687_100186584
2298 Ga0070687_100198977
2299 Ga0070661_100990318
2300 Ga0070692_10095309
2301 Ga0070692_10401231
2302 Ga0070668_100001192
2303 Ga0070668_100006438
2304 Ga0070668_100068621
2305 Ga0070668_101492986
2306 Ga0070669_100004569
2307 Ga0070669_100099405
2308 Ga0070675_101430454
2309 Ga0070671_100047031
2310 Ga0070674_100000187
2311 Ga0070674_100025474
2312 Ga0070674_100300932
2313 Ga0070674_100495203
2314 Ga0070673_100102120
2315 Ga0070688_101080451
2316 Ga0070659_100018793
2317 Ga0070659_100026599
2318 Ga0070659_100436784
2319 Ga0070667_100000056
2320 Ga0070667_100000854
2321 Ga0070667_100003985
2322 Ga0070667_100025316
2323 Ga0070667_100221674
2324 Ga0070667_100591567
2325 Ga0070703_10053183
2326 Ga0070709_10032314
2327 Ga0070709_10130230
2328 Ga0070714_100016403
2329 Ga0070714_100065097
2330 Ga0070714_100252503
2331 Ga0070714_100348335
2332 Ga0070714_100451848
2333 Ga0070714_100863902
2334 Ga0070714_101432416
2335 Ga0070714_101507705
2336 Ga0070713_100015655
2337 Ga0070713_100080518
2338 Ga0070713_100215794
2339 Ga0070713_100265185
2340 Ga0070713_100361968
2341 Ga0070713_100629163
2342 Ga0070710_10000277
2343 Ga0070710_10044347
2344 Ga0070710_10168660
2345 Ga0070710_10370702
2346 Ga0070701_10034333
2347 Ga0070711_100000493
2348 Ga0070711_100029466
2349 Ga0070711_100253283
2350 Ga0070711_100885304
2351 Ga0070705_100200449
2352 Ga0070705_100263554
2353 Ga0070700_100289210
2354 Ga0070694_100008280
2355 Ga0070694_100118065
2356 Ga0070708_100297322
2357 Ga0070663_100042981
2358 Ga0070663_100362811
2359 Ga0070663_100429842
2360 Ga0070663_101210567
2361 Ga0070663_101289937
2362 Ga0070678_100000280
2363 Ga0070678_100247043
2364 Ga0070678_100300022
2365 Ga0070678_100982985
2366 Ga0070678_101874325
2367 Ga0070662_100001491
2368 Ga0070662_101359820
2369 Ga0070681_10001025
2370 Ga0070681_10754339
2371 Ga0070681_11539087
2372 Ga0068867_100002048
2373 Ga0070685_10119192
2374 Ga0070685_10148015
2375 Ga0070685_10838994
2376 Ga0070679_100001551
2377 Ga0070684_100169163
2378 Ga0070697_100880770
2379 Ga0068853_100001367
2380 Ga0068853_100084260
2381 Ga0068853_100142792
2382 Ga0068853_100570000
2383 Ga0068853_101643301
2384 Ga0070672_100249143
2385 Ga0070672_100569437
2386 Ga0070695_100008891
2387 Ga0070695_100267175
2388 Ga0070696_100002977
2389 Ga0070696_100854901
2390 Ga0070693_100021947
2391 Ga0070693_100098763
2392 Ga0070693_100531666
2393 Ga0070693_101023388
2394 Ga0070665_100011296
2395 Ga0070665_100039320
2396 Ga0070665_100083036
2397 Ga0070665_100230350
2398 Ga0070665_100316153
2399 Ga0070665_100825882
2400 Ga0070665_101327790
2401 Ga0070665_102564412
2402 Ga0070704_100001052
2403 Ga0070704_100019306
2404 Ga0070704_100819551
2405 Ga0068855_100244028
2406 Ga0068855_100417642
2407 Ga0068855_100590408
2408 Ga0068855_100596191
2409 Ga0068855_100745022
2410 Ga0068855_101397090
2411 Ga0068855_102602693
2412 Ga0070664_101013283
2413 Ga0068857_100597961
2414 Ga0068854_100000458
2415 Ga0068854_100020918
2416 Ga0068854_100252151
2417 Ga0068856_100203470
2418 Ga0070702_100000308
2419 Ga0070702_100148986
2420 Ga0070702_100956426
2421 Ga0068852_100063059
2422 Ga0068852_100154194
2423 Ga0068852_101270523
2424 Ga0068852_101980594
2425 Ga0068859_100000751
2426 Ga0068859_100039348
2427 Ga0068859_100206485
2428 Ga0068864_100132511
2429 Ga0068864_100468211
2430 Ga0068864_101863702
2431 Ga0068864_102197808
2432 Ga0068866_10000187
2433 Ga0068866_10029932
2434 Ga0068866_10533620
2435 Ga0068866_11223904
2436 Ga0068861_100000195
2437 Ga0068861_100225745
2438 Ga0068861_101604859
2439 Ga0068851_10393066
2440 Ga0068870_10747542
2441 Ga0068863_100018953
2442 Ga0068863_100081670
2443 Ga0068863_100128462
2444 Ga0068863_100207411
2445 Ga0068863_101773287
2446 Ga0068858_100006827
2447 Ga0068858_100015158
2448 Ga0068858_100106856
2449 Ga0068858_100269146
2450 Ga0068858_100447887
2451 Ga0068858_100999124
2452 Ga0068858_101387952
2453 Ga0068858_102180194
2454 Ga0068860_100000092
2455 Ga0068860_100001932
2456 Ga0068860_100157374
2457 Ga0068862_100000035
2458 Ga0068862_100006561
2459 Ga0068862_100074824
2460 Ga0068862_101578887
2461 Ga0081455_10024172
2462 Ga0081455_10031920
2463 Ga0081455_10034690
2464 Ga0081455_10091239
2465 Ga0081455_10192807
2466 Ga0081455_10273175
2467 Ga0081538_10136302
2468 Ga0081540_1047146
2469 Ga0081539_10045318
2470 Ga0081539_10050996
2471 Ga0070717_10212312
2472 Ga0070717_10384114
2473 Ga0075365_10004705
2474 Ga0075365_10019404
2475 Ga0075365_10024575
2476 Ga0075365_10082992
2477 Ga0075365_10197265
2478 Ga0075365_10292279
2479 Ga0075365_10470498
2480 Ga0075365_10635542
2481 Ga0075365_10963222
2482 Ga0075365_11198904
2483 Ga0075368_10007123
2484 Ga0075368_10251780
2485 Ga0075368_10293280
2486 Ga0075368_10480886
2487 Ga0075363_100000383
2488 Ga0075363_100000613
2489 Ga0075363_100002816
2490 Ga0075363_100012126
2491 Ga0075363_100026851
2492 Ga0075363_100032534
2493 Ga0075363_100076456
2494 Ga0075363_100099522
2495 Ga0075363_100135422
2496 Ga0075363_100190303
2497 Ga0075363_100213308
2498 Ga0075363_100274408
2499 Ga0075363_100279189
2500 Ga0075363_100292455
2501 Ga0075363_100299583
2502 Ga0075363_100328371
2503 Ga0075363_100472321
2504 Ga0075364_10003028
2505 Ga0075364_10035907
2506 Ga0075364_10043671
2507 Ga0075364_10044294
2508 Ga0075364_10066923
2509 Ga0075364_10092827
2510 Ga0075364_10132230
2511 Ga0075364_10134790
2512 Ga0075364_10143695
2513 Ga0075364_10199940
2514 Ga0075364_10266749
2515 Ga0075364_10433398
2516 Ga0075364_10626454
2517 Ga0075364_10628202
2518 Ga0075364_10682480
2519 Ga0075364_10869353
2520 Ga0075364_10946726
2521 Ga0075364_11009446
2522 Ga0070715_10053904
2523 Ga0070715_10071980
2524 Ga0070716_100024573
2525 Ga0070716_100639733
2526 Ga0070712_100001061
2527 Ga0070712_100005282
2528 Ga0075362_10015901
2529 Ga0075362_10072661
2530 Ga0075362_10083764
2531 Ga0075362_10126789
2532 Ga0075362_10289765
2533 Ga0075362_10352118
2534 Ga0075367_10002885
2535 Ga0075367_10042461
2536 Ga0075367_10186612
2537 Ga0075367_10233147
2538 Ga0075367_10260938
2539 Ga0075367_10399203
2540 Ga0075367_10546065
2541 Ga0075367_10559833
2542 Ga0075369_10001505
2543 Ga0075369_10018446
2544 Ga0075369_10021403
2545 Ga0075369_10026182
2546 Ga0075369_10061574
2547 Ga0075369_10105102
2548 Ga0075369_10118627
2549 Ga0075369_10154077
2550 Ga0075369_10200650
2551 Ga0075369_10271899
2552 Ga0097621_100132479
2553 Ga0097621_100392623
2554 Ga0097621_100494859
2555 Ga0075370_10001408
2556 Ga0075370_10001448
2557 Ga0075370_10008954
2558 Ga0075370_10097924
2559 Ga0075370_10104498
2560 Ga0075370_10186332
2561 Ga0075370_10257482
2562 Ga0075370_10398205
2563 Ga0075370_10620621
2564 Ga0075370_10648252
2565 Ga0075370_10664947
2566 Ga0068871_100174821
2567 Ga0075428_100015023
2568 Ga0075430_100259087
2569 Ga0075431_101575367
2570 Ga0075433_10984058
2571 Ga0075433_11130050
2572 Ga0075433_11760735
2573 Ga0075429_100558479
2574 Ga0068865_100001276
2575 Ga0068865_100032758
2576 Ga0068865_100630967
2577 Ga0097620_100000751
2578 Ga0097620_100039348
2579 Ga0097620_100206491
2580 Ga0099826_10257458
2581 Ga0075435_100931273
2582 Ga0099794_10681931
2583 Ga0099795_10038450
2584 Ga0105251_10120384
2585 Ga0105244_10181460
2586 Ga0105250_10016382
2587 Ga0105250_10034275
2588 Ga0105250_10170611
2589 Ga0105240_10619898
2590 Ga0105240_10956301
2591 Ga0111539_10409140
2592 Ga0111539_10828184
2593 Ga0111539_11548544
2594 Ga0105245_10000870
2595 Ga0105245_10152899
2596 Ga0105245_10166509
2597 Ga0105245_10370949
2598 Ga0105245_10476371
2599 Ga0105245_10881421
2600 Ga0105245_11742491
2601 Ga0105247_10000062
2602 Ga0105247_10000637
2603 Ga0105247_10021071
2604 Ga0105247_10075913
2605 Ga0105247_10140167
2606 Ga0105247_10250979
2607 Ga0105247_10761866
2608 Ga0114129_10093305
2609 Ga0114129_10148224
2610 Ga0114129_10265638
2611 Ga0105243_10001020
2612 Ga0105243_10074007
2613 Ga0105243_10190530
2614 Ga0105243_10283666
2615 Ga0105243_10509827
2616 Ga0105243_11285122
2617 Ga0105243_11528518
2618 Ga0105243_12183366
2619 Ga0105241_10062601
2620 Ga0105241_10183888
2621 Ga0105241_10806709
2622 Ga0105241_11212921
2623 Ga0105241_12287648
2624 Ga0105242_10000650
2625 Ga0105242_10130986
2626 Ga0105242_11181071
2627 Ga0105242_11542909
2628 Ga0105242_12699092
2629 Ga0105242_12935617
2630 Ga0105248_10000036
2631 Ga0105248_10003895
2632 Ga0105248_10014411
2633 Ga0105248_10047963
2634 Ga0105248_10115569
2635 Ga0105248_10151489
2636 Ga0105248_10785375
2637 Ga0105248_10838239
2638 Ga0105248_12344186
2639 Ga0105237_10000467
2640 Ga0105237_10034141
2641 Ga0105237_10052349
2642 Ga0105237_10209041
2643 Ga0105237_10350429
2644 Ga0105237_11745850
2645 Ga0105237_11890974
2646 Ga0105238_10088868
2647 Ga0105238_10131894
2648 Ga0105238_10152187
2649 Ga0105238_10325317
2650 Ga0105238_10956875
2651 Ga0105238_12044567
2652 Ga0105238_12554437
2653 Ga0105238_12633302
2654 Ga0105249_10000046
2655 Ga0105249_10001186
2656 Ga0105249_10005021
2657 Ga0105249_10734696
2658 Ga0105249_11016856
2659 Ga0105249_11037881
2660 Ga0105249_11389858
2661 Ga0105249_11852390
2662 Ga0099796_10045462
2663 Ga0105239_10003093
2664 Ga0105239_10028730
2665 Ga0105239_10061068
2666 Ga0105239_10241758
2667 Ga0105239_10403057
2668 Ga0105239_10594153
2669 Ga0105239_10893469
2670 Ga0105239_11093110
2671 Ga0105239_11896191
2672 Ga0105239_12608396
2673 Ga0105239_12861131
2674 Ga0105239_12978285
2675 Ga0105239_13365063
2676 Ga0105246_10034380
2677 Ga0105246_10063318
2678 Ga0105246_10232450
2679 Ga0105246_11238228
2680 Ga0105246_11800899
2681 Ga0157344_1019660
2682 Ga0157313_1021463
2683 Ga0157342_1079190
2684 Ga0157315_1005519
2685 Ga0157373_10926876
2686 Ga0157371_10124561
2687 Ga0157371_10309262
2688 Ga0157370_10300678
2689 Ga0157370_11343214
2690 Ga0157370_11388264
2691 Ga0157369_10051356
2692 Ga0157369_10110992
2693 Ga0157369_10498685
2694 Ga0157369_10748083
2695 Ga0157374_10032409
2696 Ga0157374_11664878
2697 Ga0157374_11809434
2698 Ga0157378_10004457
2699 Ga0157378_10395003
2700 Ga0163162_10001609
2701 Ga0163162_10035606
2702 Ga0163162_10412955
2703 Ga0163162_10415926
2704 Ga0163162_10471848
2705 Ga0163162_11569914
2706 Ga0163162_12048891
2707 Ga0157372_10004145
2708 Ga0157372_10219830
2709 Ga0157372_10298165
2710 Ga0157372_10323563
2711 Ga0157372_13131700
2712 Ga0157375_10000419
2713 Ga0157375_11361671
2714 Ga0157375_11459471
2715 Ga0157375_12957822
2716 Ga0163163_10039390
2717 Ga0163163_10177849
2718 Ga0163163_10564851
2719 Ga0163163_11018401
2720 Ga0163163_11527267
2721 Ga0163163_12221259
2722 Ga0157380_10001844
2723 Ga0157380_10433095
2724 Ga0182008_10002958
2725 Ga0157377_10026136
2726 Ga0157377_11268421
2727 Ga0157379_10029772
2728 Ga0157379_10132262
2729 Ga0157379_10214503
2730 Ga0157379_10314622
2731 Ga0157379_11341361
2732 Ga0157376_10037960
2733 Ga0157376_10057401
2734 Ga0157376_10107119
2735 Ga0157376_11853195
2736 Ga0157376_12606991
2737 Ga0182006_1084780
2738 Ga0182005_1049382
2739 Ga0183367_1002
2740 Ga0163161_10006906
2741 Ga0163161_10172118
2742 Ga0163161_10418449
2743 Ga0163161_10600751
2744 Ga0163161_10636131
2745 Ga0197907_10131781
2746 Ga0197907_10233448
2747 Ga0206356_11143445
2748 Ga0206351_10184192
2749 Ga0206352_10845590
2750 Ga0206350_11195567
2751 Ga0206354_10960052
2752 Ga0206353_11128098
2753 Ga0206353_11287408
2754 Ga0213872_10306243
2755 Ga0213876_10009953
2756 Ga0213876_10011067
2757 Ga0213876_10023670
2758 Ga0213876_10572096
2759 Ga0213875_10032905
2760 Ga0213875_10059850
2761 Ga0213875_10273228
2762 Ga0224712_10000526
2763 Ga0224712_10002344
2764 Ga0209025_1037599
2765 Ga0209758_1007953
2766 Ga0207426_1004664
2767 Ga0207426_1006367
2768 Ga0207426_1038691
2769 Ga0209051_1000011
2770 Ga0209051_1000620
2771 Ga0209051_1000933
2772 Ga0209051_1001428
2773 Ga0209051_1033472
2774 Ga0209051_1039069
2775 Ga0209051_1095550
2776 Ga0207656_10092487
2777 Ga0207656_10115433
2778 Ga0207696_1123242
2779 Ga0207653_10045515
2780 Ga0207682_10340878
2781 Ga0207692_10001940
2782 Ga0207692_10136975
2783 Ga0207692_10302969
2784 Ga0207692_10380415
2785 Ga0207642_10000312
2786 Ga0207642_10056787
2787 Ga0207710_10000060
2788 Ga0207710_10000890
2789 Ga0207710_10130368
2790 Ga0207688_10000177
2791 Ga0207688_10000841
2792 Ga0207680_10060009
2793 Ga0207680_10107266
2794 Ga0207680_10235641
2795 Ga0207680_10600805
2796 Ga0207647_10014202
2797 Ga0207647_10028202
2798 Ga0207685_10001135
2799 Ga0207685_10010029
2800 Ga0207699_10126702
2801 Ga0207699_10282730
2802 Ga0207645_10042119
2803 Ga0207643_10540021
2804 Ga0207643_10579470
2805 Ga0207705_10002093
2806 Ga0207705_10486828
2807 Ga0207654_10071715
2808 Ga0207654_10288853
2809 Ga0207707_10000277
2810 Ga0207707_10167030
2811 Ga0207707_11302555
2812 Ga0207671_10009964
2813 Ga0207671_10018152
2814 Ga0207671_10027045
2815 Ga0207671_10151176
2816 Ga0207671_10821232
2817 Ga0207671_11168870
2818 Ga0207693_10000339
2819 Ga0207693_10000602
2820 Ga0207693_10217813
2821 Ga0207663_10000907
2822 Ga0207663_10122657
2823 Ga0207663_11001168
2824 Ga0207660_10000115
2825 Ga0207660_10111634
2826 Ga0207660_10521538
2827 Ga0207660_10831956
2828 Ga0207660_11033446
2829 Ga0207662_10075302
2830 Ga0207662_11040064
2831 Ga0207657_10095827
2832 Ga0207657_10164966
2833 Ga0207649_11409531
2834 Ga0207649_11674196
2835 Ga0207652_10000333
2836 Ga0207652_10547270
2837 Ga0207646_10636104
2838 Ga0207646_10832617
2839 Ga0207681_10000788
2840 Ga0207681_10086689
2841 Ga0207694_10048982
2842 Ga0207694_10183839
2843 Ga0207694_10632582
2844 Ga0207694_11119059
2845 Ga0207650_10129186
2846 Ga0207659_10510272
2847 Ga0207659_10968259
2848 Ga0207659_11137339
2849 Ga0207687_10001983
2850 Ga0207687_10102936
2851 Ga0207687_10302244
2852 Ga0207687_10940733
2853 Ga0207700_10070676
2854 Ga0207700_10181688
2855 Ga0207700_10206533
2856 Ga0207700_10271142
2857 Ga0207700_10298691
2858 Ga0207700_10461851
2859 Ga0207664_10068406
2860 Ga0207664_10324477
2861 Ga0207664_10569422
2862 Ga0207664_10677795
2863 Ga0207664_11686089
2864 Ga0207644_10004647
2865 Ga0207644_10020065
2866 Ga0207644_10207081
2867 Ga0207690_10024212
2868 Ga0207690_10061631
2869 Ga0207690_10851592
2870 Ga0207706_10002589
2871 Ga0207686_10001637
2872 Ga0207686_10750390
2873 Ga0207686_10789993
2874 Ga0207709_10001393
2875 Ga0207709_10074674
2876 Ga0207709_10183433
2877 Ga0207709_10222341
2878 Ga0207709_10326906
2879 Ga0207709_11668838
2880 Ga0207670_10012017
2881 Ga0207670_10739642
2882 Ga0207670_11054097
2883 Ga0207669_10000205
2884 Ga0207669_10211685
2885 Ga0207669_10655942
2886 Ga0207669_10744014
2887 Ga0207669_11018226
2888 Ga0207669_11532880
2889 Ga0207669_11791100
2890 Ga0207704_10000618
2891 Ga0207704_10209532
2892 Ga0207704_10361902
2893 Ga0207704_11617637
2894 Ga0207665_10008088
2895 Ga0207665_10011512
2896 Ga0207665_10142777
2897 Ga0207691_10548394
2898 Ga0207711_10000073
2899 Ga0207711_10061372
2900 Ga0207711_10157899
2901 Ga0207711_10536245
2902 Ga0207711_10731525
2903 Ga0207711_11955454
2904 Ga0207689_10133901
2905 Ga0207689_11283094
2906 Ga0207661_10086949
2907 Ga0207661_10290851
2908 Ga0207661_10627582
2909 Ga0207661_10735585
2910 Ga0207661_10932794
2911 Ga0207661_11837205
2912 Ga0207679_11528043
2913 Ga0207667_10183276
2914 Ga0207667_10328404
2915 Ga0207667_10705552
2916 Ga0207667_11257202
2917 Ga0207651_10223155
2918 Ga0207651_10270943
2919 Ga0207712_10000042
2920 Ga0207712_10072184
2921 Ga0207712_10754948
2922 Ga0207712_12019647
2923 Ga0207668_10006306
2924 Ga0207668_10013064
2925 Ga0207668_10048285
2926 Ga0207668_10753972
2927 Ga0207640_10003341
2928 Ga0207640_10131790
2929 Ga0207640_10477580
2930 Ga0207640_10671311
2931 Ga0207658_10000449
2932 Ga0207658_10000664
2933 Ga0207658_10003954
2934 Ga0207658_10004460
2935 Ga0207658_10069437
2936 Ga0207658_10451997
2937 Ga0207658_10852948
2938 Ga0207658_11072789
2939 Ga0207658_11902673
2940 Ga0207677_10016196
2941 Ga0207677_10257633
2942 Ga0207703_10002964
2943 Ga0207703_10059815
2944 Ga0207703_10063785
2945 Ga0207703_10065586
2946 Ga0207703_10151622
2947 Ga0207703_10414917
2948 Ga0207703_10731486
2949 Ga0207703_11092095
2950 Ga0207639_10038681
2951 Ga0207639_10379569
2952 Ga0207639_10793787
2953 Ga0207639_10973081
2954 Ga0207678_10007047
2955 Ga0207678_10118193
2956 Ga0207678_10122695
2957 Ga0207678_10795511
2958 Ga0207678_10930460
2959 Ga0207678_11078487
2960 Ga0207678_11382732
2961 Ga0207708_10003891
2962 Ga0207708_10041519
2963 Ga0207708_10738176
2964 Ga0207702_10903480
2965 Ga0207702_12014144
2966 Ga0207641_10001094
2967 Ga0207641_10015008
2968 Ga0207641_10027939
2969 Ga0207641_10070874
2970 Ga0207641_10094126
2971 Ga0207641_10468585
2972 Ga0207641_11917341
2973 Ga0207648_10000623
2974 Ga0207648_10047022
2975 Ga0207648_11638071
2976 Ga0207676_10017255
2977 Ga0207676_10203343
2978 Ga0207676_10343914
2979 Ga0207676_10985563
2980 Ga0207676_11040120
2981 Ga0207676_11369694
2982 Ga0207676_11741940
2983 Ga0207676_11947419
2984 Ga0207674_10296717
2985 Ga0207674_10500764
2986 Ga0207675_100001672
2987 Ga0207675_100533225
2988 Ga0207675_101185188
2989 Ga0207675_101475440
2990 Ga0207683_10000539
2991 Ga0207683_10017378
2992 Ga0207683_10105161
2993 Ga0207683_10383305
2994 Ga0207683_10495393
2995 Ga0207683_10507853
2996 Ga0207683_10717855
2997 Ga0207698_10047163
2998 Ga0207698_10102226
2999 Ga0207698_10678063
3000 Ga0209371_1029382
3001 Ga0209179_1045200
3002 Ga0209282_1241770
3003 Ga0209813_10018444
3004 Ga0209813_10142005
3005 Ga0207428_10336973
3006 Ga0207428_10532992
3007 Ga0207428_10570865
3008 Ga0268266_10007218
3009 Ga0268266_10012919
3010 Ga0268266_10020977
3011 Ga0268266_10102670
3012 Ga0268266_10156772
3013 Ga0268265_10000051
3014 Ga0268265_10003445
3015 Ga0268265_10076517
3016 Ga0268265_10493002
3017 Ga0268264_10000108
3018 Ga0268264_10009938
3019 Ga0268264_10197392
3020 Ga0268264_10774917
3021 Ga0307517_10004659
3022 Ga0307517_10036222
3023 Ga0307517_10265146
3024 Ga0307515_10001177
3025 Ga0307515_10083676
3026 Ga0307515_10346614
3027 Ga0268256_1023853
3028 Ga0307511_10028203
3029 Ga0307511_10062540
3030 Ga0307511_10132506
3031 Ga0307511_10235476
3032 Ga0307511_10263096
3033 Ga0307511_10276655
3034 Ga0307511_10309783
3035 Ga0307512_10037650
3036 Ga0307512_10064598
3037 Ga0307512_10182988
3038 Ga0314311_1190625
3039 Ga0316180_1107973
3040 Ga0316182_1311333
3041 Ga0265327_10000021
3042 Ga0265327_10000071
3043 Ga0265327_10000630
3044 Ga0265327_10021466
3045 Ga0307513_10032651
3046 Ga0307513_10033269
3047 Ga0307513_10119884
3048 Ga0307513_10511978
3049 Ga0307509_10169325
3050 Ga0307509_10206018
3051 Ga0307509_10338394
3052 Ga0307509_10441087
3053 Ga0307408_100304208
3054 Ga0307408_101344318
3055 Ga0307508_10001775
3056 Ga0307508_10005680
3057 Ga0307508_10020650
3058 Ga0307508_10063849
3059 Ga0307508_10075163
3060 Ga0307508_10117382
3061 Ga0307514_10036472
3062 Ga0307514_10119090
3063 Ga0307514_10190602
3064 Ga0316579_10047194
3065 Ga0316579_10445263
3066 Ga0316576_10069280
3067 Ga0316576_10557500
3068 Ga0316578_10007838
3069 Ga0316578_10054210
3070 Ga0316578_10155229
3071 Ga0316578_10695755
3072 Ga0307516_10007060
3073 Ga0307516_10023113
3074 Ga0307516_10048980
3075 Ga0307405_10106270
3076 Ga0307405_10763497
3077 Ga0307405_11497678
3078 Ga0316577_10196594
3079 Ga0316577_10698771
3080 Ga0307413_10179235
3081 Ga0307413_10760075
3082 Ga0307413_10963802
3083 Ga0307518_10156737
3084 Ga0307410_10005427
3085 Ga0307410_10050900
3086 Ga0307410_10097846
3087 Ga0307410_10154260
3088 Ga0307410_11219754
3089 Ga0307406_10986100
3090 Ga0307406_11413939
3091 Ga0307407_10015605
3092 Ga0307407_11702345
3093 Ga0307412_10273546
3094 Ga0307412_11572325
3095 Ga0307409_100037553
3096 Ga0307409_100205427
3097 Ga0307409_100326649
3098 Ga0307409_100387209
3099 Ga0307409_100641406
3100 Ga0307409_100815775
3101 Ga0307409_102087345
3102 Ga0307409_102616151
3103 Ga0307416_100056416
3104 Ga0307416_100107718
3105 Ga0307416_100436088
3106 Ga0307416_101380328
3107 Ga0307416_101534811
3108 Ga0307416_103859158
3109 Ga0307411_10140216
3110 Ga0307411_10196819
3111 Ga0307411_10561258
3112 Ga0307415_100728871
3113 Ga0307415_100940326
3114 Ga0307415_101508448
3115 Ga0316583_10012794
3116 Ga0316585_10026058
3117 Ga0316585_10140083
3118 Ga0316580_10179792
3119 Ga0316580_10284486
3120 Ga0316593_10251358
3121 Ga0307507_10000732
3122 Ga0307507_10642080
3123 Ga0307510_10035723
3124 Ga0307510_10088739
3125 Ga0307510_10284835
3126 Ga0307510_10416505
3127 Ga0307510_10651932
3128 Ga0316596_1054270
3129 Ga0373930_0210188
3130 Ga0373938_0069430
3131 Ga0373928_0105733
3132 Ga0373929_0151968
3133 Ga0373940_0078051
3134 Ga0373951_0066451
3135 Ga0373932_0036929
3136 Ga0373939_0420583
3137 Ga0373960_0036799
3138 Ga0373942_0032327
3139 Ga0373942_0078542
3140 Ga0373961_0094945
3141 Ga0373962_0012789
3142 Ga0373962_0013224
3143 Ga0316574_0078180
3144 Ga0316574_0122232
3145 Ga0373924_0452019
3146 Ga0373931_0011218
3147 Ga0316582_0204345
3148 Ga0316582_0430407
3149 Ga0316584_0053682
3150 Ga0316584_0086906
3151 Ga0316584_0421280
3152 Ga0395899_0013414
3153 Ga0395899_0748419
3154 Ga0395900_0075741
3155 Ga0395900_0427612
3156 Ga0395898_0006692
3157 Ga0395898_0017702
3158 Ga0395905_0069865
3159 Ga0395905_0528676
3160 Ga0395905_0686939
3161 Ga0316581_0167237
3162 Ga0436364_0195317
3163 Ga0436364_0229870
3164 Ga0436364_1150617
3165 Ga0436364_1291536
3166 Ga0395901_0100975
3167 Ga0395901_0550223
3168 Ga0436365_0678211
3169 Ga0436365_0939033
3170 Ga0436365_0941882
3171 Ga0436365_1035060
3172 Ga0436365_1714810
3173 Ga0436365_1908396
3174 Ga0436360_0804941
3175 Ga0436361_0716923
3176 Ga0436361_1194425
3177 Ga0436363_0444811
3178 Ga0436363_0754104
3179 Ga0436363_1331240
3180 Ga0436363_1709932
3181 Ga0436362_0757592
3182 Ga0436362_1212714
3183 Ga0439439_0009171
3184 Ga0439439_0047088
3185 Ga0439461_0013378
3186 Ga0439461_0014671
3187 Ga0439461_0024659
3188 Ga0439466_0003274
3189 Ga0439466_0008207
3190 Ga0439466_0013164
3191 Ga0439466_0035103
3192 Ga0439465_0011614
3193 Ga0439465_0013051
3194 Ga0439465_0034846
3195 Ga0439465_0131683
3196 Ga0439465_0336671
3197 Ga0451787_711011
3198 Ga0451789_0165262
3199 Ga0451789_0361298
3200 Ga0451789_0982272
3201 Ga0451791_0176299
3202 Ga0451791_0923786
3203 Ga0451793_0050578
3204 Ga0451793_0165491
3205 Ga0451793_0382258
3206 Ga0451797_0462824
3207 Ga0451797_0777865
3208 Ga0451798_1003370
3209 Ga0451800_0949963
3210 Ga0451802_0290968
3211 Ga0451802_1000802
3212 Ga0451806_545077
3213 Ga0451804_0768388
3214 Ga0451807_1186087
3215 Ga0451807_1334898
3216 Ga0451807_2088134
3217 Ga0451833_0440069
3218 Ga0451835_0852016
3219 Ga0451837_0509056
3220 Ga0451839_0168767
3221 Ga0451841_0295423
3222 Ga0451841_1253551
3223 Ga0451845_0166486
3224 Ga0451851_1033401
3225 Ga0451843_0901391
3226 Ga0451843_1680136
3227 Ga0451853_0050097
3228 Ga0451853_0425702
3229 Ga0451853_0450169
3230 Ga0451853_1037975
3231 Ga0451853_2284613
3232 Ga0451853_3283147
3233 Ga0451853_3835888
3234 Ga0451853_3894526
3235 Ga0439431_0007821
3236 Ga0439431_0100112
3237 Ga0439433_0008537
3238 Ga0439433_0014215
3239 Ga0439442_016793
3240 Ga0439442_024566
3241 Ga0439445_0001826
3242 Ga0439445_0101398
3243 Ga0439445_0135614
3244 Ga0439445_0147093
3245 Ga0439445_0262242
3246 Ga0439448_0004693
3247 Ga0439448_0130866
3248 Ga0439448_0175236
3249 Ga0439448_0234069
3250 Ga0439449_0069372
3251 Ga0439450_069576
3252 Ga0439454_050955
3253 Ga0439455_0075109
3254 Ga0439455_0197971
3255 Ga0439457_000455
3256 Ga0439457_000479
3257 Ga0439457_044746
3258 Ga0439462_0024184
3259 Ga0439463_161594
3260 Ga0450890_011941
3261 Ga0450894_000142
3262 Ga0450895_001889
3263 Ga0450898_023027
3264 Ga0450898_034090
3265 Ga0450900_015664
3266 Ga0450903_000121
3267 Ga0450906_002225
3268 Ga0439458_0001134
3269 Ga0439458_0025509
3270 Ga0450908_070131
3271 Ga0439434_0010812
3272 Ga0439434_0016765
3273 Ga0439434_0018207
3274 Ga0439435_0023314
3275 Ga0439435_0290320
3276 Ga0439459_0003093
3277 Ga0450901_024223
3278 Ga0451577_0101787
3279 Ga0439440_0260273
3280 Ga0466969_0000470
3281 Ga0466969_0005382
3282 Ga0466969_0009133
3283 Ga0466969_0020850
3284 Ga0466969_0034108
3285 Ga0466969_0056244
3286 Ga0466969_0063027
3287 Ga0466969_0106363
3288 Ga0466969_0345685
3289 Ga0466972_0005853
3290 Ga0466972_0036904
3291 Ga0466972_0038891
3292 Ga0466972_0095647
3293 Ga0466972_0119432
3294 Ga0466972_0120005
3295 Ga0466972_0132419
3296 Ga0466972_0152676
3297 Ga0466972_0246199
3298 Ga0466972_0341192
3299 Ga0466965_0005281
3300 Ga0466965_0008504
3301 Ga0466965_0023201
3302 Ga0466965_0023923
3303 Ga0466965_0065885
3304 Ga0466965_0077985
3305 Ga0466965_0112919
3306 Ga0466965_0291718
3307 Ga0466965_0561309
3308 Ga0466966_0002225
3309 Ga0466966_0002809
3310 Ga0466966_0002940
3311 Ga0466966_0003767
3312 Ga0466966_0007557
3313 Ga0466966_0010373
3314 Ga0466966_0056388
3315 Ga0466966_0074389
3316 Ga0466966_0092900
3317 Ga0466966_0653277
3318 Ga0466961_0002350
3319 Ga0466961_0004001
3320 Ga0466961_0006257
3321 Ga0466961_0008642
3322 Ga0466961_0020414
3323 Ga0466961_0032599
3324 Ga0466961_0136461
3325 Ga0466961_0162770
3326 Ga0466961_0259254
3327 Ga0466961_0385157
3328 Ga0466961_0746316
3329 Ga0466961_0917618
3330 Ga0466961_0926254
3331 Ga0466963_0000656
3332 Ga0466963_0002324
3333 Ga0466963_0062229
3334 Ga0466963_0097726
3335 Ga0466963_0117681
3336 Ga0466963_0215321
3337 Ga0466963_0286500
3338 Ga0466963_0375967
3339 Ga0466963_0821591
3340 Ga0466964_0065505
3341 Ga0466964_0120091
3342 Ga0466964_0139210
3343 Ga0466964_0658092
3344 Ga0466971_0000161
3345 Ga0466971_0009498
3346 Ga0466971_0010470
3347 Ga0466971_0037329
3348 Ga0466971_0038008
3349 Ga0466971_0104911
3350 Ga0466971_0194357
3351 Ga0466971_0204873
3352 Ga0466971_0245318
3353 Ga0466968_0003026
3354 Ga0466968_0004670
3355 Ga0466968_0017639
3356 Ga0466968_0078172
3357 Ga0466968_0087905
3358 Ga0466968_0133985
3359 Ga0466968_0204497
3360 Ga0466970_0002119
3361 Ga0466970_0004779
3362 Ga0466970_0008021
3363 Ga0466970_0010155
3364 Ga0466970_0101681
3365 Ga0466970_0102256
3366 Ga0466970_0293933
3367 Ga0466970_0629606
3368 Ga0466970_0897168
3369 Ga0466957_0001267
3370 Ga0466957_0006730
3371 Ga0466957_0019108
3372 Ga0466957_0023478
3373 Ga0466957_0071734
3374 Ga0466957_0087858
3375 Ga0466957_0144044
3376 Ga0466957_0164351
3377 Ga0466957_0337919
3378 Ga0466957_0458162
3379 Ga0466957_0653684
3380 Ga0466957_0721896
3381 Ga0466960_0000046
3382 Ga0466960_0001009
3383 Ga0466960_0002661
3384 Ga0466960_0004371
3385 Ga0466960_0051070
3386 Ga0466960_0178961
3387 Ga0466960_0585153
3388 Ga0466959_0001597
3389 Ga0466959_0002075
3390 Ga0466959_0005630
3391 Ga0466959_0019524
3392 Ga0466959_0026773
3393 Ga0466959_0027848
3394 Ga0466959_0045345
3395 Ga0466959_0050561
3396 Ga0466959_0064953
3397 Ga0466959_0116305
3398 Ga0466959_0426793
3399 Ga0466958_0008122
3400 Ga0466958_0033877
3401 Ga0466958_0210873
3402 Ga0466958_0588526
3403 Ga0466958_0675144
3404 Ga0466958_0823610
3405 Ga0466958_0984515
3406 Ga0466967_0000098
3407 Ga0466967_0001175
3408 Ga0466967_0004167
3409 Ga0466967_0013920
3410 Ga0466967_0015885
3411 Ga0466967_0039775
3412 Ga0466967_0044157
3413 Ga0466967_0052656
3414 Ga0466967_0090102
3415 Ga0466967_0108859
3416 Ga0466967_0206462
3417 Ga0466967_0213462
3418 Ga0466967_0254036
3419 Ga0466967_0317645
3420 Ga0466967_0808390
3421 Ga0466967_1448479
3422 Ga0466967_1667304
3423 Ga0466967_1936721
3424 Ga0495617_002450
3425 Ga0495627_032876
3426 Ga0495592_0005902
3427 Ga0495592_0011481
3428 Ga0495592_0017511
3429 Ga0495592_0043495
3430 Ga0495592_0232869
3431 Ga0495592_0693649
3432 Ga0495603_0002752
3433 Ga0495603_0005893
3434 Ga0495603_0026486
3435 Ga0495603_0027817
3436 Ga0495603_0057695
3437 Ga0495603_0058400
3438 Ga0495603_0090468
3439 Ga0495603_0324172
3440 Ga0495590_0167759
3441 Ga0495629_0007791
3442 Ga0495629_0019021
3443 Ga0495629_0036510
3444 Ga0495629_0038099
3445 Ga0495629_0050864
3446 Ga0495629_0199262
3447 Ga0495629_0625817
3448 Ga0495629_0879766
3449 Ga0495638_0006268
3450 Ga0495638_0037802
3451 Ga0495638_0047159
3452 Ga0495638_0069235
3453 Ga0495638_0372591
3454 Ga0495641_0036692
3455 Ga0495651_0001691
3456 Ga0495651_0002270
3457 Ga0495651_0020919
3458 Ga0495651_0032656
3459 Ga0495653_0009684
3460 Ga0495653_0125804
3461 Ga0495580_0007503
3462 Ga0495580_0093565
3463 Ga0495580_0295347
3464 Ga0495582_0015462
3465 Ga0495582_0020967
3466 Ga0495582_0123656
3467 Ga0495582_0286903
3468 Ga0495605_0040643
3469 Ga0495605_0136378
3470 Ga0495639_0035778
3471 Ga0495639_0152229
3472 Ga0495662_0003027
3473 Ga0495662_0003988
3474 Ga0495662_0004401
3475 Ga0495662_0030461
3476 Ga0495662_0578598
3477 Ga0495664_0002306
3478 Ga0495664_0006527
3479 Ga0495664_0168961
3480 Ga0495664_0638228
3481 Ga0495584_0489469
3482 Ga0495585_0006843
3483 Ga0495585_0011896
3484 Ga0495585_0056441
3485 Ga0495585_0084605
3486 Ga0495594_0012495
3487 Ga0495594_0019099
3488 Ga0495594_0036869
3489 Ga0495594_0067391
3490 Ga0495594_0105804
3491 Ga0495594_0425777
3492 Ga0495596_0007205
3493 Ga0495607_0027724
3494 Ga0495607_0116405
3495 Ga0495583_0030647
3496 Ga0495583_0152135
3497 Ga0495583_0188811
3498 Ga0495583_0249917
3499 Ga0495606_0024751
3500 Ga0495606_0040870
3501 Ga0495608_0001723
3502 Ga0495608_0029184
3503 Ga0495608_0273468
3504 Ga0495608_0570525
3505 Ga0495616_0034448
3506 Ga0495618_0020219
3507 Ga0495618_0029070
3508 Ga0495618_0085032
3509 Ga0495618_0251534
3510 Ga0495620_0175873
3511 Ga0495620_0197374
3512 Ga0495628_0001384
3513 Ga0495628_0012481
3514 Ga0495628_0026361
3515 Ga0495628_0050390
3516 Ga0495628_0149375
3517 Ga0495630_0048762
3518 Ga0495630_0265887
3519 Ga0495630_0324468
3520 Ga0495630_0613214
3521 Ga0495631_0003549
3522 Ga0495631_0472694
3523 Ga0495632_0028374
3524 Ga0495632_0430800
3525 Ga0495637_0006755
3526 Ga0495643_0007275
3527 Ga0495643_0085567
3528 Ga0495644_0157588
3529 Ga0495648_0069856
3530 Ga0495648_0112305
3531 Ga0495648_0204897
3532 Ga0495648_0413244
3533 Ga0495666_0000571
3534 Ga0495666_0024248
3535 Ga0495666_0138843
3536 Ga0495666_0481718
3537 Ga0495642_0082291
3538 Ga0495652_0002119
3539 Ga0495652_0018989
3540 Ga0495652_0024558
3541 Ga0495652_0069396
3542 Ga0495652_0072250
3543 Ga0495654_0007357
3544 Ga0495665_0005483
3545 Ga0495665_0509134
3546 Ga0495640_0005626
3547 Ga0495640_0013818
3548 Ga0495640_0016680
3549 Ga0495640_0017644
3550 Ga0495640_0142738
3551 Ga0495640_0182550
3552 Ga0495640_0913821
3553 Ga0495586_0246189
3554 Ga0495587_0079197
3555 Ga0495587_0199871
3556 Ga0495587_0705976
3557 Ga0495609_0004676
3558 Ga0495597_0031747
3559 Ga0495597_0229000
3560 Ga0495597_0302666
3561 Ga0495645_0024216
3562 Ga0495645_0028167
3563 Ga0495645_0045978
3564 Ga0495645_0101595
3565 Ga0495645_0888778
3566 Ga0495622_0005380
3567 Ga0495622_0015971
3568 Ga0495622_0056033
3569 Ga0495633_0031583
3570 Ga0495667_0033930
3571 Ga0495667_0153082
3572 Ga0495667_0323018
3573 Ga0495656_0329388
3574 Ga0495668_0000123
3575 Ga0495668_0036571
3576 Ga0495668_0651628
3577 Ga0495634_0006120
3578 Ga0495634_0010265
3579 Ga0495634_0050187
3580 Ga0495634_0213792
3581 Ga0495634_0276759
3582 Ga0495634_0382681
3583 Ga0495611_0057795
3584 Ga0495611_0215774
3585 Ga0495625_0005807
3586 Ga0495625_0029488
3587 Ga0495625_0238937
3588 Ga0495635_0002565
3589 Ga0495635_0004355
3590 Ga0495635_0066218
3591 Ga0495635_0071866
3592 Ga0495635_0088357
3593 Ga0495635_0341668
3594 Ga0495635_0375901
3595 Ga0495659_0219554
3596 Ga0495659_0562685
3597 Ga0495661_0023540
3598 Ga0495661_0175298
3599 Ga0495588_0003543
3600 Ga0495588_0003986
3601 Ga0495588_0005355
3602 Ga0495588_0010107
3603 Ga0495657_0003629
3604 Ga0495657_0007083
3605 Ga0495657_0008037
3606 Ga0495657_0008501
3607 Ga0495599_0049987
3608 Ga0495599_0064358
3609 Ga0495599_0326318
3610 Ga0495623_0059476
3611 Ga0495623_0075257
3612 Ga0495623_0135461
3613 Ga0495623_0363063
3614 Ga0495646_0000855
3615 Ga0495646_0010343
3616 Ga0495646_0051847
3617 Ga0495646_0094322
3618 Ga0495646_0620530
3619 Ga0495658_0002176
3620 Ga0495658_0112189
3621 Ga0495658_0538936
3622 Ga0495669_0356984
3623 Ga0495613_0001664
3624 Ga0495613_0006878
3625 Ga0495613_0007886
3626 Ga0495613_0017322
3627 Ga0495613_0042788
3628 Ga0495613_0056747
3629 Ga0495613_0085162
3630 Ga0495613_0096472
3631 Ga0495613_0539877
3632 Ga0495624_0075201
3633 Ga0495624_0199910
3634 Ga0495624_0706154
3635 Ga0495670_0055508
3636 Ga0495670_0058872
3637 Ga0495670_0176563
3638 Ga0495671_0013941
3639 Ga0495671_0030234
3640 Ga0495671_0147806
3641 Ga0495649_0031220
3642 Ga0495649_0171518
3643 Ga0495649_0183630
3644 Ga0495649_0247873
3645 Ga0495649_0584368
3646 Ga0495589_0036165
3647 Ga0495589_0042640
3648 Ga0495589_0436546
3649 Ga0495600_0003542
3650 Ga0495600_0010402
3651 Ga0495600_0017095
3652 Ga0495600_0051070
3653 Ga0495600_0350712
3654 Ga0495660_0031126
3655 Ga0495660_0038922
3656 Ga0495581_0011118
3657 Ga0495581_0053853
3658 Ga0495581_0081771
3659 Ga0495581_0096503
3660 Ga0495604_0002351
3661 Ga0495604_0004817
3662 Ga0495604_0007383
3663 Ga0495604_0063067
3664 Ga0495604_0285633
3665 Ga0495636_0007700
3666 Ga0495636_0036875
3667 Ga0495636_0037499
3668 Ga0495636_0087387
3669 Ga0495674_0067245
3670 Ga0495674_0070922
3671 Ga0495674_0119479
3672 Ga0495674_0268767
3673 Ga0495674_0283155
3674 Ga0495672_0010127
3675 Ga0495672_0028030
3676 Ga0495676_0001590
3677 Ga0495676_0002415
3678 Ga0495676_0147379
3679 Ga0495676_0290392
3680 Ga0495680_0178410
3681 Ga0495680_0452211
3682 Ga0495683_0000766
3683 Ga0495683_0021951
3684 Ga0495687_001147
3685 Ga0495687_003306
3686 Ga0495687_039955
3687 Ga0495687_140261
3688 Ga0495675_0011687
3689 Ga0495675_0021916
3690 Ga0495675_0030965
3691 Ga0495675_0059587
3692 Ga0495675_0059974
3693 Ga0495675_0174278
3694 Ga0495675_0390066
3695 Ga0495679_011002
3696 Ga0495685_001275
3697 Ga0495685_006034
3698 Ga0495685_081645
3699 Ga0495685_108302
3700 Ga0495673_0000456
3701 Ga0495681_0003151
3702 Ga0495681_0020011
3703 Ga0495684_0123494
3704 Ga0495684_0157647
3705 Ga0495686_0000637
3706 Ga0495686_0063634
3707 Ga0495686_0232025
3708 Ga0495593_0001812
3709 Ga0495593_0055656
3710 Ga0495593_0346380
3711 Ga0495602_0055166
3712 Ga0495602_0199002
3713 Ga0495602_0397105
3714 Ga0495602_0518465
3715 Ga0495602_0531111
3716 Ga0495602_1102216
3717 Ga0495614_0000229
3718 Ga0495614_0009446
3719 Ga0495614_0122938
3720 Ga0495626_0020580
3721 Ga0495626_0066961
3722 Ga0495626_0153541
3723 Ga0496100_0000067
3724 Ga0496100_0000461
3725 Ga0496100_0004004
3726 Ga0496100_0004747
3727 Ga0496100_0007759
3728 Ga0496100_0096240
3729 Ga0496100_0148167
3730 Ga0496100_0249001
3731 Ga0496100_0295276
3732 Ga0496100_0449650
3733 Ga0496100_0546531
3734 Ga0496101_0000099
3735 Ga0496101_0000108
3736 Ga0496101_0000750
3737 Ga0496101_0000793
3738 Ga0496101_0015063
3739 Ga0496101_0098732
3740 Ga0496101_0112323
3741 Ga0496101_0162987
3742 Ga0496101_0768929
3743 Ga0496101_0852392
3744 Ga0496101_1140795
3745 Ga0496102_0000005
3746 Ga0496102_0000390
3747 Ga0496102_0003032
3748 Ga0496102_0006978
3749 Ga0496102_0030945
3750 Ga0496102_0051773
3751 Ga0496102_0093526
3752 Ga0496102_0140005
3753 Ga0496102_0143275
3754 Ga0496102_0211602
3755 Ga0496102_0216993
3756 Ga0496102_0437293
3757 Ga0496102_0504239
3758 Ga0496102_1061507
3759 Ga0496102_1595120
3760 Ga0496103_0000002
3761 Ga0496103_0000116
3762 Ga0496103_0000663
3763 Ga0496103_0001688
3764 Ga0496103_0017503
3765 Ga0496103_0488755
3766 Ga0496104_0007517
3767 Ga0496104_0011507
3768 Ga0496104_0044914
3769 Ga0496104_0046988
3770 Ga0496104_0659991
3771 Ga0496104_1474620
3772 Ga0496105_0064390
3773 Ga0496105_0176837
3774 Ga0496105_0327777
3775 Ga0496105_0501550
3776 Ga0496105_0508548
3777 Ga0496105_0953297
3778 Ga0496106_0000424
3779 Ga0496106_0001149
3780 Ga0496106_0001741
3781 Ga0496106_0002018
3782 Ga0496106_0016794
3783 Ga0496106_0177217
3784 Ga0496106_0212106
3785 Ga0496106_0234277
3786 Ga0496106_0318636
3787 Ga0496106_0624970
3788 Ga0496106_0846820
3789 Ga0496106_1472165
3790 Ga0496107_0000079
3791 Ga0496107_0000254
3792 Ga0496107_0014513
3793 Ga0496107_0214834
3794 Ga0496107_0247435
3795 Ga0496107_0275597
3796 Ga0496107_0706240
3797 Ga0496108_0005688
3798 Ga0496108_0011641
3799 Ga0496108_0033237
3800 Ga0496108_0071519
3801 Ga0496108_0110258
3802 Ga0496108_0137681
3803 Ga0496108_0174780
3804 Ga0496108_0259237
3805 Ga0496108_0326318
3806 Ga0496108_1260981
3807 Ga0496109_0000159
3808 Ga0496109_0002268
3809 Ga0496109_0010817
3810 Ga0496109_0023653
3811 Ga0496109_0038336
3812 Ga0496109_0182877
3813 Ga0496109_0418659
3814 Ga0496109_0608141
3815 Ga0496109_1250478
3816 Ga0496109_1291365
3817 Ga0496109_1468055
3818 Ga0496110_0006109
3819 Ga0496110_0085523
3820 Ga0496110_0141431
3821 Ga0496110_0168926
3822 Ga0496110_0253450
3823 Ga0496110_0267707
3824 Ga0496110_0338005
3825 Ga0496110_0554183
3826 Ga0496110_1247954
3827 Ga0496110_1524752
3828 Ga0496110_1882754
3829 Ga0496111_0022716
3830 Ga0496111_0196695
3831 Ga0496111_0298905
3832 Ga0496111_0852906
3833 Ga0496112_0017534
3834 Ga0496112_0018053
3835 Ga0496112_0018650
3836 Ga0496112_0042682
3837 Ga0496112_0062477
3838 Ga0496112_0083572
3839 Ga0496112_0159776
3840 Ga0496112_0285554
3841 Ga0496112_1156227
3842 Ga0496113_0001013
3843 Ga0496113_0021243
3844 Ga0496113_0295987
3845 Ga0496113_0356646
3846 Ga0496113_0674981
3847 Ga0496113_0712255
3848 Ga0496113_1437271
3849 Ga0496114_0000116
3850 Ga0496114_0000711
3851 Ga0496114_0001235
3852 Ga0496114_0086311
3853 Ga0496114_0099480
3854 Ga0496114_0183417
3855 Ga0496114_0245998
3856 Ga0496114_0489472
3857 Ga0496114_0646605
3858 Ga0496114_0818518
3859 Ga0496115_0002425
3860 Ga0496115_0015061
3861 Ga0496115_0021113
3862 Ga0496115_0425739
3863 Ga0496115_1219552
3864 Ga0496116_0000034
3865 Ga0496116_0001408
3866 Ga0496116_0002098
3867 Ga0496117_0000003
3868 Ga0496117_0001155
3869 Ga0496117_0028583
3870 Ga0496117_0618140
3871 Ga0496118_0000001
3872 Ga0496118_0000165
3873 Ga0496118_0000348
3874 Ga0496118_0029623
3875 Ga0496119_0000669
3876 Ga0496119_0003552
3877 Ga0496119_0010241
3878 Ga0496119_0205331
3879 Ga0496119_0388086
3880 Ga0496120_0000594
3881 Ga0496120_0002960
3882 Ga0496120_0009506
3883 Ga0496120_0027390
3884 Ga0496120_0265903
3885 Ga0496120_0350103
3886 Ga0496121_0000016
3887 Ga0496121_0001920
3888 Ga0496121_0003113
3889 Ga0496121_0785925
3890 Ga0496122_0000284
3891 Ga0496122_0003418
3892 Ga0496122_0016911
3893 Ga0496122_0296743
3894 Ga0496123_0003511
3895 Ga0496123_0008217
3896 Ga0496123_0024695
3897 Ga0496124_0000015
3898 Ga0496124_0238890
3899 Ga0496124_0252667
3900 Ga0496125_0000021
3901 Ga0496125_0037430
3902 Ga0496125_0094243
3903 Ga0496125_0274510
3904 Ga0496125_0448140
3905 Ga0496125_0626679
3906 Ga0496126_0000015
3907 Ga0496126_0000178
3908 Ga0496126_0000807
3909 Ga0496126_0003990
3910 Ga0496126_0012073
3911 Ga0496126_0029817
3912 Ga0496126_0038286
3913 Ga0496126_0258251
3914 Ga0496126_0594121
3915 Ga0496126_0888023
3916 Ga0501305_105422
3917 Ga0495678_007860
3918 Ga0495682_0030079
3919 Ga0501031_0001068
3920 Ga0501031_0014602
3921 Ga0501031_0020290
3922 Ga0501031_0050342
3923 Ga0501031_0978008
3924 Ga0501032_0000686
3925 Ga0501032_0001416
3926 Ga0501032_0003137
3927 Ga0501032_0018870
3928 Ga0501032_0050349
3929 Ga0501032_0343667
3930 Ga0501032_0583938
3931 Ga0501032_1057408
3932 Ga0501033_0013223
3933 Ga0501033_0014277
3934 Ga0501033_0035727
3935 Ga0501033_0049148
3936 Ga0501033_0052208
3937 Ga0501033_0071252
3938 Ga0501033_0187722
3939 Ga0501033_0207894
3940 Ga0501034_0000700
3941 Ga0501034_0000987
3942 Ga0501034_0001101
3943 Ga0501034_0008658
3944 Ga0501034_0018578
3945 Ga0501034_0055651
3946 Ga0501034_0080810
3947 Ga0501034_0153981
3948 Ga0501034_0158112
3949 Ga0501034_0255631
3950 Ga0501034_0304551
3951 Ga0501034_0932102
3952 Ga0501034_0975050
3953 Ga0501036_0001560
3954 Ga0501036_0004005
3955 Ga0501036_0010187
3956 Ga0501036_0011832
3957 Ga0501036_0034998
3958 Ga0501036_0088645
3959 Ga0501036_0200542
3960 Ga0501036_0275877
3961 Ga0501036_1415193
3962 Ga0501037_0000796
3963 Ga0501037_0001087
3964 Ga0501037_0003517
3965 Ga0501037_0020048
3966 Ga0501037_0073888
3967 Ga0501037_0143192
3968 Ga0501037_0410221
3969 Ga0501037_0417484
3970 Ga0501038_0001242
3971 Ga0501038_0021854
3972 Ga0501038_0022452
3973 Ga0501038_0022934
3974 Ga0501038_0128585
3975 Ga0501038_0229890
3976 Ga0501038_0235105
3977 Ga0501038_0680683
3978 Ga0501039_0001950
3979 Ga0501039_0004622
3980 Ga0501039_0014245
3981 Ga0501039_0062350
3982 Ga0501039_0073151
3983 Ga0501039_0083420
3984 Ga0501039_0420405
3985 Ga0501039_0482092
3986 Ga0501039_1502394
3987 Ga0501040_0002076
3988 Ga0501040_0004277
3989 Ga0501040_0012616
3990 Ga0501040_0182649
3991 Ga0501040_0320419
3992 Ga0501041_0000883
3993 Ga0501041_0011660
3994 Ga0501041_0180918
3995 Ga0501042_0009170
3996 Ga0501042_0031635
3997 Ga0501042_0069336
3998 Ga0501043_0000867
3999 Ga0501043_0002585
4000 Ga0501043_0005384
4001 Ga0501043_0006178
4002 Ga0501043_0026492
4003 Ga0501043_0038502
4004 Ga0501043_0093226
4005 Ga0501043_0236408
4006 Ga0501043_0343251
4007 Ga0501043_0507562
4008 Ga0501043_0584666
4009 Ga0501046_0002722
4010 Ga0501046_0003795
4011 Ga0501046_0013539
4012 Ga0501046_0055300
4013 Ga0501046_0073322
4014 Ga0501047_0000216
4015 Ga0501047_0000544
4016 Ga0501047_0002484
4017 Ga0501047_0027108
4018 Ga0501047_0034178
4019 Ga0501047_0045820
4020 Ga0501047_0068246
4021 Ga0501047_0271380
4022 Ga0501047_0295297
4023 Ga0501047_0335490
4024 Ga0501047_0604000
4025 Ga0501047_0771746
4026 Ga0501047_1361502
4027 Ga0501048_0002418
4028 Ga0501048_0002590
4029 Ga0501048_0003490
4030 Ga0501048_0199309
4031 Ga0501067_0002500
4032 Ga0501068_0000652
4033 Ga0501068_0192534
4034 Ga0501068_0872184
4035 Ga0501068_1123447
4036 Ga0501069_0005601
4037 Ga0501069_0012698
4038 Ga0501069_0165863
4039 Ga0501069_0238129
4040 Ga0501069_0532726
4041 Ga0501069_0585736
4042 Ga0501069_0945461
4043 Ga0501070_0000456
4044 Ga0501070_0000766
4045 Ga0501070_0007603
4046 Ga0501070_0108283
4047 Ga0501070_0326560
4048 Ga0501070_0505795
4049 Ga0501070_0600534
4050 Ga0501070_0656884
4051 Ga0501070_1493345
4052 Ga0501071_0006265
4053 Ga0501071_0011659
4054 Ga0501072_0002534
4055 Ga0501072_0005287
4056 Ga0501072_0776204
4057 Ga0501073_0055489
4058 Ga0501073_0057778
4059 Ga0501073_0073139
4060 Ga0501073_0137798
4061 Ga0501073_0224702
4062 Ga0501074_0006059
4063 Ga0501074_0006068
4064 Ga0501074_0199426
4065 Ga0501074_1138889
4066 Ga0501075_0013356
4067 Ga0501076_0006709
4068 Ga0501076_0089498
4069 Ga0501076_1756910
4070 Ga0501077_0015072
4071 Ga0501077_0129275
4072 Ga0501077_0184382
4073 Ga0501235_024973
4074 Ga0501225_0088809
4075 Ga0501079_0023146
4076 Ga0501079_0029937
4077 Ga0501080_0015534
4078 Ga0501080_0053708
4079 Ga0501080_0056741
4080 Ga0501080_0114961
4081 Ga0501080_0191273
4082 Ga0501080_0691588
4083 Ga0501080_0717311
4084 Ga0501080_0974738
4085 Ga0501081_0138955
4086 Ga0501081_0273584
4087 Ga0501081_0336567
4088 Ga0501081_0991854
4089 Ga0501083_0001307
4090 Ga0501083_0178532
4091 Ga0501266_088690
4092 Ga0501282_003648
4093 Ga0501035_0000870
4094 Ga0501035_0001097
4095 Ga0501035_0001386
4096 Ga0501035_0004451
4097 Ga0501035_0010236
4098 Ga0501035_0018724
4099 Ga0501035_0020892
4100 Ga0501035_0090680
4101 Ga0501035_0101450
4102 Ga0501035_0179268
4103 Ga0501035_0429294
4104 Ga0501035_0753361
4105 Ga0501044_0001367
4106 Ga0501044_0002317
4107 Ga0501044_0004810
4108 Ga0501044_0007119
4109 Ga0501044_0019900
4110 Ga0501044_0049478
4111 Ga0501044_0053350
4112 Ga0501044_0086075
4113 Ga0501044_0102858
4114 Ga0501044_0104234
4115 Ga0501044_0121019
4116 Ga0501044_0160265
4117 Ga0501044_0197226
4118 Ga0501044_0357273
4119 Ga0501044_0516620
4120 Ga0501044_0604048
4121 Ga0501045_0003212
4122 Ga0501045_0016064
4123 Ga0501045_0099953
4124 Ga0501045_0781291
4125 Ga0501045_1393037
4126 Ga0501212_039845
4127 nmdc:mga03683_109749_c1
4128 nmdc:mga03683_196946_c1
4129 nmdc:mga03683_21413_c1
4130 nmdc:mga03683_255613_c1
4131 nmdc:mga03683_317642_c1
4132 nmdc:mga03683_49387_c1
4133 nmdc:mga03n38_102027_c1
4134 nmdc:mga03n38_104021_c1
4135 nmdc:mga03n38_107_c1
4136 nmdc:mga03n38_109159_c1
4137 nmdc:mga03n38_133580_c1
4138 nmdc:mga03n38_135101_c1
4139 nmdc:mga03n38_138478_c1
4140 nmdc:mga03n38_213599_c1
4141 nmdc:mga03n38_2914_c1
4142 nmdc:mga03n38_298421_c1
4143 nmdc:mga03n38_32904_c1
4144 nmdc:mga03n38_33091_c1
4145 nmdc:mga03n38_336384_c1
4146 nmdc:mga03n38_349407_c1
4147 nmdc:mga03n38_483979_c1
4148 nmdc:mga03n38_5259_c1
4149 nmdc:mga03n38_538692_c1
4150 nmdc:mga03n38_89173_c1
4151 nmdc:mga03n38_94257_c1
4152 nmdc:mga00v17_108812_c1
4153 nmdc:mga00v17_11148_c1
4154 nmdc:mga00v17_112072_c1
4155 nmdc:mga00v17_117929_c1
4156 nmdc:mga00v17_158503_c1
4157 nmdc:mga00v17_18215_c1
4158 nmdc:mga00v17_214437_c1
4159 nmdc:mga00v17_2226_c1
4160 nmdc:mga00v17_235637_c1
4161 nmdc:mga00v17_260368_c1
4162 nmdc:mga00v17_279242_c1
4163 nmdc:mga00v17_293564_c1
4164 nmdc:mga00v17_329288_c1
4165 nmdc:mga00v17_45291_c1
4166 nmdc:mga00v17_541992_c1
4167 nmdc:mga00v17_653229_c1
4168 nmdc:mga00v17_742439_c1
4169 nmdc:mga00v17_97638_c1
4170 nmdc:mga0yw44_22775_c1
4171 nmdc:mga0yw44_242484_c1
4172 nmdc:mga0yw44_2716_c1
4173 nmdc:mga0yw44_290519_c1
4174 nmdc:mga0yw44_35428_c1
4175 nmdc:mga0yw44_448239_c1
4176 nmdc:mga0yw44_480209_c1
4177 nmdc:mga0yw44_61750_c1
4178 nmdc:mga0yw44_622061_c1
4179 nmdc:mga0yw44_659728_c1
4180 nmdc:mga0yw44_739956_c1
4181 nmdc:mga0yw44_756391_c1
4182 nmdc:mga0yw44_826811_c1
4183 nmdc:mga0yw44_99428_c1
4184 nmdc:mga06z11_100757_c1
4185 nmdc:mga06z11_241786_c1
4186 nmdc:mga06z11_31001_c1
4187 nmdc:mga06z11_464827_c1
4188 nmdc:mga06z11_515432_c1
4189 nmdc:mga06z11_528606_c1
4190 nmdc:mga06z11_533_c1
4191 nmdc:mga06z11_920561_c1
4192 nmdc:mga04h51_195285_c1
4193 nmdc:mga04h51_23177_c1
4194 nmdc:mga07m45_116413_c1
4195 nmdc:mga07m45_14311_c1
4196 nmdc:mga07m45_161483_c1
4197 nmdc:mga07m45_298273_c1
4198 nmdc:mga07m45_45821_c1
4199 nmdc:mga07m45_70843_c1
4200 nmdc:mga07m45_83179_c1
4201 nmdc:mga05p37_15340_c1
4202 nmdc:mga05p37_86594_c1
4203 nmdc:mga09592_684227_c1
4204 nmdc:mga0qj67_73761_c1
4205 nmdc:mga0qj67_86419_c1
4206 nmdc:mga08y16_1386578_c1
4207 nmdc:mga08y16_1621178_c1
4208 nmdc:mga08y16_760492_c1
4209 nmdc:mga0a205_235559_c1
4210 nmdc:mga0sz30_105066_c1
4211 nmdc:mga0sz30_114790_c1
4212 nmdc:mga0sz30_214035_c1
4213 nmdc:mga0sz30_21480_c1
4214 nmdc:mga0sz30_247555_c1
4215 nmdc:mga0sz30_25097_c1
4216 nmdc:mga0sz30_338778_c1
4217 nmdc:mga0sz30_358061_c1
4218 nmdc:mga0sz30_38126_c1
4219 nmdc:mga0sz30_38437_c1
4220 nmdc:mga0sz30_395087_c1
4221 nmdc:mga0sz30_451939_c1
4222 nmdc:mga0sz30_465596_c1
4223 nmdc:mga0sz30_62206_c2
4224 nmdc:mga0sz30_70896_c1
4225 Ga0495601_0026650
4226 Ga0495601_0038926
4227 Ga0495601_0073237
4228 Ga0495612_0005779
4229 Ga0495612_0087117
4230 Ga0500610_0011119
4231 Ga0500610_0147176
4232 Ga0500610_0284705
4233 Ga0500635_0465480
4234 Ga0495655_0093937
4235 Ga0495655_0324614
4236 Ga0495655_0367919
4237 Ga0495595_0407764
4238 Ga0495619_0007645
4239 Ga0495619_0133108
4240 Ga0495619_0209860
4241 Ga0495619_0772303
4242 Ga0500578_0185326
4243 Ga0500578_0250628
4244 Ga0500578_0361070
4245 Ga0500643_004993
4246 Ga0500643_034977
4247 Ga0500643_040244
4248 Ga0500643_042530
4249 Ga0500581_203034
4250 Ga0500583_0211859
4251 Ga0500583_0318492
4252 Ga0500651_0722005
4253 Ga0500566_0114405
4254 Ga0500640_000199
4255 Ga0500641_0119258
4256 Ga0500650_0052766
4257 Ga0500654_032949
4258 Ga0500654_187819
4259 Ga0500553_034430
4260 Ga0500556_0025034
4261 Ga0500556_0115219
4262 Ga0500558_214684
4263 Ga0500560_000605
4264 Ga0500560_015926
4265 Ga0500560_042009
4266 Ga0500562_037695
4267 Ga0500562_163035
4268 Ga0500569_000808
4269 Ga0500572_027614
4270 Ga0500572_259794
4271 Ga0500594_0187516
4272 Ga0500595_063465
4273 Ga0500608_054416
4274 Ga0500614_041281
4275 Ga0500618_152749
4276 Ga0500621_029543
4277 Ga0500628_004395
4278 Ga0500628_030134
4279 Ga0500652_001721
4280 Ga0500652_010700
4281 Ga0500652_176044
4282 Ga0500652_269688
4283 Ga0500655_055522
4284 Ga0500658_0021304
4285 Ga0500559_0146159
4286 Ga0500559_0193688
4287 Ga0500559_0529806
4288 Ga0500561_0000789
4289 Ga0500573_0005248
4290 Ga0500573_0024372
4291 Ga0500573_0052240
4292 Ga0500573_0446074
4293 Ga0500579_044854
4294 Ga0500586_026498
4295 Ga0500586_198010
4296 Ga0500588_0035717
4297 Ga0500588_0306182
4298 Ga0500600_0022759
4299 Ga0500603_037368
4300 Ga0500616_0041089
4301 Ga0500616_0055332
4302 Ga0500616_0141584
4303 Ga0500620_283881
4304 Ga0500627_0085476
4305 Ga0500633_0022892
4306 Ga0500633_0254976
4307 Ga0500634_0039494
4308 Ga0500634_0134890
4309 Ga0500645_000032
4310 Ga0500645_172225
4311 Ga0500656_030485
4312 Ga0500587_003192
4313 Ga0501084_0001814
4314 Ga0501084_0025061
4315 Ga0587073_0223576
4316 Ga0587080_095102
4317 Ga0587083_0054650
4318 Ga0587099_061417
4319 Ga0587122_008489
4320 Ga0587067_042151
4321 Ga0587069_121145
4322 Ga0587114_057507
4323 Ga0501082_0003705
4324 Ga0501082_0104495
4325 Ga0466962_0000056
4326 Ga0466962_0000729
4327 Ga0466962_0003557
4328 Ga0466962_0007132
4329 Ga0466962_0017444
4330 Ga0466962_0086224
4331 Ga0466962_0434474
4332 Ga0530510_0034383
4333 2523384142
4334 2547410063
4335 2552108214
4336 2554256882
4337 2566996612
4338 2585299419
4339 2585308196
4340 2585319180
4341 2616696887
4342 2616902026
4343 2643764858
4344 2643902801
4345 2643942076
4346 2644017240
4347 2644173799
4348 2644261701
4349 2644389735
4350 2644404690
4351 2644429159
4352 2644439224
4353 2644461302
4354 2644489447
4355 2644516043
4356 2644633411
4357 2644636251
4358 2731908880
4359 2738667089
4360 2738708748
4361 2738891350
4362 2739145933
4363 2739205425
4364 2744957629
4365 2753037133
4366 2753325002
4367 2768643405
4368 2784589629
4369 2785341974
4370 2785370673
4371 2786671856
4372 2793980307
4373 2799186689
4374 2808843229
4375 2808912818
4376 2808921578
4377 2809233309
4378 2811845196
4379 2812356819
4380 2812479534
4381 2819695309
4382 2842138795
4383 2842891061
4384 2852640433
4385 2862181685
4386 2862286758
4387 2862292195
4388 2862387714
4389 2862514387
4390 2862578278
4391 2863411665
4392 2867434711
4393 2867479144
4394 2868090607
4395 2873154776
4396 2877679915
4397 2902798010
4398 2902799094
4399 2902804392
4400 2902812375
4401 2902815770
4402 2902842212
4403 2904539130
4404 2912718561
4405 2912762042
4406 2918505723
4407 2919475444
4408 2922555798
4409 2928144860
4410 2929214382
4411 2935394868
4412 2939586269
4413 2946048700
4414 2946069053
4415 2946077000
4416 2947227885
4417 2954003032
4418 2954384870
4419 2954678133
4420 2954686025
4421 2954695683
4422 2954710876
4423 2954715099
4424 2954725041
4425 2954736777
4426 2954743974
4427 2954755624
4428 2954762914
4429 2966601543
4430 2974319892
4431 2984523764
4432 2990045362
4433 2990062205
4434 2995468636
4435 2997458156
4436 2997606378
4437 3001890491
4438 3006326300
4439 3006393465
4440 3006492632
4441 3006499677
4442 8008566438
4443 8008577889
4444 8023626424
4445 8025484836
4446 8025534831
4447 8033689151
4448 8047719891
4449 8047897061
4450 8048134681
4451 8048361891
4452 8048374045
4453 8048384181
4454 8048410734
4455 8053948525
4456 8054160729
4457 8056448877
4458 8056667953
4459 8056833872

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

7

95

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7su2-assembly1.cif.gz_C crystal structure of a co-bound ridc1 variant 0.9678 7 45
7rwx-assembly1.cif.gz_B-2 crystal structure of a zn-bound ridc1 variant in the presence of reductant 0.966 7 45
6dy4-assembly2.cif.gz_D fe(ii)-bound structure of the engineered cyt cb562 variant, ch2e 0.9643 7 45
5l31-assembly1.cif.gz_B crystal structure of an engineered metal-free ridc1 variant containing five disulfide bonds. 0.963 7 45
4er9-assembly1.cif.gz_A crystal structure of cytochrome b562 from salmonella enterica subsp. enterica serovar typhimurium str. 14028s 0.9626 6 45
ID Description Score Start End Superfamily
af_Q9XK79_1_97_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9694 7 84 1.10.287.3510
2qlaA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.9667 7 45 1.20.120.10
4er9A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.9626 6 45 1.20.120.10
2bc5B00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.9597 7 45 1.20.120.10
3nmiE00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.956 7 45 1.20.120.10
ID Description Score Start End GO Terms
AF-A0A2E0M9H2-F1-model_v4 NADH-quinone oxidoreductase subunit NuoK 0.9959 1 73 GO:0016651
GO:0030964
GO:0042773
AF-A0A0C9LSE0-F1-model_v4 NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) 0.9856 3 84 GO:0005886
GO:0030964
GO:0042773
GO:0048038
GO:0050136
AF-A0A4P5XI80-F1-model_v4 NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) 0.9824 3 84 GO:0005886
GO:0030964
GO:0042773
GO:0048038
GO:0050136
AF-A0A7C3TW05-F1-model_v4 NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) 0.9794 3 84 GO:0005886
GO:0030964
GO:0042773
GO:0048038
GO:0050136
AF-A0A0R2U7Q2-F1-model_v4 NADH:ubiquinone oxidoreductase subunit K (EC 1.6.5.11) 0.9775 1 79 GO:0016651
GO:0030964
GO:0042773
GO:0048038

Map