F496575

General Info

Members Datasets Scaffolds Average Seq Length
2230 722 4460 162

Family's Representative Sequence

Representative Sequence 3300053088|Ga0500644_0000485|Ga0500644_0000485_6181_6756
Length 191
Sequence LAWFKPAPLTGEKRRVSPSSTIQAARRTCAMKGDAKVIEYLNKALRHELTAVNQYWLHYRLLDNWGLKDLAKQWRKESIEEMEHADKLIERIIFFDGFPNLQVLDPLHIGQNVKEVLDCDLVAELSARALYQEAATFCQTAKDYVTRDLFEKLMSDEEHHIDFLETQLDLVEKLGVQLYSQHHIGEMGEGD

Samples

Sample ID Description Type Environment
1 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
10 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
11 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
12 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
17 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
18 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
19 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
20 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
21 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
22 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
23 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
24 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
25 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
26 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
27 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
28 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
30 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
31 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
33 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
34 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
35 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
36 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
37 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
38 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
46 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
47 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
48 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
49 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
53 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
54 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
55 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
56 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
57 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
58 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
59 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
60 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
61 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
62 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
63 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
64 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
65 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
66 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
67 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
68 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
69 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
70 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
71 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
72 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
73 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
74 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
75 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
76 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
77 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
78 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
79 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
80 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
81 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
82 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
83 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
84 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
87 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
90 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
91 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
92 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
93 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
94 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
95 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
96 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
97 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
98 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
99 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
100 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
101 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
102 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
103 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
104 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
105 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
106 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
107 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
108 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
111 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
114 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
115 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
116 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
117 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
118 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
119 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
120 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
121 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
122 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
123 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
124 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
125 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
126 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
127 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
128 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
129 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
130 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
132 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
133 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
134 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
135 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
136 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
137 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
138 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
139 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
140 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
141 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
142 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
143 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
144 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
145 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
146 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
147 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
148 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
149 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
150 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
151 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
152 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
153 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
154 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
155 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
156 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
157 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
158 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
159 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
160 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
161 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
162 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
163 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
164 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
165 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
166 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
167 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
168 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
169 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
170 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
171 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
172 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
173 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
174 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
175 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
176 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
177 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
178 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
179 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
180 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
181 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
182 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
183 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
184 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
185 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
186 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
187 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
188 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
189 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
191 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
192 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
264 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
268 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
269 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
273 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
274 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
278 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
281 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
282 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
283 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
284 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
285 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
286 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
287 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
288 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
289 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
290 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
291 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
292 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
293 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
294 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
295 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
296 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
297 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
298 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
299 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
300 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
301 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
302 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
303 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
304 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
305 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
306 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
307 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
308 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
309 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
310 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
311 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
312 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
313 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
314 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
315 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
316 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
317 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
318 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
319 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
320 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
321 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
322 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
323 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
324 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
325 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
326 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
327 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
328 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
329 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
330 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
331 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
332 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
333 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
334 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
335 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
336 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
337 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
338 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
339 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
340 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
341 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
342 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
343 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
344 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
345 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
346 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
347 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
348 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
349 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
350 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
351 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
352 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
353 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
354 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
355 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
356 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
357 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
358 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
359 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
360 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
361 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
362 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
363 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
364 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
365 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
366 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
367 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
368 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
369 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
370 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
371 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
372 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
373 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
374 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
375 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
376 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
377 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
378 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
379 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
380 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
381 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
382 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
383 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
384 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
385 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
386 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
387 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
388 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
389 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
390 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
391 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
392 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
393 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
394 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
395 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
396 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
397 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
398 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
399 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
400 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
401 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
402 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
403 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
404 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
405 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
406 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
407 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
408 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
409 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
410 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
411 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
412 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
413 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
414 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
415 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
416 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
417 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
418 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
419 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
420 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
421 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
422 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
423 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
424 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
425 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
426 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
427 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
428 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
429 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
430 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
431 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
432 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
433 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
434 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
435 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
436 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
437 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
438 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
439 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
440 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
441 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
442 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
443 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
444 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
445 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
446 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
447 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
448 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
449 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
450 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
451 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
452 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
453 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
454 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
455 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
456 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
457 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
458 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
459 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
460 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
461 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
462 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
463 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
464 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
468 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
469 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
471 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
473 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
474 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
475 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
476 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
477 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
478 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
479 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
480 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
481 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
482 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
483 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
484 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
485 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
486 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
487 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
488 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
489 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
490 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
491 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
492 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
493 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
494 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
495 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
496 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
497 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
498 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
499 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
500 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
501 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
502 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
503 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
504 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
505 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
506 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
507 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
508 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
509 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
510 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
511 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
512 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
513 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
514 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
515 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
516 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
517 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
518 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
519 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
520 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
521 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
522 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
523 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
524 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
525 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
526 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
527 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
528 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
529 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
530 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
531 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
532 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
533 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
535 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
536 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
537 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
538 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
539 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
540 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
541 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
542 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
543 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
544 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
545 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
546 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
547 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
548 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
549 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
550 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
551 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
552 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
553 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
554 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
555 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
556 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
557 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
558 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
559 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
560 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
561 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
562 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
563 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
564 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
565 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
566 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
567 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
568 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
569 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
570 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
571 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
572 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
573 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
574 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
575 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
576 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
577 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
578 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
579 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
580 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
581 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
582 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
583 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
584 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
585 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
586 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
587 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
588 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
589 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
590 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
591 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
592 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
593 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
594 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
595 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
596 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
597 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
598 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
599 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
600 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
601 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
602 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
603 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
604 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
605 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
606 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
607 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
608 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
609 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
610 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
611 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
612 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
613 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
614 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
615 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
616 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
617 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
618 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
619 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
620 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
621 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
622 2909042592 Labrys sp. LIt4 Isolate Nodule
623 2922368715
624 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
625 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
626 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
627 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
628 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
629 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
630 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
631 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
632 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
633 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
634 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
635 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
636 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
637 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
638 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
639 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
640 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
641 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
642 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
643 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
644 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
645 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
646 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
647 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
648 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
649 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
650 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
651 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
652 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
653 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
654 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
655 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
656 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
657 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
658 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
659 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
660 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
661 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
662 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
663 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
664 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
665 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
666 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
667 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
668 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
669 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
670 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
671 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
672 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
673 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
674 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
675 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
676 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
677 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
678 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
679 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
680 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
681 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
682 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
683 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
684 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
685 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
686 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
687 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
688 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
689 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
690 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
691 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
692 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
693 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
694 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
695 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
696 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
697 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
698 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
699 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
700 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
701 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
702 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
703 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
704 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
705 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
706 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
707 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
708 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
709 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
710 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
711 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
712 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
713 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
714 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
715 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
716 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
717 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
718 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
719 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
720 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
721 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
722 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.34
Metatranscriptomes 0.31
Isolates 8.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.08
Nodule 6.05
Rhizoplane 7.67
Rhizosphere 78.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500644_0000485 3300053088 Bacteria 17515
2 2214745207 2209111006 Bacteria 15420
3 ARcpr5oldR_c000007 3300000041 Bacteria 41749
4 ARSoilYngRDRAFT_c00111 3300000042 Bacteria 13938
5 ARcpr5yngRDRAFT_c000090 3300000043 Bacteria 14724
6 ARSoilOldRDRAFT_c000004 3300000044 Bacteria 62556
7 ARCol0oldRDRAFT_c00879 3300000045 Bacteria 2396
8 ARCol0yngRDRAFT_1000074 3300000652 Bacteria 18636
9 JGI24741J21665_1009138 3300001915 Bacteria 1833
10 JGI24752J21851_1000640 3300001976 Bacteria 4666
11 JGI24746J21847_1000605 3300001977 Bacteria 5447
12 JGI24747J21853_1001521 3300001978 Bacteria 1751
13 JGI24747J21853_1003523 3300001978 Bacteria 1358
14 JGI24740J21852_10033571 3300001979 Bacteria 1627
15 JGI24739J22299_10000119 3300001989 Bacteria 24437
16 JGI24739J22299_10025457 3300001989 Bacteria 2081
17 JGI24737J22298_10000258 3300001990 Bacteria 17613
18 JGI24737J22298_10039158 3300001990 Bacteria 1458
19 JGI24737J22298_10076836 3300001990 Bacteria 995
20 JGI24743J22301_10001956 3300001991 Bacteria 2998
21 JGI24743J22301_10042439 3300001991 Bacteria 915
22 JGI24750J21931_1000164 3300002070 Bacteria 11020
23 JGI24750J21931_1000382 3300002070 Bacteria 7517
24 JGI24745J21846_1000018 3300002073 Bacteria 10266
25 JGI24745J21846_1000103 3300002073 Bacteria 6407
26 JGI24748J21848_1000848 3300002074 Bacteria 3308
27 JGI24748J21848_1001399 3300002074 Bacteria 2654
28 JGI24738J21930_10000155 3300002075 Bacteria 17211
29 JGI24738J21930_10002678 3300002075 Bacteria 4591
30 JGI24749J21850_1000093 3300002076 Bacteria 15913
31 JGI24744J21845_10001350 3300002077 Bacteria 4854
32 JGI24744J21845_10001608 3300002077 Bacteria 4513
33 JGI24744J21845_10056863 3300002077 Bacteria 717
34 JGI24035J26624_1000048 3300002126 Bacteria 9152
35 JGI24033J26618_1000900 3300002155 Bacteria 2855
36 JGI24033J26618_1003658 3300002155 Bacteria 1629
37 JGI24034J26672_10000528 3300002239 Bacteria 4903
38 JGI24742J22300_10000595 3300002244 Bacteria 5438
39 JGI24742J22300_10004653 3300002244 Bacteria 2252
40 JGI24742J22300_10062696 3300002244 Bacteria 685
41 JGI24751J29686_10001631 3300002459 Bacteria 4627
42 JGI25406J46586_10003557 3300003203 Bacteria 7304
43 JGI25165J46597_1035253 3300003214 Bacteria 644
44 JGI26129J50193_1014951 3300003349 Bacteria 571
45 JGI25405J52794_10011864 3300003911 Bacteria 1671
46 JGI25405J52794_10014374 3300003911 Bacteria 1545
47 JGI25405J52794_10025043 3300003911 Bacteria 1221
48 JGI25405J52794_10036498 3300003911 Bacteria 1031
49 Ga0058859_11560269 3300004798 Bacteria 1040
50 Ga0058860_12133653 3300004801 Bacteria 776
51 Ga0065717_1002213 3300005276 Bacteria 2470
52 Ga0065716_1001697 3300005277 Bacteria 4101
53 Ga0065704_10077166 3300005289 Bacteria 4833
54 Ga0065712_10003104 3300005290 Bacteria 5100
55 Ga0065712_10092635 3300005290 Bacteria 2324
56 Ga0065712_10318590 3300005290 Bacteria 832
57 Ga0065712_10685869 3300005290 Bacteria 552
58 Ga0065715_10001507 3300005293 Bacteria 6080
59 Ga0065715_10088946 3300005293 Bacteria 21692
60 Ga0065715_10506773 3300005293 Bacteria 775
61 Ga0065707_10104807 3300005295 Bacteria 2677
62 Ga0070658_10153634 3300005327 Bacteria 1928
63 Ga0070658_10281756 3300005327 Bacteria 1415
64 Ga0070676_10000514 3300005328 Bacteria 18558
65 Ga0070676_10038262 3300005328 Bacteria 2770
66 Ga0070676_10092281 3300005328 Bacteria 1857
67 Ga0070676_10092697 3300005328 Bacteria 1853
68 Ga0070676_10107041 3300005328 Bacteria 1736
69 Ga0070676_10131575 3300005328 Bacteria 1583
70 Ga0070676_10264504 3300005328 Bacteria 1153
71 Ga0070683_100005318 3300005329 Bacteria 10729
72 Ga0070683_100025217 3300005329 Bacteria 5336
73 Ga0070683_100083692 3300005329 Bacteria 2988
74 Ga0070683_100522873 3300005329 Bacteria 1134
75 Ga0070683_100859439 3300005329 Bacteria 870
76 Ga0070690_100008454 3300005330 Bacteria 5929
77 Ga0070690_100008826 3300005330 Bacteria 5822
78 Ga0070690_100043431 3300005330 Bacteria 2850
79 Ga0070690_100233768 3300005330 Bacteria 1294
80 Ga0070690_100516835 3300005330 Bacteria 896
81 Ga0070670_100002977 3300005331 Bacteria 14022
82 Ga0070670_100006229 3300005331 Bacteria 10093
83 Ga0070670_100084940 3300005331 Bacteria 2719
84 Ga0070670_100275568 3300005331 Bacteria 1468
85 Ga0070670_100359624 3300005331 Bacteria 1280
86 Ga0070670_100603021 3300005331 Bacteria 983
87 Ga0070670_101216841 3300005331 Bacteria 688
88 Ga0070677_10000023 3300005333 Bacteria 44929
89 Ga0070677_10004061 3300005333 Bacteria 4752
90 Ga0070677_10107827 3300005333 Bacteria 1239
91 Ga0068869_100000153 3300005334 Bacteria 34191
92 Ga0068869_100008177 3300005334 Bacteria 6731
93 Ga0068869_100185076 3300005334 Bacteria 1634
94 Ga0068869_100211361 3300005334 Bacteria 1534
95 Ga0068869_100669356 3300005334 Bacteria 883
96 Ga0068869_100717357 3300005334 Bacteria 854
97 Ga0068869_100844602 3300005334 Bacteria 789
98 Ga0068869_101192858 3300005334 Bacteria 669
99 Ga0070666_10003393 3300005335 Bacteria 9651
100 Ga0070666_10026307 3300005335 Bacteria 3799
101 Ga0070666_10659127 3300005335 Bacteria 766
102 Ga0070680_100000814 3300005336 Bacteria 21982
103 Ga0070680_100068000 3300005336 Bacteria 2923
104 Ga0070680_100557248 3300005336 Bacteria 982
105 Ga0070682_100000445 3300005337 Bacteria 26505
106 Ga0070682_100031348 3300005337 Bacteria 3215
107 Ga0070682_100034266 3300005337 Bacteria 3091
108 Ga0070682_100077114 3300005337 Bacteria 2147
109 Ga0070682_100173416 3300005337 Bacteria 1501
110 Ga0070682_100198482 3300005337 Bacteria 1413
111 Ga0070682_100786159 3300005337 Bacteria 772
112 Ga0070682_100984733 3300005337 Bacteria 699
113 Ga0068868_100014021 3300005338 Bacteria 5897
114 Ga0068868_100015712 3300005338 Bacteria 5607
115 Ga0068868_100230809 3300005338 Bacteria 1553
116 Ga0068868_100761861 3300005338 Bacteria 870
117 Ga0068868_100999857 3300005338 Bacteria 765
118 Ga0070660_100001480 3300005339 Bacteria 16083
119 Ga0070660_100074596 3300005339 Bacteria 2654
120 Ga0070689_100000880 3300005340 Bacteria 18718
121 Ga0070689_100002815 3300005340 Bacteria 11435
122 Ga0070689_100007192 3300005340 Bacteria 7761
123 Ga0070689_100009660 3300005340 Bacteria 6844
124 Ga0070689_100014559 3300005340 Bacteria 5717
125 Ga0070689_100019999 3300005340 Bacteria 4961
126 Ga0070689_100264757 3300005340 Bacteria 1422
127 Ga0070689_100381570 3300005340 Bacteria 1188
128 Ga0070691_10000320 3300005341 Bacteria 17013
129 Ga0070691_10091209 3300005341 Bacteria 1502
130 Ga0070691_10115528 3300005341 Bacteria 1346
131 Ga0070691_10138890 3300005341 Bacteria 1237
132 Ga0070691_10184404 3300005341 Bacteria 1088
133 Ga0070687_100000187 3300005343 Bacteria 21513
134 Ga0070687_100133612 3300005343 Bacteria 1435
135 Ga0070687_100445812 3300005343 Bacteria 860
136 Ga0070661_100001011 3300005344 Bacteria 19919
137 Ga0070661_100124167 3300005344 Bacteria 1935
138 Ga0070661_100238860 3300005344 Bacteria 1398
139 Ga0070661_101209785 3300005344 Bacteria 632
140 Ga0070692_10005354 3300005345 Bacteria 5461
141 Ga0070692_10089528 3300005345 Bacteria 1670
142 Ga0070668_100002838 3300005347 Bacteria 12766
143 Ga0070668_100016947 3300005347 Bacteria 5450
144 Ga0070668_100375576 3300005347 Bacteria 1209
145 Ga0070669_100000501 3300005353 Bacteria 29467
146 Ga0070669_100240436 3300005353 Bacteria 1438
147 Ga0070669_100275073 3300005353 Bacteria 1348
148 Ga0070675_100001136 3300005354 Bacteria 19211
149 Ga0070675_100046415 3300005354 Bacteria 3557
150 Ga0070675_100067779 3300005354 Bacteria 2953
151 Ga0070675_100169899 3300005354 Bacteria 1880
152 Ga0070675_100205742 3300005354 Bacteria 1709
153 Ga0070675_100604734 3300005354 Bacteria 994
154 Ga0070675_100611966 3300005354 Bacteria 988
155 Ga0070671_100000595 3300005355 Bacteria 25844
156 Ga0070671_100015479 3300005355 Bacteria 6163
157 Ga0070671_100047984 3300005355 Bacteria 3550
158 Ga0070671_100061508 3300005355 Bacteria 3127
159 Ga0070671_100065641 3300005355 Bacteria 3024
160 Ga0070671_100139147 3300005355 Bacteria 2048
161 Ga0070671_100763838 3300005355 Bacteria 840
162 Ga0070671_101048064 3300005355 Bacteria 715
163 Ga0070671_101048066 3300005355 Bacteria 715
164 Ga0070674_100000249 3300005356 Bacteria 26766
165 Ga0070674_100012198 3300005356 Bacteria 5272
166 Ga0070674_100117652 3300005356 Bacteria 1963
167 Ga0070674_100126896 3300005356 Bacteria 1897
168 Ga0070674_100173582 3300005356 Bacteria 1646
169 Ga0070674_100266565 3300005356 Bacteria 1352
170 Ga0070674_100792035 3300005356 Bacteria 818
171 Ga0070674_100923651 3300005356 Bacteria 761
172 Ga0070673_100000233 3300005364 Bacteria 27866
173 Ga0070673_100002283 3300005364 Bacteria 11629
174 Ga0070673_100021868 3300005364 Bacteria 4647
175 Ga0070673_100488374 3300005364 Bacteria 1112
176 Ga0070673_101463571 3300005364 Bacteria 644
177 Ga0070688_100000432 3300005365 Bacteria 21144
178 Ga0070688_100026130 3300005365 Bacteria 3466
179 Ga0070688_100050191 3300005365 Bacteria 2598
180 Ga0070688_100059054 3300005365 Bacteria 2417
181 Ga0070688_100238496 3300005365 Bacteria 1289
182 Ga0070688_100557811 3300005365 Bacteria 872
183 Ga0070688_100604749 3300005365 Bacteria 840
184 Ga0070659_100000746 3300005366 Bacteria 23656
185 Ga0070659_100121193 3300005366 Bacteria 2118
186 Ga0070659_100226845 3300005366 Bacteria 1543
187 Ga0070659_101520848 3300005366 Bacteria 597
188 Ga0070667_100001881 3300005367 Bacteria 18641
189 Ga0070667_100023663 3300005367 Bacteria 5098
190 Ga0070667_100097581 3300005367 Bacteria 2535
191 Ga0070667_100117881 3300005367 Bacteria 2307
192 Ga0070667_100191100 3300005367 Bacteria 1814
193 Ga0070667_100280667 3300005367 Bacteria 1495
194 Ga0070667_100307260 3300005367 Bacteria 1429
195 Ga0070667_100424440 3300005367 Bacteria 1212
196 Ga0070667_101001405 3300005367 Bacteria 780
197 Ga0070667_101245663 3300005367 Bacteria 696
198 Ga0070703_10001482 3300005406 Bacteria 7053
199 Ga0070703_10100692 3300005406 Bacteria 1018
200 Ga0070709_10047309 3300005434 Bacteria 2679
201 Ga0070709_10436863 3300005434 Bacteria 984
202 Ga0070709_10455178 3300005434 Bacteria 965
203 Ga0070709_10936571 3300005434 Bacteria 686
204 Ga0070714_100009048 3300005435 Bacteria 7804
205 Ga0070714_100091046 3300005435 Bacteria 2672
206 Ga0070714_100092299 3300005435 Bacteria 2654
207 Ga0070714_100100894 3300005435 Bacteria 2542
208 Ga0070714_100126560 3300005435 Bacteria 2279
209 Ga0070714_100335533 3300005435 Bacteria 1417
210 Ga0070714_100662321 3300005435 Bacteria 1005
211 Ga0070714_100740007 3300005435 Bacteria 950
212 Ga0070713_100016466 3300005436 Bacteria 5559
213 Ga0070713_100071321 3300005436 Bacteria 2935
214 Ga0070713_100077622 3300005436 Bacteria 2825
215 Ga0070713_100149455 3300005436 Bacteria 2076
216 Ga0070713_100268420 3300005436 Bacteria 1562
217 Ga0070713_100424108 3300005436 Bacteria 1246
218 Ga0070713_100507234 3300005436 Bacteria 1139
219 Ga0070713_100580296 3300005436 Bacteria 1064
220 Ga0070713_101314619 3300005436 Bacteria 701
221 Ga0070710_10010676 3300005437 Bacteria 4516
222 Ga0070710_10083509 3300005437 Bacteria 1870
223 Ga0070710_10111938 3300005437 Bacteria 1641
224 Ga0070710_10114113 3300005437 Bacteria 1627
225 Ga0070710_10209295 3300005437 Bacteria 1235
226 Ga0070710_10368273 3300005437 Bacteria 955
227 Ga0070710_10706782 3300005437 Bacteria 712
228 Ga0070701_10031287 3300005438 Bacteria 2639
229 Ga0070701_10669322 3300005438 Bacteria 695
230 Ga0070711_100015569 3300005439 Bacteria 4814
231 Ga0070711_100039311 3300005439 Bacteria 3186
232 Ga0070711_100042375 3300005439 Bacteria 3076
233 Ga0070711_100157199 3300005439 Bacteria 1720
234 Ga0070711_100380430 3300005439 Bacteria 1141
235 Ga0070705_100000361 3300005440 Bacteria 26716
236 Ga0070705_100024922 3300005440 Bacteria 3236
237 Ga0070705_100110267 3300005440 Bacteria 1757
238 Ga0070705_101068873 3300005440 Bacteria 659
239 Ga0070700_100000357 3300005441 Bacteria 23494
240 Ga0070700_100003357 3300005441 Bacteria 8258
241 Ga0070700_100006176 3300005441 Bacteria 6383
242 Ga0070700_100067834 3300005441 Bacteria 2267
243 Ga0070700_100297972 3300005441 Bacteria 1176
244 Ga0070700_100464700 3300005441 Bacteria 966
245 Ga0070700_100896540 3300005441 Bacteria 722
246 Ga0070694_100009629 3300005444 Bacteria 5929
247 Ga0070694_100016773 3300005444 Bacteria 4615
248 Ga0070694_100066054 3300005444 Bacteria 2481
249 Ga0070694_100077948 3300005444 Bacteria 2297
250 Ga0070694_100133504 3300005444 Bacteria 1796
251 Ga0070694_100739236 3300005444 Bacteria 803
252 Ga0070708_100011297 3300005445 Bacteria 7260
253 Ga0070708_100601179 3300005445 Bacteria 1037
254 Ga0070663_100000582 3300005455 Bacteria 19491
255 Ga0070663_100175884 3300005455 Bacteria 1657
256 Ga0070663_100196707 3300005455 Bacteria 1571
257 Ga0070663_100743917 3300005455 Bacteria 837
258 Ga0070663_100973195 3300005455 Bacteria 736
259 Ga0070663_100984138 3300005455 Bacteria 733
260 Ga0070678_100000438 3300005456 Bacteria 19678
261 Ga0070678_100048424 3300005456 Bacteria 3061
262 Ga0070678_100061654 3300005456 Bacteria 2765
263 Ga0070678_100232794 3300005456 Bacteria 1537
264 Ga0070678_100865010 3300005456 Bacteria 824
265 Ga0070678_101527312 3300005456 Bacteria 626
266 Ga0070662_100035557 3300005457 Bacteria 3519
267 Ga0070662_100060479 3300005457 Bacteria 2762
268 Ga0070662_100069477 3300005457 Bacteria 2592
269 Ga0070662_100621065 3300005457 Bacteria 910
270 Ga0070662_100649269 3300005457 Bacteria 890
271 Ga0070681_10035954 3300005458 Bacteria 4975
272 Ga0070681_10039781 3300005458 Bacteria 4713
273 Ga0070681_10046250 3300005458 Bacteria 4351
274 Ga0070681_10522177 3300005458 Bacteria 1101
275 Ga0070681_10692382 3300005458 Bacteria 935
276 Ga0068867_100001099 3300005459 Bacteria 18474
277 Ga0068867_100274953 3300005459 Bacteria 1379
278 Ga0068867_100436226 3300005459 Bacteria 1113
279 Ga0068867_100615546 3300005459 Bacteria 949
280 Ga0070685_10002191 3300005466 Bacteria 10092
281 Ga0070685_10005188 3300005466 Bacteria 6605
282 Ga0070685_10006230 3300005466 Bacteria 6074
283 Ga0070707_100341121 3300005468 Bacteria 1455
284 Ga0070707_100642181 3300005468 Bacteria 1024
285 Ga0070699_100121587 3300005518 Bacteria 2296
286 Ga0070699_100129260 3300005518 Bacteria 2226
287 Ga0070699_101381204 3300005518 Bacteria 646
288 Ga0070679_100002503 3300005530 Bacteria 16646
289 Ga0070679_100060552 3300005530 Bacteria 3773
290 Ga0070679_100178466 3300005530 Bacteria 2096
291 Ga0070679_100217496 3300005530 Bacteria 1873
292 Ga0070679_100319630 3300005530 Bacteria 1501
293 Ga0070679_101360868 3300005530 Bacteria 656
294 Ga0070679_101474501 3300005530 Bacteria 627
295 Ga0070684_100000101 3300005535 Bacteria 55960
296 Ga0070684_100025722 3300005535 Bacteria 4950
297 Ga0070684_100232752 3300005535 Bacteria 1682
298 Ga0070684_100456395 3300005535 Bacteria 1181
299 Ga0070684_100855120 3300005535 Bacteria 851
300 Ga0070697_100122513 3300005536 Bacteria 2176
301 Ga0070697_100434090 3300005536 Bacteria 1142
302 Ga0068853_100008586 3300005539 Bacteria 8214
303 Ga0068853_101218989 3300005539 Bacteria 727
304 Ga0068853_101279451 3300005539 Bacteria 709
305 Ga0070672_100003443 3300005543 Bacteria 10252
306 Ga0070672_100017991 3300005543 Bacteria 5099
307 Ga0070672_100095012 3300005543 Bacteria 2411
308 Ga0070672_100126981 3300005543 Bacteria 2092
309 Ga0070672_100259043 3300005543 Bacteria 1466
310 Ga0070672_100279313 3300005543 Bacteria 1411
311 Ga0070672_101059669 3300005543 Bacteria 720
312 Ga0070686_100000532 3300005544 Bacteria 22792
313 Ga0070686_100003076 3300005544 Bacteria 9139
314 Ga0070686_100012133 3300005544 Bacteria 4901
315 Ga0070686_100032670 3300005544 Bacteria 3192
316 Ga0070686_100056682 3300005544 Bacteria 2514
317 Ga0070686_100365139 3300005544 Bacteria 1089
318 Ga0070686_100491425 3300005544 Bacteria 951
319 Ga0070686_100619836 3300005544 Bacteria 855
320 Ga0070686_101150856 3300005544 Bacteria 643
321 Ga0070695_100005890 3300005545 Bacteria 7232
322 Ga0070695_100010023 3300005545 Bacteria 5651
323 Ga0070695_100031254 3300005545 Bacteria 3320
324 Ga0070695_101029290 3300005545 Bacteria 671
325 Ga0070695_101209592 3300005545 Bacteria 622
326 Ga0070696_100002353 3300005546 Bacteria 12485
327 Ga0070696_100061565 3300005546 Bacteria 2625
328 Ga0070696_100205520 3300005546 Bacteria 1472
329 Ga0070696_100502300 3300005546 Bacteria 965
330 Ga0070696_100614607 3300005546 Bacteria 878
331 Ga0070696_100729350 3300005546 Bacteria 810
332 Ga0070693_100003380 3300005547 Bacteria 7425
333 Ga0070693_100018122 3300005547 Bacteria 3672
334 Ga0070693_100080782 3300005547 Bacteria 1938
335 Ga0070693_100152175 3300005547 Bacteria 1466
336 Ga0070693_100433332 3300005547 Bacteria 919
337 Ga0070693_100462228 3300005547 Bacteria 893
338 Ga0070665_100069518 3300005548 Bacteria 3529
339 Ga0070665_100096979 3300005548 Bacteria 2953
340 Ga0070665_100344682 3300005548 Bacteria 1495
341 Ga0070665_101247298 3300005548 Bacteria 754
342 Ga0070665_101566558 3300005548 Bacteria 667
343 Ga0070704_100009296 3300005549 Bacteria 5929
344 Ga0070704_100039046 3300005549 Bacteria 3256
345 Ga0070704_100472997 3300005549 Bacteria 1083
346 Ga0068855_100047838 3300005563 Bacteria 5051
347 Ga0068855_100304761 3300005563 Bacteria 1763
348 Ga0068855_101399322 3300005563 Bacteria 721
349 Ga0070664_100020910 3300005564 Bacteria 5392
350 Ga0070664_100045986 3300005564 Bacteria 3686
351 Ga0070664_100050840 3300005564 Bacteria 3509
352 Ga0070664_100173825 3300005564 Bacteria 1911
353 Ga0070664_100205124 3300005564 Bacteria 1760
354 Ga0070664_100251297 3300005564 Bacteria 1589
355 Ga0070664_100501479 3300005564 Bacteria 1119
356 Ga0070664_100537883 3300005564 Bacteria 1080
357 Ga0068857_100001072 3300005577 Bacteria 21170
358 Ga0068857_100231806 3300005577 Bacteria 1689
359 Ga0068857_100315177 3300005577 Bacteria 1444
360 Ga0068857_100547386 3300005577 Bacteria 1090
361 Ga0068854_100000794 3300005578 Bacteria 18790
362 Ga0068854_100068465 3300005578 Bacteria 2588
363 Ga0068854_101751338 3300005578 Bacteria 569
364 Ga0068856_100006877 3300005614 Bacteria 11126
365 Ga0068856_100194751 3300005614 Bacteria 2041
366 Ga0068856_100946836 3300005614 Bacteria 880
367 Ga0070702_100005817 3300005615 Bacteria 5783
368 Ga0070702_100006263 3300005615 Bacteria 5619
369 Ga0070702_100250484 3300005615 Bacteria 1200
370 Ga0070702_100266210 3300005615 Bacteria 1170
371 Ga0070702_100429399 3300005615 Bacteria 953
372 Ga0070702_100511628 3300005615 Bacteria 884
373 Ga0068852_100000713 3300005616 Bacteria 21734
374 Ga0068852_100026582 3300005616 Bacteria 4707
375 Ga0068852_100287888 3300005616 Bacteria 1586
376 Ga0068852_101910944 3300005616 Bacteria 616
377 Ga0068859_100001523 3300005617 Bacteria 23646
378 Ga0068859_100055926 3300005617 Bacteria 3970
379 Ga0068859_100132778 3300005617 Bacteria 2561
380 Ga0068859_100154018 3300005617 Bacteria 2375
381 Ga0068859_100879257 3300005617 Bacteria 981
382 Ga0068859_101742908 3300005617 Bacteria 688
383 Ga0068864_100000715 3300005618 Bacteria 27854
384 Ga0068864_100011540 3300005618 Bacteria 7299
385 Ga0068864_100017038 3300005618 Bacteria 6056
386 Ga0068864_100627682 3300005618 Bacteria 1045
387 Ga0068866_10000861 3300005718 Bacteria 13443
388 Ga0068866_10008505 3300005718 Bacteria 4330
389 Ga0068866_10049473 3300005718 Bacteria 2130
390 Ga0068866_10397866 3300005718 Bacteria 888
391 Ga0068861_100000574 3300005719 Bacteria 21775
392 Ga0068861_100019829 3300005719 Bacteria 4806
393 Ga0068861_100243313 3300005719 Bacteria 1531
394 Ga0068861_100768270 3300005719 Bacteria 902
395 Ga0068851_10012824 3300005834 Bacteria 3959
396 Ga0068851_10060094 3300005834 Bacteria 1945
397 Ga0068870_10000009 3300005840 Bacteria 70353
398 Ga0068870_10001327 3300005840 Bacteria 9959
399 Ga0068863_100001272 3300005841 Bacteria 25149
400 Ga0068863_100010495 3300005841 Bacteria 9002
401 Ga0068863_100013621 3300005841 Bacteria 7844
402 Ga0068863_100080683 3300005841 Bacteria 3082
403 Ga0068863_100149451 3300005841 Bacteria 2235
404 Ga0068863_100633517 3300005841 Bacteria 1060
405 Ga0068863_100803503 3300005841 Bacteria 938
406 Ga0068863_101458315 3300005841 Bacteria 692
407 Ga0068858_100008506 3300005842 Bacteria 9862
408 Ga0068858_100011270 3300005842 Bacteria 8448
409 Ga0068858_100138044 3300005842 Bacteria 2288
410 Ga0068858_100158451 3300005842 Bacteria 2131
411 Ga0068858_100263877 3300005842 Bacteria 1637
412 Ga0068858_100379023 3300005842 Bacteria 1357
413 Ga0068858_100565977 3300005842 Bacteria 1101
414 Ga0068858_100960638 3300005842 Bacteria 837
415 Ga0068858_101393658 3300005842 Bacteria 690
416 Ga0068860_100001758 3300005843 Bacteria 23120
417 Ga0068860_100006468 3300005843 Bacteria 11765
418 Ga0068860_100020537 3300005843 Bacteria 6397
419 Ga0068860_100138960 3300005843 Bacteria 2334
420 Ga0068860_100143847 3300005843 Bacteria 2293
421 Ga0068860_100961195 3300005843 Bacteria 871
422 Ga0068862_100010288 3300005844 Bacteria 7718
423 Ga0068862_100012556 3300005844 Bacteria 7012
424 Ga0068862_100382209 3300005844 Bacteria 1313
425 Ga0068862_101096322 3300005844 Bacteria 791
426 Ga0081455_10000002 3300005937 Bacteria 460472
427 Ga0081455_10002472 3300005937 Bacteria 21974
428 Ga0081455_10052457 3300005937 Bacteria 3491
429 Ga0081455_10223921 3300005937 Bacteria 1392
430 Ga0081455_10259042 3300005937 Bacteria 1268
431 Ga0081538_10002038 3300005981 Bacteria 20187
432 Ga0081538_10045574 3300005981 Bacteria 2716
433 Ga0081538_10111348 3300005981 Bacteria 1343
434 Ga0081540_1002171 3300005983 Bacteria 16253
435 Ga0081540_1049627 3300005983 Bacteria 2092
436 Ga0081539_10001225 3300005985 Bacteria 45858
437 Ga0081539_10021565 3300005985 Bacteria 4296
438 Ga0081539_10155866 3300005985 Bacteria 1094
439 Ga0070717_10001112 3300006028 Bacteria 18150
440 Ga0070717_10300666 3300006028 Bacteria 1426
441 Ga0070717_10617332 3300006028 Bacteria 984
442 Ga0070717_10899768 3300006028 Bacteria 806
443 Ga0075365_10047510 3300006038 Bacteria 2822
444 Ga0075365_10083448 3300006038 Bacteria 2167
445 Ga0075365_10156746 3300006038 Bacteria 1585
446 Ga0075365_10257352 3300006038 Bacteria 1227
447 Ga0075365_10464145 3300006038 Bacteria 894
448 Ga0075368_10051208 3300006042 Bacteria 1641
449 Ga0075364_10031309 3300006051 Bacteria 3418
450 Ga0075364_10082133 3300006051 Bacteria 2132
451 Ga0075364_10350178 3300006051 Bacteria 1007
452 Ga0075364_10462032 3300006051 Bacteria 867
453 Ga0075364_10573871 3300006051 Bacteria 771
454 Ga0075432_10007391 3300006058 Bacteria 3741
455 Ga0075432_10102486 3300006058 Bacteria 1059
456 Ga0070715_10031454 3300006163 Bacteria 2154
457 Ga0070715_10111064 3300006163 Bacteria 1293
458 Ga0070716_100012500 3300006173 Bacteria 4305
459 Ga0070716_100177340 3300006173 Bacteria 1396
460 Ga0070716_100552456 3300006173 Bacteria 859
461 Ga0070716_101355687 3300006173 Bacteria 577
462 Ga0070712_100003993 3300006175 Bacteria 9068
463 Ga0070712_100022892 3300006175 Bacteria 4120
464 Ga0070712_100066126 3300006175 Bacteria 2568
465 Ga0070712_100074378 3300006175 Bacteria 2440
466 Ga0070712_100153247 3300006175 Bacteria 1772
467 Ga0070712_100183944 3300006175 Bacteria 1630
468 Ga0070712_100230202 3300006175 Bacteria 1471
469 Ga0070712_100835834 3300006175 Bacteria 791
470 Ga0070712_101795230 3300006175 Bacteria 537
471 Ga0075362_10089319 3300006177 Bacteria 1429
472 Ga0075362_10091610 3300006177 Bacteria 1412
473 Ga0075362_10103455 3300006177 Bacteria 1334
474 Ga0075367_10039780 3300006178 Bacteria 2743
475 Ga0075367_10080993 3300006178 Bacteria 1964
476 Ga0075367_10116168 3300006178 Bacteria 1646
477 Ga0075367_10145458 3300006178 Bacteria 1470
478 Ga0075367_10179370 3300006178 Bacteria 1320
479 Ga0075369_10001932 3300006186 Bacteria 7278
480 Ga0075369_10026208 3300006186 Bacteria 2429
481 Ga0075369_10059624 3300006186 Bacteria 1663
482 Ga0075369_10116952 3300006186 Bacteria 1205
483 Ga0075369_10359369 3300006186 Bacteria 684
484 Ga0075427_10007351 3300006194 Bacteria 1618
485 Ga0075366_10024644 3300006195 Bacteria 3509
486 Ga0075366_10175114 3300006195 Bacteria 1302
487 Ga0075366_10283936 3300006195 Bacteria 1012
488 Ga0097621_100001018 3300006237 Bacteria 19728
489 Ga0097621_100066291 3300006237 Bacteria 2973
490 Ga0097621_100072805 3300006237 Bacteria 2843
491 Ga0097621_100163570 3300006237 Bacteria 1914
492 Ga0097621_100199155 3300006237 Bacteria 1738
493 Ga0097621_100257964 3300006237 Bacteria 1528
494 Ga0097621_100769044 3300006237 Bacteria 891
495 Ga0075370_10061344 3300006353 Bacteria 2142
496 Ga0075370_10111364 3300006353 Bacteria 1590
497 Ga0075370_10130462 3300006353 Bacteria 1466
498 Ga0075370_10200912 3300006353 Bacteria 1176
499 Ga0075370_10295748 3300006353 Bacteria 962
500 Ga0068871_100000012 3300006358 Bacteria 105267
501 Ga0068871_100027675 3300006358 Bacteria 4435
502 Ga0068871_100038119 3300006358 Bacteria 3836
503 Ga0068871_100040464 3300006358 Bacteria 3733
504 Ga0068871_100179135 3300006358 Bacteria 1821
505 Ga0068871_100856059 3300006358 Bacteria 841
506 Ga0068871_101309499 3300006358 Bacteria 681
507 Ga0075428_100001200 3300006844 Bacteria 27756
508 Ga0075428_100014639 3300006844 Bacteria 8710
509 Ga0075428_100600029 3300006844 Bacteria 1176
510 Ga0075428_101060433 3300006844 Bacteria 857
511 Ga0075430_100000032 3300006846 Bacteria 72679
512 Ga0075430_100007411 3300006846 Bacteria 9264
513 Ga0075430_100125575 3300006846 Bacteria 2139
514 Ga0075431_100009024 3300006847 Bacteria 9998
515 Ga0075431_100018864 3300006847 Bacteria 7026
516 Ga0075431_100337228 3300006847 Bacteria 1518
517 Ga0075431_100461551 3300006847 Bacteria 1265
518 Ga0075431_100726028 3300006847 Bacteria 970
519 Ga0075433_10000072 3300006852 Bacteria 45390
520 Ga0075433_10005026 3300006852 Bacteria 10365
521 Ga0075433_10947946 3300006852 Bacteria 750
522 Ga0075433_11121779 3300006852 Bacteria 684
523 Ga0075434_100000341 3300006871 Bacteria 33666
524 Ga0075434_100001937 3300006871 Bacteria 17946
525 Ga0075434_100018020 3300006871 Bacteria 6813
526 Ga0075434_100035479 3300006871 Bacteria 4930
527 Ga0075434_100072041 3300006871 Bacteria 3447
528 Ga0075434_100116720 3300006871 Bacteria 2682
529 Ga0075434_100275416 3300006871 Bacteria 1702
530 Ga0075434_100479098 3300006871 Bacteria 1266
531 Ga0075434_100673352 3300006871 Bacteria 1052
532 Ga0075429_100000631 3300006880 Bacteria 27160
533 Ga0075429_100013494 3300006880 Bacteria 7088
534 Ga0075429_100436965 3300006880 Bacteria 1147
535 Ga0075429_100825681 3300006880 Bacteria 812
536 Ga0068865_100000328 3300006881 Bacteria 26279
537 Ga0068865_100014896 3300006881 Bacteria 4950
538 Ga0068865_100041691 3300006881 Bacteria 3125
539 Ga0068865_100156536 3300006881 Bacteria 1734
540 Ga0068865_100240314 3300006881 Bacteria 1425
541 Ga0068865_100347933 3300006881 Bacteria 1200
542 Ga0068865_100620881 3300006881 Bacteria 916
543 Ga0068865_101090505 3300006881 Bacteria 703
544 Ga0075436_100095605 3300006914 Bacteria 2067
545 Ga0075436_100171912 3300006914 Bacteria 1530
546 Ga0075436_100264051 3300006914 Bacteria 1228
547 Ga0075436_100339636 3300006914 Bacteria 1081
548 Ga0075436_100594935 3300006914 Bacteria 814
549 Ga0097620_100001523 3300006931 Bacteria 23646
550 Ga0097620_100055926 3300006931 Bacteria 3970
551 Ga0097620_100132777 3300006931 Bacteria 2561
552 Ga0097620_100154020 3300006931 Bacteria 2375
553 Ga0097620_100879224 3300006931 Bacteria 981
554 Ga0097620_101743473 3300006931 Bacteria 688
555 Ga0075435_100031353 3300007076 Bacteria 4187
556 Ga0075435_100054843 3300007076 Bacteria 3218
557 Ga0075435_100292073 3300007076 Bacteria 1393
558 Ga0075435_100472832 3300007076 Bacteria 1082
559 Ga0075435_100871397 3300007076 Bacteria 785
560 Ga0099794_10173693 3300007265 Bacteria 1099
561 Ga0099795_10045084 3300007788 Bacteria 1584
562 Ga0105251_10117675 3300009011 Bacteria 1208
563 Ga0105244_10023808 3300009036 Bacteria 3351
564 Ga0105240_10103668 3300009093 Bacteria 3455
565 Ga0105240_10503276 3300009093 Bacteria 1347
566 Ga0111539_10000915 3300009094 Bacteria 38573
567 Ga0111539_10001908 3300009094 Bacteria 27756
568 Ga0111539_10002936 3300009094 Bacteria 22607
569 Ga0111539_10027823 3300009094 Bacteria 6904
570 Ga0111539_10033800 3300009094 Bacteria 6206
571 Ga0111539_10070815 3300009094 Bacteria 4116
572 Ga0111539_10503546 3300009094 Bacteria 1411
573 Ga0111539_10666951 3300009094 Bacteria 1211
574 Ga0105245_10000301 3300009098 Bacteria 47401
575 Ga0105245_10001404 3300009098 Bacteria 21834
576 Ga0105245_10032714 3300009098 Bacteria 4604
577 Ga0105245_10072717 3300009098 Bacteria 3124
578 Ga0105245_10364859 3300009098 Bacteria 1434
579 Ga0105245_11580710 3300009098 Bacteria 707
580 Ga0105247_10000881 3300009101 Bacteria 22689
581 Ga0105247_10008839 3300009101 Bacteria 6141
582 Ga0105247_10069023 3300009101 Bacteria 2204
583 Ga0105247_10101848 3300009101 Bacteria 1837
584 Ga0105247_10232918 3300009101 Bacteria 1251
585 Ga0105247_10354888 3300009101 Bacteria 1032
586 Ga0105247_10587127 3300009101 Bacteria 824
587 Ga0105247_10825547 3300009101 Bacteria 709
588 Ga0114129_10001035 3300009147 Bacteria 36374
589 Ga0114129_10001551 3300009147 Bacteria 31169
590 Ga0114129_10028120 3300009147 Bacteria 7966
591 Ga0114129_10070313 3300009147 Bacteria 4880
592 Ga0114129_10204372 3300009147 Bacteria 2673
593 Ga0114129_11773734 3300009147 Bacteria 751
594 Ga0105243_10001028 3300009148 Bacteria 25704
595 Ga0105243_10061177 3300009148 Bacteria 3010
596 Ga0105243_10066314 3300009148 Bacteria 2903
597 Ga0105243_10217822 3300009148 Bacteria 1685
598 Ga0105243_10219816 3300009148 Bacteria 1678
599 Ga0105243_10286709 3300009148 Bacteria 1486
600 Ga0105243_11096495 3300009148 Bacteria 804
601 Ga0105241_10002719 3300009174 Bacteria 13247
602 Ga0105241_10023657 3300009174 Bacteria 4556
603 Ga0105241_10065709 3300009174 Bacteria 2803
604 Ga0105241_10255640 3300009174 Bacteria 1487
605 Ga0105241_10275633 3300009174 Bacteria 1435
606 Ga0105241_10394855 3300009174 Bacteria 1212
607 Ga0105241_10524514 3300009174 Bacteria 1060
608 Ga0105242_10000607 3300009176 Bacteria 28041
609 Ga0105242_10083542 3300009176 Bacteria 2675
610 Ga0105242_10106058 3300009176 Bacteria 2387
611 Ga0105242_10109860 3300009176 Bacteria 2348
612 Ga0105242_10254277 3300009176 Bacteria 1584
613 Ga0105242_10265475 3300009176 Bacteria 1552
614 Ga0105242_10604903 3300009176 Bacteria 1059
615 Ga0105242_10624918 3300009176 Bacteria 1044
616 Ga0105242_10859272 3300009176 Bacteria 903
617 Ga0105248_10000309 3300009177 Bacteria 58008
618 Ga0105248_10011832 3300009177 Bacteria 9626
619 Ga0105248_10012810 3300009177 Bacteria 9250
620 Ga0105248_10068237 3300009177 Bacteria 3993
621 Ga0105248_10271398 3300009177 Bacteria 1910
622 Ga0105248_10344652 3300009177 Bacteria 1677
623 Ga0105248_10393029 3300009177 Bacteria 1561
624 Ga0105248_10697500 3300009177 Bacteria 1145
625 Ga0105248_11648727 3300009177 Bacteria 727
626 Ga0105248_11675713 3300009177 Bacteria 721
627 Ga0105237_10010578 3300009545 Bacteria 9800
628 Ga0105237_10084828 3300009545 Bacteria 3157
629 Ga0105237_10164686 3300009545 Bacteria 2216
630 Ga0105237_11535558 3300009545 Bacteria 673
631 Ga0105238_10070190 3300009551 Bacteria 3503
632 Ga0105238_10173704 3300009551 Bacteria 2131
633 Ga0105238_10489555 3300009551 Bacteria 1230
634 Ga0105238_11536282 3300009551 Bacteria 695
635 Ga0105238_11696647 3300009551 Bacteria 663
636 Ga0105249_10000486 3300009553 Bacteria 36821
637 Ga0105249_10021002 3300009553 Bacteria 5843
638 Ga0105249_10176979 3300009553 Bacteria 2072
639 Ga0105249_10533323 3300009553 Bacteria 1223
640 Ga0105249_10609198 3300009553 Bacteria 1147
641 Ga0105249_10817491 3300009553 Bacteria 996
642 Ga0099796_10058433 3300010159 Bacteria 1360
643 Ga0099796_10129770 3300010159 Bacteria 976
644 Ga0105239_10006677 3300010375 Bacteria 13327
645 Ga0105239_10047213 3300010375 Bacteria 4719
646 Ga0105239_10050734 3300010375 Bacteria 4549
647 Ga0105239_10444362 3300010375 Bacteria 1471
648 Ga0105239_10561715 3300010375 Bacteria 1300
649 Ga0105239_10618740 3300010375 Bacteria 1236
650 Ga0105239_10701840 3300010375 Bacteria 1157
651 Ga0105246_10000696 3300011119 Bacteria 18957
652 Ga0105246_10019527 3300011119 Bacteria 4333
653 Ga0105246_10033787 3300011119 Bacteria 3402
654 Ga0105246_10047691 3300011119 Bacteria 2927
655 Ga0105246_10126771 3300011119 Bacteria 1900
656 Ga0105246_10447242 3300011119 Bacteria 1085
657 Ga0105246_11086625 3300011119 Bacteria 730
658 Ga0105246_11570894 3300011119 Bacteria 621
659 Ga0105246_11811455 3300011119 Bacteria 583
660 Ga0157336_1000555 3300012477 Bacteria 1710
661 Ga0157346_1001469 3300012480 Bacteria 1122
662 Ga0157346_1008134 3300012480 Bacteria 716
663 Ga0157337_1009938 3300012483 Bacteria 727
664 Ga0157321_1004681 3300012487 Bacteria 871
665 Ga0157314_1036743 3300012500 Bacteria 575
666 Ga0157347_1015555 3300012502 Bacteria 849
667 Ga0157313_1026130 3300012503 Bacteria 632
668 Ga0157316_1003498 3300012510 Bacteria 1137
669 Ga0157338_1006492 3300012515 Bacteria 1083
670 Ga0157338_1021895 3300012515 Bacteria 752
671 Ga0157373_10022136 3300013100 Bacteria 4612
672 Ga0157373_10446972 3300013100 Bacteria 930
673 Ga0157373_10739440 3300013100 Bacteria 723
674 Ga0157371_10006574 3300013102 Bacteria 9555
675 Ga0157371_10224499 3300013102 Bacteria 1349
676 Ga0157370_10048300 3300013104 Bacteria 4077
677 Ga0157370_11224808 3300013104 Bacteria 677
678 Ga0157369_11160066 3300013105 Bacteria 789
679 Ga0157374_10001864 3300013296 Bacteria 17741
680 Ga0157374_10131391 3300013296 Bacteria 2423
681 Ga0157374_10198399 3300013296 Bacteria 1964
682 Ga0157374_10226231 3300013296 Bacteria 1837
683 Ga0157374_10243059 3300013296 Bacteria 1770
684 Ga0157374_10369815 3300013296 Bacteria 1427
685 Ga0157374_10470262 3300013296 Bacteria 1260
686 Ga0157374_11487396 3300013296 Bacteria 700
687 Ga0157378_10006042 3300013297 Bacteria 10605
688 Ga0157378_10049474 3300013297 Bacteria 3740
689 Ga0157378_10087367 3300013297 Bacteria 2828
690 Ga0157378_10194452 3300013297 Bacteria 1915
691 Ga0157378_10263051 3300013297 Bacteria 1656
692 Ga0157378_10329991 3300013297 Bacteria 1484
693 Ga0157378_10695918 3300013297 Bacteria 1035
694 Ga0157378_11108267 3300013297 Bacteria 829
695 Ga0157378_12147029 3300013297 Bacteria 609
696 Ga0163162_10000992 3300013306 Bacteria 26439
697 Ga0163162_10030120 3300013306 Bacteria 5376
698 Ga0163162_10047201 3300013306 Bacteria 4316
699 Ga0163162_10315183 3300013306 Bacteria 1697
700 Ga0163162_10477093 3300013306 Bacteria 1379
701 Ga0163162_11148359 3300013306 Bacteria 881
702 Ga0157372_10021474 3300013307 Bacteria 6975
703 Ga0157372_10182904 3300013307 Bacteria 2427
704 Ga0157372_10234079 3300013307 Bacteria 2130
705 Ga0157372_10316968 3300013307 Bacteria 1815
706 Ga0157372_11713422 3300013307 Bacteria 723
707 Ga0157375_10002320 3300013308 Bacteria 16428
708 Ga0157375_10023485 3300013308 Bacteria 5691
709 Ga0157375_10263963 3300013308 Bacteria 1883
710 Ga0157375_10476118 3300013308 Bacteria 1414
711 Ga0157375_11450759 3300013308 Bacteria 809
712 Ga0157375_11532036 3300013308 Bacteria 787
713 Ga0157375_11792803 3300013308 Bacteria 727
714 Ga0157375_11823333 3300013308 Bacteria 721
715 Ga0157375_12962685 3300013308 Bacteria 567
716 Ga0163163_10000824 3300014325 Bacteria 26424
717 Ga0163163_10024973 3300014325 Bacteria 5691
718 Ga0163163_10188373 3300014325 Bacteria 2111
719 Ga0163163_10286426 3300014325 Bacteria 1699
720 Ga0163163_11014405 3300014325 Bacteria 893
721 Ga0163163_11706952 3300014325 Bacteria 690
722 Ga0163163_12221413 3300014325 Bacteria 608
723 Ga0163163_12547273 3300014325 Bacteria 569
724 Ga0157380_10000711 3300014326 Bacteria 20809
725 Ga0157380_10038106 3300014326 Bacteria 3731
726 Ga0157380_10081471 3300014326 Bacteria 2648
727 Ga0157380_10213892 3300014326 Bacteria 1720
728 Ga0157380_10925690 3300014326 Bacteria 900
729 Ga0157377_10000336 3300014745 Bacteria 21014
730 Ga0157377_10047817 3300014745 Bacteria 2398
731 Ga0157379_10000678 3300014968 Bacteria 27608
732 Ga0157379_10002722 3300014968 Bacteria 14925
733 Ga0157379_10026862 3300014968 Bacteria 5124
734 Ga0157379_10043686 3300014968 Bacteria 4001
735 Ga0157379_10048261 3300014968 Bacteria 3800
736 Ga0157379_10505990 3300014968 Bacteria 1120
737 Ga0157379_10533181 3300014968 Bacteria 1091
738 Ga0157379_10763044 3300014968 Bacteria 911
739 Ga0157379_10814747 3300014968 Bacteria 882
740 Ga0157379_11273174 3300014968 Bacteria 709
741 Ga0157376_10019841 3300014969 Bacteria 5189
742 Ga0157376_10042923 3300014969 Bacteria 3709
743 Ga0157376_10116548 3300014969 Bacteria 2360
744 Ga0157376_10204882 3300014969 Bacteria 1818
745 Ga0157376_10227912 3300014969 Bacteria 1729
746 Ga0157376_10252843 3300014969 Bacteria 1647
747 Ga0157376_10701427 3300014969 Bacteria 1017
748 Ga0157376_10791508 3300014969 Bacteria 960
749 Ga0157376_10859210 3300014969 Bacteria 923
750 Ga0163161_10000534 3300017792 Bacteria 31044
751 Ga0163161_10009513 3300017792 Bacteria 6724
752 Ga0163161_10276967 3300017792 Bacteria 1315
753 Ga0163161_10399926 3300017792 Bacteria 1101
754 Ga0163161_10573771 3300017792 Bacteria 927
755 Ga0213876_10306262 3300021384 Bacteria 844
756 Ga0213875_10000012 3300021388 Bacteria 312017
757 Ga0209233_1017203 3300025261 Bacteria 1974
758 Ga0207666_1000177 3300025271 Bacteria 9685
759 Ga0207673_1000025 3300025290 Bacteria 11860
760 Ga0209758_1010682 3300025297 Bacteria 5451
761 Ga0209758_1043695 3300025297 Bacteria 1647
762 Ga0207697_10000374 3300025315 Bacteria 25123
763 Ga0207697_10032416 3300025315 Bacteria 2138
764 Ga0207697_10080865 3300025315 Bacteria 1369
765 Ga0207656_10020761 3300025321 Bacteria 2614
766 Ga0207656_10052210 3300025321 Bacteria 1770
767 Ga0207655_1147347 3300025728 Bacteria 748
768 Ga0207713_1033188 3300025735 Bacteria 2257
769 Ga0207713_1092712 3300025735 Bacteria 1058
770 Ga0207653_10144532 3300025885 Bacteria 872
771 Ga0207653_10156519 3300025885 Bacteria 841
772 Ga0207682_10000011 3300025893 Bacteria 85533
773 Ga0207682_10023013 3300025893 Bacteria 2459
774 Ga0207692_10030829 3300025898 Bacteria 2562
775 Ga0207692_10087775 3300025898 Bacteria 1679
776 Ga0207692_10089130 3300025898 Bacteria 1669
777 Ga0207692_10294800 3300025898 Bacteria 985
778 Ga0207692_10651482 3300025898 Bacteria 680
779 Ga0207642_10014960 3300025899 Bacteria 2878
780 Ga0207642_10046703 3300025899 Bacteria 1931
781 Ga0207642_10157265 3300025899 Bacteria 1216
782 Ga0207642_10296665 3300025899 Bacteria 935
783 Ga0207642_10816502 3300025899 Bacteria 594
784 Ga0207710_10000805 3300025900 Bacteria 16991
785 Ga0207710_10002863 3300025900 Bacteria 7852
786 Ga0207710_10009874 3300025900 Bacteria 4013
787 Ga0207710_10010652 3300025900 Bacteria 3871
788 Ga0207710_10110335 3300025900 Bacteria 1306
789 Ga0207688_10000020 3300025901 Bacteria 51200
790 Ga0207688_10000552 3300025901 Bacteria 18231
791 Ga0207688_10169692 3300025901 Bacteria 1297
792 Ga0207688_10741926 3300025901 Bacteria 622
793 Ga0207680_10002333 3300025903 Bacteria 8832
794 Ga0207680_10126532 3300025903 Bacteria 1678
795 Ga0207680_10538469 3300025903 Bacteria 833
796 Ga0207647_10002391 3300025904 Bacteria 14250
797 Ga0207647_10027807 3300025904 Bacteria 3683
798 Ga0207647_10211940 3300025904 Bacteria 1118
799 Ga0207685_10114895 3300025905 Bacteria 1173
800 Ga0207685_10497794 3300025905 Bacteria 641
801 Ga0207699_10147619 3300025906 Bacteria 1552
802 Ga0207699_10210624 3300025906 Bacteria 1322
803 Ga0207699_10614290 3300025906 Bacteria 792
804 Ga0207699_10839916 3300025906 Bacteria 676
805 Ga0207645_10000108 3300025907 Bacteria 61630
806 Ga0207645_10106424 3300025907 Bacteria 1813
807 Ga0207645_10118629 3300025907 Bacteria 1716
808 Ga0207645_10220349 3300025907 Bacteria 1251
809 Ga0207645_10233868 3300025907 Bacteria 1213
810 Ga0207645_10547281 3300025907 Bacteria 785
811 Ga0207643_10000628 3300025908 Bacteria 22229
812 Ga0207643_10000685 3300025908 Bacteria 21167
813 Ga0207643_10198875 3300025908 Bacteria 1220
814 Ga0207705_11287652 3300025909 Bacteria 559
815 Ga0207684_10342124 3300025910 Bacteria 1288
816 Ga0207684_11137858 3300025910 Bacteria 648
817 Ga0207654_10000818 3300025911 Bacteria 17142
818 Ga0207654_10318187 3300025911 Bacteria 1063
819 Ga0207707_10000689 3300025912 Bacteria 33589
820 Ga0207707_10026505 3300025912 Bacteria 5066
821 Ga0207707_10140553 3300025912 Bacteria 2111
822 Ga0207707_10349180 3300025912 Bacteria 1275
823 Ga0207707_10566562 3300025912 Bacteria 964
824 Ga0207707_10820323 3300025912 Bacteria 774
825 Ga0207707_11401839 3300025912 Bacteria 557
826 Ga0207695_10161501 3300025913 Bacteria 2172
827 Ga0207695_10426315 3300025913 Bacteria 1210
828 Ga0207671_10024759 3300025914 Bacteria 4509
829 Ga0207671_10129740 3300025914 Bacteria 1934
830 Ga0207671_10419287 3300025914 Bacteria 1065
831 Ga0207693_10006663 3300025915 Bacteria 9540
832 Ga0207693_10012111 3300025915 Bacteria 6971
833 Ga0207693_10016657 3300025915 Bacteria 5872
834 Ga0207693_10017791 3300025915 Bacteria 5667
835 Ga0207693_10021550 3300025915 Bacteria 5120
836 Ga0207693_10051181 3300025915 Bacteria 3242
837 Ga0207693_10059861 3300025915 Bacteria 2983
838 Ga0207693_10084844 3300025915 Bacteria 2481
839 Ga0207693_10238629 3300025915 Bacteria 1427
840 Ga0207663_10028739 3300025916 Bacteria 3258
841 Ga0207663_10064670 3300025916 Bacteria 2335
842 Ga0207663_10128831 3300025916 Bacteria 1745
843 Ga0207663_10130076 3300025916 Bacteria 1738
844 Ga0207663_10168423 3300025916 Bacteria 1554
845 Ga0207663_10302657 3300025916 Bacteria 1195
846 Ga0207663_10448209 3300025916 Bacteria 995
847 Ga0207663_10882585 3300025916 Bacteria 714
848 Ga0207660_10000442 3300025917 Bacteria 27342
849 Ga0207660_10051713 3300025917 Bacteria 2922
850 Ga0207660_10074664 3300025917 Bacteria 2475
851 Ga0207660_10731722 3300025917 Bacteria 807
852 Ga0207660_11223555 3300025917 Bacteria 611
853 Ga0207662_10000249 3300025918 Bacteria 24950
854 Ga0207662_10027330 3300025918 Bacteria 3293
855 Ga0207662_10031720 3300025918 Bacteria 3071
856 Ga0207662_10066121 3300025918 Bacteria 2178
857 Ga0207662_10164952 3300025918 Bacteria 1417
858 Ga0207662_10196961 3300025918 Bacteria 1302
859 Ga0207657_10002726 3300025919 Bacteria 19014
860 Ga0207657_10056929 3300025919 Bacteria 3372
861 Ga0207657_10144933 3300025919 Bacteria 1938
862 Ga0207657_10319780 3300025919 Bacteria 1227
863 Ga0207649_10000057 3300025920 Bacteria 102314
864 Ga0207649_10034271 3300025920 Bacteria 3041
865 Ga0207649_10046622 3300025920 Bacteria 2664
866 Ga0207649_10492955 3300025920 Bacteria 931
867 Ga0207649_11089612 3300025920 Bacteria 630
868 Ga0207652_10005483 3300025921 Bacteria 10292
869 Ga0207652_10257590 3300025921 Bacteria 1574
870 Ga0207652_10558794 3300025921 Bacteria 1028
871 Ga0207652_10710033 3300025921 Bacteria 897
872 Ga0207652_11023546 3300025921 Bacteria 725
873 Ga0207646_10528869 3300025922 Bacteria 1061
874 Ga0207681_10000181 3300025923 Bacteria 51755
875 Ga0207681_10139805 3300025923 Bacteria 1802
876 Ga0207681_10543796 3300025923 Bacteria 955
877 Ga0207694_10143576 3300025924 Bacteria 1920
878 Ga0207694_10523821 3300025924 Bacteria 993
879 Ga0207694_11206291 3300025924 Bacteria 640
880 Ga0207650_10001609 3300025925 Bacteria 16125
881 Ga0207650_10003057 3300025925 Bacteria 11527
882 Ga0207650_10012596 3300025925 Bacteria 5837
883 Ga0207650_10015274 3300025925 Bacteria 5344
884 Ga0207650_10097696 3300025925 Bacteria 2255
885 Ga0207650_10384787 3300025925 Bacteria 1159
886 Ga0207650_10697001 3300025925 Bacteria 858
887 Ga0207659_10000028 3300025926 Bacteria 130804
888 Ga0207659_10005491 3300025926 Bacteria 7691
889 Ga0207659_10116378 3300025926 Bacteria 2041
890 Ga0207659_10175416 3300025926 Bacteria 1694
891 Ga0207659_10339430 3300025926 Bacteria 1244
892 Ga0207687_10000061 3300025927 Bacteria 84113
893 Ga0207687_10005331 3300025927 Bacteria 8516
894 Ga0207687_10007575 3300025927 Bacteria 7138
895 Ga0207687_10022684 3300025927 Bacteria 4180
896 Ga0207687_10450883 3300025927 Bacteria 1067
897 Ga0207687_10507505 3300025927 Bacteria 1007
898 Ga0207687_10720039 3300025927 Bacteria 848
899 Ga0207687_11053289 3300025927 Bacteria 698
900 Ga0207700_10011806 3300025928 Bacteria 5592
901 Ga0207700_10046780 3300025928 Bacteria 3202
902 Ga0207700_10177925 3300025928 Bacteria 1779
903 Ga0207700_10339689 3300025928 Bacteria 1305
904 Ga0207700_10682471 3300025928 Bacteria 916
905 Ga0207700_11194624 3300025928 Bacteria 679
906 Ga0207664_10013880 3300025929 Bacteria 5802
907 Ga0207664_10115394 3300025929 Bacteria 2239
908 Ga0207664_10178240 3300025929 Bacteria 1823
909 Ga0207664_10490486 3300025929 Bacteria 1100
910 Ga0207664_10573945 3300025929 Bacteria 1012
911 Ga0207664_10675757 3300025929 Bacteria 928
912 Ga0207644_10000315 3300025931 Bacteria 31527
913 Ga0207644_10004323 3300025931 Bacteria 9212
914 Ga0207644_10037243 3300025931 Bacteria 3421
915 Ga0207644_10050456 3300025931 Bacteria 2982
916 Ga0207644_10076433 3300025931 Bacteria 2464
917 Ga0207644_10102567 3300025931 Bacteria 2152
918 Ga0207644_10139003 3300025931 Bacteria 1868
919 Ga0207644_10214173 3300025931 Bacteria 1524
920 Ga0207644_10419372 3300025931 Bacteria 1096
921 Ga0207644_10462366 3300025931 Bacteria 1043
922 Ga0207644_10928318 3300025931 Bacteria 730
923 Ga0207690_10000445 3300025932 Bacteria 26765
924 Ga0207690_10147077 3300025932 Bacteria 1743
925 Ga0207690_10276212 3300025932 Bacteria 1307
926 Ga0207690_10309347 3300025932 Bacteria 1239
927 Ga0207690_10354488 3300025932 Bacteria 1161
928 Ga0207706_10002206 3300025933 Bacteria 18992
929 Ga0207706_10013099 3300025933 Bacteria 7546
930 Ga0207706_10079703 3300025933 Bacteria 2879
931 Ga0207706_10237809 3300025933 Bacteria 1592
932 Ga0207706_10282642 3300025933 Bacteria 1447
933 Ga0207706_10757584 3300025933 Bacteria 827
934 Ga0207686_10005349 3300025934 Bacteria 6885
935 Ga0207686_10041334 3300025934 Bacteria 2810
936 Ga0207686_10046732 3300025934 Bacteria 2672
937 Ga0207686_10130116 3300025934 Bacteria 1725
938 Ga0207686_10158495 3300025934 Bacteria 1584
939 Ga0207686_10188844 3300025934 Bacteria 1467
940 Ga0207686_10556732 3300025934 Bacteria 897
941 Ga0207686_10597008 3300025934 Bacteria 868
942 Ga0207709_10000539 3300025935 Bacteria 32486
943 Ga0207709_10009571 3300025935 Bacteria 5333
944 Ga0207709_10039576 3300025935 Bacteria 2817
945 Ga0207709_10093036 3300025935 Bacteria 1975
946 Ga0207670_10000217 3300025936 Bacteria 37598
947 Ga0207670_10007816 3300025936 Bacteria 6001
948 Ga0207670_10017489 3300025936 Bacteria 4333
949 Ga0207670_10057141 3300025936 Bacteria 2645
950 Ga0207670_10128714 3300025936 Bacteria 1851
951 Ga0207670_11338456 3300025936 Bacteria 608
952 Ga0207669_10000147 3300025937 Bacteria 34031
953 Ga0207669_10131409 3300025937 Bacteria 1721
954 Ga0207669_10171732 3300025937 Bacteria 1544
955 Ga0207669_10311744 3300025937 Bacteria 1200
956 Ga0207669_10824754 3300025937 Bacteria 770
957 Ga0207704_10000299 3300025938 Bacteria 23415
958 Ga0207704_10087431 3300025938 Bacteria 2036
959 Ga0207704_10089534 3300025938 Bacteria 2017
960 Ga0207704_10318828 3300025938 Bacteria 1198
961 Ga0207665_10003176 3300025939 Bacteria 11002
962 Ga0207691_10001422 3300025940 Bacteria 23867
963 Ga0207691_10002033 3300025940 Bacteria 19787
964 Ga0207691_10036102 3300025940 Bacteria 4581
965 Ga0207691_10043403 3300025940 Bacteria 4144
966 Ga0207691_10046867 3300025940 Bacteria 3970
967 Ga0207691_10170354 3300025940 Bacteria 1907
968 Ga0207711_10046542 3300025941 Bacteria 3707
969 Ga0207711_10060307 3300025941 Bacteria 3269
970 Ga0207711_10096859 3300025941 Bacteria 2604
971 Ga0207711_10114309 3300025941 Bacteria 2403
972 Ga0207711_10173785 3300025941 Bacteria 1956
973 Ga0207711_11208138 3300025941 Bacteria 698
974 Ga0207711_11298004 3300025941 Bacteria 670
975 Ga0207689_10001029 3300025942 Bacteria 26794
976 Ga0207689_10004322 3300025942 Bacteria 12939
977 Ga0207689_10043505 3300025942 Bacteria 3713
978 Ga0207689_10247557 3300025942 Bacteria 1474
979 Ga0207661_10000215 3300025944 Bacteria 37435
980 Ga0207661_10849827 3300025944 Bacteria 840
981 Ga0207679_10000026 3300025945 Bacteria 200073
982 Ga0207679_10029628 3300025945 Bacteria 3812
983 Ga0207679_10098964 3300025945 Bacteria 2276
984 Ga0207679_10282282 3300025945 Bacteria 1424
985 Ga0207679_10335140 3300025945 Bacteria 1314
986 Ga0207679_10438990 3300025945 Bacteria 1156
987 Ga0207667_10038113 3300025949 Bacteria 5135
988 Ga0207667_10732242 3300025949 Bacteria 989
989 Ga0207651_10000342 3300025960 Bacteria 19828
990 Ga0207651_10040521 3300025960 Bacteria 3082
991 Ga0207651_10109456 3300025960 Bacteria 2070
992 Ga0207651_10178399 3300025960 Bacteria 1682
993 Ga0207651_10625163 3300025960 Bacteria 943
994 Ga0207651_11309614 3300025960 Bacteria 651
995 Ga0207712_10000686 3300025961 Bacteria 26195
996 Ga0207712_10053365 3300025961 Bacteria 2835
997 Ga0207712_10329654 3300025961 Bacteria 1262
998 Ga0207712_10405953 3300025961 Bacteria 1146
999 Ga0207712_10538073 3300025961 Bacteria 1003
1000 Ga0207712_11343125 3300025961 Bacteria 639
1001 Ga0207668_10000242 3300025972 Bacteria 36700
1002 Ga0207668_10113591 3300025972 Bacteria 2037
1003 Ga0207668_10164745 3300025972 Bacteria 1731
1004 Ga0207668_10720732 3300025972 Bacteria 878
1005 Ga0207668_11154731 3300025972 Bacteria 695
1006 Ga0207640_10000833 3300025981 Bacteria 17545
1007 Ga0207640_10345586 3300025981 Bacteria 1193
1008 Ga0207640_10532620 3300025981 Bacteria 984
1009 Ga0207640_10705337 3300025981 Bacteria 866
1010 Ga0207658_10016307 3300025986 Bacteria 5109
1011 Ga0207658_10109234 3300025986 Bacteria 2183
1012 Ga0207658_10119126 3300025986 Bacteria 2101
1013 Ga0207658_10255753 3300025986 Bacteria 1490
1014 Ga0207658_10367702 3300025986 Bacteria 1256
1015 Ga0207658_10415246 3300025986 Bacteria 1185
1016 Ga0207658_10416868 3300025986 Bacteria 1183
1017 Ga0207677_10009440 3300026023 Bacteria 5492
1018 Ga0207677_10016232 3300026023 Bacteria 4403
1019 Ga0207677_10025936 3300026023 Bacteria 3666
1020 Ga0207677_10247869 3300026023 Bacteria 1445
1021 Ga0207677_11072468 3300026023 Bacteria 733
1022 Ga0207677_11074279 3300026023 Bacteria 733
1023 Ga0207703_10003706 3300026035 Bacteria 12723
1024 Ga0207703_10004423 3300026035 Bacteria 11548
1025 Ga0207703_10022281 3300026035 Bacteria 4967
1026 Ga0207703_10132935 3300026035 Bacteria 2151
1027 Ga0207703_10192969 3300026035 Bacteria 1805
1028 Ga0207703_10240785 3300026035 Bacteria 1626
1029 Ga0207703_10858231 3300026035 Bacteria 868
1030 Ga0207703_11194252 3300026035 Bacteria 731
1031 Ga0207639_10061852 3300026041 Bacteria 2893
1032 Ga0207639_10163344 3300026041 Bacteria 1879
1033 Ga0207639_10321689 3300026041 Bacteria 1374
1034 Ga0207678_10001079 3300026067 Bacteria 24988
1035 Ga0207678_10004670 3300026067 Bacteria 12299
1036 Ga0207678_10111016 3300026067 Bacteria 2339
1037 Ga0207678_10280636 3300026067 Bacteria 1429
1038 Ga0207678_10495468 3300026067 Bacteria 1065
1039 Ga0207678_10862801 3300026067 Bacteria 800
1040 Ga0207678_10998087 3300026067 Bacteria 741
1041 Ga0207708_10000402 3300026075 Bacteria 34168
1042 Ga0207708_10000805 3300026075 Bacteria 23614
1043 Ga0207708_10061691 3300026075 Bacteria 2863
1044 Ga0207708_10103195 3300026075 Bacteria 2209
1045 Ga0207708_10165338 3300026075 Bacteria 1749
1046 Ga0207708_10236079 3300026075 Bacteria 1469
1047 Ga0207708_10312514 3300026075 Bacteria 1280
1048 Ga0207708_10345061 3300026075 Bacteria 1220
1049 Ga0207702_10002121 3300026078 Bacteria 19082
1050 Ga0207702_10576461 3300026078 Bacteria 1103
1051 Ga0207702_10824182 3300026078 Bacteria 918
1052 Ga0207641_10004016 3300026088 Bacteria 12839
1053 Ga0207641_10005860 3300026088 Bacteria 10427
1054 Ga0207641_10071199 3300026088 Bacteria 2990
1055 Ga0207641_10105193 3300026088 Bacteria 2492
1056 Ga0207641_10703584 3300026088 Bacteria 995
1057 Ga0207641_11430580 3300026088 Bacteria 692
1058 Ga0207648_10000731 3300026089 Bacteria 36792
1059 Ga0207648_10001024 3300026089 Bacteria 31454
1060 Ga0207648_10011630 3300026089 Bacteria 8283
1061 Ga0207648_10026793 3300026089 Bacteria 5120
1062 Ga0207648_10114086 3300026089 Bacteria 2374
1063 Ga0207648_10468162 3300026089 Bacteria 1150
1064 Ga0207648_11085301 3300026089 Bacteria 751
1065 Ga0207676_10000361 3300026095 Bacteria 38795
1066 Ga0207676_10005133 3300026095 Bacteria 9268
1067 Ga0207676_10006308 3300026095 Bacteria 8373
1068 Ga0207676_10034200 3300026095 Bacteria 3847
1069 Ga0207676_10797133 3300026095 Bacteria 921
1070 Ga0207676_11503009 3300026095 Bacteria 670
1071 Ga0207674_10002121 3300026116 Bacteria 25067
1072 Ga0207674_10035134 3300026116 Bacteria 5232
1073 Ga0207675_100001489 3300026118 Bacteria 23488
1074 Ga0207675_100160388 3300026118 Bacteria 2145
1075 Ga0207675_100226310 3300026118 Bacteria 1803
1076 Ga0207675_100610024 3300026118 Bacteria 1095
1077 Ga0207675_100679416 3300026118 Bacteria 1037
1078 Ga0207675_102301118 3300026118 Bacteria 553
1079 Ga0207683_10000034 3300026121 Bacteria 101817
1080 Ga0207683_10003078 3300026121 Bacteria 14580
1081 Ga0207683_10004966 3300026121 Bacteria 11439
1082 Ga0207683_10006107 3300026121 Bacteria 10314
1083 Ga0207683_10029889 3300026121 Bacteria 4718
1084 Ga0207683_10060242 3300026121 Bacteria 3337
1085 Ga0207683_10078712 3300026121 Bacteria 2922
1086 Ga0207683_10319098 3300026121 Bacteria 1423
1087 Ga0207698_10000304 3300026142 Bacteria 29523
1088 Ga0207698_10007558 3300026142 Bacteria 6814
1089 Ga0209969_1047040 3300027360 Bacteria 674
1090 Ga0209984_1015339 3300027424 Bacteria 1018
1091 Ga0209179_1001721 3300027512 Bacteria 2771
1092 Ga0209999_1043036 3300027543 Bacteria 847
1093 Ga0209970_1018131 3300027614 Bacteria 1181
1094 Ga0210002_1002675 3300027617 Bacteria 2580
1095 Ga0210002_1018765 3300027617 Bacteria 1107
1096 Ga0209983_1014143 3300027665 Bacteria 1644
1097 Ga0209971_1018583 3300027682 Bacteria 1650
1098 Ga0209966_1017019 3300027695 Bacteria 1381
1099 Ga0209974_10030139 3300027876 Bacteria 1798
1100 Ga0207428_10000082 3300027907 Bacteria 133684
1101 Ga0207428_10000352 3300027907 Bacteria 59444
1102 Ga0207428_10001078 3300027907 Bacteria 29769
1103 Ga0207428_10123404 3300027907 Bacteria 1984
1104 Ga0207428_10186406 3300027907 Bacteria 1565
1105 Ga0207428_11068626 3300027907 Bacteria 565
1106 Ga0265357_1001279 3300028023 Bacteria 1804
1107 Ga0268266_10067461 3300028379 Bacteria 3096
1108 Ga0268266_10208955 3300028379 Bacteria 1789
1109 Ga0268266_10565528 3300028379 Bacteria 1090
1110 Ga0268266_10835032 3300028379 Bacteria 890
1111 Ga0268266_11001423 3300028379 Bacteria 809
1112 Ga0268266_11279981 3300028379 Bacteria 708
1113 Ga0268265_10001338 3300028380 Bacteria 21019
1114 Ga0268265_10041815 3300028380 Bacteria 3395
1115 Ga0268265_10043339 3300028380 Bacteria 3344
1116 Ga0268265_10117825 3300028380 Bacteria 2182
1117 Ga0268265_10450453 3300028380 Bacteria 1202
1118 Ga0268264_10002557 3300028381 Bacteria 15953
1119 Ga0268264_10083174 3300028381 Bacteria 2741
1120 Ga0268264_10145082 3300028381 Bacteria 2121
1121 Ga0268264_10145696 3300028381 Bacteria 2117
1122 Ga0268264_10315800 3300028381 Bacteria 1476
1123 Ga0268264_10515928 3300028381 Bacteria 1168
1124 Ga0265338_10050615 3300028800 Bacteria 3752
1125 Ga0265763_1000492 3300030763 Bacteria 2409
1126 Ga0265760_10043066 3300031090 Bacteria 1349
1127 Ga0265330_10005052 3300031235 Bacteria 6619
1128 Ga0265330_10095799 3300031235 Bacteria 1272
1129 Ga0265320_10032922 3300031240 Bacteria 2649
1130 Ga0265325_10019046 3300031241 Bacteria 3800
1131 Ga0265325_10042332 3300031241 Bacteria 2382
1132 Ga0265325_10044431 3300031241 Bacteria 2314
1133 Ga0265325_10053225 3300031241 Bacteria 2076
1134 Ga0265325_10137699 3300031241 Bacteria 1163
1135 Ga0265340_10050661 3300031247 Bacteria 2013
1136 Ga0265340_10072991 3300031247 Bacteria 1624
1137 Ga0265340_10084274 3300031247 Bacteria 1493
1138 Ga0265340_10100636 3300031247 Bacteria 1343
1139 Ga0265340_10395328 3300031247 Bacteria 610
1140 Ga0265339_10000038 3300031249 Bacteria 121961
1141 Ga0265339_10214584 3300031249 Bacteria 944
1142 Ga0265316_10249840 3300031344 Bacteria 1302
1143 Ga0265316_10254199 3300031344 Bacteria 1289
1144 Ga0307509_10101962 3300031507 Bacteria 2903
1145 Ga0265313_10000024 3300031595 Bacteria 138587
1146 Ga0265313_10026585 3300031595 Bacteria 3045
1147 Ga0265313_10073254 3300031595 Bacteria 1573
1148 Ga0265314_10027960 3300031711 Bacteria 4213
1149 Ga0265314_10077978 3300031711 Bacteria 2195
1150 Ga0265342_10018522 3300031712 Bacteria 4508
1151 Ga0265342_10062783 3300031712 Bacteria 2185
1152 Ga0265342_10249450 3300031712 Bacteria 948
1153 Ga0307415_100754611 3300032126 Bacteria 884
1154 Ga0307510_10236811 3300033180 Bacteria 1323
1155 Ga0373930_0000071 3300034816 Bacteria 9894
1156 Ga0373930_0004752 3300034816 Bacteria 2227
1157 Ga0373948_0000973 3300034817 Bacteria 3841
1158 Ga0373948_0001393 3300034817 Bacteria 3335
1159 Ga0373948_0115717 3300034817 Bacteria 644
1160 Ga0373950_0005539 3300034818 Bacteria 1891
1161 Ga0373950_0007843 3300034818 Bacteria 1666
1162 Ga0373958_0000121 3300034819 Bacteria 8561
1163 Ga0373959_0000829 3300034820 Bacteria 5275
1164 Ga0373938_0000045 3300034957 Bacteria 16308
1165 Ga0373938_0000596 3300034957 Bacteria 5820
1166 Ga0373938_0016059 3300034957 Bacteria 1458
1167 Ga0373926_0007448 3300035083 Bacteria 3645
1168 Ga0373926_0019770 3300035083 Bacteria 2323
1169 Ga0373926_0146990 3300035083 Bacteria 896
1170 Ga0373928_0003385 3300035084 Bacteria 3039
1171 Ga0373928_0007898 3300035084 Bacteria 2060
1172 Ga0373928_0082680 3300035084 Bacteria 812
1173 Ga0373929_0002006 3300035085 Bacteria 3799
1174 Ga0373929_0002397 3300035085 Bacteria 3443
1175 Ga0373934_0125439 3300035086 Bacteria 1045
1176 Ga0373940_0001266 3300035088 Bacteria 4492
1177 Ga0373940_0003018 3300035088 Bacteria 3372
1178 Ga0373940_0229517 3300035088 Bacteria 619
1179 Ga0373944_0001324 3300035089 Bacteria 6229
1180 Ga0373944_0002080 3300035089 Bacteria 5078
1181 Ga0373944_0016887 3300035089 Bacteria 2065
1182 Ga0373944_0018572 3300035089 Bacteria 1987
1183 Ga0373944_0026693 3300035089 Bacteria 1708
1184 Ga0373949_0011925 3300035090 Bacteria 1918
1185 Ga0373949_0018081 3300035090 Bacteria 1595
1186 Ga0373949_0028499 3300035090 Bacteria 1318
1187 Ga0373951_0000695 3300035091 Bacteria 9241
1188 Ga0373951_0001161 3300035091 Bacteria 6967
1189 Ga0373952_0000221 3300035092 Bacteria 9091
1190 Ga0373952_0008157 3300035092 Bacteria 1981
1191 Ga0373952_0034910 3300035092 Bacteria 1136
1192 Ga0373952_0051529 3300035092 Bacteria 983
1193 Ga0373923_0005448 3300035111 Bacteria 4320
1194 Ga0373923_0040902 3300035111 Bacteria 1909
1195 Ga0373923_0044802 3300035111 Bacteria 1836
1196 Ga0373923_0233118 3300035111 Bacteria 858
1197 Ga0373932_0013379 3300035112 Bacteria 2039
1198 Ga0373932_0102803 3300035112 Bacteria 932
1199 Ga0373936_0008182 3300035113 Bacteria 3931
1200 Ga0373939_0000875 3300035114 Bacteria 7460
1201 Ga0373939_0001533 3300035114 Bacteria 5602
1202 Ga0373939_0022941 3300035114 Bacteria 1725
1203 Ga0373939_0071713 3300035114 Bacteria 1129
1204 Ga0373939_0110451 3300035114 Bacteria 957
1205 Ga0373941_0001970 3300035115 Bacteria 4455
1206 Ga0373941_0002983 3300035115 Bacteria 3785
1207 Ga0373941_0016817 3300035115 Bacteria 1994
1208 Ga0373945_0000864 3300035116 Bacteria 8930
1209 Ga0373945_0009003 3300035116 Bacteria 3264
1210 Ga0373945_0020170 3300035116 Bacteria 2279
1211 Ga0373953_0054304 3300035117 Bacteria 1625
1212 Ga0373954_0005098 3300035118 Bacteria 5669
1213 Ga0373954_0010833 3300035118 Bacteria 4031
1214 Ga0373954_0049150 3300035118 Bacteria 1977
1215 Ga0373954_0194610 3300035118 Bacteria 996
1216 Ga0373956_0016870 3300035119 Bacteria 3070
1217 Ga0373956_0028034 3300035119 Bacteria 2449
1218 Ga0373956_0140542 3300035119 Bacteria 1133
1219 Ga0373956_0167932 3300035119 Bacteria 1035
1220 Ga0373960_0000083 3300035121 Bacteria 14021
1221 Ga0373960_0000603 3300035121 Bacteria 7339
1222 Ga0373960_0008857 3300035121 Bacteria 2424
1223 Ga0373943_0000495 3300035170 Bacteria 16817
1224 Ga0373943_0002515 3300035170 Bacteria 8335
1225 Ga0373943_0005818 3300035170 Bacteria 5538
1226 Ga0373943_0284352 3300035170 Bacteria 936
1227 Ga0373943_0320509 3300035170 Bacteria 883
1228 Ga0373943_0766463 3300035170 Bacteria 573
1229 Ga0373946_0003328 3300035171 Bacteria 5709
1230 Ga0373946_0068619 3300035171 Bacteria 1525
1231 Ga0373946_0235345 3300035171 Bacteria 889
1232 Ga0373946_0281112 3300035171 Bacteria 819
1233 Ga0373946_0309880 3300035171 Bacteria 782
1234 Ga0373955_0002872 3300035172 Bacteria 7553
1235 Ga0373955_0189850 3300035172 Bacteria 1221
1236 Ga0373942_0000535 3300035207 Bacteria 10652
1237 Ga0373942_0143317 3300035207 Bacteria 762
1238 Ga0373961_0000559 3300035241 Bacteria 14060
1239 Ga0373961_0003814 3300035241 Bacteria 3685
1240 Ga0373961_0162762 3300035241 Bacteria 767
1241 Ga0373962_0000468 3300035242 Bacteria 8934
1242 Ga0373962_0191028 3300035242 Bacteria 689
1243 Ga0373924_0018184 3300035410 Bacteria 2706
1244 Ga0373924_0036321 3300035410 Bacteria 2002
1245 Ga0373924_0180865 3300035410 Bacteria 928
1246 Ga0373924_0182108 3300035410 Bacteria 925
1247 Ga0373931_0000179 3300035691 Bacteria 27558
1248 Ga0373931_0003177 3300035691 Bacteria 7329
1249 Ga0373931_0006218 3300035691 Bacteria 5567
1250 Ga0373931_0007820 3300035691 Bacteria 5052
1251 Ga0373931_0031022 3300035691 Bacteria 2755
1252 Ga0373931_0222194 3300035691 Bacteria 1138
1253 Ga0373931_0329166 3300035691 Bacteria 951
1254 Ga0373935_0001447 3300035692 Bacteria 13168
1255 Ga0373935_0011857 3300035692 Bacteria 5236
1256 Ga0373935_0013245 3300035692 Bacteria 4974
1257 Ga0373935_0016312 3300035692 Bacteria 4496
1258 Ga0373935_0026703 3300035692 Bacteria 3566
1259 Ga0373935_0056648 3300035692 Bacteria 2500
1260 Ga0373935_0075674 3300035692 Bacteria 2178
1261 Ga0373935_0090757 3300035692 Bacteria 2000
1262 Ga0373927_0012133 3300035695 Bacteria 5733
1263 Ga0373927_0012650 3300035695 Bacteria 5615
1264 Ga0373927_0014596 3300035695 Bacteria 5196
1265 Ga0373927_0050471 3300035695 Bacteria 2690
1266 Ga0373927_0061598 3300035695 Bacteria 2427
1267 Ga0373927_0200607 3300035695 Bacteria 1310
1268 Ga0373927_0425576 3300035695 Bacteria 876
1269 Ga0373927_0467785 3300035695 Bacteria 833
1270 Ga0373933_0001759 3300035724 Bacteria 12567
1271 Ga0373933_0079735 3300035724 Bacteria 2005
1272 Ga0373933_0248448 3300035724 Bacteria 1145
1273 Ga0373947_0006073 3300035725 Bacteria 7039
1274 Ga0373947_0011475 3300035725 Bacteria 5082
1275 Ga0373947_0016850 3300035725 Bacteria 4197
1276 Ga0373947_0025028 3300035725 Bacteria 3480
1277 Ga0373947_0040583 3300035725 Bacteria 2772
1278 Ga0373947_0041211 3300035725 Bacteria 2753
1279 Ga0373947_0136493 3300035725 Bacteria 1570
1280 Ga0373947_0175701 3300035725 Bacteria 1392
1281 Ga0373947_0175759 3300035725 Bacteria 1391
1282 Ga0373947_0181389 3300035725 Bacteria 1371
1283 Ga0373947_0251069 3300035725 Bacteria 1170
1284 Ga0373947_0885215 3300035725 Bacteria 609
1285 Ga0373937_0000879 3300036401 Bacteria 25733
1286 Ga0373937_0002919 3300036401 Bacteria 14290
1287 Ga0373937_0035288 3300036401 Bacteria 4551
1288 Ga0373937_0112018 3300036401 Bacteria 2538
1289 Ga0373937_0495606 3300036401 Bacteria 1160
1290 Ga0373937_0907610 3300036401 Bacteria 830
1291 Ga0373925_0001617 3300037068 Bacteria 19021
1292 Ga0373925_0006666 3300037068 Bacteria 8472
1293 Ga0373925_0022396 3300037068 Bacteria 4607
1294 Ga0373925_0029354 3300037068 Bacteria 4035
1295 Ga0373925_0035293 3300037068 Bacteria 3688
1296 Ga0373925_0113908 3300037068 Bacteria 2092
1297 Ga0373925_0252494 3300037068 Bacteria 1415
1298 Ga0373925_0402657 3300037068 Bacteria 1116
1299 Ga0373925_0854115 3300037068 Bacteria 750
1300 Ga0395899_0085676 3300037312 Bacteria 2289
1301 Ga0395899_0144780 3300037312 Bacteria 1688
1302 Ga0395900_0023880 3300037418 Bacteria 6256
1303 Ga0395900_0131108 3300037418 Bacteria 2569
1304 Ga0395900_0230984 3300037418 Bacteria 1860
1305 Ga0395900_1237273 3300037418 Bacteria 661
1306 Ga0395898_0081299 3300037466 Bacteria 3124
1307 Ga0395898_0081808 3300037466 Bacteria 3113
1308 Ga0395898_0564552 3300037466 Bacteria 1080
1309 Ga0436364_0959530 3300037853 Bacteria 538
1310 Ga0436364_1094525 3300037853 Bacteria 1356
1311 Ga0395901_0019584 3300038443 Bacteria 6917
1312 Ga0395901_0354348 3300038443 Bacteria 1514
1313 Ga0395901_0734638 3300038443 Bacteria 981
1314 Ga0242420_013473 3300038996 Bacteria 1394
1315 Ga0436365_0269478 3300039437 Bacteria 987
1316 Ga0436365_0734273 3300039437 Bacteria 597
1317 Ga0436365_1273664 3300039437 Bacteria 1608
1318 Ga0436365_1457423 3300039437 Bacteria 637
1319 Ga0436361_0387528 3300039447 Bacteria 2796
1320 Ga0436363_0395586 3300039450 Bacteria 556
1321 Ga0436363_1335842 3300039450 Bacteria 1238
1322 Ga0436362_0848397 3300039453 Bacteria 920
1323 Ga0436362_0918289 3300039453 Bacteria 1871
1324 Ga0451855_1662702 3300041511 Bacteria 708
1325 Ga0439441_029652 3300042001 Bacteria 1054
1326 Ga0439448_0273864 3300042005 Bacteria 598
1327 Ga0439455_0004911 3300042012 Bacteria 2683
1328 Ga0439435_0032947 3300042436 Bacteria 1416
1329 Ga0439464_0040350 3300042439 Bacteria 1329
1330 Ga0451577_0017275 3300042876 Bacteria 6667
1331 Ga0466966_0155782 3300044684 Bacteria 1392
1332 Ga0466963_0003423 3300044694 Bacteria 9082
1333 Ga0466963_0872086 3300044694 Bacteria 634
1334 Ga0453684_0099623 3300044712 Bacteria 3559
1335 Ga0466957_0065995 3300044842 Bacteria 2230
1336 Ga0466959_0025838 3300045049 Bacteria 4355
1337 Ga0451576_0004698 3300045051 Bacteria 17570
1338 Ga0466958_0162709 3300045836 Bacteria 1410
1339 Ga0466967_0013163 3300045976 Bacteria 6376
1340 Ga0466967_0130319 3300045976 Bacteria 2334
1341 Ga0466967_2109600 3300045976 Bacteria 560
1342 Ga0495627_053486 3300046453 Bacteria 1209
1343 Ga0495592_0002436 3300046454 Bacteria 13110
1344 Ga0495592_0007150 3300046454 Bacteria 8358
1345 Ga0495592_0096465 3300046454 Bacteria 2113
1346 Ga0495592_0102143 3300046454 Bacteria 2042
1347 Ga0495592_0143210 3300046454 Bacteria 1660
1348 Ga0495603_0104580 3300046455 Bacteria 1652
1349 Ga0495603_0145180 3300046455 Bacteria 1379
1350 Ga0495603_0293723 3300046455 Bacteria 933
1351 Ga0495590_0031561 3300046457 Bacteria 1855
1352 Ga0495629_0000062 3300046459 Bacteria 97169
1353 Ga0495629_0001750 3300046459 Bacteria 17025
1354 Ga0495629_0041665 3300046459 Bacteria 3230
1355 Ga0495629_0125312 3300046459 Bacteria 1789
1356 Ga0495629_0129739 3300046459 Bacteria 1756
1357 Ga0495638_0024772 3300046460 Bacteria 3906
1358 Ga0495638_0084360 3300046460 Bacteria 1923
1359 Ga0495641_0005493 3300046461 Bacteria 8539
1360 Ga0495641_0020006 3300046461 Bacteria 3408
1361 Ga0495641_0055349 3300046461 Bacteria 1801
1362 Ga0495651_0010900 3300046462 Bacteria 6992
1363 Ga0495651_0024994 3300046462 Bacteria 4647
1364 Ga0495651_0305596 3300046462 Bacteria 1065
1365 Ga0495653_0004420 3300046463 Bacteria 11365
1366 Ga0495653_0007557 3300046463 Bacteria 8883
1367 Ga0495653_0041279 3300046463 Bacteria 3602
1368 Ga0495653_0069293 3300046463 Bacteria 2643
1369 Ga0495653_0096530 3300046463 Bacteria 2149
1370 Ga0495653_0112840 3300046463 Bacteria 1950
1371 Ga0495653_0784541 3300046463 Bacteria 574
1372 Ga0495650_0066495 3300046471 Bacteria 1427
1373 Ga0495580_0018212 3300046472 Bacteria 5232
1374 Ga0495580_0044691 3300046472 Bacteria 3149
1375 Ga0495580_0124303 3300046472 Bacteria 1790
1376 Ga0495580_0173200 3300046472 Bacteria 1491
1377 Ga0495580_0493037 3300046472 Bacteria 818
1378 Ga0495580_0770081 3300046472 Bacteria 626
1379 Ga0495582_0015348 3300046473 Bacteria 4208
1380 Ga0495582_0032548 3300046473 Bacteria 2867
1381 Ga0495582_0044598 3300046473 Bacteria 2442
1382 Ga0495582_0074327 3300046473 Bacteria 1881
1383 Ga0495582_0115906 3300046473 Bacteria 1507
1384 Ga0495582_0172048 3300046473 Bacteria 1233
1385 Ga0495605_0327874 3300046474 Bacteria 644
1386 Ga0495639_0002473 3300046475 Bacteria 8064
1387 Ga0495639_0034490 3300046475 Bacteria 2264
1388 Ga0495639_0078819 3300046475 Bacteria 1531
1389 Ga0495639_0108288 3300046475 Bacteria 1316
1390 Ga0495662_0000962 3300046476 Bacteria 14098
1391 Ga0495662_0037814 3300046476 Bacteria 2331
1392 Ga0495662_0120058 3300046476 Bacteria 1290
1393 Ga0495662_0161514 3300046476 Bacteria 1104
1394 Ga0495662_0185742 3300046476 Bacteria 1025
1395 Ga0495664_0000189 3300046477 Bacteria 30129
1396 Ga0495664_0006433 3300046477 Bacteria 6488
1397 Ga0495664_0024821 3300046477 Bacteria 3486
1398 Ga0495664_0099102 3300046477 Bacteria 1755
1399 Ga0495664_0117122 3300046477 Bacteria 1610
1400 Ga0495664_0311291 3300046477 Bacteria 950
1401 Ga0495584_0012696 3300046491 Bacteria 4299
1402 Ga0495584_0048106 3300046491 Bacteria 2151
1403 Ga0495584_0104741 3300046491 Bacteria 1430
1404 Ga0495585_0000389 3300046492 Bacteria 42431
1405 Ga0495585_0152789 3300046492 Bacteria 1203
1406 Ga0495585_0436454 3300046492 Bacteria 627
1407 Ga0495594_0016941 3300046499 Bacteria 3844
1408 Ga0495594_0025270 3300046499 Bacteria 3192
1409 Ga0495594_0080024 3300046499 Bacteria 1824
1410 Ga0495594_0187089 3300046499 Bacteria 1179
1411 Ga0495596_0185206 3300046500 Bacteria 809
1412 Ga0495607_0060180 3300046501 Bacteria 2163
1413 Ga0495583_0077837 3300046506 Bacteria 1446
1414 Ga0495608_0000129 3300046511 Bacteria 53862
1415 Ga0495608_0000211 3300046511 Bacteria 41989
1416 Ga0495608_0017027 3300046511 Bacteria 5029
1417 Ga0495608_0020973 3300046511 Bacteria 4488
1418 Ga0495610_0029915 3300046512 Bacteria 2861
1419 Ga0495616_0028133 3300046513 Bacteria 2978
1420 Ga0495616_0211038 3300046513 Bacteria 849
1421 Ga0495618_0003211 3300046514 Bacteria 10242
1422 Ga0495618_0017692 3300046514 Bacteria 4374
1423 Ga0495618_0025062 3300046514 Bacteria 3700
1424 Ga0495618_0033993 3300046514 Bacteria 3196
1425 Ga0495618_0131110 3300046514 Bacteria 1604
1426 Ga0495618_0429287 3300046514 Bacteria 805
1427 Ga0495628_0018229 3300046516 Bacteria 5819
1428 Ga0495628_0036943 3300046516 Bacteria 3917
1429 Ga0495628_0083997 3300046516 Bacteria 2471
1430 Ga0495630_0102387 3300046517 Bacteria 2166
1431 Ga0495630_0111143 3300046517 Bacteria 2075
1432 Ga0495630_0129373 3300046517 Bacteria 1917
1433 Ga0495630_0137207 3300046517 Bacteria 1859
1434 Ga0495630_0819635 3300046517 Bacteria 710
1435 Ga0495631_0064308 3300046518 Bacteria 1588
1436 Ga0495631_0107876 3300046518 Bacteria 1197
1437 Ga0495631_0336054 3300046518 Bacteria 643
1438 Ga0495632_0025840 3300046519 Bacteria 3100
1439 Ga0495637_0151845 3300046520 Bacteria 873
1440 Ga0495644_0024051 3300046523 Bacteria 2317
1441 Ga0495663_0053732 3300046525 Bacteria 1253
1442 Ga0495666_0012091 3300046526 Bacteria 4308
1443 Ga0495666_0430498 3300046526 Bacteria 592
1444 Ga0495642_0092993 3300046528 Bacteria 1278
1445 Ga0495652_0013892 3300046529 Bacteria 7242
1446 Ga0495652_0015272 3300046529 Bacteria 6872
1447 Ga0495652_0018248 3300046529 Bacteria 6258
1448 Ga0495652_0020765 3300046529 Bacteria 5836
1449 Ga0495652_0084991 3300046529 Bacteria 2601
1450 Ga0495652_0294112 3300046529 Bacteria 1183
1451 Ga0495652_0353504 3300046529 Bacteria 1052
1452 Ga0495652_0375123 3300046529 Bacteria 1013
1453 Ga0495654_0314819 3300046530 Bacteria 636
1454 Ga0495665_0012108 3300046531 Bacteria 4670
1455 Ga0495665_0025783 3300046531 Bacteria 3156
1456 Ga0495665_0078236 3300046531 Bacteria 1740
1457 Ga0495665_0178315 3300046531 Bacteria 1105
1458 Ga0495665_0216904 3300046531 Bacteria 990
1459 Ga0495665_0384828 3300046531 Bacteria 712
1460 Ga0495665_0432361 3300046531 Bacteria 666
1461 Ga0495640_0005586 3300046533 Bacteria 9999
1462 Ga0495640_0019882 3300046533 Bacteria 4952
1463 Ga0495640_0029004 3300046533 Bacteria 3978
1464 Ga0495640_0079142 3300046533 Bacteria 2189
1465 Ga0495640_0116148 3300046533 Bacteria 1743
1466 Ga0495640_0316264 3300046533 Bacteria 967
1467 Ga0495586_0001909 3300046535 Bacteria 11352
1468 Ga0495586_0249930 3300046535 Bacteria 1011
1469 Ga0495587_0001060 3300046536 Bacteria 18094
1470 Ga0495587_0001528 3300046536 Bacteria 15392
1471 Ga0495587_0004785 3300046536 Bacteria 8891
1472 Ga0495598_0000638 3300046537 Bacteria 6595
1473 Ga0495598_0001355 3300046537 Bacteria 4813
1474 Ga0495598_0016448 3300046537 Bacteria 1887
1475 Ga0495598_0027619 3300046537 Bacteria 1567
1476 Ga0495621_0037851 3300046539 Bacteria 1680
1477 Ga0495621_0166383 3300046539 Bacteria 874
1478 Ga0495645_0008141 3300046543 Bacteria 7311
1479 Ga0495645_0008998 3300046543 Bacteria 6973
1480 Ga0495645_0051727 3300046543 Bacteria 2989
1481 Ga0495645_0142765 3300046543 Bacteria 1669
1482 Ga0495622_0010569 3300046557 Bacteria 4260
1483 Ga0495622_0054345 3300046557 Bacteria 1858
1484 Ga0495633_0005189 3300046558 Bacteria 8047
1485 Ga0495633_0050481 3300046558 Bacteria 1961
1486 Ga0495633_0066883 3300046558 Bacteria 1678
1487 Ga0495667_0007026 3300046559 Bacteria 7639
1488 Ga0495667_0010190 3300046559 Bacteria 6362
1489 Ga0495667_0095260 3300046559 Bacteria 1927
1490 Ga0495667_0187771 3300046559 Bacteria 1325
1491 Ga0495667_0229094 3300046559 Bacteria 1185
1492 Ga0495667_0394957 3300046559 Bacteria 871
1493 Ga0495667_0452474 3300046559 Bacteria 807
1494 Ga0495656_0011646 3300046615 Bacteria 3230
1495 Ga0495656_0021894 3300046615 Bacteria 2495
1496 Ga0495656_0035144 3300046615 Bacteria 2057
1497 Ga0495656_0059229 3300046615 Bacteria 1665
1498 Ga0495656_0444706 3300046615 Bacteria 682
1499 Ga0495668_0060612 3300046616 Bacteria 2087
1500 Ga0495668_0296886 3300046616 Bacteria 886
1501 Ga0495634_0001707 3300046642 Bacteria 19103
1502 Ga0495634_0017126 3300046642 Bacteria 5175
1503 Ga0495634_0043617 3300046642 Bacteria 3039
1504 Ga0495634_0048148 3300046642 Bacteria 2870
1505 Ga0495634_0079499 3300046642 Bacteria 2147
1506 Ga0495634_0166852 3300046642 Bacteria 1385
1507 Ga0495611_0049562 3300046648 Bacteria 1890
1508 Ga0495611_0066725 3300046648 Bacteria 1641
1509 Ga0495625_0236050 3300046660 Bacteria 1192
1510 Ga0495635_0000992 3300046663 Bacteria 18708
1511 Ga0495635_0024646 3300046663 Bacteria 4192
1512 Ga0495635_0116288 3300046663 Bacteria 1825
1513 Ga0495635_0126292 3300046663 Bacteria 1744
1514 Ga0495635_0156279 3300046663 Bacteria 1552
1515 Ga0495635_0681209 3300046663 Bacteria 668
1516 Ga0495659_0018351 3300046664 Bacteria 2330
1517 Ga0495661_0038158 3300046665 Bacteria 2995
1518 Ga0495661_0137091 3300046665 Bacteria 1335
1519 Ga0495588_0011027 3300046674 Bacteria 4229
1520 Ga0495588_0062823 3300046674 Bacteria 1925
1521 Ga0495657_0030110 3300046675 Bacteria 3803
1522 Ga0495657_0044613 3300046675 Bacteria 3015
1523 Ga0495657_0694016 3300046675 Bacteria 585
1524 Ga0495599_0000294 3300046678 Bacteria 30376
1525 Ga0495599_0018705 3300046678 Bacteria 4317
1526 Ga0495599_0182320 3300046678 Bacteria 1294
1527 Ga0495599_0272105 3300046678 Bacteria 1027
1528 Ga0495623_0000917 3300046679 Bacteria 19934
1529 Ga0495623_0001158 3300046679 Bacteria 17853
1530 Ga0495623_0085534 3300046679 Bacteria 1945
1531 Ga0495623_0277799 3300046679 Bacteria 933
1532 Ga0495646_0010253 3300046680 Bacteria 5959
1533 Ga0495646_0036805 3300046680 Bacteria 3030
1534 Ga0495646_0231068 3300046680 Bacteria 997
1535 Ga0495646_0693977 3300046680 Bacteria 512
1536 Ga0495647_0186840 3300046681 Bacteria 904
1537 Ga0495658_0000109 3300046683 Bacteria 43760
1538 Ga0495658_0009239 3300046683 Bacteria 4903
1539 Ga0495658_0056757 3300046683 Bacteria 2234
1540 Ga0495658_0161264 3300046683 Bacteria 1383
1541 Ga0495658_0178293 3300046683 Bacteria 1317
1542 Ga0495658_0182701 3300046683 Bacteria 1302
1543 Ga0495658_0301501 3300046683 Bacteria 1013
1544 Ga0495658_0421583 3300046683 Bacteria 851
1545 Ga0495669_0033673 3300046684 Bacteria 2256
1546 Ga0495669_0104408 3300046684 Bacteria 1318
1547 Ga0495613_0047267 3300046689 Bacteria 3179
1548 Ga0495613_0078612 3300046689 Bacteria 2399
1549 Ga0495613_0164945 3300046689 Bacteria 1574
1550 Ga0495624_0006136 3300046690 Bacteria 8557
1551 Ga0495624_0018920 3300046690 Bacteria 4602
1552 Ga0495624_0029472 3300046690 Bacteria 3581
1553 Ga0495624_0667125 3300046690 Bacteria 618
1554 Ga0495670_0000106 3300046691 Bacteria 37100
1555 Ga0495670_0034922 3300046691 Bacteria 2505
1556 Ga0495670_0043654 3300046691 Bacteria 2237
1557 Ga0495671_0081344 3300046692 Bacteria 1587
1558 Ga0495671_0406879 3300046692 Bacteria 651
1559 Ga0495649_0291153 3300046694 Bacteria 833
1560 Ga0495589_0089818 3300046794 Bacteria 1492
1561 Ga0495600_0000977 3300046809 Bacteria 15417
1562 Ga0495600_0034212 3300046809 Bacteria 3298
1563 Ga0495600_0036076 3300046809 Bacteria 3213
1564 Ga0495600_0057594 3300046809 Bacteria 2538
1565 Ga0495660_0080202 3300046810 Bacteria 1713
1566 Ga0495581_0001433 3300047315 Bacteria 13240
1567 Ga0495581_0015600 3300047315 Bacteria 4409
1568 Ga0495581_0224555 3300047315 Bacteria 1098
1569 Ga0495581_0658084 3300047315 Bacteria 605
1570 Ga0495604_0000360 3300047317 Bacteria 40805
1571 Ga0495604_0001139 3300047317 Bacteria 22028
1572 Ga0495604_0007197 3300047317 Bacteria 8815
1573 Ga0495636_0429436 3300047318 Bacteria 632
1574 Ga0495674_0004987 3300047319 Bacteria 12769
1575 Ga0495674_0009292 3300047319 Bacteria 9344
1576 Ga0495674_0010157 3300047319 Bacteria 8918
1577 Ga0495674_0062334 3300047319 Bacteria 3247
1578 Ga0495674_0194812 3300047319 Bacteria 1683
1579 Ga0495674_0784197 3300047319 Bacteria 742
1580 Ga0495672_0178250 3300047320 Bacteria 1078
1581 Ga0495676_0057669 3300047321 Bacteria 3060
1582 Ga0495676_0133868 3300047321 Bacteria 1785
1583 Ga0495676_0153929 3300047321 Bacteria 1633
1584 Ga0495676_0210268 3300047321 Bacteria 1346
1585 Ga0495680_0001204 3300047322 Bacteria 28378
1586 Ga0495680_0003174 3300047322 Bacteria 16366
1587 Ga0495680_0039181 3300047322 Bacteria 3781
1588 Ga0495680_0154706 3300047322 Bacteria 1669
1589 Ga0495680_0345769 3300047322 Bacteria 1036
1590 Ga0495675_0000190 3300047444 Bacteria 44968
1591 Ga0495675_0021034 3300047444 Bacteria 4154
1592 Ga0495675_0280884 3300047444 Bacteria 993
1593 Ga0495677_0024077 3300047445 Bacteria 2209
1594 Ga0495679_086459 3300047446 Bacteria 884
1595 Ga0495685_147016 3300047447 Bacteria 766
1596 Ga0495681_0026789 3300047470 Bacteria 2993
1597 Ga0495684_0004759 3300047471 Bacteria 10606
1598 Ga0495684_0004792 3300047471 Bacteria 10562
1599 Ga0495684_0039855 3300047471 Bacteria 3601
1600 Ga0495684_0050344 3300047471 Bacteria 3181
1601 Ga0495684_0052229 3300047471 Bacteria 3119
1602 Ga0495684_0080701 3300047471 Bacteria 2469
1603 Ga0495684_0362279 3300047471 Bacteria 1027
1604 Ga0495593_0001596 3300047673 Bacteria 13393
1605 Ga0495593_0007105 3300047673 Bacteria 6565
1606 Ga0495593_0019723 3300047673 Bacteria 3779
1607 Ga0495593_0031911 3300047673 Bacteria 2874
1608 Ga0495593_0089106 3300047673 Bacteria 1590
1609 Ga0495593_0163640 3300047673 Bacteria 1123
1610 Ga0495593_0604714 3300047673 Bacteria 550
1611 Ga0495602_0000939 3300048088 Bacteria 28146
1612 Ga0495602_0018144 3300048088 Bacteria 7038
1613 Ga0495602_0091926 3300048088 Bacteria 2515
1614 Ga0495602_0111149 3300048088 Bacteria 2226
1615 Ga0495602_0229245 3300048088 Bacteria 1397
1616 Ga0495615_0029147 3300048090 Bacteria 1307
1617 Ga0496100_0000883 3300048903 Bacteria 14297
1618 Ga0496100_0001014 3300048903 Bacteria 13552
1619 Ga0496100_0009146 3300048903 Bacteria 5558
1620 Ga0496100_0014178 3300048903 Bacteria 4620
1621 Ga0496100_0035966 3300048903 Bacteria 3119
1622 Ga0496100_0103306 3300048903 Bacteria 1967
1623 Ga0496100_0342133 3300048903 Bacteria 1128
1624 Ga0496100_0365331 3300048903 Bacteria 1093
1625 Ga0496100_0368066 3300048903 Bacteria 1089
1626 Ga0496100_0372249 3300048903 Bacteria 1083
1627 Ga0496100_0862317 3300048903 Bacteria 710
1628 Ga0496101_0001110 3300048904 Bacteria 16020
1629 Ga0496101_0001721 3300048904 Bacteria 13111
1630 Ga0496101_0054900 3300048904 Bacteria 2876
1631 Ga0496101_0116176 3300048904 Bacteria 2019
1632 Ga0496101_0130255 3300048904 Bacteria 1910
1633 Ga0496101_0130307 3300048904 Bacteria 1909
1634 Ga0496101_0145568 3300048904 Bacteria 1809
1635 Ga0496101_0193386 3300048904 Bacteria 1570
1636 Ga0496101_0381219 3300048904 Bacteria 1109
1637 Ga0496101_0466525 3300048904 Bacteria 996
1638 Ga0496101_1184939 3300048904 Bacteria 599
1639 Ga0496101_1477163 3300048904 Bacteria 529
1640 Ga0496102_0002752 3300048905 Bacteria 14995
1641 Ga0496102_0005298 3300048905 Bacteria 10948
1642 Ga0496102_0008594 3300048905 Bacteria 8760
1643 Ga0496102_0017375 3300048905 Bacteria 6301
1644 Ga0496102_0028624 3300048905 Bacteria 4978
1645 Ga0496102_0102034 3300048905 Bacteria 2666
1646 Ga0496102_0144315 3300048905 Bacteria 2233
1647 Ga0496102_0187655 3300048905 Bacteria 1948
1648 Ga0496102_0352590 3300048905 Bacteria 1385
1649 Ga0496102_0460446 3300048905 Bacteria 1193
1650 Ga0496102_1139727 3300048905 Bacteria 699
1651 Ga0496103_0000582 3300048906 Bacteria 28897
1652 Ga0496103_0002481 3300048906 Bacteria 11568
1653 Ga0496103_0003119 3300048906 Bacteria 10191
1654 Ga0496103_0005721 3300048906 Bacteria 7428
1655 Ga0496103_0012578 3300048906 Bacteria 5018
1656 Ga0496103_0061510 3300048906 Bacteria 2335
1657 Ga0496103_0135141 3300048906 Bacteria 1576
1658 Ga0496103_0135549 3300048906 Bacteria 1573
1659 Ga0496103_0516181 3300048906 Bacteria 764
1660 Ga0496103_0569489 3300048906 Bacteria 722
1661 Ga0496104_0007237 3300048907 Bacteria 9793
1662 Ga0496104_0010494 3300048907 Bacteria 8274
1663 Ga0496104_0029229 3300048907 Bacteria 5112
1664 Ga0496104_0031868 3300048907 Bacteria 4904
1665 Ga0496104_0035483 3300048907 Bacteria 4655
1666 Ga0496104_0042135 3300048907 Bacteria 4283
1667 Ga0496104_0125502 3300048907 Bacteria 2464
1668 Ga0496104_0417297 3300048907 Bacteria 1254
1669 Ga0496104_0462919 3300048907 Bacteria 1179
1670 Ga0496104_0548768 3300048907 Bacteria 1066
1671 Ga0496104_1112467 3300048907 Bacteria 693
1672 Ga0496105_0001558 3300048908 Bacteria 16229
1673 Ga0496105_0003169 3300048908 Bacteria 12121
1674 Ga0496105_0028842 3300048908 Bacteria 4540
1675 Ga0496105_0055785 3300048908 Bacteria 3262
1676 Ga0496105_0096952 3300048908 Bacteria 2435
1677 Ga0496105_0296238 3300048908 Bacteria 1301
1678 Ga0496105_0532416 3300048908 Bacteria 919
1679 Ga0496105_0796266 3300048908 Bacteria 719
1680 Ga0496105_0864732 3300048908 Bacteria 683
1681 Ga0496105_0990150 3300048908 Bacteria 629
1682 Ga0496106_0002154 3300048909 Bacteria 14716
1683 Ga0496106_0013483 3300048909 Bacteria 6034
1684 Ga0496106_0023714 3300048909 Bacteria 4559
1685 Ga0496106_0024535 3300048909 Bacteria 4483
1686 Ga0496106_0042860 3300048909 Bacteria 3394
1687 Ga0496106_0071467 3300048909 Bacteria 2652
1688 Ga0496106_0087140 3300048909 Bacteria 2405
1689 Ga0496106_0138385 3300048909 Bacteria 1914
1690 Ga0496106_0434104 3300048909 Bacteria 1055
1691 Ga0496106_0439309 3300048909 Bacteria 1048
1692 Ga0496106_1368807 3300048909 Bacteria 548
1693 Ga0496107_0004170 3300048910 Bacteria 9759
1694 Ga0496107_0007065 3300048910 Bacteria 7734
1695 Ga0496107_0010170 3300048910 Bacteria 6525
1696 Ga0496107_0015819 3300048910 Bacteria 5291
1697 Ga0496107_0038014 3300048910 Bacteria 3455
1698 Ga0496107_0086487 3300048910 Bacteria 2288
1699 Ga0496107_0091502 3300048910 Bacteria 2223
1700 Ga0496107_0252415 3300048910 Bacteria 1312
1701 Ga0496107_0391556 3300048910 Bacteria 1033
1702 Ga0496107_0848043 3300048910 Bacteria 667
1703 Ga0496108_0002843 3300048911 Bacteria 13899
1704 Ga0496108_0006074 3300048911 Bacteria 9765
1705 Ga0496108_0018748 3300048911 Bacteria 5672
1706 Ga0496108_0022946 3300048911 Bacteria 5135
1707 Ga0496108_0053606 3300048911 Bacteria 3382
1708 Ga0496108_0057689 3300048911 Bacteria 3262
1709 Ga0496108_0116424 3300048911 Bacteria 2289
1710 Ga0496108_0131099 3300048911 Bacteria 2155
1711 Ga0496108_0143900 3300048911 Bacteria 2054
1712 Ga0496108_0319713 3300048911 Bacteria 1353
1713 Ga0496109_0000384 3300048912 Bacteria 40091
1714 Ga0496109_0000736 3300048912 Bacteria 27218
1715 Ga0496109_0025448 3300048912 Bacteria 5274
1716 Ga0496109_0031190 3300048912 Bacteria 4781
1717 Ga0496109_0033566 3300048912 Bacteria 4617
1718 Ga0496109_0038333 3300048912 Bacteria 4332
1719 Ga0496109_0077453 3300048912 Bacteria 3060
1720 Ga0496109_0086166 3300048912 Bacteria 2900
1721 Ga0496109_0104469 3300048912 Bacteria 2630
1722 Ga0496109_0107345 3300048912 Bacteria 2593
1723 Ga0496109_0319741 3300048912 Bacteria 1464
1724 Ga0496109_0546349 3300048912 Bacteria 1093
1725 Ga0496110_0002213 3300048913 Bacteria 14531
1726 Ga0496110_0003023 3300048913 Bacteria 12763
1727 Ga0496110_0005680 3300048913 Bacteria 9795
1728 Ga0496110_0024829 3300048913 Bacteria 5114
1729 Ga0496110_0037606 3300048913 Bacteria 4207
1730 Ga0496110_0041599 3300048913 Bacteria 4011
1731 Ga0496110_0056543 3300048913 Bacteria 3453
1732 Ga0496110_0326364 3300048913 Bacteria 1398
1733 Ga0496110_1033151 3300048913 Bacteria 729
1734 Ga0496110_1067375 3300048913 Bacteria 715
1735 Ga0496110_1093020 3300048913 Bacteria 705
1736 Ga0496110_1585837 3300048913 Bacteria 565
1737 Ga0496111_0002054 3300048914 Bacteria 11995
1738 Ga0496111_0005543 3300048914 Bacteria 8109
1739 Ga0496111_0017102 3300048914 Bacteria 5007
1740 Ga0496111_0041909 3300048914 Bacteria 3286
1741 Ga0496111_0114824 3300048914 Bacteria 1985
1742 Ga0496111_0150568 3300048914 Bacteria 1725
1743 Ga0496111_0176601 3300048914 Bacteria 1588
1744 Ga0496111_0200583 3300048914 Bacteria 1483
1745 Ga0496111_0826831 3300048914 Bacteria 669
1746 Ga0496112_0002196 3300048915 Bacteria 15539
1747 Ga0496112_0003380 3300048915 Bacteria 13178
1748 Ga0496112_0009635 3300048915 Bacteria 8714
1749 Ga0496112_0021933 3300048915 Bacteria 6077
1750 Ga0496112_0027921 3300048915 Bacteria 5444
1751 Ga0496112_0028856 3300048915 Bacteria 5360
1752 Ga0496112_0034785 3300048915 Bacteria 4903
1753 Ga0496112_0080898 3300048915 Bacteria 3212
1754 Ga0496112_0102410 3300048915 Bacteria 2833
1755 Ga0496112_0197756 3300048915 Bacteria 1970
1756 Ga0496112_0694398 3300048915 Bacteria 946
1757 Ga0496112_0759667 3300048915 Bacteria 895
1758 Ga0496113_0002202 3300048916 Bacteria 11241
1759 Ga0496113_0006851 3300048916 Bacteria 7268
1760 Ga0496113_0018382 3300048916 Bacteria 4867
1761 Ga0496113_0074647 3300048916 Bacteria 2586
1762 Ga0496113_0117492 3300048916 Bacteria 2076
1763 Ga0496113_0216308 3300048916 Bacteria 1526
1764 Ga0496113_0224481 3300048916 Bacteria 1497
1765 Ga0496113_0228860 3300048916 Bacteria 1482
1766 Ga0496113_0658005 3300048916 Bacteria 838
1767 Ga0496113_0804168 3300048916 Bacteria 747
1768 Ga0496113_0872700 3300048916 Bacteria 712
1769 Ga0496114_0003895 3300048917 Bacteria 11508
1770 Ga0496114_0006922 3300048917 Bacteria 8930
1771 Ga0496114_0010065 3300048917 Bacteria 7519
1772 Ga0496114_0097585 3300048917 Bacteria 2503
1773 Ga0496114_0116425 3300048917 Bacteria 2294
1774 Ga0496114_0519405 3300048917 Bacteria 1053
1775 Ga0496114_0962067 3300048917 Bacteria 736
1776 Ga0496115_0002409 3300048918 Bacteria 13422
1777 Ga0496115_0014762 3300048918 Bacteria 5920
1778 Ga0496115_0016238 3300048918 Bacteria 5665
1779 Ga0496115_0039365 3300048918 Bacteria 3754
1780 Ga0496115_0053154 3300048918 Bacteria 3250
1781 Ga0496115_0073203 3300048918 Bacteria 2780
1782 Ga0496115_0190245 3300048918 Bacteria 1695
1783 Ga0496115_0203002 3300048918 Bacteria 1637
1784 Ga0496115_0217606 3300048918 Bacteria 1576
1785 Ga0496115_0637062 3300048918 Bacteria 844
1786 Ga0496115_0637680 3300048918 Bacteria 843
1787 Ga0496115_1106408 3300048918 Bacteria 600
1788 Ga0496118_0142145 3300048921 Bacteria 1519
1789 Ga0496119_0075493 3300048922 Bacteria 1959
1790 Ga0496119_0200701 3300048922 Bacteria 1032
1791 Ga0496120_0282930 3300048923 Bacteria 766
1792 Ga0496121_0001203 3300048924 Bacteria 45295
1793 Ga0501031_0021558 3300049568 Bacteria 4200
1794 Ga0501031_0145513 3300049568 Bacteria 1548
1795 Ga0501031_0430327 3300049568 Bacteria 853
1796 Ga0501032_0013465 3300049569 Bacteria 5815
1797 Ga0501032_0187761 3300049569 Bacteria 1351
1798 Ga0501033_0022327 3300049570 Bacteria 4774
1799 Ga0501033_0045402 3300049570 Bacteria 3270
1800 Ga0501033_0219597 3300049570 Bacteria 1353
1801 Ga0501034_0061762 3300049571 Bacteria 3763
1802 Ga0501034_0127693 3300049571 Bacteria 2527
1803 Ga0501034_0320681 3300049571 Bacteria 1482
1804 Ga0501034_0461508 3300049571 Bacteria 1187
1805 Ga0501034_0657355 3300049571 Bacteria 949
1806 Ga0501036_0010044 3300049572 Bacteria 7798
1807 Ga0501036_0097681 3300049572 Bacteria 2482
1808 Ga0501036_0330524 3300049572 Bacteria 1273
1809 Ga0501036_0599800 3300049572 Bacteria 913
1810 Ga0501037_0008767 3300049573 Bacteria 7414
1811 Ga0501037_0091527 3300049573 Bacteria 2199
1812 Ga0501037_0174526 3300049573 Bacteria 1527
1813 Ga0501037_0332335 3300049573 Bacteria 1051
1814 Ga0501038_0003573 3300049574 Bacteria 14467
1815 Ga0501038_0024219 3300049574 Bacteria 5415
1816 Ga0501038_0054055 3300049574 Bacteria 3454
1817 Ga0501038_0621448 3300049574 Bacteria 816
1818 Ga0501039_0056048 3300049575 Bacteria 3053
1819 Ga0501039_0179071 3300049575 Bacteria 1667
1820 Ga0501039_0449738 3300049575 Bacteria 1012
1821 Ga0501039_1313295 3300049575 Bacteria 558
1822 Ga0501041_0450134 3300049577 Bacteria 817
1823 Ga0501042_0260251 3300049578 Bacteria 1252
1824 Ga0501042_0369412 3300049578 Bacteria 1038
1825 Ga0501043_0016285 3300049579 Bacteria 5830
1826 Ga0501043_0462749 3300049579 Bacteria 951
1827 Ga0501046_0007715 3300049580 Bacteria 9433
1828 Ga0501047_0130763 3300049581 Bacteria 2391
1829 Ga0501047_0130941 3300049581 Bacteria 2389
1830 Ga0501047_0207381 3300049581 Bacteria 1819
1831 Ga0501047_0252337 3300049581 Bacteria 1612
1832 Ga0501047_0422448 3300049581 Bacteria 1164
1833 Ga0501048_0007056 3300049582 Bacteria 8534
1834 Ga0501048_0092956 3300049582 Bacteria 2128
1835 Ga0501048_0417202 3300049582 Bacteria 960
1836 Ga0501048_1102861 3300049582 Bacteria 571
1837 Ga0501067_0163073 3300049583 Bacteria 1241
1838 Ga0501068_0003549 3300049584 Bacteria 8427
1839 Ga0501068_0280834 3300049584 Bacteria 1064
1840 Ga0501069_0230171 3300049585 Bacteria 1079
1841 Ga0501070_0031699 3300049586 Bacteria 4428
1842 Ga0501070_0094553 3300049586 Bacteria 2473
1843 Ga0501070_0099161 3300049586 Bacteria 2410
1844 Ga0501070_0153402 3300049586 Bacteria 1900
1845 Ga0501070_0365690 3300049586 Bacteria 1170
1846 Ga0501071_0015838 3300049587 Bacteria 5179
1847 Ga0501071_0215543 3300049587 Bacteria 1444
1848 Ga0501072_0075216 3300049588 Bacteria 2671
1849 Ga0501073_0074958 3300049589 Bacteria 2355
1850 Ga0501073_0726516 3300049589 Bacteria 685
1851 Ga0501073_1088282 3300049589 Bacteria 549
1852 Ga0501075_0171856 3300049591 Bacteria 1654
1853 Ga0501075_0222822 3300049591 Bacteria 1439
1854 Ga0501076_0018574 3300049592 Bacteria 5304
1855 Ga0501077_0010133 3300049593 Bacteria 5869
1856 Ga0501079_0014563 3300049741 Bacteria 5998
1857 Ga0501079_0621986 3300049741 Bacteria 850
1858 Ga0501079_0938744 3300049741 Bacteria 681
1859 Ga0501080_0029067 3300049742 Bacteria 5145
1860 Ga0501080_0349968 3300049742 Bacteria 1334
1861 Ga0501081_0053250 3300049743 Bacteria 2794
1862 Ga0501083_0004338 3300049744 Bacteria 9992
1863 Ga0501083_0011778 3300049744 Bacteria 6130
1864 Ga0501083_0144040 3300049744 Bacteria 1560
1865 Ga0501083_0267220 3300049744 Bacteria 1113
1866 Ga0501035_0006796 3300049822 Bacteria 10687
1867 Ga0501035_0049464 3300049822 Bacteria 3767
1868 Ga0501035_0096444 3300049822 Bacteria 2598
1869 Ga0501035_0101385 3300049822 Bacteria 2526
1870 Ga0501035_0174157 3300049822 Bacteria 1857
1871 Ga0501035_0248890 3300049822 Bacteria 1510
1872 Ga0501035_0465613 3300049822 Bacteria 1044
1873 Ga0501044_0003604 3300049823 Bacteria 17424
1874 Ga0501044_0026832 3300049823 Bacteria 6096
1875 Ga0501044_0084848 3300049823 Bacteria 3200
1876 Ga0501044_0151099 3300049823 Bacteria 2304
1877 Ga0501044_0274507 3300049823 Bacteria 1621
1878 Ga0501044_0276218 3300049823 Bacteria 1615
1879 Ga0501044_0300952 3300049823 Bacteria 1533
1880 Ga0501044_0383307 3300049823 Bacteria 1321
1881 Ga0501044_0387202 3300049823 Bacteria 1312
1882 Ga0501044_0450894 3300049823 Bacteria 1193
1883 Ga0501045_0189372 3300049824 Bacteria 1533
1884 nmdc:mga03683_13305_c1 3300050489 Bacteria 3025
1885 nmdc:mga03683_94363_c1 3300050489 Bacteria 1308
1886 nmdc:mga03n38_216440_c1 3300050490 Bacteria 998
1887 nmdc:mga03n38_26625_c1 3300050490 Bacteria 2389
1888 nmdc:mga03n38_70992_c1 3300050490 Bacteria 1612
1889 nmdc:mga00v17_114008_c1 3300050491 Bacteria 1717
1890 nmdc:mga00v17_190164_c1 3300050491 Bacteria 1326
1891 nmdc:mga00v17_295825_c1 3300050491 Bacteria 1051
1892 nmdc:mga00v17_546752_c1 3300050491 Bacteria 749
1893 nmdc:mga0yw44_144147_c1 3300050492 Bacteria 1550
1894 nmdc:mga0yw44_195533_c1 3300050492 Bacteria 1335
1895 nmdc:mga0yw44_263060_c1 3300050492 Bacteria 1150
1896 nmdc:mga0yw44_32663_c1 3300050492 Bacteria 3035
1897 nmdc:mga0yw44_38878_c1 3300050492 Bacteria 2817
1898 nmdc:mga0yw44_494860_c1 3300050492 Bacteria 829
1899 nmdc:mga0yw44_62725_c1 3300050492 Bacteria 1951
1900 nmdc:mga0k408_137211_c1 3300050493 Bacteria 1454
1901 nmdc:mga0k408_239141_c1 3300050493 Bacteria 1084
1902 nmdc:mga0k408_637389_c1 3300050493 Bacteria 627
1903 nmdc:mga06z11_188437_c1 3300050494 Bacteria 1193
1904 nmdc:mga06z11_211635_c1 3300050494 Bacteria 750
1905 nmdc:mga06z11_248424_c1 3300050494 Bacteria 1047
1906 nmdc:mga06z11_25416_c1 3300050494 Bacteria 2806
1907 nmdc:mga06z11_381047_c1 3300050494 Bacteria 847
1908 nmdc:mga06z11_441259_c1 3300050494 Bacteria 786
1909 nmdc:mga06z11_455963_c1 3300050494 Bacteria 773
1910 nmdc:mga06z11_52618_c1 3300050494 Bacteria 2090
1911 nmdc:mga04h51_82259_c1 3300050495 Bacteria 1145
1912 nmdc:mga07m45_108668_c1 3300050496 Bacteria 1596
1913 nmdc:mga07m45_128101_c1 3300050496 Bacteria 1468
1914 nmdc:mga05p37_11620_c1 3300050507 Bacteria 10493
1915 nmdc:mga05p37_1252734_c1 3300050507 Bacteria 761
1916 nmdc:mga05p37_19_c2 3300050507 Bacteria 99994
1917 nmdc:mga05p37_284395_c1 3300050507 Bacteria 1971
1918 nmdc:mga05p37_5389_c1 3300050507 Bacteria 15038
1919 nmdc:mga05p37_60931_c1 3300050507 Bacteria 4646
1920 nmdc:mga05p37_62542_c1 3300050507 Bacteria 4581
1921 nmdc:mga05p37_652410_c1 3300050507 Bacteria 1178
1922 nmdc:mga09592_238_c1 3300050508 Bacteria 40013
1923 nmdc:mga09592_28100_c2 3300050508 Bacteria 1804
1924 nmdc:mga09592_422439_c1 3300050508 Bacteria 1151
1925 nmdc:mga09592_752032_c1 3300050508 Bacteria 827
1926 nmdc:mga0qj67_259_c1 3300050509 Bacteria 36242
1927 nmdc:mga0qj67_43438_c1 3300050509 Bacteria 3539
1928 nmdc:mga0qj67_47225_c1 3300050509 Bacteria 3401
1929 nmdc:mga0qj67_933_c1 3300050509 Bacteria 20130
1930 nmdc:mga06r32_2023_c1 3300050510 Bacteria 18128
1931 nmdc:mga06r32_33555_c1 3300050510 Bacteria 4835
1932 nmdc:mga06r32_557085_c1 3300050510 Bacteria 1120
1933 nmdc:mga06r32_558689_c1 3300050510 Bacteria 1118
1934 nmdc:mga08y16_209698_c1 3300050511 Bacteria 2018
1935 nmdc:mga08y16_230812_c1 3300050511 Bacteria 1914
1936 nmdc:mga08y16_2548_c1 3300050511 Bacteria 18740
1937 nmdc:mga08y16_2735_c1 3300050511 Bacteria 18090
1938 nmdc:mga08y16_680431_c1 3300050511 Bacteria 1030
1939 nmdc:mga0n895_120909_c1 3300050512 Bacteria 2640
1940 nmdc:mga0n895_1651_c1 3300050512 Bacteria 16871
1941 nmdc:mga0n895_236272_c1 3300050512 Bacteria 1855
1942 nmdc:mga0n895_350022_c1 3300050512 Bacteria 1496
1943 nmdc:mga0n895_37298_c1 3300050512 Bacteria 4701
1944 nmdc:mga0n895_394_c1 3300050512 Bacteria 29311
1945 nmdc:mga0n895_41689_c1 3300050512 Bacteria 4463
1946 nmdc:mga0n895_528383_c1 3300050512 Bacteria 1187
1947 nmdc:mga0n895_737764_c1 3300050512 Bacteria 979
1948 nmdc:mga0n895_9070_c1 3300050512 Bacteria 8677
1949 nmdc:mga0rr50_1052072_c1 3300050513 Bacteria 693
1950 nmdc:mga0rr50_13004_c1 3300050513 Bacteria 5402
1951 nmdc:mga0rr50_417419_c1 3300050513 Bacteria 1135
1952 nmdc:mga0rr50_462055_c1 3300050513 Bacteria 1077
1953 nmdc:mga0rr50_49049_c1 3300050513 Bacteria 3124
1954 nmdc:mga0rr50_785_c1 3300050513 Bacteria 17098
1955 nmdc:mga08x19_147075_c1 3300050514 Bacteria 1594
1956 nmdc:mga08x19_232918_c1 3300050514 Bacteria 1268
1957 nmdc:mga08x19_52251_c1 3300050514 Bacteria 2628
1958 nmdc:mga08x19_54177_c1 3300050514 Bacteria 2581
1959 nmdc:mga08x19_98074_c1 3300050514 Bacteria 1941
1960 nmdc:mga0a205_107086_c1 3300050515 Bacteria 2021
1961 nmdc:mga0a205_1167_c2 3300050515 Bacteria 15903
1962 nmdc:mga0a205_249_c1 3300050515 Bacteria 38472
1963 nmdc:mga0a205_315905_c1 3300050515 Bacteria 1434
1964 nmdc:mga0a205_39512_c2 3300050515 Bacteria 3662
1965 nmdc:mga0a205_513640_c1 3300050515 Bacteria 1055
1966 nmdc:mga0a205_621396_c1 3300050515 Bacteria 933
1967 nmdc:mga0sz30_28584_c1 3300050516 Bacteria 2295
1968 nmdc:mga0sz30_328241_c1 3300050516 Bacteria 683
1969 nmdc:mga0sz30_346313_c1 3300050516 Bacteria 664
1970 Ga0495601_0001035 3300053077 Bacteria 15177
1971 Ga0495601_0002495 3300053077 Bacteria 10465
1972 Ga0495601_0006979 3300053077 Bacteria 6614
1973 Ga0495601_0019854 3300053077 Bacteria 4101
1974 Ga0495601_0024854 3300053077 Bacteria 3690
1975 Ga0495601_0051130 3300053077 Bacteria 2608
1976 Ga0495601_0114981 3300053077 Bacteria 1744
1977 Ga0495601_0130848 3300053077 Bacteria 1634
1978 Ga0495601_0135407 3300053077 Bacteria 1606
1979 Ga0495612_0005592 3300053078 Bacteria 5196
1980 Ga0495612_0009082 3300053078 Bacteria 4031
1981 Ga0495612_0010155 3300053078 Bacteria 3808
1982 Ga0495612_0034559 3300053078 Bacteria 2047
1983 Ga0495612_0047985 3300053078 Bacteria 1750
1984 Ga0495612_0082495 3300053078 Bacteria 1352
1985 Ga0495612_0197996 3300053078 Bacteria 886
1986 Ga0500635_0015141 3300053080 Bacteria 2273
1987 Ga0495655_0034643 3300053083 Bacteria 1250
1988 Ga0495595_0000305 3300053084 Bacteria 19108
1989 Ga0495595_0000463 3300053084 Bacteria 15390
1990 Ga0495595_0001598 3300053084 Bacteria 8840
1991 Ga0495595_0005742 3300053084 Bacteria 5027
1992 Ga0495619_0000052 3300053085 Bacteria 98882
1993 Ga0495619_0000078 3300053085 Bacteria 72749
1994 Ga0495619_0001206 3300053085 Bacteria 16974
1995 Ga0495619_0002522 3300053085 Bacteria 11978
1996 Ga0495619_0008359 3300053085 Bacteria 6543
1997 Ga0495619_0020914 3300053085 Bacteria 4173
1998 Ga0495619_0023566 3300053085 Bacteria 3947
1999 Ga0495619_0025235 3300053085 Bacteria 3815
2000 Ga0495619_0061471 3300053085 Bacteria 2500
2001 Ga0495619_0080423 3300053085 Bacteria 2193
2002 Ga0495619_0206411 3300053085 Bacteria 1360
2003 Ga0495619_0605257 3300053085 Bacteria 749
2004 Ga0495619_0633603 3300053085 Bacteria 730
2005 Ga0500643_002661 3300053087 Bacteria 9005
2006 Ga0500651_0030627 3300053093 Bacteria 3386
2007 Ga0500651_0091143 3300053093 Bacteria 1876
2008 Ga0500651_0553606 3300053093 Bacteria 629
2009 Ga0500566_0103116 3300053094 Bacteria 1561
2010 Ga0500650_0075193 3300053098 Bacteria 1579
2011 Ga0500595_000003 3300053119 Bacteria 419332
2012 Ga0500595_022759 3300053119 Bacteria 2211
2013 Ga0500642_0065529 3300053130 Bacteria 1641
2014 Ga0500652_000033 3300053131 Bacteria 80332
2015 Ga0500652_002017 3300053131 Bacteria 6117
2016 Ga0500559_0036419 3300053136 Bacteria 2128
2017 Ga0500577_0361724 3300053142 Bacteria 635
2018 Ga0500616_0000002 3300053153 Bacteria 1611257
2019 Ga0500616_0000028 3300053153 Bacteria 435722
2020 Ga0500616_0141357 3300053153 Bacteria 1124
2021 Ga0500636_0024898 3300053177 Bacteria 3537
2022 Ga0500636_0158993 3300053177 Bacteria 1234
2023 Ga0500637_0421960 3300053178 Bacteria 685
2024 Ga0500645_000078 3300053730 Bacteria 76931
2025 Ga0501084_0032563 3300054114 Bacteria 4361
2026 Ga0501084_0235585 3300054114 Bacteria 1545
2027 Ga0501084_0511799 3300054114 Bacteria 1015
2028 Ga0590077_053709 3300059426 Bacteria 907
2029 Ga0587073_0183415 3300059492 Bacteria 616
2030 Ga0587077_133692 3300059493 Bacteria 632
2031 Ga0587072_049375 3300059643 Bacteria 839
2032 Ga0501082_0259159 3300060353 Bacteria 1513
2033 Ga0501082_0566173 3300060353 Bacteria 994
2034 Ga0501082_0780337 3300060353 Bacteria 836
2035 Ga0501082_0796100 3300060353 Bacteria 827
2036 Ga0501082_0870433 3300060353 Bacteria 788
2037 Ga0501082_1020082 3300060353 Bacteria 723
2038 Ga0466962_0160192 3300061719 Bacteria 1093
2039 Ga0530510_0038877 3300061734 Bacteria 3436
2040 Ga0530510_0070744 3300061734 Bacteria 2532
2041 Ga0530510_0074232 3300061734 Bacteria 2469
2042 Ga0530510_0765918 3300061734 Bacteria 736
2043 Ga0530510_1094185 3300061734 Bacteria 610
2044 2507511102 2507262055 Bacteria 8048963
2045 2508544917 2508501009 Bacteria 7784016
2046 2508696856 2508501042 Bacteria 8719808
2047 2513623559 2513237092 Bacteria 8341956
2048 2513637387 2513237094 Bacteria 8789602
2049 2513649762 2513237095 Bacteria 8976980
2050 2513706868 2513237102 Bacteria 7703324
2051 2513716994 2513237104 Bacteria 10034502
2052 2513874725 2513237139 Bacteria 8737671
2053 2513892162 2513237141 Bacteria 8496279
2054 2514010554 2513237161 Bacteria 8871253
2055 2515625331 2515154112 Bacteria 8294334
2056 2517100669 2517093001 Bacteria 9002274
2057 2524438109 2524023205 Bacteria 8918781
2058 2528855553 2528768022 Bacteria 10457665
2059 2617353309 2617270735 Bacteria 9163226
2060 2617373222 2617270741 Bacteria 8201522
2061 2643757513 2643221547 Bacteria 4740017
2062 2745077010 2744054633 Bacteria 8678936
2063 2793061957 2791355196 Bacteria 7323613
2064 2805916726 2802429603 Bacteria 8777136
2065 2818238234 2816332527 Bacteria 8933356
2066 2824608939 2824600985 Bacteria 8488197
2067 2824611621 2824609381 Bacteria 8672835
2068 2824626223 2824617872 Bacteria 8814715
2069 2824634939 2824626560 Bacteria 8813858
2070 2824643220 2824635225 Bacteria 8785348
2071 2824651481 2824644064 Bacteria 8743947
2072 2824660892 2824653114 Bacteria 8493680
2073 2824670612 2824661429 Bacteria 9877870
2074 2824678806 2824671348 Bacteria 8369588
2075 2824687399 2824679649 Bacteria 8248951
2076 2824695198 2824687955 Bacteria 8360029
2077 2824703647 2824696289 Bacteria 8335049
2078 2824712531 2824704595 Bacteria 9667483
2079 2824722669 2824714736 Bacteria 8717648
2080 2824731459 2824723954 Bacteria 8758240
2081 2824739758 2824732956 Bacteria 7810675
2082 2824753492 2824746037 Bacteria 7911610
2083 2824763239 2824753945 Bacteria 9787441
2084 2824773108 2824763712 Bacteria 9792355
2085 2824781248 2824773399 Bacteria 8360218
2086 2838127974 2838122688 Bacteria 8803140
2087 2841943272 2841941048 Bacteria 8688029
2088 2841954000 2841949485 Bacteria 8680857
2089 2841961958 2841957949 Bacteria 8652217
2090 2841968092 2841966195 Bacteria 8673214
2091 2841980852 2841974524 Bacteria 8931498
2092 2841981348 2841974524 Bacteria 8931498
2093 2841988071 2841983080 Bacteria 8395090
2094 2842042625 2842038055 Bacteria 8002051
2095 2842050668 2842045827 Bacteria 8006841
2096 2844316829 2844315083 Bacteria 8138177
2097 2847938641 2847930680 Bacteria 9342022
2098 2847944160 2847939898 Bacteria 8606328
2099 2849081616 2849076700 Bacteria 7039503
2100 2857512267 2857509624 Bacteria 7472071
2101 2874597832 2874590934 Bacteria 8299676
2102 2874616889 2874612657 Bacteria 8252029
2103 2874623357 2874620515 Bacteria 8290088
2104 2874625412 2874620515 Bacteria 8290088
2105 2874631291 2874628541 Bacteria 8630250
2106 2874651361 2874645413 Bacteria 8214782
2107 2876762929 2876761206 Bacteria 10111113
2108 2876776432 2876771140 Bacteria 8287509
2109 2876821000 2876818435 Bacteria 8274608
2110 2879081705 2879074833 Bacteria 8279565
2111 2879088385 2879083081 Bacteria 8587928
2112 2879108889 2879099564 Bacteria 10442239
2113 2879130420 2879127579 Bacteria 8294491
2114 2879147784 2879142872 Bacteria 8267021
2115 2881370759 2881364244 Bacteria 7710352
2116 2881673259 2881665667 Bacteria 8175609
2117 2885366855 2885366525 Bacteria 8326213
2118 2885414582 2885409591 Bacteria 9235467
2119 2888381445 2888378607 Bacteria 9652610
2120 2888389204 2888388044 Bacteria 7304136
2121 2888421848 2888419890 Bacteria 7857137
2122 2903733882 2903727486 Bacteria 8281579
2123 2904670630 2904666416 Bacteria 8226587
2124 2904672712 2904666416 Bacteria 8226587
2125 2904719319 2904711408 Bacteria 9771557
2126 2906606818 2906602504 Bacteria 8295279
2127 2906635255 2906626472 Bacteria 8826946
2128 2906651994 2906643746 Bacteria 8722424
2129 2908781679 2908775508 Bacteria 8092255
2130 2909043243 2909042592 Bacteria 6499737
2131 2922371092
2132 2922401041 2922393267 Bacteria 8285685
2133 2929619488 2929615660 Bacteria 9193770
2134 2929628042 2929624759 Bacteria 9339455
2135 2932785814 2932784394 Bacteria 9704911
2136 2932801062 2932794094 Bacteria 7915132
2137 2932804191 2932801729 Bacteria 7987968
2138 2932813618 2932809354 Bacteria 9135765
2139 2932826673 2932818245 Bacteria 9955613
2140 2932830859 2932828146 Bacteria 9745859
2141 2933581408 2933577622 Bacteria 9116884
2142 2935612669 2935608549 Bacteria 8203142
2143 2935620902 2935616580 Bacteria 9032984
2144 2935639985 2935638405 Bacteria 10015038
2145 2935655214 2935648319 Bacteria 8801166
2146 2935664095 2935656913 Bacteria 8965014
2147 2935667161 2935665750 Bacteria 9571747
2148 2935677779 2935675223 Bacteria 9928132
2149 2935690290 2935684952 Bacteria 9590419
2150 2935697374 2935694250 Bacteria 9291695
2151 2935704917 2935703347 Bacteria 10242284
2152 2935718014 2935713505 Bacteria 9608509
2153 2935726836 2935722832 Bacteria 9608746
2154 2935735606 2935732158 Bacteria 9706831
2155 2935745123 2935741537 Bacteria 9707219
2156 2935755300 2935750917 Bacteria 9590372
2157 2935762178 2935760218 Bacteria 9817913
2158 2935773563 2935769743 Bacteria 7878163
2159 2935784533 2935777560 Bacteria 8077691
2160 2935788532 2935785616 Bacteria 7962367
2161 2935796688 2935793552 Bacteria 8012592
2162 2935803681 2935801545 Bacteria 9301974
2163 2935811595 2935810662 Bacteria 9401221
2164 2935824158 2935819856 Bacteria 8261050
2165 2935829468 2935827899 Bacteria 10038562
2166 2935842555 2935837841 Bacteria 9454360
2167 2935852695 2935847175 Bacteria 8228321
2168 2935858710 2935855204 Bacteria 9035059
2169 2935866868 2935864058 Bacteria 9784707
2170 2935876999 2935873716 Bacteria 9632195
2171 2935890452 2935883170 Bacteria 7964738
2172 2935912152 2935908558 Bacteria 8568796
2173 2935922365 2935916978 Bacteria 9113783
2174 2935929181 2935926038 Bacteria 8601059
2175 2935935812 2935934488 Bacteria 8602579
2176 2935947378 2935942939 Bacteria 8599779
2177 2935953528 2935951376 Bacteria 8602333
2178 2935961964 2935959822 Bacteria 7869783
2179 2935968554 2935967501 Bacteria 8603075
2180 2935976734 2935975950 Bacteria 8347125
2181 2935990641 2935984226 Bacteria 8302647
2182 2935993361 2935992306 Bacteria 9802711
2183 2936004256 2936002035 Bacteria 9362176
2184 2936015407 2936011229 Bacteria 8801034
2185 2936024041 2936019824 Bacteria 8804134
2186 2936033056 2936028420 Bacteria 8965941
2187 2936038177 2936037263 Bacteria 9446081
2188 2936051149 2936046547 Bacteria 8903709
2189 2936058526 2936055302 Bacteria 8785755
2190 2940561419 2940556831 Bacteria 9590747
2191 2941533609 2941531003 Bacteria 7653939
2192 2941544598 2941538514 Bacteria 9402094
2193 3005488302 3005483717 Bacteria 7877331
2194 3005507051 3005506211 Bacteria 6943378
2195 3005593011 3005587118 Bacteria 7794411
2196 3005596457 3005594810 Bacteria 8716512
2197 3005712526 3005710791 Bacteria 7622528
2198 3005719590 3005718088 Bacteria 8283608
2199 8006929846 8006926726 Bacteria 6749210
2200 8006986411 8006984368 Bacteria 9651211
2201 8016516532 8016511872 Bacteria 9921665
2202 8016523934 8016522445 Bacteria 8156687
2203 8016537465 8016530956 Bacteria 8155261
2204 8016541737 8016539877 Bacteria 8155419
2205 8016551535 8016548790 Bacteria 8155074
2206 8016559918 8016557553 Bacteria 8154380
2207 8016567122 8016566248 Bacteria 8158151
2208 8016589042 8016583857 Bacteria 10421953
2209 8016597849 8016595262 Bacteria 8149947
2210 8016603986 8016603502 Bacteria 8731218
2211 8016620568 8016613128 Bacteria 8794220
2212 8016629423 8016622563 Bacteria 7999408
2213 8016633938 8016630954 Bacteria 9217207
2214 8017060010 8017057580 Bacteria 10023680
2215 8019537149 8019530166 Bacteria 8155624
2216 8019542398 8019538911 Bacteria 7872763
2217 8019548360 8019547302 Bacteria 7996444
2218 8019579514 8019576017 Bacteria 10049540
2219 8019587224 8019586578 Bacteria 10212056
2220 8019614415 8019608314 Bacteria 10042931
2221 8019625050 8019619141 Bacteria 9218857
2222 8019637130 8019629233 Bacteria 8687553
2223 8019642465 8019638758 Bacteria 9062356
2224 8019650118 8019648815 Bacteria 10014479
2225 8019664998 8019659431 Bacteria 8577854
2226 8019674533 8019668869 Bacteria 8791617
2227 8019681572 8019678201 Bacteria 8863603
2228 8019694210 8019687851 Bacteria 8712826
2229 8055749255 8055742211 Bacteria 9226248
2230 8056969629 8056967851 Bacteria 9038162
2231 Ga0500644_0000485
2232 2214745207
2233 ARcpr5oldR_c000007
2234 ARSoilYngRDRAFT_c00111
2235 ARcpr5yngRDRAFT_c000090
2236 ARSoilOldRDRAFT_c000004
2237 ARCol0oldRDRAFT_c00879
2238 ARCol0yngRDRAFT_1000074
2239 JGI24741J21665_1009138
2240 JGI24752J21851_1000640
2241 JGI24746J21847_1000605
2242 JGI24747J21853_1001521
2243 JGI24747J21853_1003523
2244 JGI24740J21852_10033571
2245 JGI24739J22299_10000119
2246 JGI24739J22299_10025457
2247 JGI24737J22298_10000258
2248 JGI24737J22298_10039158
2249 JGI24737J22298_10076836
2250 JGI24743J22301_10001956
2251 JGI24743J22301_10042439
2252 JGI24750J21931_1000164
2253 JGI24750J21931_1000382
2254 JGI24745J21846_1000018
2255 JGI24745J21846_1000103
2256 JGI24748J21848_1000848
2257 JGI24748J21848_1001399
2258 JGI24738J21930_10000155
2259 JGI24738J21930_10002678
2260 JGI24749J21850_1000093
2261 JGI24744J21845_10001350
2262 JGI24744J21845_10001608
2263 JGI24744J21845_10056863
2264 JGI24035J26624_1000048
2265 JGI24033J26618_1000900
2266 JGI24033J26618_1003658
2267 JGI24034J26672_10000528
2268 JGI24742J22300_10000595
2269 JGI24742J22300_10004653
2270 JGI24742J22300_10062696
2271 JGI24751J29686_10001631
2272 JGI25406J46586_10003557
2273 JGI25165J46597_1035253
2274 JGI26129J50193_1014951
2275 JGI25405J52794_10011864
2276 JGI25405J52794_10014374
2277 JGI25405J52794_10025043
2278 JGI25405J52794_10036498
2279 Ga0058859_11560269
2280 Ga0058860_12133653
2281 Ga0065717_1002213
2282 Ga0065716_1001697
2283 Ga0065704_10077166
2284 Ga0065712_10003104
2285 Ga0065712_10092635
2286 Ga0065712_10318590
2287 Ga0065712_10685869
2288 Ga0065715_10001507
2289 Ga0065715_10088946
2290 Ga0065715_10506773
2291 Ga0065707_10104807
2292 Ga0070658_10153634
2293 Ga0070658_10281756
2294 Ga0070676_10000514
2295 Ga0070676_10038262
2296 Ga0070676_10092281
2297 Ga0070676_10092697
2298 Ga0070676_10107041
2299 Ga0070676_10131575
2300 Ga0070676_10264504
2301 Ga0070683_100005318
2302 Ga0070683_100025217
2303 Ga0070683_100083692
2304 Ga0070683_100522873
2305 Ga0070683_100859439
2306 Ga0070690_100008454
2307 Ga0070690_100008826
2308 Ga0070690_100043431
2309 Ga0070690_100233768
2310 Ga0070690_100516835
2311 Ga0070670_100002977
2312 Ga0070670_100006229
2313 Ga0070670_100084940
2314 Ga0070670_100275568
2315 Ga0070670_100359624
2316 Ga0070670_100603021
2317 Ga0070670_101216841
2318 Ga0070677_10000023
2319 Ga0070677_10004061
2320 Ga0070677_10107827
2321 Ga0068869_100000153
2322 Ga0068869_100008177
2323 Ga0068869_100185076
2324 Ga0068869_100211361
2325 Ga0068869_100669356
2326 Ga0068869_100717357
2327 Ga0068869_100844602
2328 Ga0068869_101192858
2329 Ga0070666_10003393
2330 Ga0070666_10026307
2331 Ga0070666_10659127
2332 Ga0070680_100000814
2333 Ga0070680_100068000
2334 Ga0070680_100557248
2335 Ga0070682_100000445
2336 Ga0070682_100031348
2337 Ga0070682_100034266
2338 Ga0070682_100077114
2339 Ga0070682_100173416
2340 Ga0070682_100198482
2341 Ga0070682_100786159
2342 Ga0070682_100984733
2343 Ga0068868_100014021
2344 Ga0068868_100015712
2345 Ga0068868_100230809
2346 Ga0068868_100761861
2347 Ga0068868_100999857
2348 Ga0070660_100001480
2349 Ga0070660_100074596
2350 Ga0070689_100000880
2351 Ga0070689_100002815
2352 Ga0070689_100007192
2353 Ga0070689_100009660
2354 Ga0070689_100014559
2355 Ga0070689_100019999
2356 Ga0070689_100264757
2357 Ga0070689_100381570
2358 Ga0070691_10000320
2359 Ga0070691_10091209
2360 Ga0070691_10115528
2361 Ga0070691_10138890
2362 Ga0070691_10184404
2363 Ga0070687_100000187
2364 Ga0070687_100133612
2365 Ga0070687_100445812
2366 Ga0070661_100001011
2367 Ga0070661_100124167
2368 Ga0070661_100238860
2369 Ga0070661_101209785
2370 Ga0070692_10005354
2371 Ga0070692_10089528
2372 Ga0070668_100002838
2373 Ga0070668_100016947
2374 Ga0070668_100375576
2375 Ga0070669_100000501
2376 Ga0070669_100240436
2377 Ga0070669_100275073
2378 Ga0070675_100001136
2379 Ga0070675_100046415
2380 Ga0070675_100067779
2381 Ga0070675_100169899
2382 Ga0070675_100205742
2383 Ga0070675_100604734
2384 Ga0070675_100611966
2385 Ga0070671_100000595
2386 Ga0070671_100015479
2387 Ga0070671_100047984
2388 Ga0070671_100061508
2389 Ga0070671_100065641
2390 Ga0070671_100139147
2391 Ga0070671_100763838
2392 Ga0070671_101048064
2393 Ga0070671_101048066
2394 Ga0070674_100000249
2395 Ga0070674_100012198
2396 Ga0070674_100117652
2397 Ga0070674_100126896
2398 Ga0070674_100173582
2399 Ga0070674_100266565
2400 Ga0070674_100792035
2401 Ga0070674_100923651
2402 Ga0070673_100000233
2403 Ga0070673_100002283
2404 Ga0070673_100021868
2405 Ga0070673_100488374
2406 Ga0070673_101463571
2407 Ga0070688_100000432
2408 Ga0070688_100026130
2409 Ga0070688_100050191
2410 Ga0070688_100059054
2411 Ga0070688_100238496
2412 Ga0070688_100557811
2413 Ga0070688_100604749
2414 Ga0070659_100000746
2415 Ga0070659_100121193
2416 Ga0070659_100226845
2417 Ga0070659_101520848
2418 Ga0070667_100001881
2419 Ga0070667_100023663
2420 Ga0070667_100097581
2421 Ga0070667_100117881
2422 Ga0070667_100191100
2423 Ga0070667_100280667
2424 Ga0070667_100307260
2425 Ga0070667_100424440
2426 Ga0070667_101001405
2427 Ga0070667_101245663
2428 Ga0070703_10001482
2429 Ga0070703_10100692
2430 Ga0070709_10047309
2431 Ga0070709_10436863
2432 Ga0070709_10455178
2433 Ga0070709_10936571
2434 Ga0070714_100009048
2435 Ga0070714_100091046
2436 Ga0070714_100092299
2437 Ga0070714_100100894
2438 Ga0070714_100126560
2439 Ga0070714_100335533
2440 Ga0070714_100662321
2441 Ga0070714_100740007
2442 Ga0070713_100016466
2443 Ga0070713_100071321
2444 Ga0070713_100077622
2445 Ga0070713_100149455
2446 Ga0070713_100268420
2447 Ga0070713_100424108
2448 Ga0070713_100507234
2449 Ga0070713_100580296
2450 Ga0070713_101314619
2451 Ga0070710_10010676
2452 Ga0070710_10083509
2453 Ga0070710_10111938
2454 Ga0070710_10114113
2455 Ga0070710_10209295
2456 Ga0070710_10368273
2457 Ga0070710_10706782
2458 Ga0070701_10031287
2459 Ga0070701_10669322
2460 Ga0070711_100015569
2461 Ga0070711_100039311
2462 Ga0070711_100042375
2463 Ga0070711_100157199
2464 Ga0070711_100380430
2465 Ga0070705_100000361
2466 Ga0070705_100024922
2467 Ga0070705_100110267
2468 Ga0070705_101068873
2469 Ga0070700_100000357
2470 Ga0070700_100003357
2471 Ga0070700_100006176
2472 Ga0070700_100067834
2473 Ga0070700_100297972
2474 Ga0070700_100464700
2475 Ga0070700_100896540
2476 Ga0070694_100009629
2477 Ga0070694_100016773
2478 Ga0070694_100066054
2479 Ga0070694_100077948
2480 Ga0070694_100133504
2481 Ga0070694_100739236
2482 Ga0070708_100011297
2483 Ga0070708_100601179
2484 Ga0070663_100000582
2485 Ga0070663_100175884
2486 Ga0070663_100196707
2487 Ga0070663_100743917
2488 Ga0070663_100973195
2489 Ga0070663_100984138
2490 Ga0070678_100000438
2491 Ga0070678_100048424
2492 Ga0070678_100061654
2493 Ga0070678_100232794
2494 Ga0070678_100865010
2495 Ga0070678_101527312
2496 Ga0070662_100035557
2497 Ga0070662_100060479
2498 Ga0070662_100069477
2499 Ga0070662_100621065
2500 Ga0070662_100649269
2501 Ga0070681_10035954
2502 Ga0070681_10039781
2503 Ga0070681_10046250
2504 Ga0070681_10522177
2505 Ga0070681_10692382
2506 Ga0068867_100001099
2507 Ga0068867_100274953
2508 Ga0068867_100436226
2509 Ga0068867_100615546
2510 Ga0070685_10002191
2511 Ga0070685_10005188
2512 Ga0070685_10006230
2513 Ga0070707_100341121
2514 Ga0070707_100642181
2515 Ga0070699_100121587
2516 Ga0070699_100129260
2517 Ga0070699_101381204
2518 Ga0070679_100002503
2519 Ga0070679_100060552
2520 Ga0070679_100178466
2521 Ga0070679_100217496
2522 Ga0070679_100319630
2523 Ga0070679_101360868
2524 Ga0070679_101474501
2525 Ga0070684_100000101
2526 Ga0070684_100025722
2527 Ga0070684_100232752
2528 Ga0070684_100456395
2529 Ga0070684_100855120
2530 Ga0070697_100122513
2531 Ga0070697_100434090
2532 Ga0068853_100008586
2533 Ga0068853_101218989
2534 Ga0068853_101279451
2535 Ga0070672_100003443
2536 Ga0070672_100017991
2537 Ga0070672_100095012
2538 Ga0070672_100126981
2539 Ga0070672_100259043
2540 Ga0070672_100279313
2541 Ga0070672_101059669
2542 Ga0070686_100000532
2543 Ga0070686_100003076
2544 Ga0070686_100012133
2545 Ga0070686_100032670
2546 Ga0070686_100056682
2547 Ga0070686_100365139
2548 Ga0070686_100491425
2549 Ga0070686_100619836
2550 Ga0070686_101150856
2551 Ga0070695_100005890
2552 Ga0070695_100010023
2553 Ga0070695_100031254
2554 Ga0070695_101029290
2555 Ga0070695_101209592
2556 Ga0070696_100002353
2557 Ga0070696_100061565
2558 Ga0070696_100205520
2559 Ga0070696_100502300
2560 Ga0070696_100614607
2561 Ga0070696_100729350
2562 Ga0070693_100003380
2563 Ga0070693_100018122
2564 Ga0070693_100080782
2565 Ga0070693_100152175
2566 Ga0070693_100433332
2567 Ga0070693_100462228
2568 Ga0070665_100069518
2569 Ga0070665_100096979
2570 Ga0070665_100344682
2571 Ga0070665_101247298
2572 Ga0070665_101566558
2573 Ga0070704_100009296
2574 Ga0070704_100039046
2575 Ga0070704_100472997
2576 Ga0068855_100047838
2577 Ga0068855_100304761
2578 Ga0068855_101399322
2579 Ga0070664_100020910
2580 Ga0070664_100045986
2581 Ga0070664_100050840
2582 Ga0070664_100173825
2583 Ga0070664_100205124
2584 Ga0070664_100251297
2585 Ga0070664_100501479
2586 Ga0070664_100537883
2587 Ga0068857_100001072
2588 Ga0068857_100231806
2589 Ga0068857_100315177
2590 Ga0068857_100547386
2591 Ga0068854_100000794
2592 Ga0068854_100068465
2593 Ga0068854_101751338
2594 Ga0068856_100006877
2595 Ga0068856_100194751
2596 Ga0068856_100946836
2597 Ga0070702_100005817
2598 Ga0070702_100006263
2599 Ga0070702_100250484
2600 Ga0070702_100266210
2601 Ga0070702_100429399
2602 Ga0070702_100511628
2603 Ga0068852_100000713
2604 Ga0068852_100026582
2605 Ga0068852_100287888
2606 Ga0068852_101910944
2607 Ga0068859_100001523
2608 Ga0068859_100055926
2609 Ga0068859_100132778
2610 Ga0068859_100154018
2611 Ga0068859_100879257
2612 Ga0068859_101742908
2613 Ga0068864_100000715
2614 Ga0068864_100011540
2615 Ga0068864_100017038
2616 Ga0068864_100627682
2617 Ga0068866_10000861
2618 Ga0068866_10008505
2619 Ga0068866_10049473
2620 Ga0068866_10397866
2621 Ga0068861_100000574
2622 Ga0068861_100019829
2623 Ga0068861_100243313
2624 Ga0068861_100768270
2625 Ga0068851_10012824
2626 Ga0068851_10060094
2627 Ga0068870_10000009
2628 Ga0068870_10001327
2629 Ga0068863_100001272
2630 Ga0068863_100010495
2631 Ga0068863_100013621
2632 Ga0068863_100080683
2633 Ga0068863_100149451
2634 Ga0068863_100633517
2635 Ga0068863_100803503
2636 Ga0068863_101458315
2637 Ga0068858_100008506
2638 Ga0068858_100011270
2639 Ga0068858_100138044
2640 Ga0068858_100158451
2641 Ga0068858_100263877
2642 Ga0068858_100379023
2643 Ga0068858_100565977
2644 Ga0068858_100960638
2645 Ga0068858_101393658
2646 Ga0068860_100001758
2647 Ga0068860_100006468
2648 Ga0068860_100020537
2649 Ga0068860_100138960
2650 Ga0068860_100143847
2651 Ga0068860_100961195
2652 Ga0068862_100010288
2653 Ga0068862_100012556
2654 Ga0068862_100382209
2655 Ga0068862_101096322
2656 Ga0081455_10000002
2657 Ga0081455_10002472
2658 Ga0081455_10052457
2659 Ga0081455_10223921
2660 Ga0081455_10259042
2661 Ga0081538_10002038
2662 Ga0081538_10045574
2663 Ga0081538_10111348
2664 Ga0081540_1002171
2665 Ga0081540_1049627
2666 Ga0081539_10001225
2667 Ga0081539_10021565
2668 Ga0081539_10155866
2669 Ga0070717_10001112
2670 Ga0070717_10300666
2671 Ga0070717_10617332
2672 Ga0070717_10899768
2673 Ga0075365_10047510
2674 Ga0075365_10083448
2675 Ga0075365_10156746
2676 Ga0075365_10257352
2677 Ga0075365_10464145
2678 Ga0075368_10051208
2679 Ga0075364_10031309
2680 Ga0075364_10082133
2681 Ga0075364_10350178
2682 Ga0075364_10462032
2683 Ga0075364_10573871
2684 Ga0075432_10007391
2685 Ga0075432_10102486
2686 Ga0070715_10031454
2687 Ga0070715_10111064
2688 Ga0070716_100012500
2689 Ga0070716_100177340
2690 Ga0070716_100552456
2691 Ga0070716_101355687
2692 Ga0070712_100003993
2693 Ga0070712_100022892
2694 Ga0070712_100066126
2695 Ga0070712_100074378
2696 Ga0070712_100153247
2697 Ga0070712_100183944
2698 Ga0070712_100230202
2699 Ga0070712_100835834
2700 Ga0070712_101795230
2701 Ga0075362_10089319
2702 Ga0075362_10091610
2703 Ga0075362_10103455
2704 Ga0075367_10039780
2705 Ga0075367_10080993
2706 Ga0075367_10116168
2707 Ga0075367_10145458
2708 Ga0075367_10179370
2709 Ga0075369_10001932
2710 Ga0075369_10026208
2711 Ga0075369_10059624
2712 Ga0075369_10116952
2713 Ga0075369_10359369
2714 Ga0075427_10007351
2715 Ga0075366_10024644
2716 Ga0075366_10175114
2717 Ga0075366_10283936
2718 Ga0097621_100001018
2719 Ga0097621_100066291
2720 Ga0097621_100072805
2721 Ga0097621_100163570
2722 Ga0097621_100199155
2723 Ga0097621_100257964
2724 Ga0097621_100769044
2725 Ga0075370_10061344
2726 Ga0075370_10111364
2727 Ga0075370_10130462
2728 Ga0075370_10200912
2729 Ga0075370_10295748
2730 Ga0068871_100000012
2731 Ga0068871_100027675
2732 Ga0068871_100038119
2733 Ga0068871_100040464
2734 Ga0068871_100179135
2735 Ga0068871_100856059
2736 Ga0068871_101309499
2737 Ga0075428_100001200
2738 Ga0075428_100014639
2739 Ga0075428_100600029
2740 Ga0075428_101060433
2741 Ga0075430_100000032
2742 Ga0075430_100007411
2743 Ga0075430_100125575
2744 Ga0075431_100009024
2745 Ga0075431_100018864
2746 Ga0075431_100337228
2747 Ga0075431_100461551
2748 Ga0075431_100726028
2749 Ga0075433_10000072
2750 Ga0075433_10005026
2751 Ga0075433_10947946
2752 Ga0075433_11121779
2753 Ga0075434_100000341
2754 Ga0075434_100001937
2755 Ga0075434_100018020
2756 Ga0075434_100035479
2757 Ga0075434_100072041
2758 Ga0075434_100116720
2759 Ga0075434_100275416
2760 Ga0075434_100479098
2761 Ga0075434_100673352
2762 Ga0075429_100000631
2763 Ga0075429_100013494
2764 Ga0075429_100436965
2765 Ga0075429_100825681
2766 Ga0068865_100000328
2767 Ga0068865_100014896
2768 Ga0068865_100041691
2769 Ga0068865_100156536
2770 Ga0068865_100240314
2771 Ga0068865_100347933
2772 Ga0068865_100620881
2773 Ga0068865_101090505
2774 Ga0075436_100095605
2775 Ga0075436_100171912
2776 Ga0075436_100264051
2777 Ga0075436_100339636
2778 Ga0075436_100594935
2779 Ga0097620_100001523
2780 Ga0097620_100055926
2781 Ga0097620_100132777
2782 Ga0097620_100154020
2783 Ga0097620_100879224
2784 Ga0097620_101743473
2785 Ga0075435_100031353
2786 Ga0075435_100054843
2787 Ga0075435_100292073
2788 Ga0075435_100472832
2789 Ga0075435_100871397
2790 Ga0099794_10173693
2791 Ga0099795_10045084
2792 Ga0105251_10117675
2793 Ga0105244_10023808
2794 Ga0105240_10103668
2795 Ga0105240_10503276
2796 Ga0111539_10000915
2797 Ga0111539_10001908
2798 Ga0111539_10002936
2799 Ga0111539_10027823
2800 Ga0111539_10033800
2801 Ga0111539_10070815
2802 Ga0111539_10503546
2803 Ga0111539_10666951
2804 Ga0105245_10000301
2805 Ga0105245_10001404
2806 Ga0105245_10032714
2807 Ga0105245_10072717
2808 Ga0105245_10364859
2809 Ga0105245_11580710
2810 Ga0105247_10000881
2811 Ga0105247_10008839
2812 Ga0105247_10069023
2813 Ga0105247_10101848
2814 Ga0105247_10232918
2815 Ga0105247_10354888
2816 Ga0105247_10587127
2817 Ga0105247_10825547
2818 Ga0114129_10001035
2819 Ga0114129_10001551
2820 Ga0114129_10028120
2821 Ga0114129_10070313
2822 Ga0114129_10204372
2823 Ga0114129_11773734
2824 Ga0105243_10001028
2825 Ga0105243_10061177
2826 Ga0105243_10066314
2827 Ga0105243_10217822
2828 Ga0105243_10219816
2829 Ga0105243_10286709
2830 Ga0105243_11096495
2831 Ga0105241_10002719
2832 Ga0105241_10023657
2833 Ga0105241_10065709
2834 Ga0105241_10255640
2835 Ga0105241_10275633
2836 Ga0105241_10394855
2837 Ga0105241_10524514
2838 Ga0105242_10000607
2839 Ga0105242_10083542
2840 Ga0105242_10106058
2841 Ga0105242_10109860
2842 Ga0105242_10254277
2843 Ga0105242_10265475
2844 Ga0105242_10604903
2845 Ga0105242_10624918
2846 Ga0105242_10859272
2847 Ga0105248_10000309
2848 Ga0105248_10011832
2849 Ga0105248_10012810
2850 Ga0105248_10068237
2851 Ga0105248_10271398
2852 Ga0105248_10344652
2853 Ga0105248_10393029
2854 Ga0105248_10697500
2855 Ga0105248_11648727
2856 Ga0105248_11675713
2857 Ga0105237_10010578
2858 Ga0105237_10084828
2859 Ga0105237_10164686
2860 Ga0105237_11535558
2861 Ga0105238_10070190
2862 Ga0105238_10173704
2863 Ga0105238_10489555
2864 Ga0105238_11536282
2865 Ga0105238_11696647
2866 Ga0105249_10000486
2867 Ga0105249_10021002
2868 Ga0105249_10176979
2869 Ga0105249_10533323
2870 Ga0105249_10609198
2871 Ga0105249_10817491
2872 Ga0099796_10058433
2873 Ga0099796_10129770
2874 Ga0105239_10006677
2875 Ga0105239_10047213
2876 Ga0105239_10050734
2877 Ga0105239_10444362
2878 Ga0105239_10561715
2879 Ga0105239_10618740
2880 Ga0105239_10701840
2881 Ga0105246_10000696
2882 Ga0105246_10019527
2883 Ga0105246_10033787
2884 Ga0105246_10047691
2885 Ga0105246_10126771
2886 Ga0105246_10447242
2887 Ga0105246_11086625
2888 Ga0105246_11570894
2889 Ga0105246_11811455
2890 Ga0157336_1000555
2891 Ga0157346_1001469
2892 Ga0157346_1008134
2893 Ga0157337_1009938
2894 Ga0157321_1004681
2895 Ga0157314_1036743
2896 Ga0157347_1015555
2897 Ga0157313_1026130
2898 Ga0157316_1003498
2899 Ga0157338_1006492
2900 Ga0157338_1021895
2901 Ga0157373_10022136
2902 Ga0157373_10446972
2903 Ga0157373_10739440
2904 Ga0157371_10006574
2905 Ga0157371_10224499
2906 Ga0157370_10048300
2907 Ga0157370_11224808
2908 Ga0157369_11160066
2909 Ga0157374_10001864
2910 Ga0157374_10131391
2911 Ga0157374_10198399
2912 Ga0157374_10226231
2913 Ga0157374_10243059
2914 Ga0157374_10369815
2915 Ga0157374_10470262
2916 Ga0157374_11487396
2917 Ga0157378_10006042
2918 Ga0157378_10049474
2919 Ga0157378_10087367
2920 Ga0157378_10194452
2921 Ga0157378_10263051
2922 Ga0157378_10329991
2923 Ga0157378_10695918
2924 Ga0157378_11108267
2925 Ga0157378_12147029
2926 Ga0163162_10000992
2927 Ga0163162_10030120
2928 Ga0163162_10047201
2929 Ga0163162_10315183
2930 Ga0163162_10477093
2931 Ga0163162_11148359
2932 Ga0157372_10021474
2933 Ga0157372_10182904
2934 Ga0157372_10234079
2935 Ga0157372_10316968
2936 Ga0157372_11713422
2937 Ga0157375_10002320
2938 Ga0157375_10023485
2939 Ga0157375_10263963
2940 Ga0157375_10476118
2941 Ga0157375_11450759
2942 Ga0157375_11532036
2943 Ga0157375_11792803
2944 Ga0157375_11823333
2945 Ga0157375_12962685
2946 Ga0163163_10000824
2947 Ga0163163_10024973
2948 Ga0163163_10188373
2949 Ga0163163_10286426
2950 Ga0163163_11014405
2951 Ga0163163_11706952
2952 Ga0163163_12221413
2953 Ga0163163_12547273
2954 Ga0157380_10000711
2955 Ga0157380_10038106
2956 Ga0157380_10081471
2957 Ga0157380_10213892
2958 Ga0157380_10925690
2959 Ga0157377_10000336
2960 Ga0157377_10047817
2961 Ga0157379_10000678
2962 Ga0157379_10002722
2963 Ga0157379_10026862
2964 Ga0157379_10043686
2965 Ga0157379_10048261
2966 Ga0157379_10505990
2967 Ga0157379_10533181
2968 Ga0157379_10763044
2969 Ga0157379_10814747
2970 Ga0157379_11273174
2971 Ga0157376_10019841
2972 Ga0157376_10042923
2973 Ga0157376_10116548
2974 Ga0157376_10204882
2975 Ga0157376_10227912
2976 Ga0157376_10252843
2977 Ga0157376_10701427
2978 Ga0157376_10791508
2979 Ga0157376_10859210
2980 Ga0163161_10000534
2981 Ga0163161_10009513
2982 Ga0163161_10276967
2983 Ga0163161_10399926
2984 Ga0163161_10573771
2985 Ga0213876_10306262
2986 Ga0213875_10000012
2987 Ga0209233_1017203
2988 Ga0207666_1000177
2989 Ga0207673_1000025
2990 Ga0209758_1010682
2991 Ga0209758_1043695
2992 Ga0207697_10000374
2993 Ga0207697_10032416
2994 Ga0207697_10080865
2995 Ga0207656_10020761
2996 Ga0207656_10052210
2997 Ga0207655_1147347
2998 Ga0207713_1033188
2999 Ga0207713_1092712
3000 Ga0207653_10144532
3001 Ga0207653_10156519
3002 Ga0207682_10000011
3003 Ga0207682_10023013
3004 Ga0207692_10030829
3005 Ga0207692_10087775
3006 Ga0207692_10089130
3007 Ga0207692_10294800
3008 Ga0207692_10651482
3009 Ga0207642_10014960
3010 Ga0207642_10046703
3011 Ga0207642_10157265
3012 Ga0207642_10296665
3013 Ga0207642_10816502
3014 Ga0207710_10000805
3015 Ga0207710_10002863
3016 Ga0207710_10009874
3017 Ga0207710_10010652
3018 Ga0207710_10110335
3019 Ga0207688_10000020
3020 Ga0207688_10000552
3021 Ga0207688_10169692
3022 Ga0207688_10741926
3023 Ga0207680_10002333
3024 Ga0207680_10126532
3025 Ga0207680_10538469
3026 Ga0207647_10002391
3027 Ga0207647_10027807
3028 Ga0207647_10211940
3029 Ga0207685_10114895
3030 Ga0207685_10497794
3031 Ga0207699_10147619
3032 Ga0207699_10210624
3033 Ga0207699_10614290
3034 Ga0207699_10839916
3035 Ga0207645_10000108
3036 Ga0207645_10106424
3037 Ga0207645_10118629
3038 Ga0207645_10220349
3039 Ga0207645_10233868
3040 Ga0207645_10547281
3041 Ga0207643_10000628
3042 Ga0207643_10000685
3043 Ga0207643_10198875
3044 Ga0207705_11287652
3045 Ga0207684_10342124
3046 Ga0207684_11137858
3047 Ga0207654_10000818
3048 Ga0207654_10318187
3049 Ga0207707_10000689
3050 Ga0207707_10026505
3051 Ga0207707_10140553
3052 Ga0207707_10349180
3053 Ga0207707_10566562
3054 Ga0207707_10820323
3055 Ga0207707_11401839
3056 Ga0207695_10161501
3057 Ga0207695_10426315
3058 Ga0207671_10024759
3059 Ga0207671_10129740
3060 Ga0207671_10419287
3061 Ga0207693_10006663
3062 Ga0207693_10012111
3063 Ga0207693_10016657
3064 Ga0207693_10017791
3065 Ga0207693_10021550
3066 Ga0207693_10051181
3067 Ga0207693_10059861
3068 Ga0207693_10084844
3069 Ga0207693_10238629
3070 Ga0207663_10028739
3071 Ga0207663_10064670
3072 Ga0207663_10128831
3073 Ga0207663_10130076
3074 Ga0207663_10168423
3075 Ga0207663_10302657
3076 Ga0207663_10448209
3077 Ga0207663_10882585
3078 Ga0207660_10000442
3079 Ga0207660_10051713
3080 Ga0207660_10074664
3081 Ga0207660_10731722
3082 Ga0207660_11223555
3083 Ga0207662_10000249
3084 Ga0207662_10027330
3085 Ga0207662_10031720
3086 Ga0207662_10066121
3087 Ga0207662_10164952
3088 Ga0207662_10196961
3089 Ga0207657_10002726
3090 Ga0207657_10056929
3091 Ga0207657_10144933
3092 Ga0207657_10319780
3093 Ga0207649_10000057
3094 Ga0207649_10034271
3095 Ga0207649_10046622
3096 Ga0207649_10492955
3097 Ga0207649_11089612
3098 Ga0207652_10005483
3099 Ga0207652_10257590
3100 Ga0207652_10558794
3101 Ga0207652_10710033
3102 Ga0207652_11023546
3103 Ga0207646_10528869
3104 Ga0207681_10000181
3105 Ga0207681_10139805
3106 Ga0207681_10543796
3107 Ga0207694_10143576
3108 Ga0207694_10523821
3109 Ga0207694_11206291
3110 Ga0207650_10001609
3111 Ga0207650_10003057
3112 Ga0207650_10012596
3113 Ga0207650_10015274
3114 Ga0207650_10097696
3115 Ga0207650_10384787
3116 Ga0207650_10697001
3117 Ga0207659_10000028
3118 Ga0207659_10005491
3119 Ga0207659_10116378
3120 Ga0207659_10175416
3121 Ga0207659_10339430
3122 Ga0207687_10000061
3123 Ga0207687_10005331
3124 Ga0207687_10007575
3125 Ga0207687_10022684
3126 Ga0207687_10450883
3127 Ga0207687_10507505
3128 Ga0207687_10720039
3129 Ga0207687_11053289
3130 Ga0207700_10011806
3131 Ga0207700_10046780
3132 Ga0207700_10177925
3133 Ga0207700_10339689
3134 Ga0207700_10682471
3135 Ga0207700_11194624
3136 Ga0207664_10013880
3137 Ga0207664_10115394
3138 Ga0207664_10178240
3139 Ga0207664_10490486
3140 Ga0207664_10573945
3141 Ga0207664_10675757
3142 Ga0207644_10000315
3143 Ga0207644_10004323
3144 Ga0207644_10037243
3145 Ga0207644_10050456
3146 Ga0207644_10076433
3147 Ga0207644_10102567
3148 Ga0207644_10139003
3149 Ga0207644_10214173
3150 Ga0207644_10419372
3151 Ga0207644_10462366
3152 Ga0207644_10928318
3153 Ga0207690_10000445
3154 Ga0207690_10147077
3155 Ga0207690_10276212
3156 Ga0207690_10309347
3157 Ga0207690_10354488
3158 Ga0207706_10002206
3159 Ga0207706_10013099
3160 Ga0207706_10079703
3161 Ga0207706_10237809
3162 Ga0207706_10282642
3163 Ga0207706_10757584
3164 Ga0207686_10005349
3165 Ga0207686_10041334
3166 Ga0207686_10046732
3167 Ga0207686_10130116
3168 Ga0207686_10158495
3169 Ga0207686_10188844
3170 Ga0207686_10556732
3171 Ga0207686_10597008
3172 Ga0207709_10000539
3173 Ga0207709_10009571
3174 Ga0207709_10039576
3175 Ga0207709_10093036
3176 Ga0207670_10000217
3177 Ga0207670_10007816
3178 Ga0207670_10017489
3179 Ga0207670_10057141
3180 Ga0207670_10128714
3181 Ga0207670_11338456
3182 Ga0207669_10000147
3183 Ga0207669_10131409
3184 Ga0207669_10171732
3185 Ga0207669_10311744
3186 Ga0207669_10824754
3187 Ga0207704_10000299
3188 Ga0207704_10087431
3189 Ga0207704_10089534
3190 Ga0207704_10318828
3191 Ga0207665_10003176
3192 Ga0207691_10001422
3193 Ga0207691_10002033
3194 Ga0207691_10036102
3195 Ga0207691_10043403
3196 Ga0207691_10046867
3197 Ga0207691_10170354
3198 Ga0207711_10046542
3199 Ga0207711_10060307
3200 Ga0207711_10096859
3201 Ga0207711_10114309
3202 Ga0207711_10173785
3203 Ga0207711_11208138
3204 Ga0207711_11298004
3205 Ga0207689_10001029
3206 Ga0207689_10004322
3207 Ga0207689_10043505
3208 Ga0207689_10247557
3209 Ga0207661_10000215
3210 Ga0207661_10849827
3211 Ga0207679_10000026
3212 Ga0207679_10029628
3213 Ga0207679_10098964
3214 Ga0207679_10282282
3215 Ga0207679_10335140
3216 Ga0207679_10438990
3217 Ga0207667_10038113
3218 Ga0207667_10732242
3219 Ga0207651_10000342
3220 Ga0207651_10040521
3221 Ga0207651_10109456
3222 Ga0207651_10178399
3223 Ga0207651_10625163
3224 Ga0207651_11309614
3225 Ga0207712_10000686
3226 Ga0207712_10053365
3227 Ga0207712_10329654
3228 Ga0207712_10405953
3229 Ga0207712_10538073
3230 Ga0207712_11343125
3231 Ga0207668_10000242
3232 Ga0207668_10113591
3233 Ga0207668_10164745
3234 Ga0207668_10720732
3235 Ga0207668_11154731
3236 Ga0207640_10000833
3237 Ga0207640_10345586
3238 Ga0207640_10532620
3239 Ga0207640_10705337
3240 Ga0207658_10016307
3241 Ga0207658_10109234
3242 Ga0207658_10119126
3243 Ga0207658_10255753
3244 Ga0207658_10367702
3245 Ga0207658_10415246
3246 Ga0207658_10416868
3247 Ga0207677_10009440
3248 Ga0207677_10016232
3249 Ga0207677_10025936
3250 Ga0207677_10247869
3251 Ga0207677_11072468
3252 Ga0207677_11074279
3253 Ga0207703_10003706
3254 Ga0207703_10004423
3255 Ga0207703_10022281
3256 Ga0207703_10132935
3257 Ga0207703_10192969
3258 Ga0207703_10240785
3259 Ga0207703_10858231
3260 Ga0207703_11194252
3261 Ga0207639_10061852
3262 Ga0207639_10163344
3263 Ga0207639_10321689
3264 Ga0207678_10001079
3265 Ga0207678_10004670
3266 Ga0207678_10111016
3267 Ga0207678_10280636
3268 Ga0207678_10495468
3269 Ga0207678_10862801
3270 Ga0207678_10998087
3271 Ga0207708_10000402
3272 Ga0207708_10000805
3273 Ga0207708_10061691
3274 Ga0207708_10103195
3275 Ga0207708_10165338
3276 Ga0207708_10236079
3277 Ga0207708_10312514
3278 Ga0207708_10345061
3279 Ga0207702_10002121
3280 Ga0207702_10576461
3281 Ga0207702_10824182
3282 Ga0207641_10004016
3283 Ga0207641_10005860
3284 Ga0207641_10071199
3285 Ga0207641_10105193
3286 Ga0207641_10703584
3287 Ga0207641_11430580
3288 Ga0207648_10000731
3289 Ga0207648_10001024
3290 Ga0207648_10011630
3291 Ga0207648_10026793
3292 Ga0207648_10114086
3293 Ga0207648_10468162
3294 Ga0207648_11085301
3295 Ga0207676_10000361
3296 Ga0207676_10005133
3297 Ga0207676_10006308
3298 Ga0207676_10034200
3299 Ga0207676_10797133
3300 Ga0207676_11503009
3301 Ga0207674_10002121
3302 Ga0207674_10035134
3303 Ga0207675_100001489
3304 Ga0207675_100160388
3305 Ga0207675_100226310
3306 Ga0207675_100610024
3307 Ga0207675_100679416
3308 Ga0207675_102301118
3309 Ga0207683_10000034
3310 Ga0207683_10003078
3311 Ga0207683_10004966
3312 Ga0207683_10006107
3313 Ga0207683_10029889
3314 Ga0207683_10060242
3315 Ga0207683_10078712
3316 Ga0207683_10319098
3317 Ga0207698_10000304
3318 Ga0207698_10007558
3319 Ga0209969_1047040
3320 Ga0209984_1015339
3321 Ga0209179_1001721
3322 Ga0209999_1043036
3323 Ga0209970_1018131
3324 Ga0210002_1002675
3325 Ga0210002_1018765
3326 Ga0209983_1014143
3327 Ga0209971_1018583
3328 Ga0209966_1017019
3329 Ga0209974_10030139
3330 Ga0207428_10000082
3331 Ga0207428_10000352
3332 Ga0207428_10001078
3333 Ga0207428_10123404
3334 Ga0207428_10186406
3335 Ga0207428_11068626
3336 Ga0265357_1001279
3337 Ga0268266_10067461
3338 Ga0268266_10208955
3339 Ga0268266_10565528
3340 Ga0268266_10835032
3341 Ga0268266_11001423
3342 Ga0268266_11279981
3343 Ga0268265_10001338
3344 Ga0268265_10041815
3345 Ga0268265_10043339
3346 Ga0268265_10117825
3347 Ga0268265_10450453
3348 Ga0268264_10002557
3349 Ga0268264_10083174
3350 Ga0268264_10145082
3351 Ga0268264_10145696
3352 Ga0268264_10315800
3353 Ga0268264_10515928
3354 Ga0265338_10050615
3355 Ga0265763_1000492
3356 Ga0265760_10043066
3357 Ga0265330_10005052
3358 Ga0265330_10095799
3359 Ga0265320_10032922
3360 Ga0265325_10019046
3361 Ga0265325_10042332
3362 Ga0265325_10044431
3363 Ga0265325_10053225
3364 Ga0265325_10137699
3365 Ga0265340_10050661
3366 Ga0265340_10072991
3367 Ga0265340_10084274
3368 Ga0265340_10100636
3369 Ga0265340_10395328
3370 Ga0265339_10000038
3371 Ga0265339_10214584
3372 Ga0265316_10249840
3373 Ga0265316_10254199
3374 Ga0307509_10101962
3375 Ga0265313_10000024
3376 Ga0265313_10026585
3377 Ga0265313_10073254
3378 Ga0265314_10027960
3379 Ga0265314_10077978
3380 Ga0265342_10018522
3381 Ga0265342_10062783
3382 Ga0265342_10249450
3383 Ga0307415_100754611
3384 Ga0307510_10236811
3385 Ga0373930_0000071
3386 Ga0373930_0004752
3387 Ga0373948_0000973
3388 Ga0373948_0001393
3389 Ga0373948_0115717
3390 Ga0373950_0005539
3391 Ga0373950_0007843
3392 Ga0373958_0000121
3393 Ga0373959_0000829
3394 Ga0373938_0000045
3395 Ga0373938_0000596
3396 Ga0373938_0016059
3397 Ga0373926_0007448
3398 Ga0373926_0019770
3399 Ga0373926_0146990
3400 Ga0373928_0003385
3401 Ga0373928_0007898
3402 Ga0373928_0082680
3403 Ga0373929_0002006
3404 Ga0373929_0002397
3405 Ga0373934_0125439
3406 Ga0373940_0001266
3407 Ga0373940_0003018
3408 Ga0373940_0229517
3409 Ga0373944_0001324
3410 Ga0373944_0002080
3411 Ga0373944_0016887
3412 Ga0373944_0018572
3413 Ga0373944_0026693
3414 Ga0373949_0011925
3415 Ga0373949_0018081
3416 Ga0373949_0028499
3417 Ga0373951_0000695
3418 Ga0373951_0001161
3419 Ga0373952_0000221
3420 Ga0373952_0008157
3421 Ga0373952_0034910
3422 Ga0373952_0051529
3423 Ga0373923_0005448
3424 Ga0373923_0040902
3425 Ga0373923_0044802
3426 Ga0373923_0233118
3427 Ga0373932_0013379
3428 Ga0373932_0102803
3429 Ga0373936_0008182
3430 Ga0373939_0000875
3431 Ga0373939_0001533
3432 Ga0373939_0022941
3433 Ga0373939_0071713
3434 Ga0373939_0110451
3435 Ga0373941_0001970
3436 Ga0373941_0002983
3437 Ga0373941_0016817
3438 Ga0373945_0000864
3439 Ga0373945_0009003
3440 Ga0373945_0020170
3441 Ga0373953_0054304
3442 Ga0373954_0005098
3443 Ga0373954_0010833
3444 Ga0373954_0049150
3445 Ga0373954_0194610
3446 Ga0373956_0016870
3447 Ga0373956_0028034
3448 Ga0373956_0140542
3449 Ga0373956_0167932
3450 Ga0373960_0000083
3451 Ga0373960_0000603
3452 Ga0373960_0008857
3453 Ga0373943_0000495
3454 Ga0373943_0002515
3455 Ga0373943_0005818
3456 Ga0373943_0284352
3457 Ga0373943_0320509
3458 Ga0373943_0766463
3459 Ga0373946_0003328
3460 Ga0373946_0068619
3461 Ga0373946_0235345
3462 Ga0373946_0281112
3463 Ga0373946_0309880
3464 Ga0373955_0002872
3465 Ga0373955_0189850
3466 Ga0373942_0000535
3467 Ga0373942_0143317
3468 Ga0373961_0000559
3469 Ga0373961_0003814
3470 Ga0373961_0162762
3471 Ga0373962_0000468
3472 Ga0373962_0191028
3473 Ga0373924_0018184
3474 Ga0373924_0036321
3475 Ga0373924_0180865
3476 Ga0373924_0182108
3477 Ga0373931_0000179
3478 Ga0373931_0003177
3479 Ga0373931_0006218
3480 Ga0373931_0007820
3481 Ga0373931_0031022
3482 Ga0373931_0222194
3483 Ga0373931_0329166
3484 Ga0373935_0001447
3485 Ga0373935_0011857
3486 Ga0373935_0013245
3487 Ga0373935_0016312
3488 Ga0373935_0026703
3489 Ga0373935_0056648
3490 Ga0373935_0075674
3491 Ga0373935_0090757
3492 Ga0373927_0012133
3493 Ga0373927_0012650
3494 Ga0373927_0014596
3495 Ga0373927_0050471
3496 Ga0373927_0061598
3497 Ga0373927_0200607
3498 Ga0373927_0425576
3499 Ga0373927_0467785
3500 Ga0373933_0001759
3501 Ga0373933_0079735
3502 Ga0373933_0248448
3503 Ga0373947_0006073
3504 Ga0373947_0011475
3505 Ga0373947_0016850
3506 Ga0373947_0025028
3507 Ga0373947_0040583
3508 Ga0373947_0041211
3509 Ga0373947_0136493
3510 Ga0373947_0175701
3511 Ga0373947_0175759
3512 Ga0373947_0181389
3513 Ga0373947_0251069
3514 Ga0373947_0885215
3515 Ga0373937_0000879
3516 Ga0373937_0002919
3517 Ga0373937_0035288
3518 Ga0373937_0112018
3519 Ga0373937_0495606
3520 Ga0373937_0907610
3521 Ga0373925_0001617
3522 Ga0373925_0006666
3523 Ga0373925_0022396
3524 Ga0373925_0029354
3525 Ga0373925_0035293
3526 Ga0373925_0113908
3527 Ga0373925_0252494
3528 Ga0373925_0402657
3529 Ga0373925_0854115
3530 Ga0395899_0085676
3531 Ga0395899_0144780
3532 Ga0395900_0023880
3533 Ga0395900_0131108
3534 Ga0395900_0230984
3535 Ga0395900_1237273
3536 Ga0395898_0081299
3537 Ga0395898_0081808
3538 Ga0395898_0564552
3539 Ga0436364_0959530
3540 Ga0436364_1094525
3541 Ga0395901_0019584
3542 Ga0395901_0354348
3543 Ga0395901_0734638
3544 Ga0242420_013473
3545 Ga0436365_0269478
3546 Ga0436365_0734273
3547 Ga0436365_1273664
3548 Ga0436365_1457423
3549 Ga0436361_0387528
3550 Ga0436363_0395586
3551 Ga0436363_1335842
3552 Ga0436362_0848397
3553 Ga0436362_0918289
3554 Ga0451855_1662702
3555 Ga0439441_029652
3556 Ga0439448_0273864
3557 Ga0439455_0004911
3558 Ga0439435_0032947
3559 Ga0439464_0040350
3560 Ga0451577_0017275
3561 Ga0466966_0155782
3562 Ga0466963_0003423
3563 Ga0466963_0872086
3564 Ga0453684_0099623
3565 Ga0466957_0065995
3566 Ga0466959_0025838
3567 Ga0451576_0004698
3568 Ga0466958_0162709
3569 Ga0466967_0013163
3570 Ga0466967_0130319
3571 Ga0466967_2109600
3572 Ga0495627_053486
3573 Ga0495592_0002436
3574 Ga0495592_0007150
3575 Ga0495592_0096465
3576 Ga0495592_0102143
3577 Ga0495592_0143210
3578 Ga0495603_0104580
3579 Ga0495603_0145180
3580 Ga0495603_0293723
3581 Ga0495590_0031561
3582 Ga0495629_0000062
3583 Ga0495629_0001750
3584 Ga0495629_0041665
3585 Ga0495629_0125312
3586 Ga0495629_0129739
3587 Ga0495638_0024772
3588 Ga0495638_0084360
3589 Ga0495641_0005493
3590 Ga0495641_0020006
3591 Ga0495641_0055349
3592 Ga0495651_0010900
3593 Ga0495651_0024994
3594 Ga0495651_0305596
3595 Ga0495653_0004420
3596 Ga0495653_0007557
3597 Ga0495653_0041279
3598 Ga0495653_0069293
3599 Ga0495653_0096530
3600 Ga0495653_0112840
3601 Ga0495653_0784541
3602 Ga0495650_0066495
3603 Ga0495580_0018212
3604 Ga0495580_0044691
3605 Ga0495580_0124303
3606 Ga0495580_0173200
3607 Ga0495580_0493037
3608 Ga0495580_0770081
3609 Ga0495582_0015348
3610 Ga0495582_0032548
3611 Ga0495582_0044598
3612 Ga0495582_0074327
3613 Ga0495582_0115906
3614 Ga0495582_0172048
3615 Ga0495605_0327874
3616 Ga0495639_0002473
3617 Ga0495639_0034490
3618 Ga0495639_0078819
3619 Ga0495639_0108288
3620 Ga0495662_0000962
3621 Ga0495662_0037814
3622 Ga0495662_0120058
3623 Ga0495662_0161514
3624 Ga0495662_0185742
3625 Ga0495664_0000189
3626 Ga0495664_0006433
3627 Ga0495664_0024821
3628 Ga0495664_0099102
3629 Ga0495664_0117122
3630 Ga0495664_0311291
3631 Ga0495584_0012696
3632 Ga0495584_0048106
3633 Ga0495584_0104741
3634 Ga0495585_0000389
3635 Ga0495585_0152789
3636 Ga0495585_0436454
3637 Ga0495594_0016941
3638 Ga0495594_0025270
3639 Ga0495594_0080024
3640 Ga0495594_0187089
3641 Ga0495596_0185206
3642 Ga0495607_0060180
3643 Ga0495583_0077837
3644 Ga0495608_0000129
3645 Ga0495608_0000211
3646 Ga0495608_0017027
3647 Ga0495608_0020973
3648 Ga0495610_0029915
3649 Ga0495616_0028133
3650 Ga0495616_0211038
3651 Ga0495618_0003211
3652 Ga0495618_0017692
3653 Ga0495618_0025062
3654 Ga0495618_0033993
3655 Ga0495618_0131110
3656 Ga0495618_0429287
3657 Ga0495628_0018229
3658 Ga0495628_0036943
3659 Ga0495628_0083997
3660 Ga0495630_0102387
3661 Ga0495630_0111143
3662 Ga0495630_0129373
3663 Ga0495630_0137207
3664 Ga0495630_0819635
3665 Ga0495631_0064308
3666 Ga0495631_0107876
3667 Ga0495631_0336054
3668 Ga0495632_0025840
3669 Ga0495637_0151845
3670 Ga0495644_0024051
3671 Ga0495663_0053732
3672 Ga0495666_0012091
3673 Ga0495666_0430498
3674 Ga0495642_0092993
3675 Ga0495652_0013892
3676 Ga0495652_0015272
3677 Ga0495652_0018248
3678 Ga0495652_0020765
3679 Ga0495652_0084991
3680 Ga0495652_0294112
3681 Ga0495652_0353504
3682 Ga0495652_0375123
3683 Ga0495654_0314819
3684 Ga0495665_0012108
3685 Ga0495665_0025783
3686 Ga0495665_0078236
3687 Ga0495665_0178315
3688 Ga0495665_0216904
3689 Ga0495665_0384828
3690 Ga0495665_0432361
3691 Ga0495640_0005586
3692 Ga0495640_0019882
3693 Ga0495640_0029004
3694 Ga0495640_0079142
3695 Ga0495640_0116148
3696 Ga0495640_0316264
3697 Ga0495586_0001909
3698 Ga0495586_0249930
3699 Ga0495587_0001060
3700 Ga0495587_0001528
3701 Ga0495587_0004785
3702 Ga0495598_0000638
3703 Ga0495598_0001355
3704 Ga0495598_0016448
3705 Ga0495598_0027619
3706 Ga0495621_0037851
3707 Ga0495621_0166383
3708 Ga0495645_0008141
3709 Ga0495645_0008998
3710 Ga0495645_0051727
3711 Ga0495645_0142765
3712 Ga0495622_0010569
3713 Ga0495622_0054345
3714 Ga0495633_0005189
3715 Ga0495633_0050481
3716 Ga0495633_0066883
3717 Ga0495667_0007026
3718 Ga0495667_0010190
3719 Ga0495667_0095260
3720 Ga0495667_0187771
3721 Ga0495667_0229094
3722 Ga0495667_0394957
3723 Ga0495667_0452474
3724 Ga0495656_0011646
3725 Ga0495656_0021894
3726 Ga0495656_0035144
3727 Ga0495656_0059229
3728 Ga0495656_0444706
3729 Ga0495668_0060612
3730 Ga0495668_0296886
3731 Ga0495634_0001707
3732 Ga0495634_0017126
3733 Ga0495634_0043617
3734 Ga0495634_0048148
3735 Ga0495634_0079499
3736 Ga0495634_0166852
3737 Ga0495611_0049562
3738 Ga0495611_0066725
3739 Ga0495625_0236050
3740 Ga0495635_0000992
3741 Ga0495635_0024646
3742 Ga0495635_0116288
3743 Ga0495635_0126292
3744 Ga0495635_0156279
3745 Ga0495635_0681209
3746 Ga0495659_0018351
3747 Ga0495661_0038158
3748 Ga0495661_0137091
3749 Ga0495588_0011027
3750 Ga0495588_0062823
3751 Ga0495657_0030110
3752 Ga0495657_0044613
3753 Ga0495657_0694016
3754 Ga0495599_0000294
3755 Ga0495599_0018705
3756 Ga0495599_0182320
3757 Ga0495599_0272105
3758 Ga0495623_0000917
3759 Ga0495623_0001158
3760 Ga0495623_0085534
3761 Ga0495623_0277799
3762 Ga0495646_0010253
3763 Ga0495646_0036805
3764 Ga0495646_0231068
3765 Ga0495646_0693977
3766 Ga0495647_0186840
3767 Ga0495658_0000109
3768 Ga0495658_0009239
3769 Ga0495658_0056757
3770 Ga0495658_0161264
3771 Ga0495658_0178293
3772 Ga0495658_0182701
3773 Ga0495658_0301501
3774 Ga0495658_0421583
3775 Ga0495669_0033673
3776 Ga0495669_0104408
3777 Ga0495613_0047267
3778 Ga0495613_0078612
3779 Ga0495613_0164945
3780 Ga0495624_0006136
3781 Ga0495624_0018920
3782 Ga0495624_0029472
3783 Ga0495624_0667125
3784 Ga0495670_0000106
3785 Ga0495670_0034922
3786 Ga0495670_0043654
3787 Ga0495671_0081344
3788 Ga0495671_0406879
3789 Ga0495649_0291153
3790 Ga0495589_0089818
3791 Ga0495600_0000977
3792 Ga0495600_0034212
3793 Ga0495600_0036076
3794 Ga0495600_0057594
3795 Ga0495660_0080202
3796 Ga0495581_0001433
3797 Ga0495581_0015600
3798 Ga0495581_0224555
3799 Ga0495581_0658084
3800 Ga0495604_0000360
3801 Ga0495604_0001139
3802 Ga0495604_0007197
3803 Ga0495636_0429436
3804 Ga0495674_0004987
3805 Ga0495674_0009292
3806 Ga0495674_0010157
3807 Ga0495674_0062334
3808 Ga0495674_0194812
3809 Ga0495674_0784197
3810 Ga0495672_0178250
3811 Ga0495676_0057669
3812 Ga0495676_0133868
3813 Ga0495676_0153929
3814 Ga0495676_0210268
3815 Ga0495680_0001204
3816 Ga0495680_0003174
3817 Ga0495680_0039181
3818 Ga0495680_0154706
3819 Ga0495680_0345769
3820 Ga0495675_0000190
3821 Ga0495675_0021034
3822 Ga0495675_0280884
3823 Ga0495677_0024077
3824 Ga0495679_086459
3825 Ga0495685_147016
3826 Ga0495681_0026789
3827 Ga0495684_0004759
3828 Ga0495684_0004792
3829 Ga0495684_0039855
3830 Ga0495684_0050344
3831 Ga0495684_0052229
3832 Ga0495684_0080701
3833 Ga0495684_0362279
3834 Ga0495593_0001596
3835 Ga0495593_0007105
3836 Ga0495593_0019723
3837 Ga0495593_0031911
3838 Ga0495593_0089106
3839 Ga0495593_0163640
3840 Ga0495593_0604714
3841 Ga0495602_0000939
3842 Ga0495602_0018144
3843 Ga0495602_0091926
3844 Ga0495602_0111149
3845 Ga0495602_0229245
3846 Ga0495615_0029147
3847 Ga0496100_0000883
3848 Ga0496100_0001014
3849 Ga0496100_0009146
3850 Ga0496100_0014178
3851 Ga0496100_0035966
3852 Ga0496100_0103306
3853 Ga0496100_0342133
3854 Ga0496100_0365331
3855 Ga0496100_0368066
3856 Ga0496100_0372249
3857 Ga0496100_0862317
3858 Ga0496101_0001110
3859 Ga0496101_0001721
3860 Ga0496101_0054900
3861 Ga0496101_0116176
3862 Ga0496101_0130255
3863 Ga0496101_0130307
3864 Ga0496101_0145568
3865 Ga0496101_0193386
3866 Ga0496101_0381219
3867 Ga0496101_0466525
3868 Ga0496101_1184939
3869 Ga0496101_1477163
3870 Ga0496102_0002752
3871 Ga0496102_0005298
3872 Ga0496102_0008594
3873 Ga0496102_0017375
3874 Ga0496102_0028624
3875 Ga0496102_0102034
3876 Ga0496102_0144315
3877 Ga0496102_0187655
3878 Ga0496102_0352590
3879 Ga0496102_0460446
3880 Ga0496102_1139727
3881 Ga0496103_0000582
3882 Ga0496103_0002481
3883 Ga0496103_0003119
3884 Ga0496103_0005721
3885 Ga0496103_0012578
3886 Ga0496103_0061510
3887 Ga0496103_0135141
3888 Ga0496103_0135549
3889 Ga0496103_0516181
3890 Ga0496103_0569489
3891 Ga0496104_0007237
3892 Ga0496104_0010494
3893 Ga0496104_0029229
3894 Ga0496104_0031868
3895 Ga0496104_0035483
3896 Ga0496104_0042135
3897 Ga0496104_0125502
3898 Ga0496104_0417297
3899 Ga0496104_0462919
3900 Ga0496104_0548768
3901 Ga0496104_1112467
3902 Ga0496105_0001558
3903 Ga0496105_0003169
3904 Ga0496105_0028842
3905 Ga0496105_0055785
3906 Ga0496105_0096952
3907 Ga0496105_0296238
3908 Ga0496105_0532416
3909 Ga0496105_0796266
3910 Ga0496105_0864732
3911 Ga0496105_0990150
3912 Ga0496106_0002154
3913 Ga0496106_0013483
3914 Ga0496106_0023714
3915 Ga0496106_0024535
3916 Ga0496106_0042860
3917 Ga0496106_0071467
3918 Ga0496106_0087140
3919 Ga0496106_0138385
3920 Ga0496106_0434104
3921 Ga0496106_0439309
3922 Ga0496106_1368807
3923 Ga0496107_0004170
3924 Ga0496107_0007065
3925 Ga0496107_0010170
3926 Ga0496107_0015819
3927 Ga0496107_0038014
3928 Ga0496107_0086487
3929 Ga0496107_0091502
3930 Ga0496107_0252415
3931 Ga0496107_0391556
3932 Ga0496107_0848043
3933 Ga0496108_0002843
3934 Ga0496108_0006074
3935 Ga0496108_0018748
3936 Ga0496108_0022946
3937 Ga0496108_0053606
3938 Ga0496108_0057689
3939 Ga0496108_0116424
3940 Ga0496108_0131099
3941 Ga0496108_0143900
3942 Ga0496108_0319713
3943 Ga0496109_0000384
3944 Ga0496109_0000736
3945 Ga0496109_0025448
3946 Ga0496109_0031190
3947 Ga0496109_0033566
3948 Ga0496109_0038333
3949 Ga0496109_0077453
3950 Ga0496109_0086166
3951 Ga0496109_0104469
3952 Ga0496109_0107345
3953 Ga0496109_0319741
3954 Ga0496109_0546349
3955 Ga0496110_0002213
3956 Ga0496110_0003023
3957 Ga0496110_0005680
3958 Ga0496110_0024829
3959 Ga0496110_0037606
3960 Ga0496110_0041599
3961 Ga0496110_0056543
3962 Ga0496110_0326364
3963 Ga0496110_1033151
3964 Ga0496110_1067375
3965 Ga0496110_1093020
3966 Ga0496110_1585837
3967 Ga0496111_0002054
3968 Ga0496111_0005543
3969 Ga0496111_0017102
3970 Ga0496111_0041909
3971 Ga0496111_0114824
3972 Ga0496111_0150568
3973 Ga0496111_0176601
3974 Ga0496111_0200583
3975 Ga0496111_0826831
3976 Ga0496112_0002196
3977 Ga0496112_0003380
3978 Ga0496112_0009635
3979 Ga0496112_0021933
3980 Ga0496112_0027921
3981 Ga0496112_0028856
3982 Ga0496112_0034785
3983 Ga0496112_0080898
3984 Ga0496112_0102410
3985 Ga0496112_0197756
3986 Ga0496112_0694398
3987 Ga0496112_0759667
3988 Ga0496113_0002202
3989 Ga0496113_0006851
3990 Ga0496113_0018382
3991 Ga0496113_0074647
3992 Ga0496113_0117492
3993 Ga0496113_0216308
3994 Ga0496113_0224481
3995 Ga0496113_0228860
3996 Ga0496113_0658005
3997 Ga0496113_0804168
3998 Ga0496113_0872700
3999 Ga0496114_0003895
4000 Ga0496114_0006922
4001 Ga0496114_0010065
4002 Ga0496114_0097585
4003 Ga0496114_0116425
4004 Ga0496114_0519405
4005 Ga0496114_0962067
4006 Ga0496115_0002409
4007 Ga0496115_0014762
4008 Ga0496115_0016238
4009 Ga0496115_0039365
4010 Ga0496115_0053154
4011 Ga0496115_0073203
4012 Ga0496115_0190245
4013 Ga0496115_0203002
4014 Ga0496115_0217606
4015 Ga0496115_0637062
4016 Ga0496115_0637680
4017 Ga0496115_1106408
4018 Ga0496118_0142145
4019 Ga0496119_0075493
4020 Ga0496119_0200701
4021 Ga0496120_0282930
4022 Ga0496121_0001203
4023 Ga0501031_0021558
4024 Ga0501031_0145513
4025 Ga0501031_0430327
4026 Ga0501032_0013465
4027 Ga0501032_0187761
4028 Ga0501033_0022327
4029 Ga0501033_0045402
4030 Ga0501033_0219597
4031 Ga0501034_0061762
4032 Ga0501034_0127693
4033 Ga0501034_0320681
4034 Ga0501034_0461508
4035 Ga0501034_0657355
4036 Ga0501036_0010044
4037 Ga0501036_0097681
4038 Ga0501036_0330524
4039 Ga0501036_0599800
4040 Ga0501037_0008767
4041 Ga0501037_0091527
4042 Ga0501037_0174526
4043 Ga0501037_0332335
4044 Ga0501038_0003573
4045 Ga0501038_0024219
4046 Ga0501038_0054055
4047 Ga0501038_0621448
4048 Ga0501039_0056048
4049 Ga0501039_0179071
4050 Ga0501039_0449738
4051 Ga0501039_1313295
4052 Ga0501041_0450134
4053 Ga0501042_0260251
4054 Ga0501042_0369412
4055 Ga0501043_0016285
4056 Ga0501043_0462749
4057 Ga0501046_0007715
4058 Ga0501047_0130763
4059 Ga0501047_0130941
4060 Ga0501047_0207381
4061 Ga0501047_0252337
4062 Ga0501047_0422448
4063 Ga0501048_0007056
4064 Ga0501048_0092956
4065 Ga0501048_0417202
4066 Ga0501048_1102861
4067 Ga0501067_0163073
4068 Ga0501068_0003549
4069 Ga0501068_0280834
4070 Ga0501069_0230171
4071 Ga0501070_0031699
4072 Ga0501070_0094553
4073 Ga0501070_0099161
4074 Ga0501070_0153402
4075 Ga0501070_0365690
4076 Ga0501071_0015838
4077 Ga0501071_0215543
4078 Ga0501072_0075216
4079 Ga0501073_0074958
4080 Ga0501073_0726516
4081 Ga0501073_1088282
4082 Ga0501075_0171856
4083 Ga0501075_0222822
4084 Ga0501076_0018574
4085 Ga0501077_0010133
4086 Ga0501079_0014563
4087 Ga0501079_0621986
4088 Ga0501079_0938744
4089 Ga0501080_0029067
4090 Ga0501080_0349968
4091 Ga0501081_0053250
4092 Ga0501083_0004338
4093 Ga0501083_0011778
4094 Ga0501083_0144040
4095 Ga0501083_0267220
4096 Ga0501035_0006796
4097 Ga0501035_0049464
4098 Ga0501035_0096444
4099 Ga0501035_0101385
4100 Ga0501035_0174157
4101 Ga0501035_0248890
4102 Ga0501035_0465613
4103 Ga0501044_0003604
4104 Ga0501044_0026832
4105 Ga0501044_0084848
4106 Ga0501044_0151099
4107 Ga0501044_0274507
4108 Ga0501044_0276218
4109 Ga0501044_0300952
4110 Ga0501044_0383307
4111 Ga0501044_0387202
4112 Ga0501044_0450894
4113 Ga0501045_0189372
4114 nmdc:mga03683_13305_c1
4115 nmdc:mga03683_94363_c1
4116 nmdc:mga03n38_216440_c1
4117 nmdc:mga03n38_26625_c1
4118 nmdc:mga03n38_70992_c1
4119 nmdc:mga00v17_114008_c1
4120 nmdc:mga00v17_190164_c1
4121 nmdc:mga00v17_295825_c1
4122 nmdc:mga00v17_546752_c1
4123 nmdc:mga0yw44_144147_c1
4124 nmdc:mga0yw44_195533_c1
4125 nmdc:mga0yw44_263060_c1
4126 nmdc:mga0yw44_32663_c1
4127 nmdc:mga0yw44_38878_c1
4128 nmdc:mga0yw44_494860_c1
4129 nmdc:mga0yw44_62725_c1
4130 nmdc:mga0k408_137211_c1
4131 nmdc:mga0k408_239141_c1
4132 nmdc:mga0k408_637389_c1
4133 nmdc:mga06z11_188437_c1
4134 nmdc:mga06z11_211635_c1
4135 nmdc:mga06z11_248424_c1
4136 nmdc:mga06z11_25416_c1
4137 nmdc:mga06z11_381047_c1
4138 nmdc:mga06z11_441259_c1
4139 nmdc:mga06z11_455963_c1
4140 nmdc:mga06z11_52618_c1
4141 nmdc:mga04h51_82259_c1
4142 nmdc:mga07m45_108668_c1
4143 nmdc:mga07m45_128101_c1
4144 nmdc:mga05p37_11620_c1
4145 nmdc:mga05p37_1252734_c1
4146 nmdc:mga05p37_19_c2
4147 nmdc:mga05p37_284395_c1
4148 nmdc:mga05p37_5389_c1
4149 nmdc:mga05p37_60931_c1
4150 nmdc:mga05p37_62542_c1
4151 nmdc:mga05p37_652410_c1
4152 nmdc:mga09592_238_c1
4153 nmdc:mga09592_28100_c2
4154 nmdc:mga09592_422439_c1
4155 nmdc:mga09592_752032_c1
4156 nmdc:mga0qj67_259_c1
4157 nmdc:mga0qj67_43438_c1
4158 nmdc:mga0qj67_47225_c1
4159 nmdc:mga0qj67_933_c1
4160 nmdc:mga06r32_2023_c1
4161 nmdc:mga06r32_33555_c1
4162 nmdc:mga06r32_557085_c1
4163 nmdc:mga06r32_558689_c1
4164 nmdc:mga08y16_209698_c1
4165 nmdc:mga08y16_230812_c1
4166 nmdc:mga08y16_2548_c1
4167 nmdc:mga08y16_2735_c1
4168 nmdc:mga08y16_680431_c1
4169 nmdc:mga0n895_120909_c1
4170 nmdc:mga0n895_1651_c1
4171 nmdc:mga0n895_236272_c1
4172 nmdc:mga0n895_350022_c1
4173 nmdc:mga0n895_37298_c1
4174 nmdc:mga0n895_394_c1
4175 nmdc:mga0n895_41689_c1
4176 nmdc:mga0n895_528383_c1
4177 nmdc:mga0n895_737764_c1
4178 nmdc:mga0n895_9070_c1
4179 nmdc:mga0rr50_1052072_c1
4180 nmdc:mga0rr50_13004_c1
4181 nmdc:mga0rr50_417419_c1
4182 nmdc:mga0rr50_462055_c1
4183 nmdc:mga0rr50_49049_c1
4184 nmdc:mga0rr50_785_c1
4185 nmdc:mga08x19_147075_c1
4186 nmdc:mga08x19_232918_c1
4187 nmdc:mga08x19_52251_c1
4188 nmdc:mga08x19_54177_c1
4189 nmdc:mga08x19_98074_c1
4190 nmdc:mga0a205_107086_c1
4191 nmdc:mga0a205_1167_c2
4192 nmdc:mga0a205_249_c1
4193 nmdc:mga0a205_315905_c1
4194 nmdc:mga0a205_39512_c2
4195 nmdc:mga0a205_513640_c1
4196 nmdc:mga0a205_621396_c1
4197 nmdc:mga0sz30_28584_c1
4198 nmdc:mga0sz30_328241_c1
4199 nmdc:mga0sz30_346313_c1
4200 Ga0495601_0001035
4201 Ga0495601_0002495
4202 Ga0495601_0006979
4203 Ga0495601_0019854
4204 Ga0495601_0024854
4205 Ga0495601_0051130
4206 Ga0495601_0114981
4207 Ga0495601_0130848
4208 Ga0495601_0135407
4209 Ga0495612_0005592
4210 Ga0495612_0009082
4211 Ga0495612_0010155
4212 Ga0495612_0034559
4213 Ga0495612_0047985
4214 Ga0495612_0082495
4215 Ga0495612_0197996
4216 Ga0500635_0015141
4217 Ga0495655_0034643
4218 Ga0495595_0000305
4219 Ga0495595_0000463
4220 Ga0495595_0001598
4221 Ga0495595_0005742
4222 Ga0495619_0000052
4223 Ga0495619_0000078
4224 Ga0495619_0001206
4225 Ga0495619_0002522
4226 Ga0495619_0008359
4227 Ga0495619_0020914
4228 Ga0495619_0023566
4229 Ga0495619_0025235
4230 Ga0495619_0061471
4231 Ga0495619_0080423
4232 Ga0495619_0206411
4233 Ga0495619_0605257
4234 Ga0495619_0633603
4235 Ga0500643_002661
4236 Ga0500651_0030627
4237 Ga0500651_0091143
4238 Ga0500651_0553606
4239 Ga0500566_0103116
4240 Ga0500650_0075193
4241 Ga0500595_000003
4242 Ga0500595_022759
4243 Ga0500642_0065529
4244 Ga0500652_000033
4245 Ga0500652_002017
4246 Ga0500559_0036419
4247 Ga0500577_0361724
4248 Ga0500616_0000002
4249 Ga0500616_0000028
4250 Ga0500616_0141357
4251 Ga0500636_0024898
4252 Ga0500636_0158993
4253 Ga0500637_0421960
4254 Ga0500645_000078
4255 Ga0501084_0032563
4256 Ga0501084_0235585
4257 Ga0501084_0511799
4258 Ga0590077_053709
4259 Ga0587073_0183415
4260 Ga0587077_133692
4261 Ga0587072_049375
4262 Ga0501082_0259159
4263 Ga0501082_0566173
4264 Ga0501082_0780337
4265 Ga0501082_0796100
4266 Ga0501082_0870433
4267 Ga0501082_1020082
4268 Ga0466962_0160192
4269 Ga0530510_0038877
4270 Ga0530510_0070744
4271 Ga0530510_0074232
4272 Ga0530510_0765918
4273 Ga0530510_1094185
4274 2507511102
4275 2508544917
4276 2508696856
4277 2513623559
4278 2513637387
4279 2513649762
4280 2513706868
4281 2513716994
4282 2513874725
4283 2513892162
4284 2514010554
4285 2515625331
4286 2517100669
4287 2524438109
4288 2528855553
4289 2617353309
4290 2617373222
4291 2643757513
4292 2745077010
4293 2793061957
4294 2805916726
4295 2818238234
4296 2824608939
4297 2824611621
4298 2824626223
4299 2824634939
4300 2824643220
4301 2824651481
4302 2824660892
4303 2824670612
4304 2824678806
4305 2824687399
4306 2824695198
4307 2824703647
4308 2824712531
4309 2824722669
4310 2824731459
4311 2824739758
4312 2824753492
4313 2824763239
4314 2824773108
4315 2824781248
4316 2838127974
4317 2841943272
4318 2841954000
4319 2841961958
4320 2841968092
4321 2841980852
4322 2841981348
4323 2841988071
4324 2842042625
4325 2842050668
4326 2844316829
4327 2847938641
4328 2847944160
4329 2849081616
4330 2857512267
4331 2874597832
4332 2874616889
4333 2874623357
4334 2874625412
4335 2874631291
4336 2874651361
4337 2876762929
4338 2876776432
4339 2876821000
4340 2879081705
4341 2879088385
4342 2879108889
4343 2879130420
4344 2879147784
4345 2881370759
4346 2881673259
4347 2885366855
4348 2885414582
4349 2888381445
4350 2888389204
4351 2888421848
4352 2903733882
4353 2904670630
4354 2904672712
4355 2904719319
4356 2906606818
4357 2906635255
4358 2906651994
4359 2908781679
4360 2909043243
4361 2922371092
4362 2922401041
4363 2929619488
4364 2929628042
4365 2932785814
4366 2932801062
4367 2932804191
4368 2932813618
4369 2932826673
4370 2932830859
4371 2933581408
4372 2935612669
4373 2935620902
4374 2935639985
4375 2935655214
4376 2935664095
4377 2935667161
4378 2935677779
4379 2935690290
4380 2935697374
4381 2935704917
4382 2935718014
4383 2935726836
4384 2935735606
4385 2935745123
4386 2935755300
4387 2935762178
4388 2935773563
4389 2935784533
4390 2935788532
4391 2935796688
4392 2935803681
4393 2935811595
4394 2935824158
4395 2935829468
4396 2935842555
4397 2935852695
4398 2935858710
4399 2935866868
4400 2935876999
4401 2935890452
4402 2935912152
4403 2935922365
4404 2935929181
4405 2935935812
4406 2935947378
4407 2935953528
4408 2935961964
4409 2935968554
4410 2935976734
4411 2935990641
4412 2935993361
4413 2936004256
4414 2936015407
4415 2936024041
4416 2936033056
4417 2936038177
4418 2936051149
4419 2936058526
4420 2940561419
4421 2941533609
4422 2941544598
4423 3005488302
4424 3005507051
4425 3005593011
4426 3005596457
4427 3005712526
4428 3005719590
4429 8006929846
4430 8006986411
4431 8016516532
4432 8016523934
4433 8016537465
4434 8016541737
4435 8016551535
4436 8016559918
4437 8016567122
4438 8016589042
4439 8016597849
4440 8016603986
4441 8016620568
4442 8016629423
4443 8016633938
4444 8017060010
4445 8019537149
4446 8019542398
4447 8019548360
4448 8019579514
4449 8019587224
4450 8019614415
4451 8019625050
4452 8019637130
4453 8019642465
4454 8019650118
4455 8019664998
4456 8019674533
4457 8019681572
4458 8019694210
4459 8055749255
4460 8056969629

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

38

174

0.98

PF02915

Rubrerythrin

Rubrerythrin

39

166

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cvp-assembly1.cif.gz_A-2 structure of apobacterioferritin 0.9699 1 154
8sqo-assembly1.cif.gz_A crystal structure of bacterioferritin (bfr) from brucella abortus (magnesium bound, f16l mutant) 0.9684 1 153
3bkn-assembly1.cif.gz_A the structure of mycobacterial bacterioferritin 0.9681 1 152
8sqr-assembly1.cif.gz_A crystal structure of bacterioferritin (bfr) from brucella abortus (iron bound, f16l mutant) 0.968 1 159
8sqp-assembly1.cif.gz_A crystal structure of bacterioferritin (bfr) from brucella abortus (apo, f16l mutant) 0.9669 2 159
ID Description Score Start End Superfamily
5xx9B00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9705 1 156 1.20.1260.10
4cvpA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9699 1 154 1.20.1260.10
5zurA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9669 1 153 1.20.1260.10
3gvyA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9667 1 153 1.20.1260.10
4cvtA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9658 1 156 1.20.1260.10

Map