F496582

General Info

Members Datasets Scaffolds Average Seq Length
2235 909 1753 535

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0016256|Ga0496100_0016256_1028_2812
Length 594
Sequence VPNFRVNSLNSRYYLYPLNNFSAQLVQNTSQHPHHGLCSSHLLFSKLNIMTSLPEYQCDVLIVGSGAAGLSLALRLAPHYQVTVLSKAQVNEGSTLYAQGGIAAVFDETDSIESHVEDTLVAGAGLCDRDTVSFIASNARHCVQWLIDNGVAFDKEPQAEGEARYHLTREGGHSHRRILHSADATGRAVETTLVSQALSHPNIRIIERTNAVDLILSDKLGLPGKRRVVGAWIWNRKREQVETCRARAVVLATGGAAKVYQYTTNPDVASGDGIAMAWRAGCRVANLEFNQFHPTCLFHPQAQNFLLTEALRGEGAWLLRPDGTRFMPDFDERAELAPRDIVARAIDHEMKRLGVDCMYLDISHQPESFVRAHFPMIYEKLLTFGLDLTKQPIPIVPAAHYTCGGVMVDQQGRTDVDGLYAIGEVSYTGLHGANRMASNSLLECLVYGWSAAEDMIARLPDIAAVEHLPAWDESRVDDADERVVIQHNWHELRLFMWDYMGIVRTTKRLERALRRINLLQQEIDEYYAHFRLSNNLLELRNLVQVAELMVRCALERKESRGLHFTLDNPDLLDEALPTILQPEASGTGKSLSPG

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
4 2506520008 Serratia plymuthica AS12 Isolate Unclassified
5 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
6 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
7 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
8 2511231004 Pseudomonas sp. GM102 Isolate Nodule
9 2511231006 Pseudomonas sp. GM17 Isolate Nodule
10 2511231007 Pseudomonas sp. GM18 Isolate Nodule
11 2511231008 Pseudomonas sp. GM21 Isolate Nodule
12 2511231010 Pseudomonas sp. GM25 Isolate Nodule
13 2511231011 Pseudomonas sp. GM30 Isolate Nodule
14 2511231012 Pseudomonas sp. GM33 Isolate Nodule
15 2511231014 Pseudomonas sp. GM48 Isolate Nodule
16 2511231015 Pseudomonas sp. GM49 Isolate Nodule
17 2511231016 Pseudomonas sp. GM50 Isolate Nodule
18 2511231017 Pseudomonas sp. GM55 Isolate Nodule
19 2511231018 Pseudomonas sp. GM60 Isolate Nodule
20 2511231019 Pseudomonas sp. GM67 Isolate Nodule
21 2511231020 Pseudomonas sp. GM74 Isolate Nodule
22 2511231021 Pseudomonas sp. GM78 Isolate Nodule
23 2511231022 Pseudomonas sp. GM79 Isolate Nodule
24 2511231023 Pseudomonas sp. GM80 Isolate Nodule
25 2511231024 Pseudomonas sp. GM84 Isolate Nodule
26 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
27 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
28 2511231031 Pseudomonas sp. GM16 Isolate Nodule
29 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
30 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
31 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
32 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
33 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
34 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
35 2547132181 Kosakonia sacchari SP1 Isolate Stem
36 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
37 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
38 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
39 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
40 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
41 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
42 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
43 2561511199 Enterobacter sp. R4-368 Isolate Nodule
44 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
45 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
46 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
47 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
48 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
49 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
50 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
51 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
52 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
53 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
54 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
55 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
56 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
57 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
58 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
59 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
60 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
61 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
62 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
63 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
64 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
65 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
66 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
67 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
68 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
69 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
70 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
71 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
72 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
73 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
74 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
75 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
76 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
77 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
78 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
79 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
80 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
81 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
82 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
83 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
84 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
85 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
86 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
87 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
88 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
89 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
90 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
91 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
92 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
93 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
94 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
95 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
96 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
97 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
98 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
99 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
100 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
101 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
102 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
103 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
104 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
105 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
106 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
107 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
108 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
109 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
110 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
111 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
112 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
113 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
114 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
115 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
116 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
117 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
118 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
119 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
120 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
121 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
122 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
123 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
124 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
125 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
126 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
127 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
128 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
129 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
130 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
131 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
132 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
133 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
134 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
135 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
136 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
137 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
138 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
139 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
140 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
141 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
142 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
143 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
144 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
145 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
146 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
147 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
148 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
149 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
150 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
151 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
152 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
153 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
154 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
155 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
156 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
157 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
158 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
159 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
160 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
161 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
162 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
163 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
164 2636415599 Klebsiella variicola DX120E Isolate Unclassified
165 2639762793 Acinetobacter calcoaceticus GK1 Isolate Rhizosphere
166 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
167 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
168 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
169 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
170 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
171 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
172 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
173 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
174 2643221731 Bacillus sp. Root147 Isolate Unclassified
175 2643221732 Bacillus sp. Root239 Isolate Unclassified
176 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
177 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
178 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
179 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
180 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
181 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
182 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
183 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
184 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
185 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
186 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
187 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
188 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
189 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
190 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
191 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
192 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
193 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
194 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
195 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
196 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
197 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
198 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
199 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
200 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
201 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
202 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
203 2728369097 Stutzerimonas balearica st101 Isolate Unclassified
204 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
205 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
206 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
207 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
208 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
209 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
210 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
211 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
212 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
213 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
214 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
215 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
216 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
217 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
218 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
219 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
220 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
221 2751185917 Enterobacter sp. HK169 Isolate Unclassified
222 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
223 2765235841 Pseudomonas putida AA7 Isolate Unclassified
224 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
225 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
226 2773857670 Pseudomonas sp. 478 Isolate Unclassified
227 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
228 2773857673 Pseudomonas sp. 443 Isolate Unclassified
229 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
230 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
231 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
232 2775507074 Klebsiella sp. D5A Isolate Unclassified
233 2784132063 Pseudomonas sp. 424 Isolate Unclassified
234 2784132072 Pseudomonas sp. 460 Isolate Unclassified
235 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
236 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
237 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
238 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
239 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
240 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
241 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
242 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
243 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
244 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
245 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
246 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
247 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
248 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
249 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
250 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
251 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
252 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
253 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
254 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
255 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
256 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
257 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
258 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
259 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
260 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
261 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
262 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
263 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
264 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
265 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
266 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
267 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
268 2821118458 Enterobacter asburiae 609 Isolate Unclassified
269 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
270 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
271 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
272 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
273 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
274 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
275 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
276 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
277 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
278 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
279 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
280 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
281 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
282 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
283 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
284 2842882022 Bacillus sp. R-71893 Isolate Unclassified
285 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
286 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
287 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
288 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
289 2847085930 Erwinia persicina B64 Isolate Bulb
290 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
291 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
292 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
293 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
294 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
295 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
296 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
297 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
298 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
299 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
300 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
301 2865014394 Pantoea sp. R-71966 Isolate Unclassified
302 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
303 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
304 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
305 2876601092 Pantoea endophytica 596 Isolate Unclassified
306 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
307 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
308 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
309 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
310 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
311 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
312 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
313 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
314 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
315 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
316 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
317 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
318 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
319 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
320 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
321 2904504865 Serratia marcescens 1822 Isolate Unclassified
322 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
323 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
324 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
325 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
326 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
327 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
328 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
329 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
330 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
331 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
332 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
333 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
334 2916178963 Pseudoalteromonas rhizosphaerae RA15 Isolate Rhizosphere
335 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
336 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
337 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
338 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
339 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
340 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
341 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
342 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
343 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
344 2919150387 Rahnella aceris 1817 Isolate Unclassified
345 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
346 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
347 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
348 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
349 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
350 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
351 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
352 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
353 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
354 2919506607 Acinetobacter sp. 3657 Isolate Unclassified
355 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
356 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
357 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
358 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
359 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
360 2919720352 Priestia megaterium 4340 Isolate Unclassified
361 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
362 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
363 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
364 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
365 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
366 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
367 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
368 2927143783 Rahnella sp. 2050 Isolate Unclassified
369 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
370 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
371 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
372 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
373 2929004312 Priestia megaterium 1104 Isolate Unclassified
374 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
375 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
376 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
377 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
378 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
379 2932406140 Serratia sp. 2723 Isolate Rhizosphere
380 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
381 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
382 2937539931 Pantoea sp. LS15 Isolate Unclassified
383 2937967321 Serratia sp. YC16 Isolate Unclassified
384 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
385 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
386 2939577877 Serratia sp. 509 Isolate Rhizosphere
387 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
388 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
389 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
390 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
391 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
392 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
393 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
394 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
395 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
396 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
397 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
398 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
399 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
400 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
401 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
402 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
403 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
404 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
405 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
406 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
407 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
408 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
409 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
410 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
411 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
412 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
413 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
414 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
415 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
416 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
417 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
418 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
419 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
420 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
421 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
422 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
423 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
424 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
425 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
426 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
427 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
428 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
429 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
430 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
431 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
432 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
433 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
434 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
435 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
436 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
437 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
438 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
439 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
440 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
441 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
442 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
443 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
444 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
445 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
446 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
447 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
448 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
449 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
450 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
451 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
452 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
453 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
454 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
455 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
456 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
457 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
458 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
459 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
460 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
461 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
462 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
463 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
464 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
465 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
466 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
467 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
468 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
469 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
470 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
471 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
472 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
473 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
474 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
475 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
476 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
477 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
478 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
479 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
480 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
481 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
482 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
483 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
484 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
485 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
486 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
487 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
488 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
489 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
490 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
491 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
492 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
493 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
494 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
495 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
496 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
497 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
498 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
499 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
500 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
501 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
502 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
503 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
504 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
505 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
506 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
507 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
508 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
509 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
510 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
511 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
512 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
513 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
514 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
515 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
516 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
517 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
518 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
519 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
520 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
521 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
522 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
523 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
524 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
525 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
526 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
527 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
528 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
529 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
530 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
531 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
532 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
533 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
534 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
535 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
536 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
537 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
538 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
539 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
540 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
541 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
542 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
543 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
544 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
545 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
546 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
547 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
548 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
549 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
550 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
551 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
552 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
553 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
554 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
555 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
556 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
557 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
558 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
559 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
560 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
561 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
562 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
563 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
564 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
565 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
566 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
567 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
568 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
569 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
570 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
571 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
572 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
573 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
574 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
575 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
576 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
577 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
578 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
579 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
580 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
581 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
582 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
583 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
584 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
585 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
586 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
587 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
588 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
589 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
590 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
591 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
592 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
593 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
594 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
595 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
596 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
597 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
598 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
599 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
600 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
601 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
602 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
603 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
604 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
605 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
606 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
607 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
608 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
609 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
610 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
611 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
612 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
613 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
614 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
615 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
616 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
617 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
618 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
619 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
620 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
621 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
622 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
623 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
624 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
625 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
626 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
627 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
628 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
629 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
630 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
631 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
632 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
633 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
634 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
635 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
636 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
637 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
638 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
639 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
640 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
641 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
642 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
643 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
644 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
645 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
646 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
647 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
648 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
649 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
650 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
651 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
652 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
653 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
654 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
655 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
656 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
657 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
658 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
659 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
660 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
661 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
662 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
663 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
664 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
665 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
666 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
667 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
668 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
669 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
670 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
671 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
672 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
673 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
674 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
675 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
676 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
677 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
678 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
679 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
680 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
681 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
682 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
683 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
684 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
685 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
686 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
687 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
688 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
689 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
690 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
691 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
692 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
693 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
694 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
695 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
696 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
697 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
698 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
699 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
700 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
701 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
702 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
703 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
704 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
705 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
706 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
707 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
708 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
709 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
710 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
711 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
712 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
713 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
714 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
715 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
716 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
717 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
718 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
719 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
720 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
721 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
722 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
723 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
724 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
725 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
726 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
727 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
728 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
729 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
730 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
731 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
732 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
733 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
734 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
735 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
736 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
737 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
738 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
739 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
740 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
741 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
742 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
743 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
744 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
745 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
746 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
747 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
748 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
749 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
750 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
751 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
752 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
753 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
754 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
755 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
756 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
757 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
758 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
759 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
760 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
761 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
762 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
763 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
764 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
765 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
766 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
767 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
768 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
769 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
770 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
771 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
772 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
773 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
774 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
775 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
776 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
777 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
778 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
779 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
780 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
781 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
782 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
783 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
784 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
785 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
786 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
787 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
788 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
789 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
790 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
791 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
792 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
793 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
794 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
795 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
796 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
797 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
798 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
799 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
800 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
801 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
802 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
803 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
804 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
805 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
806 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
807 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
808 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
809 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
810 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
811 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
812 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
813 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
814 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
815 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
816 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
817 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
818 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
819 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
820 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
821 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
822 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
823 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
824 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
825 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
826 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
827 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
828 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
829 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
830 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
831 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
832 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
833 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
834 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
835 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
836 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
837 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
838 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
839 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
840 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
841 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
842 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
843 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
844 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
845 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
846 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
847 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
848 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
849 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
850 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
851 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
852 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
853 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
854 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
855 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
856 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
857 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
858 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
859 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
860 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
861 640753048 Serratia proteamaculans 568 Isolate Endosphere
862 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
863 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
864 8004592986 Serratia sp. S119 Isolate Unclassified
865 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
866 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
867 8015556637 Bdellovibrio reynosensis LBG001 Isolate Rhizosphere
868 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
869 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
870 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
871 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
872 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
873 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
874 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
875 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
876 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
877 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
878 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified
879 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
880 8052494512 Pseudomonas putida LD6 Isolate Unclassified
881 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
882 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
883 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere
884 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
885 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
886 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
887 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
888 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
889 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
890 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
891 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
892 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
893 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
894 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
895 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
896 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
897 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
898 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
899 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
900 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
901 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
902 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
903 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
904 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
905 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
906 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
907 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
908 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere
909 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 77.9
Metatranscriptomes 0.54
Isolates 21.57

Biome Distribution

Category Percentage (%)
Aerial Root 0.31
Bulb 0.04
Endosphere 4.88
Nodule 2.19
Rhizoplane 6.85
Rhizosphere 68.37
Stem 0.04
Stem Tuber 0.31
Unclassified 17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_27 2124908027 Bacteria 53155
2 SwRhRL2b_contig_1578050 2162886007 Bacteria 2880
3 SwRhRL2b_contig_1759361 2162886007 Bacteria 232727
4 SwRhRL2b_contig_2166766 2162886007 Bacteria 2909
5 SwRhRL2b_contig_2174536 2162886007 Bacteria 2817
6 JGI24736J21556_1000951 3300001904 Bacteria 5342
7 JGI24741J21665_1000304 3300001915 Bacteria 14779
8 JGI24740J21852_10000432 3300001979 Bacteria 17873
9 JGI24740J21852_10003302 3300001979 Bacteria 7106
10 JGI24740J21852_10009450 3300001979 Bacteria 3817
11 JGI24739J22299_10005695 3300001989 Bacteria 4721
12 JGI24737J22298_10000312 3300001990 Bacteria 16238
13 JGI24737J22298_10003042 3300001990 Bacteria 5948
14 JGI24737J22298_10003936 3300001990 Bacteria 5201
15 JGI24735J21928_10001252 3300002067 Bacteria 9024
16 JGI25162J39368_1000003 3300002737 Bacteria 575218
17 JGI25162J39368_1000054 3300002737 Bacteria 147779
18 JGI25162J39368_1000132 3300002737 Bacteria 80803
19 JGI25163J39215_1000026 3300002771 Bacteria 69247
20 JGI25163J39215_1000844 3300002771 Bacteria 7315
21 JGI25163J39215_1000977 3300002771 Bacteria 6347
22 JGI25164J39214_1000009 3300002772 Bacteria 303437
23 JGI25164J39214_1000029 3300002772 Bacteria 147779
24 JGI25164J39214_1000106 3300002772 Bacteria 80803
25 JGI25152J39213_1000449 3300002773 Bacteria 24354
26 JGI25165J46597_1000111 3300003214 Bacteria 147779
27 JGI25165J46597_1000217 3300003214 Bacteria 80803
28 rootH2_10080641 3300003320 Bacteria 8834
29 rootH1_10014691 3300003323 Bacteria 26302
30 rootH1_10147070 3300003323 Bacteria 8113
31 Ga0055538_1000002 3300003751 Bacteria 999437
32 Ga0055538_1000005 3300003751 Bacteria 575218
33 Ga0055538_1000099 3300003751 Bacteria 70627
34 Ga0055539_1000002 3300003752 Bacteria 999437
35 Ga0055539_1000007 3300003752 Bacteria 575218
36 Ga0055539_1000147 3300003752 Bacteria 70627
37 Ga0055533_1000004 3300003756 Bacteria 999437
38 Ga0055533_1000009 3300003756 Bacteria 575218
39 Ga0055533_1000151 3300003756 Bacteria 70627
40 Ga0055532_1000108 3300003758 Bacteria 88720
41 Ga0055532_1002034 3300003758 Bacteria 4638
42 Ga0055525_1000002 3300003759 Bacteria 999437
43 Ga0055525_1000010 3300003759 Bacteria 575218
44 Ga0055525_1000199 3300003759 Bacteria 70627
45 Ga0055536_1000043 3300003781 Bacteria 124663
46 Ga0055536_1000474 3300003781 Bacteria 27993
47 Ga0055536_1000583 3300003781 Bacteria 24873
48 Ga0055528_1016713 3300003790 Bacteria 2579
49 Ga0055530_10000031 3300003791 Bacteria 122117
50 Ga0055530_10000701 3300003791 Bacteria 28278
51 Ga0055530_10002189 3300003791 Bacteria 12927
52 Ga0055540_1000415 3300003792 Bacteria 34269
53 Ga0055540_1000503 3300003792 Bacteria 29794
54 Ga0055540_1000542 3300003792 Bacteria 28278
55 Ga0055531_10000283 3300003794 Bacteria 51426
56 Ga0055541_1000002 3300003841 Bacteria 896405
57 Ga0055541_1000005 3300003841 Bacteria 575218
58 Ga0055541_1000099 3300003841 Bacteria 70627
59 Ga0058692_1000001 3300003856 Bacteria 834230
60 Ga0058692_1000186 3300003856 Bacteria 37589
61 Ga0058692_1000818 3300003856 Bacteria 12355
62 Ga0058692_1001110 3300003856 Bacteria 10439
63 Ga0058692_1001965 3300003856 Bacteria 7165
64 Ga0058692_1005488 3300003856 Bacteria 3612
65 Ga0058692_1007364 3300003856 Bacteria 2927
66 Ga0058692_1007655 3300003856 Bacteria 2847
67 Ga0058692_1007732 3300003856 Bacteria 2826
68 Ga0065703_1000284 3300005272 Bacteria 23800
69 Ga0065714_10000009 3300005288 Bacteria 21525
70 Ga0065714_10004204 3300005288 Bacteria 5686
71 Ga0065714_10006149 3300005288 Bacteria 3442
72 Ga0065714_10008077 3300005288 Bacteria 4255
73 Ga0065714_10065522 3300005288 Bacteria 9626
74 Ga0065714_10068565 3300005288 Bacteria 4655
75 Ga0065714_10084286 3300005288 Bacteria 2169
76 Ga0065704_10000444 3300005289 Bacteria 86255
77 Ga0065704_10001998 3300005289 Bacteria 6708
78 Ga0065704_10004583 3300005289 Bacteria 3300
79 Ga0065704_10005150 3300005289 Bacteria 4730
80 Ga0065704_10070132 3300005289 Bacteria 1955461
81 Ga0065704_10072410 3300005289 Bacteria 8559
82 Ga0065704_10103689 3300005289 Bacteria 2159
83 Ga0065704_10121991 3300005289 Bacteria 1757
84 Ga0065712_10067895 3300005290 Bacteria 22221
85 Ga0070658_10000003 3300005327 Bacteria 465963
86 Ga0070658_10001393 3300005327 Bacteria 20623
87 Ga0070658_10005046 3300005327 Bacteria 10747
88 Ga0070658_10025621 3300005327 Bacteria 4727
89 Ga0070658_10082748 3300005327 Bacteria 2638
90 Ga0070683_100008343 3300005329 Bacteria 8799
91 Ga0070670_100000011 3300005331 Bacteria 263074
92 Ga0070670_100000267 3300005331 Bacteria 46521
93 Ga0070670_100024496 3300005331 Bacteria 5190
94 Ga0070670_100061958 3300005331 Bacteria 3211
95 Ga0070666_10001251 3300005335 Bacteria 15377
96 Ga0070666_10008077 3300005335 Bacteria 6516
97 Ga0070666_10016189 3300005335 Bacteria 4768
98 Ga0070680_100000499 3300005336 Bacteria 26967
99 Ga0070680_100001660 3300005336 Bacteria 16265
100 Ga0070680_100006363 3300005336 Bacteria 8970
101 Ga0070680_100006573 3300005336 Bacteria 8841
102 Ga0070680_100008145 3300005336 Bacteria 8008
103 Ga0070682_100009487 3300005337 Bacteria 5507
104 Ga0070682_100054429 3300005337 Bacteria 2511
105 Ga0070660_100000339 3300005339 Bacteria 31090
106 Ga0070660_100000348 3300005339 Bacteria 30900
107 Ga0070660_100001567 3300005339 Bacteria 15721
108 Ga0070660_100006022 3300005339 Bacteria 8387
109 Ga0070660_100036805 3300005339 Bacteria 3709
110 Ga0070660_100045289 3300005339 Bacteria 3367
111 Ga0070687_100062417 3300005343 Bacteria 1973
112 Ga0070661_100000003 3300005344 Bacteria 254653
113 Ga0070661_100000081 3300005344 Bacteria 75382
114 Ga0070661_100000354 3300005344 Bacteria 36155
115 Ga0070661_100043589 3300005344 Bacteria 3277
116 Ga0070692_10000570 3300005345 Bacteria 11561
117 Ga0070692_10001320 3300005345 Bacteria 8921
118 Ga0070692_10001825 3300005345 Bacteria 7977
119 Ga0070692_10010870 3300005345 Bacteria 4162
120 Ga0070668_100000011 3300005347 Bacteria 123099
121 Ga0070668_100004229 3300005347 Bacteria 10651
122 Ga0070668_100011746 3300005347 Bacteria 6521
123 Ga0070669_100002205 3300005353 Bacteria 14113
124 Ga0070669_100064671 3300005353 Bacteria 2694
125 Ga0070675_100112340 3300005354 Bacteria 2307
126 Ga0070671_100000036 3300005355 Bacteria 95440
127 Ga0070671_100000707 3300005355 Bacteria 23997
128 Ga0070671_100002890 3300005355 Bacteria 13372
129 Ga0070659_100000311 3300005366 Bacteria 37881
130 Ga0070659_100002897 3300005366 Bacteria 12219
131 Ga0070667_100000123 3300005367 Bacteria 99323
132 Ga0070667_100027760 3300005367 Bacteria 4710
133 Ga0070667_100146179 3300005367 Bacteria 2073
134 Ga0070714_100003869 3300005435 Bacteria 11242
135 Ga0070714_100006582 3300005435 Bacteria 8989
136 Ga0070663_100001000 3300005455 Bacteria 15406
137 Ga0070663_100004050 3300005455 Bacteria 8555
138 Ga0070663_100031114 3300005455 Bacteria 3665
139 Ga0070678_100062610 3300005456 Bacteria 2748
140 Ga0070662_100000548 3300005457 Bacteria 22750
141 Ga0070662_100001149 3300005457 Bacteria 16221
142 Ga0070662_100001841 3300005457 Bacteria 12994
143 Ga0070662_100002054 3300005457 Bacteria 12334
144 Ga0070662_100038399 3300005457 Bacteria 3401
145 Ga0070685_10000004 3300005466 Bacteria 246215
146 Ga0070679_100000001 3300005530 Bacteria 764811
147 Ga0070679_100046158 3300005530 Bacteria 4342
148 Ga0070679_100094457 3300005530 Bacteria 2977
149 Ga0068853_100001473 3300005539 Bacteria 17091
150 Ga0068853_100014562 3300005539 Bacteria 6447
151 Ga0068853_100025547 3300005539 Bacteria 4957
152 Ga0068853_100059061 3300005539 Bacteria 3313
153 Ga0070696_100070184 3300005546 Bacteria 2464
154 Ga0070665_100002680 3300005548 Bacteria 19346
155 Ga0070665_100004617 3300005548 Bacteria 14399
156 Ga0070665_100031217 3300005548 Bacteria 5363
157 Ga0070665_100057371 3300005548 Bacteria 3903
158 Ga0068855_100000046 3300005563 Bacteria 147225
159 Ga0068855_100000194 3300005563 Bacteria 78505
160 Ga0068855_100008129 3300005563 Bacteria 12680
161 Ga0068855_100024900 3300005563 Bacteria 7161
162 Ga0068855_100054653 3300005563 Bacteria 4693
163 Ga0068855_100092943 3300005563 Bacteria 3478
164 Ga0070664_100000128 3300005564 Bacteria 50589
165 Ga0070664_100000159 3300005564 Bacteria 46319
166 Ga0068857_100174445 3300005577 Bacteria 1955
167 Ga0068854_100001138 3300005578 Bacteria 15976
168 Ga0068854_100020365 3300005578 Bacteria 4487
169 Ga0068854_100025436 3300005578 Bacteria 4062
170 Ga0068856_100001416 3300005614 Bacteria 25152
171 Ga0068856_100021261 3300005614 Bacteria 6303
172 Ga0068856_100026157 3300005614 Bacteria 5690
173 Ga0068852_100009007 3300005616 Bacteria 7387
174 Ga0068852_100014137 3300005616 Bacteria 6131
175 Ga0068852_100054364 3300005616 Bacteria 3451
176 Ga0068859_100007228 3300005617 Bacteria 11270
177 Ga0068864_100000020 3300005618 Bacteria 263460
178 Ga0068851_10000048 3300005834 Bacteria 73185
179 Ga0068863_100000186 3300005841 Bacteria 65963
180 Ga0068863_100200733 3300005841 Bacteria 1918
181 Ga0068858_100081833 3300005842 Bacteria 3001
182 Ga0068860_100202184 3300005843 Bacteria 1925
183 Ga0068862_100001921 3300005844 Bacteria 18890
184 Ga0068862_100012269 3300005844 Bacteria 7086
185 Ga0081539_10003747 3300005985 Bacteria 18067
186 Ga0081539_10009603 3300005985 Bacteria 8037
187 Ga0075364_10032810 3300006051 Bacteria 3339
188 Ga0075432_10001832 3300006058 Bacteria 7006
189 Ga0075432_10006691 3300006058 Bacteria 3926
190 Ga0075432_10013639 3300006058 Bacteria 2761
191 Ga0075362_10023192 3300006177 Bacteria 2623
192 Ga0075366_10002461 3300006195 Bacteria 9482
193 Ga0075366_10031278 3300006195 Bacteria 3132
194 Ga0075428_100002620 3300006844 Bacteria 19578
195 Ga0075430_100033772 3300006846 Bacteria 4341
196 Ga0075430_100067350 3300006846 Bacteria 3006
197 Ga0075431_100066126 3300006847 Bacteria 3732
198 Ga0097620_100007228 3300006931 Bacteria 11270
199 Ga0079104_1000075 3300006946 Bacteria 148544
200 Ga0079104_1000090 3300006946 Bacteria 132824
201 Ga0079104_1000134 3300006946 Bacteria 103774
202 Ga0079104_1000531 3300006946 Bacteria 40464
203 Ga0079104_1003936 3300006946 Bacteria 6626
204 Ga0079104_1005384 3300006946 Bacteria 5130
205 Ga0079104_1006582 3300006946 Bacteria 4362
206 Ga0079104_1007645 3300006946 Bacteria 3878
207 Ga0079104_1008605 3300006946 Bacteria 3545
208 Ga0079104_1012471 3300006946 Bacteria 2667
209 Ga0099826_10003760 3300006948 Bacteria 10433
210 Ga0105251_10000004 3300009011 Bacteria 285212
211 Ga0105251_10001609 3300009011 Bacteria 19193
212 Ga0105251_10001902 3300009011 Bacteria 17124
213 Ga0105251_10003243 3300009011 Bacteria 11956
214 Ga0105251_10003460 3300009011 Bacteria 11456
215 Ga0105251_10004491 3300009011 Bacteria 9466
216 Ga0105251_10005047 3300009011 Bacteria 8753
217 Ga0105251_10005052 3300009011 Bacteria 8746
218 Ga0105251_10011947 3300009011 Bacteria 4932
219 Ga0105251_10012135 3300009011 Bacteria 4890
220 Ga0105251_10012530 3300009011 Bacteria 4793
221 Ga0105251_10019235 3300009011 Bacteria 3613
222 Ga0105251_10019862 3300009011 Bacteria 3538
223 Ga0105251_10020323 3300009011 Bacteria 3491
224 Ga0105251_10021160 3300009011 Bacteria 3401
225 Ga0105251_10021760 3300009011 Bacteria 3342
226 Ga0105251_10023354 3300009011 Bacteria 3193
227 Ga0105251_10023987 3300009011 Bacteria 3139
228 Ga0105251_10036942 3300009011 Bacteria 2399
229 Ga0105251_10041371 3300009011 Bacteria 2243
230 Ga0105251_10042998 3300009011 Bacteria 2190
231 Ga0105251_10045823 3300009011 Bacteria 2107
232 Ga0105244_10000031 3300009036 Bacteria 177606
233 Ga0105244_10000497 3300009036 Bacteria 35402
234 Ga0105244_10000700 3300009036 Bacteria 29092
235 Ga0105244_10000922 3300009036 Bacteria 24861
236 Ga0105244_10001014 3300009036 Bacteria 23519
237 Ga0105244_10001237 3300009036 Bacteria 20953
238 Ga0105244_10002328 3300009036 Bacteria 14437
239 Ga0105244_10002681 3300009036 Bacteria 13316
240 Ga0105244_10002988 3300009036 Bacteria 12426
241 Ga0105244_10005910 3300009036 Bacteria 8030
242 Ga0105244_10006961 3300009036 Bacteria 7240
243 Ga0105244_10012584 3300009036 Bacteria 4991
244 Ga0105244_10016429 3300009036 Bacteria 4216
245 Ga0105244_10018049 3300009036 Bacteria 3971
246 Ga0105244_10020345 3300009036 Bacteria 3689
247 Ga0105244_10020480 3300009036 Bacteria 3673
248 Ga0105244_10021545 3300009036 Bacteria 3564
249 Ga0105244_10028285 3300009036 Bacteria 3008
250 Ga0105244_10031832 3300009036 Bacteria 2798
251 Ga0105244_10040502 3300009036 Bacteria 2418
252 Ga0105244_10044649 3300009036 Bacteria 2282
253 Ga0105244_10044714 3300009036 Bacteria 2280
254 Ga0105250_10000048 3300009092 Bacteria 123838
255 Ga0105250_10000106 3300009092 Bacteria 75353
256 Ga0105250_10000300 3300009092 Bacteria 38930
257 Ga0105250_10000303 3300009092 Bacteria 38599
258 Ga0105250_10000433 3300009092 Bacteria 30592
259 Ga0105250_10000982 3300009092 Bacteria 16602
260 Ga0105250_10003140 3300009092 Bacteria 7936
261 Ga0105250_10003490 3300009092 Bacteria 7437
262 Ga0105250_10013182 3300009092 Bacteria 3401
263 Ga0105250_10013225 3300009092 Bacteria 3397
264 Ga0105250_10014915 3300009092 Bacteria 3187
265 Ga0105250_10020233 3300009092 Bacteria 2691
266 Ga0105250_10024156 3300009092 Bacteria 2449
267 Ga0105240_10010783 3300009093 Bacteria 12808
268 Ga0105240_10022569 3300009093 Bacteria 8340
269 Ga0105240_10044586 3300009093 Bacteria 5634
270 Ga0105240_10126479 3300009093 Bacteria 3071
271 Ga0111539_10108820 3300009094 Bacteria 3253
272 Ga0105247_10000048 3300009101 Bacteria 150745
273 Ga0105247_10000540 3300009101 Bacteria 30739
274 Ga0105243_10000013 3300009148 Bacteria 275151
275 Ga0105243_10000144 3300009148 Bacteria 81484
276 Ga0105243_10000218 3300009148 Bacteria 67019
277 Ga0105243_10002674 3300009148 Bacteria 14810
278 Ga0105243_10009620 3300009148 Bacteria 7359
279 Ga0105243_10018270 3300009148 Bacteria 5309
280 Ga0105243_10043323 3300009148 Bacteria 3527
281 Ga0105241_10000011 3300009174 Bacteria 243033
282 Ga0105242_10001406 3300009176 Bacteria 18958
283 Ga0105242_10001485 3300009176 Bacteria 18461
284 Ga0105248_10000206 3300009177 Bacteria 67932
285 Ga0105248_10021983 3300009177 Bacteria 7069
286 Ga0105248_10048227 3300009177 Bacteria 4777
287 Ga0105248_10156410 3300009177 Bacteria 2573
288 Ga0105237_10000916 3300009545 Bacteria 39641
289 Ga0105237_10071182 3300009545 Bacteria 3473
290 Ga0105238_10000917 3300009551 Bacteria 30127
291 Ga0105238_10027319 3300009551 Bacteria 5813
292 Ga0105238_10197933 3300009551 Bacteria 1985
293 Ga0105249_10002290 3300009553 Bacteria 16626
294 Ga0105249_10003057 3300009553 Bacteria 14442
295 Ga0105249_10005838 3300009553 Bacteria 10651
296 Ga0105239_10072761 3300010375 Bacteria 3779
297 Ga0105239_10286261 3300010375 Bacteria 1856
298 Ga0105246_10000106 3300011119 Bacteria 36716
299 Ga0105246_10000228 3300011119 Bacteria 28707
300 Ga0105246_10009655 3300011119 Bacteria 5946
301 Ga0105246_10013274 3300011119 Bacteria 5162
302 Ga0157345_1000028 3300012498 Bacteria 37231
303 Ga0157373_10000473 3300013100 Bacteria 31857
304 Ga0157373_10003274 3300013100 Bacteria 12234
305 Ga0157373_10003627 3300013100 Bacteria 11659
306 Ga0157373_10006653 3300013100 Bacteria 8610
307 Ga0157373_10007338 3300013100 Bacteria 8211
308 Ga0157373_10021164 3300013100 Bacteria 4721
309 Ga0157373_10056917 3300013100 Bacteria 2774
310 Ga0157373_10065008 3300013100 Bacteria 2582
311 Ga0157373_10065559 3300013100 Bacteria 2570
312 Ga0157373_10078654 3300013100 Bacteria 2325
313 Ga0157371_10000007 3300013102 Bacteria 401847
314 Ga0157371_10000230 3300013102 Bacteria 80303
315 Ga0157371_10000460 3300013102 Bacteria 49750
316 Ga0157371_10001666 3300013102 Bacteria 22667
317 Ga0157371_10003068 3300013102 Bacteria 15502
318 Ga0157371_10003756 3300013102 Bacteria 13592
319 Ga0157371_10006320 3300013102 Bacteria 9808
320 Ga0157371_10006518 3300013102 Bacteria 9606
321 Ga0157371_10012007 3300013102 Bacteria 6640
322 Ga0157371_10013816 3300013102 Bacteria 6117
323 Ga0157371_10025391 3300013102 Bacteria 4317
324 Ga0157371_10038723 3300013102 Bacteria 3410
325 Ga0157371_10046045 3300013102 Bacteria 3103
326 Ga0157371_10093381 3300013102 Bacteria 2132
327 Ga0157370_10000162 3300013104 Bacteria 81640
328 Ga0157370_10000572 3300013104 Bacteria 45922
329 Ga0157370_10005514 3300013104 Bacteria 14180
330 Ga0157370_10012469 3300013104 Bacteria 8811
331 Ga0157370_10042894 3300013104 Bacteria 4356
332 Ga0157370_10046862 3300013104 Bacteria 4144
333 Ga0157370_10076758 3300013104 Bacteria 3147
334 Ga0157370_10094387 3300013104 Bacteria 2807
335 Ga0157370_10161628 3300013104 Bacteria 2083
336 Ga0157369_10000043 3300013105 Bacteria 180713
337 Ga0157369_10006256 3300013105 Bacteria 13818
338 Ga0157369_10007612 3300013105 Bacteria 12461
339 Ga0157369_10007762 3300013105 Bacteria 12342
340 Ga0157369_10012852 3300013105 Bacteria 9490
341 Ga0157369_10016302 3300013105 Bacteria 8365
342 Ga0157369_10022960 3300013105 Bacteria 6957
343 Ga0157369_10086157 3300013105 Bacteria 3355
344 Ga0157369_10119570 3300013105 Bacteria 2796
345 Ga0157369_10119656 3300013105 Bacteria 2795
346 Ga0157369_10162994 3300013105 Bacteria 2352
347 Ga0157369_10217039 3300013105 Bacteria 2003
348 Ga0163162_10000679 3300013306 Bacteria 31608
349 Ga0163162_10027149 3300013306 Bacteria 5661
350 Ga0163162_10041183 3300013306 Bacteria 4621
351 Ga0163162_10175249 3300013306 Bacteria 2270
352 Ga0157372_10000815 3300013307 Bacteria 33774
353 Ga0157372_10002756 3300013307 Bacteria 18998
354 Ga0157372_10004696 3300013307 Bacteria 14507
355 Ga0157372_10007104 3300013307 Bacteria 11934
356 Ga0157372_10053705 3300013307 Bacteria 4492
357 Ga0157375_10009709 3300013308 Bacteria 8461
358 Ga0157375_10024539 3300013308 Bacteria 5583
359 Ga0157375_10117704 3300013308 Bacteria 2763
360 Ga0163163_10000286 3300014325 Bacteria 50173
361 Ga0163163_10001043 3300014325 Bacteria 23509
362 Ga0182008_10000783 3300014497 Bacteria 22244
363 Ga0182008_10001519 3300014497 Bacteria 15487
364 Ga0182008_10005713 3300014497 Bacteria 7044
365 Ga0182008_10009438 3300014497 Bacteria 5264
366 Ga0182008_10013208 3300014497 Bacteria 4343
367 Ga0182008_10017015 3300014497 Bacteria 3773
368 Ga0182008_10019315 3300014497 Bacteria 3518
369 Ga0182008_10021622 3300014497 Bacteria 3303
370 Ga0182006_1000024 3300015261 Bacteria 257431
371 Ga0182006_1001311 3300015261 Bacteria 15281
372 Ga0182006_1001590 3300015261 Bacteria 13458
373 Ga0182006_1002240 3300015261 Bacteria 10694
374 Ga0182006_1003761 3300015261 Bacteria 7660
375 Ga0182006_1004370 3300015261 Bacteria 6988
376 Ga0182006_1007275 3300015261 Bacteria 5079
377 Ga0182006_1031039 3300015261 Bacteria 2155
378 Ga0182007_10001309 3300015262 Bacteria 13468
379 Ga0182007_10018386 3300015262 Bacteria 2532
380 Ga0182007_10024530 3300015262 Bacteria 2110
381 Ga0182005_1001728 3300015265 Bacteria 8436
382 Ga0182005_1016463 3300015265 Bacteria 2056
383 Ga0183366_1001 3300015679 Bacteria 2743932
384 Ga0183370_1001 3300015680 Bacteria 2743932
385 Ga0183369_1001 3300015685 Bacteria 2743932
386 Ga0183368_1001 3300015687 Bacteria 2743932
387 Ga0163161_10000005 3300017792 Bacteria 327860
388 Ga0163161_10004555 3300017792 Bacteria 9651
389 Ga0163161_10009858 3300017792 Bacteria 6617
390 Ga0163161_10011830 3300017792 Bacteria 6052
391 Ga0163161_10015005 3300017792 Bacteria 5397
392 Ga0163161_10035861 3300017792 Bacteria 3551
393 Ga0163161_10076103 3300017792 Bacteria 2463
394 Ga0163161_10076332 3300017792 Bacteria 2459
395 Ga0206353_10185733 3300020082 Bacteria 4581
396 Ga0213873_10000016 3300021358 Bacteria 124829
397 Ga0213872_10000888 3300021361 Bacteria 21570
398 Ga0213872_10001442 3300021361 Bacteria 15485
399 Ga0213872_10004265 3300021361 Bacteria 7656
400 Ga0213872_10005001 3300021361 Bacteria 6887
401 Ga0213876_10000056 3300021384 Bacteria 135017
402 Ga0213876_10000065 3300021384 Bacteria 128435
403 Ga0213876_10001336 3300021384 Bacteria 15468
404 Ga0213876_10010656 3300021384 Bacteria 4925
405 Ga0213876_10016047 3300021384 Bacteria 3961
406 Ga0213876_10028640 3300021384 Bacteria 2936
407 Ga0213876_10061824 3300021384 Bacteria 1976
408 Ga0209435_101386 3300025206 Bacteria 3104
409 Ga0209760_100015 3300025207 Bacteria 176281
410 Ga0209760_100047 3300025207 Bacteria 107520
411 Ga0209760_100069 3300025207 Bacteria 83692
412 Ga0209784_100001 3300025224 Bacteria 3600592
413 Ga0209784_100002 3300025224 Bacteria 1753105
414 Ga0209784_100015 3300025224 Bacteria 482117
415 Ga0209566_100001 3300025225 Bacteria 3600765
416 Ga0209566_100003 3300025225 Bacteria 1753105
417 Ga0209566_100012 3300025225 Bacteria 482281
418 Ga0209674_100002 3300025226 Bacteria 3600592
419 Ga0209674_100004 3300025226 Bacteria 1753105
420 Ga0209674_100027 3300025226 Bacteria 482281
421 Ga0209147_100019 3300025229 Bacteria 482139
422 Ga0209147_100282 3300025229 Bacteria 43777
423 Ga0209563_100006 3300025230 Bacteria 1753105
424 Ga0209563_100008 3300025230 Bacteria 1554545
425 Ga0209563_100031 3300025230 Bacteria 482281
426 Ga0209563_100515 3300025230 Bacteria 13129
427 Ga0207427_100001 3300025231 Bacteria 1410763
428 Ga0207427_100002 3300025231 Bacteria 1355321
429 Ga0207427_100029 3300025231 Bacteria 376678
430 Ga0209437_100003 3300025233 Bacteria 1517827
431 Ga0209437_100007 3300025233 Bacteria 938377
432 Ga0209437_100009 3300025233 Bacteria 915954
433 Ga0209437_100115 3300025233 Bacteria 209911
434 Ga0209258_100364 3300025242 Bacteria 60333
435 Ga0209646_1000199 3300025246 Bacteria 71982
436 Ga0209677_100003 3300025253 Bacteria 1753105
437 Ga0209677_100004 3300025253 Bacteria 1554545
438 Ga0209677_100016 3300025253 Bacteria 482117
439 Ga0209759_1003869 3300025256 Bacteria 5787
440 Ga0209129_1000104 3300025258 Bacteria 161264
441 Ga0209233_1000007 3300025261 Bacteria 1411234
442 Ga0209233_1000032 3300025261 Bacteria 623596
443 Ga0209233_1002485 3300025261 Bacteria 6754
444 Ga0209673_1012947 3300025273 Bacteria 3321
445 Ga0209676_1000016 3300025292 Bacteria 655561
446 Ga0209676_1000033 3300025292 Bacteria 463236
447 Ga0209676_1000080 3300025292 Bacteria 287400
448 Ga0209676_1000721 3300025292 Bacteria 45474
449 Ga0209676_1001858 3300025292 Bacteria 17373
450 Ga0209676_1003397 3300025292 Bacteria 9864
451 Ga0209025_1011780 3300025294 Bacteria 5702
452 Ga0209050_1000009 3300025298 Bacteria 1047265
453 Ga0209050_1000036 3300025298 Bacteria 423070
454 Ga0209050_1000117 3300025298 Bacteria 202979
455 Ga0209050_1001816 3300025298 Bacteria 20822
456 Ga0209051_1000053 3300025303 Bacteria 281564
457 Ga0209051_1000077 3300025303 Bacteria 202959
458 Ga0209051_1000094 3300025303 Bacteria 168538
459 Ga0209257_1000173 3300025304 Bacteria 166678
460 Ga0209257_1015809 3300025304 Bacteria 3105
461 Ga0207656_10000040 3300025321 Bacteria 54923
462 Ga0207696_1000004 3300025711 Bacteria 671626
463 Ga0207696_1000022 3300025711 Bacteria 427529
464 Ga0207696_1000035 3300025711 Bacteria 339626
465 Ga0207696_1000039 3300025711 Bacteria 324954
466 Ga0207696_1000044 3300025711 Bacteria 300953
467 Ga0207696_1000063 3300025711 Bacteria 239123
468 Ga0207696_1000083 3300025711 Bacteria 197352
469 Ga0207696_1000131 3300025711 Bacteria 132958
470 Ga0207696_1000259 3300025711 Bacteria 68316
471 Ga0207696_1000452 3300025711 Bacteria 35857
472 Ga0207696_1000688 3300025711 Bacteria 23512
473 Ga0207696_1000771 3300025711 Bacteria 21132
474 Ga0207696_1004775 3300025711 Bacteria 5763
475 Ga0207696_1005554 3300025711 Bacteria 5215
476 Ga0207696_1006039 3300025711 Bacteria 4939
477 Ga0207696_1007113 3300025711 Bacteria 4420
478 Ga0207696_1010002 3300025711 Bacteria 3502
479 Ga0207696_1012431 3300025711 Bacteria 3009
480 Ga0207655_1000002 3300025728 Bacteria 1148694
481 Ga0207655_1000004 3300025728 Bacteria 1021221
482 Ga0207655_1000005 3300025728 Bacteria 917277
483 Ga0207655_1000015 3300025728 Bacteria 600662
484 Ga0207655_1000029 3300025728 Bacteria 432187
485 Ga0207655_1000062 3300025728 Bacteria 258054
486 Ga0207655_1000078 3300025728 Bacteria 219360
487 Ga0207655_1000193 3300025728 Bacteria 107789
488 Ga0207655_1000199 3300025728 Bacteria 105047
489 Ga0207655_1000240 3300025728 Bacteria 90267
490 Ga0207655_1000516 3300025728 Bacteria 49122
491 Ga0207655_1000655 3300025728 Bacteria 41217
492 Ga0207655_1001509 3300025728 Bacteria 21228
493 Ga0207655_1001511 3300025728 Bacteria 21214
494 Ga0207655_1002315 3300025728 Bacteria 15642
495 Ga0207655_1002564 3300025728 Bacteria 14532
496 Ga0207655_1003690 3300025728 Bacteria 11282
497 Ga0207655_1003969 3300025728 Bacteria 10707
498 Ga0207655_1004830 3300025728 Bacteria 9379
499 Ga0207655_1005303 3300025728 Bacteria 8825
500 Ga0207655_1005936 3300025728 Bacteria 8181
501 Ga0207655_1007890 3300025728 Bacteria 6836
502 Ga0207655_1008094 3300025728 Bacteria 6726
503 Ga0207655_1010304 3300025728 Bacteria 5677
504 Ga0207655_1020047 3300025728 Bacteria 3461
505 Ga0207655_1025031 3300025728 Bacteria 2908
506 Ga0207655_1026256 3300025728 Bacteria 2801
507 Ga0207655_1030016 3300025728 Bacteria 2535
508 Ga0207655_1036336 3300025728 Bacteria 2185
509 Ga0207713_1000001 3300025735 Bacteria 2295391
510 Ga0207713_1000013 3300025735 Bacteria 475751
511 Ga0207713_1000052 3300025735 Bacteria 222663
512 Ga0207713_1000069 3300025735 Bacteria 191229
513 Ga0207713_1000086 3300025735 Bacteria 157106
514 Ga0207713_1000104 3300025735 Bacteria 138310
515 Ga0207713_1000230 3300025735 Bacteria 74936
516 Ga0207713_1000516 3300025735 Bacteria 39139
517 Ga0207713_1000812 3300025735 Bacteria 28863
518 Ga0207713_1000933 3300025735 Bacteria 26222
519 Ga0207713_1000977 3300025735 Bacteria 25286
520 Ga0207713_1001391 3300025735 Bacteria 19598
521 Ga0207713_1002512 3300025735 Bacteria 13283
522 Ga0207713_1003887 3300025735 Bacteria 9953
523 Ga0207713_1004318 3300025735 Bacteria 9260
524 Ga0207713_1006328 3300025735 Bacteria 7227
525 Ga0207713_1006461 3300025735 Bacteria 7140
526 Ga0207713_1011701 3300025735 Bacteria 4746
527 Ga0207713_1012706 3300025735 Bacteria 4483
528 Ga0207713_1013969 3300025735 Bacteria 4200
529 Ga0207713_1015340 3300025735 Bacteria 3938
530 Ga0207713_1015403 3300025735 Bacteria 3926
531 Ga0207713_1024580 3300025735 Bacteria 2806
532 Ga0207713_1026812 3300025735 Bacteria 2631
533 Ga0207713_1027741 3300025735 Bacteria 2567
534 Ga0207713_1029582 3300025735 Bacteria 2451
535 Ga0207710_10000005 3300025900 Bacteria 607066
536 Ga0207710_10000026 3300025900 Bacteria 307644
537 Ga0207680_10004476 3300025903 Bacteria 6628
538 Ga0207680_10006494 3300025903 Bacteria 5657
539 Ga0207647_10005488 3300025904 Bacteria 9283
540 Ga0207699_10136490 3300025906 Bacteria 1607
541 Ga0207705_10000005 3300025909 Bacteria 673478
542 Ga0207705_10000033 3300025909 Bacteria 223997
543 Ga0207705_10000082 3300025909 Bacteria 118194
544 Ga0207705_10003295 3300025909 Bacteria 12292
545 Ga0207705_10004248 3300025909 Bacteria 10845
546 Ga0207705_10006793 3300025909 Bacteria 8452
547 Ga0207705_10017711 3300025909 Bacteria 5096
548 Ga0207705_10055298 3300025909 Bacteria 2861
549 Ga0207705_10085409 3300025909 Bacteria 2305
550 Ga0207705_10139239 3300025909 Bacteria 1811
551 Ga0207654_10000012 3300025911 Bacteria 243044
552 Ga0207707_10002141 3300025912 Bacteria 17883
553 Ga0207707_10142404 3300025912 Bacteria 2096
554 Ga0207695_10001065 3300025913 Bacteria 48010
555 Ga0207695_10002063 3300025913 Bacteria 30645
556 Ga0207695_10015358 3300025913 Bacteria 9017
557 Ga0207695_10058083 3300025913 Bacteria 4017
558 Ga0207695_10090792 3300025913 Bacteria 3069
559 Ga0207671_10000339 3300025914 Bacteria 68933
560 Ga0207660_10000789 3300025917 Bacteria 20979
561 Ga0207660_10001233 3300025917 Bacteria 17134
562 Ga0207660_10001527 3300025917 Bacteria 15521
563 Ga0207660_10004143 3300025917 Bacteria 9434
564 Ga0207657_10000360 3300025919 Bacteria 48193
565 Ga0207657_10000398 3300025919 Bacteria 46000
566 Ga0207657_10000993 3300025919 Bacteria 30099
567 Ga0207657_10002401 3300025919 Bacteria 20253
568 Ga0207657_10002670 3300025919 Bacteria 19230
569 Ga0207649_10000002 3300025920 Bacteria 498633
570 Ga0207649_10000016 3300025920 Bacteria 243843
571 Ga0207649_10002077 3300025920 Bacteria 11388
572 Ga0207649_10002320 3300025920 Bacteria 10689
573 Ga0207649_10003730 3300025920 Bacteria 8307
574 Ga0207649_10045049 3300025920 Bacteria 2703
575 Ga0207649_10061057 3300025920 Bacteria 2371
576 Ga0207652_10000002 3300025921 Bacteria 878035
577 Ga0207652_10018123 3300025921 Bacteria 5772
578 Ga0207652_10165523 3300025921 Bacteria 1983
579 Ga0207681_10000504 3300025923 Bacteria 27213
580 Ga0207681_10001290 3300025923 Bacteria 16177
581 Ga0207681_10055011 3300025923 Bacteria 2708
582 Ga0207694_10000446 3300025924 Bacteria 38303
583 Ga0207650_10000025 3300025925 Bacteria 265351
584 Ga0207650_10000655 3300025925 Bacteria 27391
585 Ga0207650_10000796 3300025925 Bacteria 24177
586 Ga0207659_10108595 3300025926 Bacteria 2105
587 Ga0207664_10007174 3300025929 Bacteria 7724
588 Ga0207664_10011079 3300025929 Bacteria 6390
589 Ga0207644_10000015 3300025931 Bacteria 179880
590 Ga0207644_10000032 3300025931 Bacteria 133759
591 Ga0207690_10000118 3300025932 Bacteria 65435
592 Ga0207690_10001000 3300025932 Bacteria 18055
593 Ga0207690_10007053 3300025932 Bacteria 6669
594 Ga0207690_10067009 3300025932 Bacteria 2461
595 Ga0207706_10000222 3300025933 Bacteria 62279
596 Ga0207706_10000362 3300025933 Bacteria 49001
597 Ga0207706_10001030 3300025933 Bacteria 28340
598 Ga0207706_10003172 3300025933 Bacteria 15795
599 Ga0207686_10001565 3300025934 Bacteria 12903
600 Ga0207709_10000001 3300025935 Bacteria 2228154
601 Ga0207709_10000036 3300025935 Bacteria 292568
602 Ga0207709_10000250 3300025935 Bacteria 65488
603 Ga0207709_10014532 3300025935 Bacteria 4349
604 Ga0207709_10017421 3300025935 Bacteria 4010
605 Ga0207709_10021391 3300025935 Bacteria 3661
606 Ga0207709_10024141 3300025935 Bacteria 3468
607 Ga0207709_10047673 3300025935 Bacteria 2606
608 Ga0207711_10000375 3300025941 Bacteria 47521
609 Ga0207711_10000559 3300025941 Bacteria 37917
610 Ga0207711_10005230 3300025941 Bacteria 10997
611 Ga0207711_10029756 3300025941 Bacteria 4607
612 Ga0207661_10016630 3300025944 Bacteria 5430
613 Ga0207679_10000006 3300025945 Bacteria 498868
614 Ga0207679_10001626 3300025945 Bacteria 14010
615 Ga0207679_10002671 3300025945 Bacteria 11010
616 Ga0207667_10000036 3300025949 Bacteria 297966
617 Ga0207667_10002436 3300025949 Bacteria 23296
618 Ga0207667_10003833 3300025949 Bacteria 18489
619 Ga0207667_10007100 3300025949 Bacteria 13519
620 Ga0207667_10044801 3300025949 Bacteria 4687
621 Ga0207667_10053912 3300025949 Bacteria 4230
622 Ga0207667_10062541 3300025949 Bacteria 3892
623 Ga0207667_10093530 3300025949 Bacteria 3105
624 Ga0207712_10005662 3300025961 Bacteria 7881
625 Ga0207712_10011186 3300025961 Bacteria 5714
626 Ga0207712_10016898 3300025961 Bacteria 4731
627 Ga0207668_10000034 3300025972 Bacteria 119274
628 Ga0207668_10051810 3300025972 Bacteria 2837
629 Ga0207668_10063376 3300025972 Bacteria 2608
630 Ga0207640_10002534 3300025981 Bacteria 9792
631 Ga0207640_10020129 3300025981 Bacteria 3957
632 Ga0207658_10000008 3300025986 Bacteria 265351
633 Ga0207658_10020941 3300025986 Bacteria 4532
634 Ga0207658_10149676 3300025986 Bacteria 1900
635 Ga0207639_10010150 3300026041 Bacteria 6516
636 Ga0207639_10038013 3300026041 Bacteria 3578
637 Ga0207639_10068819 3300026041 Bacteria 2760
638 Ga0207639_10105535 3300026041 Bacteria 2286
639 Ga0207678_10002500 3300026067 Bacteria 16720
640 Ga0207678_10008428 3300026067 Bacteria 9092
641 Ga0207678_10021777 3300026067 Bacteria 5623
642 Ga0207678_10088460 3300026067 Bacteria 2647
643 Ga0207702_10000074 3300026078 Bacteria 113070
644 Ga0207702_10003066 3300026078 Bacteria 15531
645 Ga0207702_10010296 3300026078 Bacteria 7833
646 Ga0207702_10014307 3300026078 Bacteria 6588
647 Ga0207641_10000031 3300026088 Bacteria 224320
648 Ga0207641_10088322 3300026088 Bacteria 2706
649 Ga0207676_10000024 3300026095 Bacteria 265351
650 Ga0207676_10058351 3300026095 Bacteria 3044
651 Ga0207676_10127970 3300026095 Bacteria 2154
652 Ga0207674_10001981 3300026116 Bacteria 25946
653 Ga0207674_10003653 3300026116 Bacteria 18761
654 Ga0207674_10045072 3300026116 Bacteria 4539
655 Ga0207698_10001175 3300026142 Bacteria 15258
656 Ga0207698_10023240 3300026142 Bacteria 4327
657 Ga0207698_10031065 3300026142 Bacteria 3851
658 Ga0207698_10123835 3300026142 Bacteria 2194
659 Ga0209281_1000004 3300027111 Bacteria 1253949
660 Ga0209281_1000013 3300027111 Bacteria 653449
661 Ga0209281_1000014 3300027111 Bacteria 643021
662 Ga0209281_1000079 3300027111 Bacteria 261444
663 Ga0209281_1000142 3300027111 Bacteria 174280
664 Ga0209281_1000171 3300027111 Bacteria 153284
665 Ga0209281_1000172 3300027111 Bacteria 151766
666 Ga0209281_1000184 3300027111 Bacteria 144981
667 Ga0209281_1000602 3300027111 Bacteria 40803
668 Ga0209281_1001075 3300027111 Bacteria 20315
669 Ga0209281_1001174 3300027111 Bacteria 18145
670 Ga0209281_1002216 3300027111 Bacteria 8322
671 Ga0209281_1002582 3300027111 Bacteria 7023
672 Ga0209389_1000002 3300027296 Bacteria 333932
673 Ga0209371_1000001 3300027312 Bacteria 2771503
674 Ga0209371_1000008 3300027312 Bacteria 1024606
675 Ga0209371_1000015 3300027312 Bacteria 659640
676 Ga0209371_1000084 3300027312 Bacteria 180842
677 Ga0209371_1000158 3300027312 Bacteria 105459
678 Ga0209371_1000218 3300027312 Bacteria 77448
679 Ga0209371_1000239 3300027312 Bacteria 68842
680 Ga0209371_1000414 3300027312 Bacteria 44059
681 Ga0209371_1000554 3300027312 Bacteria 34422
682 Ga0209371_1001966 3300027312 Bacteria 12425
683 Ga0209371_1001980 3300027312 Bacteria 12380
684 Ga0209371_1003043 3300027312 Bacteria 8619
685 Ga0209371_1003503 3300027312 Bacteria 7579
686 Ga0209371_1003888 3300027312 Bacteria 6879
687 Ga0209371_1005986 3300027312 Bacteria 4653
688 Ga0209371_1010262 3300027312 Bacteria 2897
689 Ga0209983_1000759 3300027665 Bacteria 7014
690 Ga0207428_10006599 3300027907 Bacteria 10683
691 Ga0207428_10063326 3300027907 Bacteria 2922
692 Ga0268266_10010441 3300028379 Bacteria 8113
693 Ga0268266_10026710 3300028379 Bacteria 4912
694 Ga0268266_10051032 3300028379 Bacteria 3550
695 Ga0268266_10057209 3300028379 Bacteria 3355
696 Ga0268266_10061309 3300028379 Bacteria 3244
697 Ga0268265_10000583 3300028380 Bacteria 36905
698 Ga0268265_10018262 3300028380 Bacteria 4858
699 Ga0268264_10000036 3300028381 Bacteria 392994
700 Ga0268264_10057726 3300028381 Bacteria 3247
701 Ga0265334_10000017 3300028573 Bacteria 147461
702 Ga0265334_10000093 3300028573 Bacteria 63970
703 Ga0265338_10010511 3300028800 Bacteria 10833
704 Ga0265324_10009981 3300029957 Bacteria 3686
705 Ga0268256_1000001 3300030500 Bacteria 2771065
706 Ga0268256_1000009 3300030500 Bacteria 1022625
707 Ga0268256_1000018 3300030500 Bacteria 594572
708 Ga0268256_1000069 3300030500 Bacteria 195391
709 Ga0268256_1000075 3300030500 Bacteria 180814
710 Ga0268256_1000174 3300030500 Bacteria 77446
711 Ga0268256_1000199 3300030500 Bacteria 68849
712 Ga0268256_1000355 3300030500 Bacteria 44059
713 Ga0268256_1000430 3300030500 Bacteria 37678
714 Ga0268256_1000444 3300030500 Bacteria 36570
715 Ga0268256_1001695 3300030500 Bacteria 12580
716 Ga0268256_1001751 3300030500 Bacteria 12257
717 Ga0268256_1001952 3300030500 Bacteria 11281
718 Ga0268256_1002422 3300030500 Bacteria 9523
719 Ga0268256_1003207 3300030500 Bacteria 7579
720 Ga0268256_1011004 3300030500 Bacteria 2897
721 Ga0268256_1011574 3300030500 Bacteria 2781
722 Ga0268256_1011975 3300030500 Bacteria 2708
723 Ga0268256_1013302 3300030500 Bacteria 2501
724 Ga0307511_10070803 3300030521 Bacteria 2550
725 Ga0316178_1048493 3300030735 Bacteria 14555
726 Ga0265328_10002145 3300031239 Bacteria 8900
727 Ga0265320_10017340 3300031240 Bacteria 4001
728 Ga0265331_10000377 3300031250 Bacteria 46393
729 Ga0265327_10000282 3300031251 Bacteria 100324
730 Ga0265327_10001013 3300031251 Bacteria 39758
731 Ga0265327_10001065 3300031251 Bacteria 38232
732 Ga0265327_10003940 3300031251 Bacteria 13585
733 Ga0265327_10004965 3300031251 Bacteria 11430
734 Ga0265316_10000679 3300031344 Bacteria 37852
735 Ga0307509_10000075 3300031507 Bacteria 139230
736 Ga0307408_100000081 3300031548 Bacteria 106920
737 Ga0307408_100001669 3300031548 Bacteria 16353
738 Ga0307408_100002529 3300031548 Bacteria 12788
739 Ga0307408_100003809 3300031548 Bacteria 10270
740 Ga0307408_100005045 3300031548 Bacteria 8854
741 Ga0307408_100009063 3300031548 Bacteria 6568
742 Ga0307408_100051624 3300031548 Bacteria 2962
743 Ga0307408_100096279 3300031548 Bacteria 2245
744 Ga0265313_10000004 3300031595 Bacteria 188027
745 Ga0265313_10000109 3300031595 Bacteria 83136
746 Ga0265313_10013313 3300031595 Bacteria 4946
747 Ga0316575_10017295 3300031665 Bacteria 2738
748 Ga0316575_10019157 3300031665 Bacteria 2613
749 Ga0316575_10020470 3300031665 Bacteria 2539
750 Ga0316575_10022522 3300031665 Bacteria 2431
751 Ga0316579_10000057 3300031691 Bacteria 26877
752 Ga0316579_10000290 3300031691 Bacteria 15398
753 Ga0316579_10001181 3300031691 Bacteria 9331
754 Ga0316579_10001576 3300031691 Bacteria 8326
755 Ga0316579_10002450 3300031691 Bacteria 7007
756 Ga0316579_10007724 3300031691 Bacteria 4455
757 Ga0316579_10011392 3300031691 Bacteria 3779
758 Ga0316579_10019648 3300031691 Bacteria 2986
759 Ga0265314_10011130 3300031711 Bacteria 7454
760 Ga0316576_10000479 3300031727 Bacteria 18754
761 Ga0316576_10005569 3300031727 Bacteria 7715
762 Ga0316576_10042366 3300031727 Bacteria 3281
763 Ga0316576_10063353 3300031727 Bacteria 2714
764 Ga0316576_10082447 3300031727 Bacteria 2388
765 Ga0316576_10095809 3300031727 Bacteria 2214
766 Ga0316578_10001696 3300031728 Bacteria 9197
767 Ga0316578_10002977 3300031728 Bacteria 7624
768 Ga0316578_10021501 3300031728 Bacteria 3581
769 Ga0316578_10021721 3300031728 Bacteria 3566
770 Ga0316578_10047827 3300031728 Bacteria 2496
771 Ga0316578_10066439 3300031728 Bacteria 2130
772 Ga0316578_10094147 3300031728 Bacteria 1791
773 Ga0307405_10003196 3300031731 Bacteria 7462
774 Ga0307405_10003807 3300031731 Bacteria 7013
775 Ga0307405_10029236 3300031731 Bacteria 3219
776 Ga0307405_10029577 3300031731 Bacteria 3203
777 Ga0307405_10067256 3300031731 Bacteria 2288
778 Ga0316577_10000204 3300031733 Bacteria 19966
779 Ga0316577_10006901 3300031733 Bacteria 6032
780 Ga0316577_10011054 3300031733 Bacteria 4883
781 Ga0316577_10012570 3300031733 Bacteria 4613
782 Ga0316577_10029526 3300031733 Bacteria 3060
783 Ga0316577_10036451 3300031733 Bacteria 2750
784 Ga0307413_10008341 3300031824 Bacteria 4886
785 Ga0307413_10010021 3300031824 Bacteria 4568
786 Ga0307413_10024637 3300031824 Bacteria 3284
787 Ga0307413_10032676 3300031824 Bacteria 2953
788 Ga0307413_10039218 3300031824 Bacteria 2752
789 Ga0307413_10042328 3300031824 Bacteria 2675
790 Ga0307410_10000294 3300031852 Bacteria 19366
791 Ga0307410_10001860 3300031852 Bacteria 9848
792 Ga0307410_10005981 3300031852 Bacteria 6515
793 Ga0307406_10001631 3300031901 Bacteria 12341
794 Ga0307406_10028050 3300031901 Bacteria 3399
795 Ga0307406_10036256 3300031901 Bacteria 3037
796 Ga0307406_10054208 3300031901 Bacteria 2558
797 Ga0307406_10064464 3300031901 Bacteria 2378
798 Ga0307407_10002081 3300031903 Bacteria 7670
799 Ga0307412_10002982 3300031911 Bacteria 9387
800 Ga0307412_10003255 3300031911 Bacteria 9024
801 Ga0307412_10010987 3300031911 Bacteria 5229
802 Ga0307412_10078750 3300031911 Bacteria 2271
803 Ga0307412_10095249 3300031911 Bacteria 2092
804 Ga0307409_100004079 3300031995 Bacteria 8121
805 Ga0307409_100088588 3300031995 Bacteria 2527
806 Ga0307416_100008181 3300032002 Bacteria 6723
807 Ga0307416_100011129 3300032002 Bacteria 5983
808 Ga0307416_100092344 3300032002 Bacteria 2603
809 Ga0307414_10011270 3300032004 Bacteria 5234
810 Ga0307414_10018529 3300032004 Bacteria 4290
811 Ga0307414_10037319 3300032004 Bacteria 3252
812 Ga0307411_10001138 3300032005 Bacteria 10415
813 Ga0307411_10002818 3300032005 Bacteria 7840
814 Ga0307411_10003084 3300032005 Bacteria 7619
815 Ga0307411_10003832 3300032005 Bacteria 7078
816 Ga0307411_10008164 3300032005 Bacteria 5402
817 Ga0307411_10009183 3300032005 Bacteria 5179
818 Ga0307411_10028667 3300032005 Bacteria 3389
819 Ga0307411_10053619 3300032005 Bacteria 2643
820 Ga0307411_10088687 3300032005 Bacteria 2152
821 Ga0307415_100005101 3300032126 Bacteria 6920
822 Ga0316583_10005624 3300032133 Bacteria 4504
823 Ga0316583_10006565 3300032133 Bacteria 4180
824 Ga0316583_10006807 3300032133 Bacteria 4118
825 Ga0316583_10016938 3300032133 Bacteria 2622
826 Ga0316585_10000009 3300032137 Bacteria 29608
827 Ga0316585_10000423 3300032137 Bacteria 9857
828 Ga0316580_10000319 3300032139 Bacteria 10558
829 Ga0316580_10001717 3300032139 Bacteria 5840
830 Ga0316580_10003240 3300032139 Bacteria 4604
831 Ga0316580_10008215 3300032139 Bacteria 3124
832 Ga0316580_10011392 3300032139 Bacteria 2699
833 Ga0316593_10002145 3300032168 Bacteria 4599
834 Ga0316593_10005164 3300032168 Bacteria 3420
835 Ga0316593_10019209 3300032168 Bacteria 2110
836 Ga0316593_10022077 3300032168 Bacteria 1996
837 Ga0307510_10054802 3300033180 Bacteria 4171
838 Ga0316592_1000685 3300033524 Bacteria 4979
839 Ga0316588_1002067 3300033528 Bacteria 3437
840 Ga0316588_1004722 3300033528 Bacteria 2602
841 Ga0316596_1000021 3300033541 Bacteria 14639
842 Ga0316596_1000647 3300033541 Bacteria 6236
843 Ga0316596_1001108 3300033541 Bacteria 5251
844 Ga0316596_1001294 3300033541 Bacteria 4974
845 Ga0316574_0000243 3300035398 Bacteria 19739
846 Ga0316574_0001093 3300035398 Bacteria 12406
847 Ga0316574_0004491 3300035398 Bacteria 7320
848 Ga0316574_0006348 3300035398 Bacteria 6385
849 Ga0316574_0014766 3300035398 Bacteria 4520
850 Ga0316574_0017482 3300035398 Bacteria 4198
851 Ga0316574_0022521 3300035398 Bacteria 3752
852 Ga0316574_0033913 3300035398 Bacteria 3109
853 Ga0373927_0000003 3300035695 Bacteria 480348
854 Ga0373927_0041959 3300035695 Bacteria 2967
855 Ga0373937_0038714 3300036401 Bacteria 4345
856 Ga0316582_0000155 3300036647 Bacteria 20725
857 Ga0316582_0000694 3300036647 Bacteria 13303
858 Ga0316582_0001269 3300036647 Bacteria 10898
859 Ga0316582_0001388 3300036647 Bacteria 10549
860 Ga0316582_0006919 3300036647 Bacteria 5999
861 Ga0316582_0007888 3300036647 Bacteria 5689
862 Ga0316582_0009738 3300036647 Bacteria 5226
863 Ga0316582_0017585 3300036647 Bacteria 4140
864 Ga0316582_0018704 3300036647 Bacteria 4038
865 Ga0316582_0032839 3300036647 Bacteria 3183
866 Ga0316582_0057372 3300036647 Bacteria 2488
867 Ga0316584_0001910 3300036712 Bacteria 12964
868 Ga0316584_0001968 3300036712 Bacteria 12826
869 Ga0316584_0004957 3300036712 Bacteria 8862
870 Ga0316584_0008822 3300036712 Bacteria 6966
871 Ga0316584_0009954 3300036712 Bacteria 6622
872 Ga0316584_0025404 3300036712 Bacteria 4343
873 Ga0316584_0026225 3300036712 Bacteria 4282
874 Ga0316584_0066105 3300036712 Bacteria 2710
875 Ga0316584_0072089 3300036712 Bacteria 2589
876 Ga0316584_0086219 3300036712 Bacteria 2351
877 Ga0316584_0120222 3300036712 Bacteria 1963
878 Ga0395899_0000340 3300037312 Bacteria 58575
879 Ga0395899_0001402 3300037312 Bacteria 20666
880 Ga0395899_0004516 3300037312 Bacteria 10849
881 Ga0395899_0011814 3300037312 Bacteria 6684
882 Ga0395899_0016157 3300037312 Bacteria 5689
883 Ga0395899_0035196 3300037312 Bacteria 3759
884 Ga0395899_0038478 3300037312 Bacteria 3582
885 Ga0395899_0057997 3300037312 Bacteria 2856
886 Ga0395900_0000794 3300037418 Bacteria 41709
887 Ga0395900_0001467 3300037418 Bacteria 28145
888 Ga0395900_0036227 3300037418 Bacteria 5085
889 Ga0395900_0043084 3300037418 Bacteria 4650
890 Ga0395900_0062683 3300037418 Bacteria 3822
891 Ga0395900_0091525 3300037418 Bacteria 3125
892 Ga0395900_0099657 3300037418 Bacteria 2984
893 Ga0395900_0104381 3300037418 Bacteria 2911
894 Ga0395900_0104385 3300037418 Bacteria 2911
895 Ga0395900_0123248 3300037418 Bacteria 2658
896 Ga0395900_0168469 3300037418 Bacteria 2231
897 Ga0395900_0229732 3300037418 Bacteria 1866
898 Ga0395900_0375567 3300037418 Bacteria 1390
899 Ga0395898_0007116 3300037466 Bacteria 11879
900 Ga0395898_0018136 3300037466 Bacteria 7184
901 Ga0395898_0062547 3300037466 Bacteria 3614
902 Ga0395898_0069413 3300037466 Bacteria 3409
903 Ga0395898_0224572 3300037466 Bacteria 1791
904 Ga0395905_0000449 3300037471 Bacteria 57651
905 Ga0395905_0003152 3300037471 Bacteria 17761
906 Ga0395905_0011002 3300037471 Bacteria 8756
907 Ga0395905_0026797 3300037471 Bacteria 5436
908 Ga0395905_0037369 3300037471 Bacteria 4559
909 Ga0395905_0055304 3300037471 Bacteria 3714
910 Ga0395905_0073161 3300037471 Bacteria 3213
911 Ga0395905_0129360 3300037471 Bacteria 2374
912 Ga0436364_0496747 3300037853 Bacteria 12455
913 Ga0395901_0000031 3300038443 Bacteria 241733
914 Ga0395901_0005395 3300038443 Bacteria 12938
915 Ga0395901_0008013 3300038443 Bacteria 10668
916 Ga0395901_0012507 3300038443 Bacteria 8612
917 Ga0395901_0021440 3300038443 Bacteria 6619
918 Ga0395901_0041316 3300038443 Bacteria 4778
919 Ga0395901_0045185 3300038443 Bacteria 4569
920 Ga0395901_0049456 3300038443 Bacteria 4368
921 Ga0395901_0072778 3300038443 Bacteria 3583
922 Ga0237819_00586 3300038705 Bacteria 12170
923 Ga0400484_14499 3300038725 Bacteria 11316
924 Ga0400484_18004 3300038725 Bacteria 11941
925 Ga0400484_38937 3300038725 Bacteria 24235
926 Ga0400484_40435 3300038725 Bacteria 5298
927 Ga0400490_05485 3300038726 Bacteria 73498
928 Ga0400490_16093 3300038726 Bacteria 26424
929 Ga0400490_22207 3300038726 Bacteria 48156
930 Ga0400490_37780 3300038726 Bacteria 37835
931 Ga0400490_37813 3300038726 Bacteria 38722
932 Ga0400490_42866 3300038726 Bacteria 8878
933 Ga0400490_47679 3300038726 Bacteria 119204
934 Ga0400491_04720 3300038727 Bacteria 2531
935 Ga0400491_06102 3300038727 Bacteria 4796
936 Ga0400485_07750 3300038735 Bacteria 78520
937 Ga0400485_16880 3300038735 Bacteria 18572
938 Ga0400488_01902 3300038741 Bacteria 13587
939 Ga0400488_43050 3300038741 Bacteria 7731
940 Ga0400488_48403 3300038741 Bacteria 26223
941 Ga0400488_59715 3300038741 Bacteria 6397
942 Ga0400488_60045 3300038741 Bacteria 5155
943 Ga0400486_04085 3300038742 Bacteria 79054
944 Ga0400486_12219 3300038742 Bacteria 18021
945 Ga0400486_15402 3300038742 Bacteria 34536
946 Ga0400486_15788 3300038742 Bacteria 11653
947 Ga0400486_32041 3300038742 Bacteria 2453
948 Ga0400483_004725 3300039062 Bacteria 184421
949 Ga0400483_015695 3300039062 Bacteria 3314
950 Ga0400483_025279 3300039062 Bacteria 2158
951 Ga0400483_042324 3300039062 Bacteria 23091
952 Ga0400483_049231 3300039062 Bacteria 4188
953 Ga0400483_066147 3300039062 Bacteria 5564
954 Ga0400483_067590 3300039062 Bacteria 70090
955 Ga0400483_105417 3300039062 Bacteria 7467
956 Ga0400483_108103 3300039062 Bacteria 30756
957 Ga0400483_146661 3300039062 Bacteria 38163
958 Ga0400483_154029 3300039062 Bacteria 11572
959 Ga0400483_155721 3300039062 Bacteria 6819
960 Ga0400483_162357 3300039062 Bacteria 32148
961 Ga0400483_169513 3300039062 Bacteria 3287
962 Ga0400483_169970 3300039062 Bacteria 30966
963 Ga0400483_208313 3300039062 Bacteria 1900
964 Ga0400483_211867 3300039062 Bacteria 7660
965 Ga0400483_212256 3300039062 Bacteria 21400
966 Ga0400483_218030 3300039062 Bacteria 9941
967 Ga0400483_229745 3300039062 Bacteria 7578
968 Ga0400483_246600 3300039062 Bacteria 15045
969 Ga0400487_04871 3300039110 Bacteria 21360
970 Ga0400487_18391 3300039110 Bacteria 5892
971 Ga0400487_20689 3300039110 Bacteria 9759
972 Ga0400487_24198 3300039110 Bacteria 78489
973 Ga0400487_24791 3300039110 Bacteria 81428
974 Ga0400487_26493 3300039110 Bacteria 13063
975 Ga0400487_27026 3300039110 Bacteria 22608
976 Ga0400487_57461 3300039110 Bacteria 2984
977 Ga0436365_0062931 3300039437 Bacteria 52276
978 Ga0436365_0135600 3300039437 Bacteria 15237
979 Ga0436365_0547247 3300039437 Bacteria 9788
980 Ga0436365_0869628 3300039437 Bacteria 66366
981 Ga0436365_1613017 3300039437 Bacteria 128504
982 Ga0436365_1869161 3300039437 Bacteria 2414
983 Ga0436360_1123266 3300039438 Bacteria 2361
984 Ga0436361_0251195 3300039447 Bacteria 11493
985 Ga0436361_0301994 3300039447 Bacteria 3524
986 Ga0436361_0539675 3300039447 Bacteria 3397
987 Ga0436361_0781898 3300039447 Bacteria 8665
988 Ga0436362_0580304 3300039453 Bacteria 124869
989 Ga0439438_000002 3300041405 Bacteria 618223
990 Ga0439438_000537 3300041405 Bacteria 17245
991 Ga0439438_000850 3300041405 Bacteria 13648
992 Ga0439438_000992 3300041405 Bacteria 12681
993 Ga0439438_001945 3300041405 Bacteria 9016
994 Ga0439438_002440 3300041405 Bacteria 7920
995 Ga0439438_005518 3300041405 Bacteria 4634
996 Ga0439438_009356 3300041405 Bacteria 3176
997 Ga0439438_014528 3300041405 Bacteria 2341
998 Ga0439447_000502 3300041407 Bacteria 14543
999 Ga0439447_002323 3300041407 Bacteria 6951
1000 Ga0439447_003338 3300041407 Bacteria 5710
1001 Ga0439447_011139 3300041407 Bacteria 2637
1002 Ga0439466_0000001 3300041411 Bacteria 647258
1003 Ga0439466_0001434 3300041411 Bacteria 9311
1004 Ga0439466_0001459 3300041411 Bacteria 9229
1005 Ga0439466_0004836 3300041411 Bacteria 5179
1006 Ga0439466_0006472 3300041411 Bacteria 4451
1007 Ga0439466_0007459 3300041411 Bacteria 4142
1008 Ga0439466_0008849 3300041411 Bacteria 3787
1009 Ga0439466_0010442 3300041411 Bacteria 3451
1010 Ga0439465_0001421 3300041413 Bacteria 7746
1011 Ga0451853_0653488 3300041512 Bacteria 10121
1012 Ga0439431_0004827 3300041997 Bacteria 2970
1013 Ga0439437_000441 3300042000 Bacteria 4042
1014 Ga0439445_0001029 3300042004 Bacteria 5942
1015 Ga0439432_001181 3300042006 Bacteria 9880
1016 Ga0439432_002305 3300042006 Bacteria 7190
1017 Ga0439432_006081 3300042006 Bacteria 4324
1018 Ga0439432_015627 3300042006 Bacteria 2559
1019 Ga0439449_0002198 3300042007 Bacteria 7679
1020 Ga0439451_001403 3300042009 Bacteria 4763
1021 Ga0439451_009906 3300042009 Bacteria 1923
1022 Ga0439452_000002 3300042010 Bacteria 1377577
1023 Ga0439452_000015 3300042010 Bacteria 342948
1024 Ga0439452_000036 3300042010 Bacteria 158675
1025 Ga0439452_000135 3300042010 Bacteria 55807
1026 Ga0439452_000500 3300042010 Bacteria 21349
1027 Ga0439452_000622 3300042010 Bacteria 17904
1028 Ga0439452_000652 3300042010 Bacteria 17271
1029 Ga0439452_001277 3300042010 Bacteria 10694
1030 Ga0439452_001366 3300042010 Bacteria 10109
1031 Ga0439452_006731 3300042010 Bacteria 3578
1032 Ga0439456_000039 3300042013 Bacteria 48127
1033 Ga0439456_005258 3300042013 Bacteria 2629
1034 Ga0439456_005535 3300042013 Bacteria 2565
1035 Ga0439462_0000785 3300042015 Bacteria 6603
1036 Ga0439463_000242 3300042016 Bacteria 15106
1037 Ga0450911_000037 3300042115 Bacteria 60341
1038 Ga0450911_000292 3300042115 Bacteria 18338
1039 Ga0450911_002178 3300042115 Bacteria 3973
1040 Ga0450911_002891 3300042115 Bacteria 3200
1041 Ga0450900_001045 3300042136 Bacteria 2547
1042 Ga0450902_000689 3300042137 Bacteria 4307
1043 Ga0450902_002270 3300042137 Bacteria 2718
1044 Ga0450903_001649 3300042138 Bacteria 4143
1045 Ga0450903_002408 3300042138 Bacteria 3334
1046 Ga0450903_003619 3300042138 Bacteria 2668
1047 Ga0450904_000012 3300042139 Bacteria 42482
1048 Ga0450905_000074 3300042142 Bacteria 9342
1049 Ga0450906_000157 3300042145 Bacteria 12663
1050 Ga0450906_000365 3300042145 Bacteria 9171
1051 Ga0450907_000041 3300042146 Bacteria 56455
1052 Ga0450907_000252 3300042146 Bacteria 18275
1053 Ga0450907_002004 3300042146 Bacteria 4080
1054 Ga0439446_0003724 3300042156 Bacteria 3809
1055 Ga0439446_0008446 3300042156 Bacteria 2734
1056 Ga0450909_000555 3300042185 Bacteria 4924
1057 Ga0439434_0000189 3300042435 Bacteria 16824
1058 Ga0439464_0005768 3300042439 Bacteria 3210
1059 Ga0439460_0000237 3300042461 Bacteria 11180
1060 Ga0439460_0000244 3300042461 Bacteria 11102
1061 Ga0450901_000212 3300042533 Bacteria 6940
1062 Ga0451577_0000027 3300042876 Bacteria 397014
1063 Ga0451577_0000190 3300042876 Bacteria 130692
1064 Ga0451577_0000317 3300042876 Bacteria 91191
1065 Ga0451577_0001205 3300042876 Bacteria 36184
1066 Ga0451577_0005576 3300042876 Bacteria 12815
1067 Ga0451577_0007694 3300042876 Bacteria 10568
1068 Ga0451577_0034282 3300042876 Bacteria 4577
1069 Ga0466972_0012955 3300044658 Bacteria 4189
1070 Ga0466981_0000169 3300044669 Bacteria 18711
1071 Ga0453683_0000105 3300044673 Bacteria 124993
1072 Ga0453683_0000289 3300044673 Bacteria 65192
1073 Ga0453683_0016598 3300044673 Bacteria 4749
1074 Ga0453683_0027884 3300044673 Bacteria 3578
1075 Ga0466965_0018049 3300044683 Bacteria 3377
1076 Ga0466965_0025677 3300044683 Bacteria 2853
1077 Ga0466966_0000021 3300044684 Bacteria 116714
1078 Ga0466966_0001996 3300044684 Bacteria 13224
1079 Ga0466966_0021901 3300044684 Bacteria 4196
1080 Ga0466963_0011415 3300044694 Bacteria 5409
1081 Ga0466963_0018282 3300044694 Bacteria 4379
1082 Ga0466963_0019094 3300044694 Bacteria 4292
1083 Ga0466963_0104858 3300044694 Bacteria 1937
1084 Ga0453684_0000006 3300044712 Bacteria 1364191
1085 Ga0453684_0000031 3300044712 Bacteria 752632
1086 Ga0453684_0000051 3300044712 Bacteria 551033
1087 Ga0453684_0000154 3300044712 Bacteria 305062
1088 Ga0453684_0000213 3300044712 Bacteria 253663
1089 Ga0453684_0000618 3300044712 Bacteria 129995
1090 Ga0453684_0001032 3300044712 Bacteria 89042
1091 Ga0453684_0003359 3300044712 Bacteria 36238
1092 Ga0453684_0003583 3300044712 Bacteria 34658
1093 Ga0453684_0004640 3300044712 Bacteria 28554
1094 Ga0453684_0005291 3300044712 Bacteria 25758
1095 Ga0453684_0006884 3300044712 Bacteria 21334
1096 Ga0453684_0006974 3300044712 Bacteria 21147
1097 Ga0453684_0007656 3300044712 Bacteria 19769
1098 Ga0453684_0007674 3300044712 Bacteria 19728
1099 Ga0453684_0012206 3300044712 Bacteria 14235
1100 Ga0453684_0017144 3300044712 Bacteria 11249
1101 Ga0453684_0020139 3300044712 Bacteria 10092
1102 Ga0453684_0031930 3300044712 Bacteria 7384
1103 Ga0466971_0000846 3300044719 Bacteria 12460
1104 Ga0466968_0002196 3300044735 Bacteria 7127
1105 Ga0466970_0006718 3300044765 Bacteria 5756
1106 Ga0466957_0011895 3300044842 Bacteria 5029
1107 Ga0466960_0001312 3300044901 Bacteria 9013
1108 Ga0466959_0006500 3300045049 Bacteria 8102
1109 Ga0466959_0030822 3300045049 Bacteria 3971
1110 Ga0451576_0000032 3300045051 Bacteria 397014
1111 Ga0451576_0000426 3300045051 Bacteria 96967
1112 Ga0451576_0000552 3300045051 Bacteria 80314
1113 Ga0451576_0000830 3300045051 Bacteria 60243
1114 Ga0451576_0001041 3300045051 Bacteria 51115
1115 Ga0451576_0001713 3300045051 Bacteria 36235
1116 Ga0451576_0002395 3300045051 Bacteria 28188
1117 Ga0451576_0002412 3300045051 Bacteria 28044
1118 Ga0451576_0010707 3300045051 Bacteria 10501
1119 Ga0451576_0012763 3300045051 Bacteria 9428
1120 Ga0451576_0023577 3300045051 Bacteria 6662
1121 Ga0451576_0025809 3300045051 Bacteria 6329
1122 Ga0451576_0059041 3300045051 Bacteria 4005
1123 Ga0451576_0059141 3300045051 Bacteria 4002
1124 Ga0451576_0079174 3300045051 Bacteria 3419
1125 Ga0466958_0004044 3300045836 Bacteria 7687
1126 Ga0466958_0019206 3300045836 Bacteria 3976
1127 Ga0466967_0016713 3300045976 Bacteria 5797
1128 Ga0466967_0281483 3300045976 Bacteria 1596
1129 Ga0495617_006320 3300046452 Bacteria 4161
1130 Ga0495617_008387 3300046452 Bacteria 3564
1131 Ga0495617_013991 3300046452 Bacteria 2727
1132 Ga0495627_000021 3300046453 Bacteria 282454
1133 Ga0495627_000128 3300046453 Bacteria 92036
1134 Ga0495627_000279 3300046453 Bacteria 51531
1135 Ga0495627_001683 3300046453 Bacteria 12175
1136 Ga0495627_002401 3300046453 Bacteria 9080
1137 Ga0495627_007877 3300046453 Bacteria 4042
1138 Ga0495627_013515 3300046453 Bacteria 2870
1139 Ga0495592_0083298 3300046454 Bacteria 2310
1140 Ga0495603_0061619 3300046455 Bacteria 2215
1141 Ga0495590_0000904 3300046457 Bacteria 13261
1142 Ga0495590_0000920 3300046457 Bacteria 13074
1143 Ga0495590_0021092 3300046457 Bacteria 2311
1144 Ga0495591_000001 3300046458 Bacteria 503087
1145 Ga0495591_000015 3300046458 Bacteria 252107
1146 Ga0495591_000157 3300046458 Bacteria 72549
1147 Ga0495591_000293 3300046458 Bacteria 45920
1148 Ga0495591_000841 3300046458 Bacteria 21683
1149 Ga0495591_001627 3300046458 Bacteria 13592
1150 Ga0495591_002294 3300046458 Bacteria 10847
1151 Ga0495591_003678 3300046458 Bacteria 7795
1152 Ga0495591_004293 3300046458 Bacteria 7037
1153 Ga0495591_009294 3300046458 Bacteria 3920
1154 Ga0495591_009694 3300046458 Bacteria 3802
1155 Ga0495591_014423 3300046458 Bacteria 2841
1156 Ga0495591_016712 3300046458 Bacteria 2542
1157 Ga0495591_017482 3300046458 Bacteria 2461
1158 Ga0495591_021794 3300046458 Bacteria 2084
1159 Ga0495629_0009993 3300046459 Bacteria 6924
1160 Ga0495638_0004966 3300046460 Bacteria 9989
1161 Ga0495638_0006497 3300046460 Bacteria 8501
1162 Ga0495638_0007291 3300046460 Bacteria 7947
1163 Ga0495638_0017071 3300046460 Bacteria 4850
1164 Ga0495638_0021071 3300046460 Bacteria 4299
1165 Ga0495638_0022488 3300046460 Bacteria 4138
1166 Ga0495638_0028077 3300046460 Bacteria 3636
1167 Ga0495638_0055267 3300046460 Bacteria 2465
1168 Ga0495638_0061408 3300046460 Bacteria 2322
1169 Ga0495653_0001346 3300046463 Bacteria 19072
1170 Ga0495653_0023818 3300046463 Bacteria 4941
1171 Ga0495653_0028429 3300046463 Bacteria 4469
1172 Ga0495650_0000016 3300046471 Bacteria 554693
1173 Ga0495650_0000149 3300046471 Bacteria 159524
1174 Ga0495650_0000326 3300046471 Bacteria 85267
1175 Ga0495650_0001786 3300046471 Bacteria 19471
1176 Ga0495650_0004276 3300046471 Bacteria 9862
1177 Ga0495650_0014262 3300046471 Bacteria 4147
1178 Ga0495650_0024106 3300046471 Bacteria 2879
1179 Ga0495650_0034084 3300046471 Bacteria 2258
1180 Ga0495605_0000016 3300046474 Bacteria 289508
1181 Ga0495605_0000031 3300046474 Bacteria 213242
1182 Ga0495605_0000558 3300046474 Bacteria 30460
1183 Ga0495605_0000917 3300046474 Bacteria 20251
1184 Ga0495605_0003396 3300046474 Bacteria 9496
1185 Ga0495605_0013182 3300046474 Bacteria 4566
1186 Ga0495605_0014459 3300046474 Bacteria 4323
1187 Ga0495605_0014901 3300046474 Bacteria 4241
1188 Ga0495605_0017011 3300046474 Bacteria 3927
1189 Ga0495639_0000505 3300046475 Bacteria 18424
1190 Ga0495584_0003475 3300046491 Bacteria 8661
1191 Ga0495584_0004191 3300046491 Bacteria 7779
1192 Ga0495584_0004653 3300046491 Bacteria 7354
1193 Ga0495584_0012803 3300046491 Bacteria 4280
1194 Ga0495584_0014800 3300046491 Bacteria 3975
1195 Ga0495584_0026322 3300046491 Bacteria 2946
1196 Ga0495584_0030126 3300046491 Bacteria 2749
1197 Ga0495584_0040636 3300046491 Bacteria 2348
1198 Ga0495585_0000559 3300046492 Bacteria 35171
1199 Ga0495585_0003008 3300046492 Bacteria 11630
1200 Ga0495585_0005559 3300046492 Bacteria 7923
1201 Ga0495585_0008243 3300046492 Bacteria 6326
1202 Ga0495585_0020410 3300046492 Bacteria 3811
1203 Ga0495585_0023384 3300046492 Bacteria 3546
1204 Ga0495585_0032362 3300046492 Bacteria 2962
1205 Ga0495585_0039829 3300046492 Bacteria 2640
1206 Ga0495585_0062919 3300046492 Bacteria 2037
1207 Ga0495594_0002203 3300046499 Bacteria 10130
1208 Ga0495594_0018058 3300046499 Bacteria 3734
1209 Ga0495596_0000073 3300046500 Bacteria 74267
1210 Ga0495596_0001221 3300046500 Bacteria 14990
1211 Ga0495596_0012665 3300046500 Bacteria 3602
1212 Ga0495607_0000162 3300046501 Bacteria 71325
1213 Ga0495607_0000166 3300046501 Bacteria 70056
1214 Ga0495607_0000566 3300046501 Bacteria 36103
1215 Ga0495607_0001224 3300046501 Bacteria 23039
1216 Ga0495607_0001547 3300046501 Bacteria 20147
1217 Ga0495607_0004193 3300046501 Bacteria 10702
1218 Ga0495607_0006473 3300046501 Bacteria 8239
1219 Ga0495607_0009546 3300046501 Bacteria 6558
1220 Ga0495607_0010940 3300046501 Bacteria 6068
1221 Ga0495607_0011018 3300046501 Bacteria 6039
1222 Ga0495607_0016615 3300046501 Bacteria 4748
1223 Ga0495607_0024910 3300046501 Bacteria 3725
1224 Ga0495607_0027712 3300046501 Bacteria 3499
1225 Ga0495607_0042631 3300046501 Bacteria 2688
1226 Ga0495607_0070979 3300046501 Bacteria 1943
1227 Ga0495583_0000010 3300046506 Bacteria 353523
1228 Ga0495583_0000041 3300046506 Bacteria 234707
1229 Ga0495583_0000578 3300046506 Bacteria 50328
1230 Ga0495583_0001999 3300046506 Bacteria 18668
1231 Ga0495583_0002465 3300046506 Bacteria 15782
1232 Ga0495583_0004895 3300046506 Bacteria 9323
1233 Ga0495583_0005316 3300046506 Bacteria 8792
1234 Ga0495583_0006354 3300046506 Bacteria 7746
1235 Ga0495583_0029429 3300046506 Bacteria 2687
1236 Ga0495606_0000055 3300046507 Bacteria 199348
1237 Ga0495606_0000076 3300046507 Bacteria 166969
1238 Ga0495606_0001713 3300046507 Bacteria 28272
1239 Ga0495606_0003469 3300046507 Bacteria 16721
1240 Ga0495606_0004545 3300046507 Bacteria 13798
1241 Ga0495606_0005454 3300046507 Bacteria 12178
1242 Ga0495606_0007319 3300046507 Bacteria 9929
1243 Ga0495606_0007485 3300046507 Bacteria 9753
1244 Ga0495606_0010240 3300046507 Bacteria 7811
1245 Ga0495606_0010262 3300046507 Bacteria 7802
1246 Ga0495606_0029907 3300046507 Bacteria 3816
1247 Ga0495606_0053254 3300046507 Bacteria 2626
1248 Ga0495606_0057647 3300046507 Bacteria 2500
1249 Ga0495610_0005910 3300046512 Bacteria 8572
1250 Ga0495610_0010229 3300046512 Bacteria 5849
1251 Ga0495610_0015222 3300046512 Bacteria 4479
1252 Ga0495610_0023274 3300046512 Bacteria 3371
1253 Ga0495610_0033482 3300046512 Bacteria 2656
1254 Ga0495610_0033704 3300046512 Bacteria 2644
1255 Ga0495610_0035149 3300046512 Bacteria 2575
1256 Ga0495610_0045300 3300046512 Bacteria 2177
1257 Ga0495616_0001130 3300046513 Bacteria 18916
1258 Ga0495616_0001777 3300046513 Bacteria 14670
1259 Ga0495616_0003265 3300046513 Bacteria 10427
1260 Ga0495616_0025856 3300046513 Bacteria 3130
1261 Ga0495616_0029377 3300046513 Bacteria 2903
1262 Ga0495616_0037259 3300046513 Bacteria 2503
1263 Ga0495616_0046658 3300046513 Bacteria 2185
1264 Ga0495620_0000013 3300046515 Bacteria 160349
1265 Ga0495620_0000015 3300046515 Bacteria 154625
1266 Ga0495620_0000506 3300046515 Bacteria 25295
1267 Ga0495620_0000863 3300046515 Bacteria 18767
1268 Ga0495620_0004849 3300046515 Bacteria 7550
1269 Ga0495620_0009210 3300046515 Bacteria 5260
1270 Ga0495620_0015063 3300046515 Bacteria 3912
1271 Ga0495628_0028498 3300046516 Bacteria 4536
1272 Ga0495631_0000635 3300046518 Bacteria 22971
1273 Ga0495631_0001850 3300046518 Bacteria 12495
1274 Ga0495631_0007239 3300046518 Bacteria 5657
1275 Ga0495631_0016114 3300046518 Bacteria 3571
1276 Ga0495632_0000217 3300046519 Bacteria 58142
1277 Ga0495632_0001435 3300046519 Bacteria 19869
1278 Ga0495632_0001837 3300046519 Bacteria 17116
1279 Ga0495632_0006118 3300046519 Bacteria 7800
1280 Ga0495632_0015299 3300046519 Bacteria 4307
1281 Ga0495632_0018221 3300046519 Bacteria 3857
1282 Ga0495632_0027745 3300046519 Bacteria 2961
1283 Ga0495632_0028197 3300046519 Bacteria 2931
1284 Ga0495632_0028404 3300046519 Bacteria 2919
1285 Ga0495632_0034455 3300046519 Bacteria 2590
1286 Ga0495632_0039049 3300046519 Bacteria 2400
1287 Ga0495637_0000381 3300046520 Bacteria 33258
1288 Ga0495637_0000578 3300046520 Bacteria 26111
1289 Ga0495637_0001350 3300046520 Bacteria 14739
1290 Ga0495637_0001569 3300046520 Bacteria 13303
1291 Ga0495637_0003452 3300046520 Bacteria 8399
1292 Ga0495637_0012799 3300046520 Bacteria 4003
1293 Ga0495637_0018735 3300046520 Bacteria 3207
1294 Ga0495637_0019429 3300046520 Bacteria 3141
1295 Ga0495637_0028371 3300046520 Bacteria 2500
1296 Ga0495637_0030715 3300046520 Bacteria 2381
1297 Ga0495637_0030988 3300046520 Bacteria 2368
1298 Ga0495637_0031003 3300046520 Bacteria 2367
1299 Ga0495643_0000223 3300046522 Bacteria 86920
1300 Ga0495643_0002001 3300046522 Bacteria 16994
1301 Ga0495643_0002058 3300046522 Bacteria 16681
1302 Ga0495643_0027695 3300046522 Bacteria 3182
1303 Ga0495643_0032971 3300046522 Bacteria 2869
1304 Ga0495643_0046000 3300046522 Bacteria 2368
1305 Ga0495644_0002017 3300046523 Bacteria 8166
1306 Ga0495644_0005922 3300046523 Bacteria 4767
1307 Ga0495644_0006147 3300046523 Bacteria 4666
1308 Ga0495644_0024578 3300046523 Bacteria 2291
1309 Ga0495648_0000491 3300046524 Bacteria 42524
1310 Ga0495648_0003497 3300046524 Bacteria 13777
1311 Ga0495648_0003997 3300046524 Bacteria 12744
1312 Ga0495648_0006371 3300046524 Bacteria 9647
1313 Ga0495648_0007480 3300046524 Bacteria 8736
1314 Ga0495648_0008162 3300046524 Bacteria 8262
1315 Ga0495648_0012725 3300046524 Bacteria 6253
1316 Ga0495648_0017358 3300046524 Bacteria 5147
1317 Ga0495648_0022434 3300046524 Bacteria 4345
1318 Ga0495648_0027629 3300046524 Bacteria 3794
1319 Ga0495648_0027743 3300046524 Bacteria 3784
1320 Ga0495648_0039285 3300046524 Bacteria 3012
1321 Ga0495648_0045503 3300046524 Bacteria 2729
1322 Ga0495666_0006365 3300046526 Bacteria 5944
1323 Ga0495666_0048649 3300046526 Bacteria 2041
1324 Ga0495642_0000097 3300046528 Bacteria 49030
1325 Ga0495642_0000956 3300046528 Bacteria 13519
1326 Ga0495642_0000978 3300046528 Bacteria 13305
1327 Ga0495654_0000033 3300046530 Bacteria 201799
1328 Ga0495654_0000055 3300046530 Bacteria 142121
1329 Ga0495654_0001879 3300046530 Bacteria 13957
1330 Ga0495654_0002407 3300046530 Bacteria 12063
1331 Ga0495654_0003774 3300046530 Bacteria 9173
1332 Ga0495654_0005990 3300046530 Bacteria 6984
1333 Ga0495654_0016014 3300046530 Bacteria 3972
1334 Ga0495654_0017768 3300046530 Bacteria 3732
1335 Ga0495654_0025486 3300046530 Bacteria 3045
1336 Ga0495654_0030034 3300046530 Bacteria 2767
1337 Ga0495654_0038082 3300046530 Bacteria 2406
1338 Ga0495609_0000015 3300046538 Bacteria 322474
1339 Ga0495609_0000066 3300046538 Bacteria 131202
1340 Ga0495609_0000070 3300046538 Bacteria 128181
1341 Ga0495609_0002544 3300046538 Bacteria 11157
1342 Ga0495609_0003946 3300046538 Bacteria 8308
1343 Ga0495609_0025564 3300046538 Bacteria 2706
1344 Ga0495609_0030470 3300046538 Bacteria 2455
1345 Ga0495597_0000005 3300046542 Bacteria 286580
1346 Ga0495597_0000319 3300046542 Bacteria 43373
1347 Ga0495597_0002158 3300046542 Bacteria 12930
1348 Ga0495597_0007453 3300046542 Bacteria 5554
1349 Ga0495597_0009234 3300046542 Bacteria 4885
1350 Ga0495597_0011716 3300046542 Bacteria 4246
1351 Ga0495645_0039638 3300046543 Bacteria 3435
1352 Ga0495622_0000912 3300046557 Bacteria 16032
1353 Ga0495622_0002180 3300046557 Bacteria 9554
1354 Ga0495622_0003574 3300046557 Bacteria 7305
1355 Ga0495622_0032303 3300046557 Bacteria 2444
1356 Ga0495633_0000060 3300046558 Bacteria 144561
1357 Ga0495633_0002293 3300046558 Bacteria 13664
1358 Ga0495656_0023683 3300046615 Bacteria 2418
1359 Ga0495668_0000770 3300046616 Bacteria 37419
1360 Ga0495668_0004101 3300046616 Bacteria 10556
1361 Ga0495668_0009526 3300046616 Bacteria 5954
1362 Ga0495668_0032913 3300046616 Bacteria 2914
1363 Ga0495668_0078330 3300046616 Bacteria 1814
1364 Ga0495634_0001715 3300046642 Bacteria 19024
1365 Ga0495611_0000817 3300046648 Bacteria 17225
1366 Ga0495611_0000934 3300046648 Bacteria 15695
1367 Ga0495625_0001491 3300046660 Bacteria 28149
1368 Ga0495625_0005089 3300046660 Bacteria 12165
1369 Ga0495625_0007191 3300046660 Bacteria 9751
1370 Ga0495625_0009109 3300046660 Bacteria 8369
1371 Ga0495625_0056705 3300046660 Bacteria 2788
1372 Ga0495625_0063687 3300046660 Bacteria 2603
1373 Ga0495635_0005430 3300046663 Bacteria 8866
1374 Ga0495635_0018843 3300046663 Bacteria 4817
1375 Ga0495659_0000584 3300046664 Bacteria 13423
1376 Ga0495661_0000110 3300046665 Bacteria 97854
1377 Ga0495661_0000139 3300046665 Bacteria 85160
1378 Ga0495661_0000194 3300046665 Bacteria 70173
1379 Ga0495661_0000304 3300046665 Bacteria 56019
1380 Ga0495661_0003093 3300046665 Bacteria 12493
1381 Ga0495661_0003941 3300046665 Bacteria 10840
1382 Ga0495661_0026573 3300046665 Bacteria 3727
1383 Ga0495661_0032582 3300046665 Bacteria 3293
1384 Ga0495661_0066388 3300046665 Bacteria 2123
1385 Ga0495588_0006984 3300046674 Bacteria 5118
1386 Ga0495588_0037245 3300046674 Bacteria 2470
1387 Ga0495646_0017786 3300046680 Bacteria 4506
1388 Ga0495646_0047683 3300046680 Bacteria 2606
1389 Ga0495613_0097248 3300046689 Bacteria 2128
1390 Ga0495624_0000167 3300046690 Bacteria 48623
1391 Ga0495670_0007739 3300046691 Bacteria 5283
1392 Ga0495670_0012502 3300046691 Bacteria 4177
1393 Ga0495670_0017566 3300046691 Bacteria 3522
1394 Ga0495670_0030698 3300046691 Bacteria 2669
1395 Ga0495671_0000168 3300046692 Bacteria 57864
1396 Ga0495671_0001706 3300046692 Bacteria 14325
1397 Ga0495671_0002259 3300046692 Bacteria 12245
1398 Ga0495671_0003125 3300046692 Bacteria 10290
1399 Ga0495671_0015419 3300046692 Bacteria 4092
1400 Ga0495671_0017509 3300046692 Bacteria 3813
1401 Ga0495671_0028882 3300046692 Bacteria 2852
1402 Ga0495671_0039306 3300046692 Bacteria 2389
1403 Ga0495649_0001678 3300046694 Bacteria 16441
1404 Ga0495649_0006007 3300046694 Bacteria 7602
1405 Ga0495649_0016746 3300046694 Bacteria 4150
1406 Ga0495649_0017462 3300046694 Bacteria 4046
1407 Ga0495649_0017528 3300046694 Bacteria 4039
1408 Ga0495649_0020458 3300046694 Bacteria 3712
1409 Ga0495649_0030266 3300046694 Bacteria 2990
1410 Ga0495649_0034186 3300046694 Bacteria 2797
1411 Ga0495649_0035138 3300046694 Bacteria 2756
1412 Ga0495649_0035139 3300046694 Bacteria 2756
1413 Ga0495649_0041991 3300046694 Bacteria 2499
1414 Ga0495589_0000040 3300046794 Bacteria 140801
1415 Ga0495589_0000305 3300046794 Bacteria 39215
1416 Ga0495589_0001305 3300046794 Bacteria 14643
1417 Ga0495589_0001652 3300046794 Bacteria 12768
1418 Ga0495589_0006680 3300046794 Bacteria 6077
1419 Ga0495589_0035514 3300046794 Bacteria 2499
1420 Ga0495600_0002016 3300046809 Bacteria 11424
1421 Ga0495660_0000007 3300046810 Bacteria 485295
1422 Ga0495660_0000017 3300046810 Bacteria 320655
1423 Ga0495660_0000469 3300046810 Bacteria 33478
1424 Ga0495660_0008400 3300046810 Bacteria 6042
1425 Ga0495660_0021215 3300046810 Bacteria 3720
1426 Ga0495660_0023303 3300046810 Bacteria 3530
1427 Ga0495660_0028677 3300046810 Bacteria 3142
1428 Ga0495660_0039762 3300046810 Bacteria 2610
1429 Ga0495660_0049620 3300046810 Bacteria 2289
1430 Ga0495581_0012130 3300047315 Bacteria 4988
1431 Ga0495604_0005968 3300047317 Bacteria 9667
1432 Ga0495636_0000726 3300047318 Bacteria 12084
1433 Ga0495636_0006632 3300047318 Bacteria 4552
1434 Ga0495672_0000001 3300047320 Bacteria 1458820
1435 Ga0495672_0000052 3300047320 Bacteria 236266
1436 Ga0495672_0000156 3300047320 Bacteria 98712
1437 Ga0495672_0000985 3300047320 Bacteria 29464
1438 Ga0495672_0003898 3300047320 Bacteria 12520
1439 Ga0495672_0016049 3300047320 Bacteria 5064
1440 Ga0495672_0020674 3300047320 Bacteria 4307
1441 Ga0495672_0048488 3300047320 Bacteria 2518
1442 Ga0495672_0051983 3300047320 Bacteria 2409
1443 Ga0495676_0000013 3300047321 Bacteria 213031
1444 Ga0495676_0003992 3300047321 Bacteria 13429
1445 Ga0495676_0006281 3300047321 Bacteria 10932
1446 Ga0495680_0000389 3300047322 Bacteria 49112
1447 Ga0495680_0095979 3300047322 Bacteria 2215
1448 Ga0495683_0000027 3300047323 Bacteria 153730
1449 Ga0495683_0002053 3300047323 Bacteria 12474
1450 Ga0495683_0009108 3300047323 Bacteria 5288
1451 Ga0495683_0016001 3300047323 Bacteria 3896
1452 Ga0495683_0026805 3300047323 Bacteria 2949
1453 Ga0495683_0027333 3300047323 Bacteria 2916
1454 Ga0495683_0050937 3300047323 Bacteria 2071
1455 Ga0495687_004846 3300047443 Bacteria 8845
1456 Ga0495687_007564 3300047443 Bacteria 6374
1457 Ga0495687_027908 3300047443 Bacteria 2634
1458 Ga0495675_0001992 3300047444 Bacteria 12194
1459 Ga0495679_000169 3300047446 Bacteria 59122
1460 Ga0495679_000206 3300047446 Bacteria 51518
1461 Ga0495679_003887 3300047446 Bacteria 7064
1462 Ga0495679_004152 3300047446 Bacteria 6767
1463 Ga0495679_008217 3300047446 Bacteria 4262
1464 Ga0495673_0000019 3300047469 Bacteria 554389
1465 Ga0495673_0000343 3300047469 Bacteria 58816
1466 Ga0495673_0001678 3300047469 Bacteria 17025
1467 Ga0495673_0002278 3300047469 Bacteria 13760
1468 Ga0495673_0003117 3300047469 Bacteria 11099
1469 Ga0495673_0004241 3300047469 Bacteria 9048
1470 Ga0495673_0007619 3300047469 Bacteria 6194
1471 Ga0495673_0023930 3300047469 Bacteria 2960
1472 Ga0495673_0024795 3300047469 Bacteria 2890
1473 Ga0495673_0026811 3300047469 Bacteria 2749
1474 Ga0495673_0026813 3300047469 Bacteria 2749
1475 Ga0495673_0031244 3300047469 Bacteria 2494
1476 Ga0495681_0000933 3300047470 Bacteria 22521
1477 Ga0495681_0001629 3300047470 Bacteria 16673
1478 Ga0495681_0002441 3300047470 Bacteria 13265
1479 Ga0495681_0002802 3300047470 Bacteria 12338
1480 Ga0495681_0004033 3300047470 Bacteria 10105
1481 Ga0495681_0004844 3300047470 Bacteria 9106
1482 Ga0495681_0005072 3300047470 Bacteria 8878
1483 Ga0495681_0010935 3300047470 Bacteria 5451
1484 Ga0495681_0015083 3300047470 Bacteria 4387
1485 Ga0495681_0022688 3300047470 Bacteria 3352
1486 Ga0495681_0028181 3300047470 Bacteria 2893
1487 Ga0495681_0034534 3300047470 Bacteria 2519
1488 Ga0495686_0000002 3300047472 Bacteria 1050777
1489 Ga0495686_0004515 3300047472 Bacteria 11407
1490 Ga0495686_0005865 3300047472 Bacteria 9574
1491 Ga0495686_0024698 3300047472 Bacteria 3945
1492 Ga0495686_0028435 3300047472 Bacteria 3641
1493 Ga0495602_0053327 3300048088 Bacteria 3582
1494 Ga0495626_0000056 3300048091 Bacteria 150654
1495 Ga0495626_0001227 3300048091 Bacteria 21100
1496 Ga0495626_0002338 3300048091 Bacteria 13369
1497 Ga0495626_0002462 3300048091 Bacteria 12817
1498 Ga0495626_0003814 3300048091 Bacteria 9461
1499 Ga0495626_0012513 3300048091 Bacteria 4444
1500 Ga0495626_0027322 3300048091 Bacteria 2775
1501 Ga0495626_0030868 3300048091 Bacteria 2582
1502 Ga0496100_0002021 3300048903 Bacteria 10152
1503 Ga0496100_0016256 3300048903 Bacteria 4365
1504 Ga0496101_0000120 3300048904 Bacteria 76357
1505 Ga0496101_0001272 3300048904 Bacteria 15089
1506 Ga0496101_0014234 3300048904 Bacteria 5344
1507 Ga0496101_0059861 3300048904 Bacteria 2762
1508 Ga0496102_0000242 3300048905 Bacteria 71504
1509 Ga0496102_0022059 3300048905 Bacteria 5639
1510 Ga0496102_0024014 3300048905 Bacteria 5419
1511 Ga0496103_0018552 3300048906 Bacteria 4173
1512 Ga0496104_0000337 3300048907 Bacteria 41907
1513 Ga0496104_0000415 3300048907 Bacteria 37260
1514 Ga0496104_0000598 3300048907 Bacteria 30862
1515 Ga0496105_0013356 3300048908 Bacteria 6517
1516 Ga0496105_0021481 3300048908 Bacteria 5222
1517 Ga0496106_0000241 3300048909 Bacteria 37961
1518 Ga0496107_0000257 3300048910 Bacteria 28188
1519 Ga0496108_0018831 3300048911 Bacteria 5660
1520 Ga0496108_0019561 3300048911 Bacteria 5561
1521 Ga0496109_0001315 3300048912 Bacteria 20499
1522 Ga0496110_0001642 3300048913 Bacteria 16414
1523 Ga0496110_0034795 3300048913 Bacteria 4367
1524 Ga0496110_0041721 3300048913 Bacteria 4004
1525 Ga0496110_0094355 3300048913 Bacteria 2679
1526 Ga0496110_0094889 3300048913 Bacteria 2671
1527 Ga0496111_0004284 3300048914 Bacteria 8992
1528 Ga0496112_0000575 3300048915 Bacteria 25224
1529 Ga0496113_0036505 3300048916 Bacteria 3601
1530 Ga0496115_0002769 3300048918 Bacteria 12599
1531 Ga0496115_0086169 3300048918 Bacteria 2563
1532 Ga0496116_0000007 3300048919 Bacteria 795464
1533 Ga0496116_0000126 3300048919 Bacteria 160425
1534 Ga0496116_0000283 3300048919 Bacteria 86431
1535 Ga0496116_0000886 3300048919 Bacteria 37329
1536 Ga0496116_0001433 3300048919 Bacteria 26786
1537 Ga0496116_0002028 3300048919 Bacteria 21733
1538 Ga0496116_0002321 3300048919 Bacteria 20147
1539 Ga0496116_0003107 3300048919 Bacteria 16690
1540 Ga0496116_0003949 3300048919 Bacteria 14418
1541 Ga0496116_0013314 3300048919 Bacteria 6642
1542 Ga0496116_0021801 3300048919 Bacteria 4820
1543 Ga0496116_0029593 3300048919 Bacteria 3945
1544 Ga0496116_0031666 3300048919 Bacteria 3781
1545 Ga0496116_0034437 3300048919 Bacteria 3573
1546 Ga0496117_0000073 3300048920 Bacteria 236223
1547 Ga0496117_0000422 3300048920 Bacteria 71421
1548 Ga0496117_0000663 3300048920 Bacteria 55078
1549 Ga0496117_0000833 3300048920 Bacteria 47714
1550 Ga0496117_0001182 3300048920 Bacteria 39209
1551 Ga0496117_0001303 3300048920 Bacteria 36716
1552 Ga0496117_0003126 3300048920 Bacteria 19758
1553 Ga0496117_0003799 3300048920 Bacteria 17218
1554 Ga0496117_0004482 3300048920 Bacteria 15363
1555 Ga0496117_0004828 3300048920 Bacteria 14571
1556 Ga0496117_0005668 3300048920 Bacteria 13017
1557 Ga0496117_0006498 3300048920 Bacteria 11792
1558 Ga0496117_0006832 3300048920 Bacteria 11353
1559 Ga0496117_0009272 3300048920 Bacteria 9197
1560 Ga0496117_0043013 3300048920 Bacteria 3290
1561 Ga0496117_0051300 3300048920 Bacteria 2917
1562 Ga0496117_0061916 3300048920 Bacteria 2568
1563 Ga0496118_0000094 3300048921 Bacteria 166019
1564 Ga0496118_0001555 3300048921 Bacteria 34113
1565 Ga0496118_0001807 3300048921 Bacteria 30813
1566 Ga0496118_0003903 3300048921 Bacteria 18256
1567 Ga0496118_0004616 3300048921 Bacteria 16182
1568 Ga0496118_0007379 3300048921 Bacteria 11673
1569 Ga0496118_0007584 3300048921 Bacteria 11442
1570 Ga0496118_0012340 3300048921 Bacteria 8217
1571 Ga0496118_0024326 3300048921 Bacteria 5230
1572 Ga0496118_0026044 3300048921 Bacteria 4995
1573 Ga0496118_0062275 3300048921 Bacteria 2756
1574 Ga0496118_0063667 3300048921 Bacteria 2712
1575 Ga0496118_0070883 3300048921 Bacteria 2513
1576 Ga0496119_0000013 3300048922 Bacteria 323820
1577 Ga0496119_0000073 3300048922 Bacteria 151806
1578 Ga0496119_0000112 3300048922 Bacteria 114767
1579 Ga0496119_0000212 3300048922 Bacteria 83042
1580 Ga0496119_0000214 3300048922 Bacteria 82258
1581 Ga0496119_0000573 3300048922 Bacteria 49688
1582 Ga0496119_0014179 3300048922 Bacteria 6262
1583 Ga0496119_0015773 3300048922 Bacteria 5792
1584 Ga0496119_0043227 3300048922 Bacteria 2850
1585 Ga0496119_0064301 3300048922 Bacteria 2179
1586 Ga0496120_0000035 3300048923 Bacteria 213992
1587 Ga0496120_0000064 3300048923 Bacteria 169462
1588 Ga0496120_0000088 3300048923 Bacteria 151806
1589 Ga0496120_0000826 3300048923 Bacteria 44233
1590 Ga0496120_0009793 3300048923 Bacteria 6755
1591 Ga0496120_0030652 3300048923 Bacteria 3264
1592 Ga0496120_0039361 3300048923 Bacteria 2789
1593 Ga0496120_0039691 3300048923 Bacteria 2774
1594 Ga0496120_0075953 3300048923 Bacteria 1832
1595 Ga0496121_0000142 3300048924 Bacteria 160072
1596 Ga0496121_0000386 3300048924 Bacteria 89849
1597 Ga0496121_0003009 3300048924 Bacteria 24478
1598 Ga0496121_0003989 3300048924 Bacteria 20359
1599 Ga0496121_0014056 3300048924 Bacteria 8542
1600 Ga0496121_0031977 3300048924 Bacteria 4795
1601 Ga0496121_0043290 3300048924 Bacteria 3901
1602 Ga0496121_0048109 3300048924 Bacteria 3631
1603 Ga0496121_0055886 3300048924 Bacteria 3284
1604 Ga0496121_0074547 3300048924 Bacteria 2714
1605 Ga0496121_0102714 3300048924 Bacteria 2201
1606 Ga0496122_0000122 3300048925 Bacteria 181491
1607 Ga0496122_0001833 3300048925 Bacteria 32393
1608 Ga0496122_0001842 3300048925 Bacteria 32312
1609 Ga0496122_0002657 3300048925 Bacteria 24963
1610 Ga0496122_0005812 3300048925 Bacteria 14502
1611 Ga0496122_0009580 3300048925 Bacteria 10161
1612 Ga0496122_0011118 3300048925 Bacteria 9171
1613 Ga0496122_0011263 3300048925 Bacteria 9085
1614 Ga0496122_0011986 3300048925 Bacteria 8696
1615 Ga0496122_0012431 3300048925 Bacteria 8475
1616 Ga0496122_0019568 3300048925 Bacteria 6175
1617 Ga0496122_0037707 3300048925 Bacteria 3885
1618 Ga0496122_0048017 3300048925 Bacteria 3288
1619 Ga0496122_0050929 3300048925 Bacteria 3152
1620 Ga0496122_0052489 3300048925 Bacteria 3085
1621 Ga0496122_0058727 3300048925 Bacteria 2844
1622 Ga0496122_0063098 3300048925 Bacteria 2707
1623 Ga0496123_0000391 3300048926 Bacteria 82015
1624 Ga0496123_0001340 3300048926 Bacteria 34830
1625 Ga0496123_0001483 3300048926 Bacteria 32587
1626 Ga0496123_0001505 3300048926 Bacteria 32310
1627 Ga0496123_0002012 3300048926 Bacteria 26237
1628 Ga0496123_0002139 3300048926 Bacteria 25246
1629 Ga0496123_0003830 3300048926 Bacteria 16411
1630 Ga0496123_0004535 3300048926 Bacteria 14502
1631 Ga0496123_0007328 3300048926 Bacteria 10451
1632 Ga0496123_0008108 3300048926 Bacteria 9711
1633 Ga0496123_0043135 3300048926 Bacteria 3102
1634 Ga0496123_0043638 3300048926 Bacteria 3077
1635 Ga0496123_0057009 3300048926 Bacteria 2547
1636 Ga0496123_0064934 3300048926 Bacteria 2323
1637 Ga0496123_0093522 3300048926 Bacteria 1775
1638 Ga0496124_0000001 3300048927 Bacteria 1747840
1639 Ga0496124_0000010 3300048927 Bacteria 595157
1640 Ga0496124_0000049 3300048927 Bacteria 269753
1641 Ga0496124_0000222 3300048927 Bacteria 110854
1642 Ga0496124_0000877 3300048927 Bacteria 48930
1643 Ga0496124_0001183 3300048927 Bacteria 40695
1644 Ga0496124_0001779 3300048927 Bacteria 29980
1645 Ga0496124_0001847 3300048927 Bacteria 29252
1646 Ga0496124_0009865 3300048927 Bacteria 9765
1647 Ga0496124_0010893 3300048927 Bacteria 9149
1648 Ga0496124_0011593 3300048927 Bacteria 8797
1649 Ga0496124_0013032 3300048927 Bacteria 8148
1650 Ga0496124_0016740 3300048927 Bacteria 6953
1651 Ga0496124_0018827 3300048927 Bacteria 6449
1652 Ga0496124_0036623 3300048927 Bacteria 4277
1653 Ga0496124_0037374 3300048927 Bacteria 4223
1654 Ga0496124_0042506 3300048927 Bacteria 3913
1655 Ga0496124_0043435 3300048927 Bacteria 3864
1656 Ga0496124_0057436 3300048927 Bacteria 3279
1657 Ga0496124_0059681 3300048927 Bacteria 3203
1658 Ga0496124_0060792 3300048927 Bacteria 3168
1659 Ga0496124_0083438 3300048927 Bacteria 2621
1660 Ga0496124_0104844 3300048927 Bacteria 2285
1661 Ga0496125_0000019 3300048928 Bacteria 474989
1662 Ga0496125_0001683 3300048928 Bacteria 30939
1663 Ga0496125_0010865 3300048928 Bacteria 9163
1664 Ga0496125_0017692 3300048928 Bacteria 6784
1665 Ga0496125_0020693 3300048928 Bacteria 6169
1666 Ga0496125_0023874 3300048928 Bacteria 5634
1667 Ga0496125_0051178 3300048928 Bacteria 3410
1668 Ga0496125_0053543 3300048928 Bacteria 3306
1669 Ga0496125_0055167 3300048928 Bacteria 3240
1670 Ga0496125_0056039 3300048928 Bacteria 3204
1671 Ga0496125_0065887 3300048928 Bacteria 2866
1672 Ga0496125_0084512 3300048928 Bacteria 2409
1673 Ga0496126_0000651 3300048929 Bacteria 64444
1674 Ga0496126_0001458 3300048929 Bacteria 36910
1675 Ga0496126_0007056 3300048929 Bacteria 12377
1676 Ga0496126_0010782 3300048929 Bacteria 9540
1677 Ga0496126_0015585 3300048929 Bacteria 7638
1678 Ga0496126_0030629 3300048929 Bacteria 5094
1679 Ga0496126_0034453 3300048929 Bacteria 4755
1680 Ga0496126_0042557 3300048929 Bacteria 4194
1681 Ga0496126_0070829 3300048929 Bacteria 3105
1682 Ga0496126_0120265 3300048929 Bacteria 2278
1683 Ga0496126_0150813 3300048929 Bacteria 1993
1684 Ga0495678_000031 3300049459 Bacteria 215528
1685 Ga0495678_000039 3300049459 Bacteria 191665
1686 Ga0495678_001704 3300049459 Bacteria 16503
1687 Ga0495678_004240 3300049459 Bacteria 8408
1688 Ga0495678_009205 3300049459 Bacteria 4912
1689 Ga0495678_012322 3300049459 Bacteria 4057
1690 Ga0495678_012401 3300049459 Bacteria 4044
1691 Ga0495678_015646 3300049459 Bacteria 3485
1692 Ga0495678_015647 3300049459 Bacteria 3485
1693 Ga0495678_025008 3300049459 Bacteria 2570
1694 Ga0495678_036533 3300049459 Bacteria 2004
1695 Ga0495682_0000011 3300049460 Bacteria 278474
1696 Ga0495682_0000078 3300049460 Bacteria 85448
1697 Ga0495682_0000860 3300049460 Bacteria 18879
1698 Ga0495682_0001344 3300049460 Bacteria 13589
1699 Ga0495682_0020536 3300049460 Bacteria 2479
1700 Ga0501033_0002742 3300049570 Bacteria 14770
1701 Ga0501033_0046074 3300049570 Bacteria 3243
1702 Ga0501034_0000137 3300049571 Bacteria 136592
1703 Ga0501034_0033359 3300049571 Bacteria 5224
1704 Ga0501034_0058320 3300049571 Bacteria 3880
1705 Ga0501034_0067502 3300049571 Bacteria 3589
1706 Ga0501034_0119233 3300049571 Bacteria 2625
1707 Ga0501034_0128889 3300049571 Bacteria 2514
1708 Ga0501037_0002564 3300049573 Bacteria 13130
1709 Ga0501037_0012887 3300049573 Bacteria 6162
1710 Ga0501037_0111685 3300049573 Bacteria 1969
1711 Ga0501038_0003639 3300049574 Bacteria 14353
1712 Ga0501038_0134508 3300049574 Bacteria 2027
1713 Ga0501039_0078159 3300049575 Bacteria 2574
1714 Ga0501040_0000283 3300049576 Bacteria 29621
1715 Ga0501040_0047189 3300049576 Bacteria 2941
1716 Ga0501042_0010878 3300049578 Bacteria 6122
1717 Ga0501043_0008855 3300049579 Bacteria 7919
1718 Ga0501046_0001861 3300049580 Bacteria 20092
1719 Ga0501047_0056016 3300049581 Bacteria 3811
1720 Ga0501047_0106518 3300049581 Bacteria 2684
1721 Ga0501048_0079576 3300049582 Bacteria 2313
1722 Ga0501069_0037065 3300049585 Bacteria 2691
1723 Ga0501073_0001320 3300049589 Bacteria 18260
1724 Ga0501073_0123389 3300049589 Bacteria 1795
1725 Ga0501074_0001273 3300049590 Bacteria 16664
1726 Ga0501074_0034332 3300049590 Bacteria 3677
1727 Ga0501075_0007483 3300049591 Bacteria 7573
1728 Ga0501257_000023 3300049686 Bacteria 44305
1729 Ga0501080_0008771 3300049742 Bacteria 9186
1730 Ga0501080_0009290 3300049742 Bacteria 8966
1731 Ga0501080_0011652 3300049742 Bacteria 8052
1732 Ga0501080_0021925 3300049742 Bacteria 5916
1733 Ga0501080_0023606 3300049742 Bacteria 5698
1734 Ga0501241_000766 3300049758 Bacteria 6877
1735 Ga0501044_0000940 3300049823 Bacteria 34948
1736 Ga0501044_0016449 3300049823 Bacteria 7939
1737 Ga0501226_000017 3300049853 Bacteria 150879
1738 nmdc:mga00v17_17981_c1 3300050491 Bacteria 4011
1739 nmdc:mga00v17_34180_c1 3300050491 Bacteria 3018
1740 nmdc:mga0k408_2076_c1 3300050493 Bacteria 9874
1741 nmdc:mga0k408_5102_c1 3300050493 Bacteria 6952
1742 nmdc:mga0k408_6979_c1 3300050493 Bacteria 6024
1743 nmdc:mga08y16_5671_c1 3300050511 Bacteria 13081
1744 Ga0500650_0000060 3300053098 Bacteria 35425
1745 Ga0500555_000370 3300053103 Bacteria 19042
1746 Ga0500618_000221 3300053125 Bacteria 44814
1747 Ga0500618_003175 3300053125 Bacteria 5768
1748 Ga0500621_000005 3300053126 Bacteria 320383
1749 Ga0500659_0002202 3300053135 Bacteria 11827
1750 Ga0500564_002145 3300053138 Bacteria 7167
1751 Ga0500627_0000021 3300053158 Bacteria 108539
1752 Ga0500634_0036039 3300053161 Bacteria 2693
1753 Ga0466962_0002938 3300061719 Bacteria 8127

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0375567 Ga0395900_0375567_55_1359 430
2 3300045976 Ga0466967_0281483 Ga0466967_0281483_103_1551 438
3 3300021384 Ga0213876_10028640 Ga0213876_100286402 451
4 3300039437 Ga0436365_1869161 Ga0436365_1869161_71_1585 451
5 3300021384 Ga0213876_10016047 Ga0213876_100160473 455
6 3300021384 Ga0213876_10061824 Ga0213876_100618242 455
7 3300037853 Ga0436364_0496747 Ga0436364_0496747_8876_10372 455
8 3300039437 Ga0436365_0135600 Ga0436365_0135600_5623_7119 455
9 3300025906 Ga0207699_10136490 Ga0207699_101364901 458
10 3300039437 Ga0436365_0547247 Ga0436365_0547247_92_1618 459
11 3300003320 rootH2_10080641 rootH2_100806417 461
12 3300003758 Ga0055532_1002034 Ga0055532_10020342 461
13 3300025229 Ga0209147_100282 Ga0209147_10028224 461
14 3300039438 Ga0436360_1123266 Ga0436360_1123266_507_2054 463
15 iso_pu_bacteria 2643221731 2644715664 470
16 iso_pu_bacteria 2643221732 2644727384 470
17 iso_pu_bacteria 2818991465 2819709134 470
18 iso_pu_bacteria 2842882022 2842884621 470
19 iso_pu_bacteria 2904524088 2904524349 470
20 iso_pu_bacteria 2919143609 2919147074 470
21 iso_pu_bacteria 2919517244 2919518978 470
22 iso_pu_bacteria 2919720352 2919723346 470
23 iso_pu_bacteria 2928093941 2928096128 470
24 iso_pu_bacteria 2929004312 2929006501 470
25 iso_pu_bacteria 2960319331 2960319746 470
26 iso_pu_bacteria 2960375949 2960381042 470
27 iso_pu_bacteria 8022893055 8022898296 470
28 iso_pu_bacteria 8022914991 8022917475 470
29 3300005336 Ga0070680_100008145 Ga0070680_1000081452 471
30 3300025917 Ga0207660_10001233 Ga0207660_100012337 471
31 3300025949 Ga0207667_10062541 Ga0207667_100625414 471
32 3300003790 Ga0055528_1016713 Ga0055528_10167132 473
33 3300005331 Ga0070670_100024496 Ga0070670_1000244962 473
34 3300005355 Ga0070671_100002890 Ga0070671_10000289015 473
35 3300009148 Ga0105243_10002674 Ga0105243_1000267416 473
36 3300009176 Ga0105242_10001406 Ga0105242_100014062 473
37 3300011119 Ga0105246_10009655 Ga0105246_100096555 473
38 3300025273 Ga0209673_1012947 Ga0209673_10129473 473
39 3300025294 Ga0209025_1011780 Ga0209025_10117801 473
40 3300025711 Ga0207696_1004775 Ga0207696_10047752 473
41 3300025728 Ga0207655_1008094 Ga0207655_10080943 473
42 3300025735 Ga0207713_1001391 Ga0207713_100139120 473
43 3300025935 Ga0207709_10024141 Ga0207709_100241413 473
44 3300031548 Ga0307408_100005045 Ga0307408_1000050456 473
45 3300047323 Ga0495683_0016001 Ga0495683_0016001_2178_3722 473
46 3300048903 Ga0496100_0002021 Ga0496100_0002021_5564_7108 473
47 3300048904 Ga0496101_0001272 Ga0496101_0001272_12829_14373 473
48 3300048905 Ga0496102_0022059 Ga0496102_0022059_764_2308 473
49 3300048907 Ga0496104_0000337 Ga0496104_0000337_18332_19876 473
50 3300048909 Ga0496106_0000241 Ga0496106_0000241_28425_29969 473
51 3300048910 Ga0496107_0000257 Ga0496107_0000257_3045_4589 473
52 3300048911 Ga0496108_0019561 Ga0496108_0019561_845_2389 473
53 3300048912 Ga0496109_0001315 Ga0496109_0001315_11898_13442 473
54 3300048913 Ga0496110_0041721 Ga0496110_0041721_1635_3179 473
55 3300048914 Ga0496111_0004284 Ga0496111_0004284_1706_3250 473
56 3300048915 Ga0496112_0000575 Ga0496112_0000575_15912_17456 473
57 3300048916 Ga0496113_0036505 Ga0496113_0036505_1201_2745 473
58 3300048919 Ga0496116_0003107 Ga0496116_0003107_3680_5224 473
59 3300048920 Ga0496117_0043013 Ga0496117_0043013_1347_2891 473
60 3300048922 Ga0496119_0064301 Ga0496119_0064301_149_1693 473
61 3300048925 Ga0496122_0050929 Ga0496122_0050929_764_2308 473
62 3300048928 Ga0496125_0001683 Ga0496125_0001683_15178_16722 473
63 3300048929 Ga0496126_0015585 Ga0496126_0015585_5928_7472 473
64 3300048918 Ga0496115_0002769 Ga0496115_0002769_9062_10675 474
65 iso_pu_bacteria 2894023352 2894025184 475
66 3300049571 Ga0501034_0067502 Ga0501034_0067502_1347_2924 476
67 3300005354 Ga0070675_100112340 Ga0070675_1001123402 482
68 3300025926 Ga0207659_10108595 Ga0207659_101085952 482
69 3300031824 Ga0307413_10008341 Ga0307413_100083413 482
70 3300028379 Ga0268266_10057209 Ga0268266_100572093 483
71 3300006846 Ga0075430_100033772 Ga0075430_1000337723 484
72 3300006847 Ga0075431_100066126 Ga0075431_1000661263 484
73 3300045051 Ga0451576_0012763 Ga0451576_0012763_2768_4411 484
74 3300044658 Ga0466972_0012955 Ga0466972_0012955_1448_3118 485
75 3300044683 Ga0466965_0018049 Ga0466965_0018049_1646_3316 485
76 3300044735 Ga0466968_0002196 Ga0466968_0002196_1101_2771 485
77 3300044901 Ga0466960_0001312 Ga0466960_0001312_6284_7954 485
78 3300025913 Ga0207695_10058083 Ga0207695_100580834 487
79 3300044712 Ga0453684_0006974 Ga0453684_0006974_19622_21133 488
80 3300046616 Ga0495668_0078330 Ga0495668_0078330_25_1491 488
81 3300045051 Ga0451576_0002395 Ga0451576_0002395_18654_20297 491
82 3300036712 Ga0316584_0086219 Ga0316584_0086219_633_2297 492
83 3300044712 Ga0453684_0000051 Ga0453684_0000051_339204_340793 494
84 3300005327 Ga0070658_10000003 Ga0070658_10000003147 496
85 3300005345 Ga0070692_10000570 Ga0070692_100005705 496
86 3300025909 Ga0207705_10000005 Ga0207705_10000005150 496
87 3300005339 Ga0070660_100000348 Ga0070660_10000034829 497
88 3300025919 Ga0207657_10002670 Ga0207657_100026704 497
89 3300049576 Ga0501040_0047189 Ga0501040_0047189_616_2277 497
90 3300037471 Ga0395905_0000449 Ga0395905_0000449_53766_55313 501
91 3300021384 Ga0213876_10001336 Ga0213876_1000133611 502
92 3300039437 Ga0436365_0062931 Ga0436365_0062931_34713_36305 502
93 3300044683 Ga0466965_0025677 Ga0466965_0025677_956_2566 502
94 3300044684 Ga0466966_0021901 Ga0466966_0021901_409_2019 502
95 3300048913 Ga0496110_0001642 Ga0496110_0001642_9136_10773 503
96 3300048929 Ga0496126_0010782 Ga0496126_0010782_3270_4883 503
97 3300049570 Ga0501033_0046074 Ga0501033_0046074_1409_3034 503
98 3300049574 Ga0501038_0134508 Ga0501038_0134508_333_1958 503
99 3300049582 Ga0501048_0079576 Ga0501048_0079576_615_2240 503
100 3300049823 Ga0501044_0000940 Ga0501044_0000940_31011_32636 503
101 3300044712 Ga0453684_0007656 Ga0453684_0007656_11231_12805 504
102 3300045051 Ga0451576_0023577 Ga0451576_0023577_3732_5306 504
103 3300005336 Ga0070680_100000499 Ga0070680_10000049915 505
104 3300005530 Ga0070679_100000001 Ga0070679_100000001342 505
105 3300025917 Ga0207660_10001527 Ga0207660_100015275 505
106 3300025921 Ga0207652_10000002 Ga0207652_10000002905 505
107 3300042876 Ga0451577_0000317 Ga0451577_0000317_25966_27543 505
108 3300044712 Ga0453684_0001032 Ga0453684_0001032_61505_63082 505
109 3300045051 Ga0451576_0000830 Ga0451576_0000830_9989_11566 505
110 3300047318 Ga0495636_0000726 Ga0495636_0000726_15_1532 505
111 3300047443 Ga0495687_007564 Ga0495687_007564_4843_6360 505
112 3300037312 Ga0395899_0001402 Ga0395899_0001402_7665_9275 506
113 3300037418 Ga0395900_0036227 Ga0395900_0036227_2982_4592 506
114 3300037471 Ga0395905_0055304 Ga0395905_0055304_1128_2738 506
115 3300042876 Ga0451577_0000027 Ga0451577_0000027_150893_152482 506
116 3300042876 Ga0451577_0001205 Ga0451577_0001205_25122_26738 506
117 3300042876 Ga0451577_0034282 Ga0451577_0034282_1816_3405 506
118 3300044673 Ga0453683_0000289 Ga0453683_0000289_23333_24922 506
119 3300044712 Ga0453684_0000154 Ga0453684_0000154_58941_60530 506
120 3300044712 Ga0453684_0000213 Ga0453684_0000213_241892_243481 506
121 3300044712 Ga0453684_0003359 Ga0453684_0003359_9500_11116 506
122 3300044712 Ga0453684_0020139 Ga0453684_0020139_549_2138 506
123 3300045051 Ga0451576_0000032 Ga0451576_0000032_244533_246122 506
124 3300045051 Ga0451576_0001713 Ga0451576_0001713_9497_11113 506
125 3300045051 Ga0451576_0002412 Ga0451576_0002412_15172_16752 506
126 3300045051 Ga0451576_0025809 Ga0451576_0025809_1950_3539 506
127 iso_pu_bacteria 2904474040 2904474794 506
128 iso_pu_bacteria 2919150387 2919151140 506
129 iso_pu_bacteria 2927143783 2927146014 506
130 3300031251 Ga0265327_10004965 Ga0265327_1000496510 507
131 3300042876 Ga0451577_0000190 Ga0451577_0000190_53385_54992 507
132 3300044673 Ga0453683_0000105 Ga0453683_0000105_101508_103091 507
133 3300044673 Ga0453683_0027884 Ga0453683_0027884_791_2374 507
134 3300044712 Ga0453684_0000618 Ga0453684_0000618_75322_76929 507
135 3300044712 Ga0453684_0017144 Ga0453684_0017144_2271_3854 507
136 3300045051 Ga0451576_0059041 Ga0451576_0059041_2369_3952 507
137 3300048927 Ga0496124_0043435 Ga0496124_0043435_2222_3802 508
138 3300009092 Ga0105250_10013225 Ga0105250_100132251 510
139 3300009553 Ga0105249_10005838 Ga0105249_100058388 510
140 3300013102 Ga0157371_10003756 Ga0157371_1000375613 510
141 3300025961 Ga0207712_10005662 Ga0207712_100056622 510
142 3300046526 Ga0495666_0048649 Ga0495666_0048649_279_1811 510
143 3300045051 Ga0451576_0001041 Ga0451576_0001041_37848_39467 511
144 3300005336 Ga0070680_100006573 Ga0070680_1000065732 512
145 3300005616 Ga0068852_100009007 Ga0068852_1000090076 512
146 3300009093 Ga0105240_10044586 Ga0105240_100445866 512
147 3300025917 Ga0207660_10000789 Ga0207660_100007893 512
148 3300026142 Ga0207698_10031065 Ga0207698_100310653 512
149 3300048913 Ga0496110_0034795 Ga0496110_0034795_2279_3892 512
150 3300048927 Ga0496124_0000001 Ga0496124_0000001_207226_208839 512
151 3300037312 Ga0395899_0016157 Ga0395899_0016157_1487_3061 513
152 3300005347 Ga0070668_100011746 Ga0070668_1000117463 514
153 3300025972 Ga0207668_10051810 Ga0207668_100518103 514
154 3300038443 Ga0395901_0008013 Ga0395901_0008013_1602_3194 514
155 3300044712 Ga0453684_0031930 Ga0453684_0031930_5373_7010 514
156 iso_pu_bacteria 2526164512 2526210696 514
157 iso_pu_bacteria 2838054893 2838061515 514
158 iso_pu_bacteria 2885192300 2885196882 514
159 3300005344 Ga0070661_100000003 Ga0070661_100000003173 515
160 3300025920 Ga0207649_10000016 Ga0207649_1000001677 515
161 3300044712 Ga0453684_0012206 Ga0453684_0012206_10637_12217 515
162 3300045051 Ga0451576_0059141 Ga0451576_0059141_426_2006 515
163 iso_pu_bacteria 2511231026 2511385857 515
164 3300028573 Ga0265334_10000093 Ga0265334_100000933 516
165 3300031251 Ga0265327_10003940 Ga0265327_100039403 516
166 3300031507 Ga0307509_10000075 Ga0307509_10000075114 516
167 iso_pu_bacteria 2599185322 2600061885 516
168 iso_pu_bacteria 2765235838 2765569331 516
169 iso_pu_bacteria 2839094727 2839095783 516
170 3300005327 Ga0070658_10082748 Ga0070658_100827483 517
171 3300005435 Ga0070714_100006582 Ga0070714_1000065824 517
172 3300006195 Ga0075366_10031278 Ga0075366_100312783 517
173 3300025929 Ga0207664_10007174 Ga0207664_100071744 517
174 3300028573 Ga0265334_10000017 Ga0265334_10000017138 517
175 3300031595 Ga0265313_10000109 Ga0265313_1000010959 517
176 3300033541 Ga0316596_1001294 Ga0316596_10012941 517
177 3300035695 Ga0373927_0041959 Ga0373927_0041959_11_1636 517
178 3300041411 Ga0439466_0004836 Ga0439466_0004836_3580_5157 517
179 3300041413 Ga0439465_0001421 Ga0439465_0001421_829_2406 517
180 3300042004 Ga0439445_0001029 Ga0439445_0001029_241_1818 517
181 3300042006 Ga0439432_001181 Ga0439432_001181_7652_9229 517
182 3300042007 Ga0439449_0002198 Ga0439449_0002198_5887_7464 517
183 3300042015 Ga0439462_0000785 Ga0439462_0000785_1268_2845 517
184 iso_pu_bacteria 2521172590 2521558516 517
185 iso_pu_bacteria 2551306416 2553003307 517
186 iso_pu_bacteria 2808606386 2808984594 517
187 iso_pu_bacteria 2808606415 2809130861 517
188 iso_pu_bacteria 2808606419 2809150804 517
189 iso_pu_bacteria 2818991449 2819614687 517
190 iso_pu_bacteria 2852618963 2852622323 517
191 iso_pu_bacteria 2891633521 2891635875 517
192 iso_pu_bacteria 2904439833 2904441055 517
193 iso_pu_bacteria 2904504865 2904509359 517
194 iso_pu_bacteria 2904530477 2904532000 517
195 iso_pu_bacteria 2904584206 2904587774 517
196 iso_pu_bacteria 2904589729 2904590066 517
197 iso_pu_bacteria 2904601388 2904602546 517
198 iso_pu_bacteria 2919046199 2919046648 517
199 iso_pu_bacteria 2919079590 2919079948 517
200 iso_pu_bacteria 2923510766 2923511426 517
201 iso_pu_bacteria 2928130867 2928131358 517
202 3300009036 Ga0105244_10002681 Ga0105244_100026817 518
203 3300025728 Ga0207655_1002315 Ga0207655_10023157 518
204 3300028800 Ga0265338_10010511 Ga0265338_100105114 518
205 3300031251 Ga0265327_10001013 Ga0265327_1000101310 518
206 3300031344 Ga0265316_10000679 Ga0265316_1000067917 518
207 3300031595 Ga0265313_10013313 Ga0265313_100133135 518
208 3300031665 Ga0316575_10020470 Ga0316575_100204703 518
209 3300049742 Ga0501080_0011652 Ga0501080_0011652_5155_6762 518
210 3300049823 Ga0501044_0016449 Ga0501044_0016449_6211_7818 518
211 3300050493 nmdc:mga0k408_6979_c1 nmdc:mga0k408_6979_c1_306_1910 518
212 3300053125 Ga0500618_000221 Ga0500618_000221_33116_34723 518
213 3300001979 JGI24740J21852_10003302 JGI24740J21852_100033023 519
214 3300009551 Ga0105238_10027319 Ga0105238_100273196 519
215 3300025909 Ga0207705_10055298 Ga0207705_100552982 519
216 3300025913 Ga0207695_10015358 Ga0207695_100153583 519
217 3300026142 Ga0207698_10001175 Ga0207698_1000117512 519
218 3300039110 Ga0400487_27026 Ga0400487_27026_12368_13987 519
219 iso_pu_bacteria 2734482258 2735816278 519
220 3300005985 Ga0081539_10003747 Ga0081539_1000374710 520
221 3300009553 Ga0105249_10002290 Ga0105249_1000229014 520
222 3300013102 Ga0157371_10046045 Ga0157371_100460452 520
223 3300031548 Ga0307408_100096279 Ga0307408_1000962792 520
224 3300031901 Ga0307406_10028050 Ga0307406_100280503 520
225 3300032002 Ga0307416_100092344 Ga0307416_1000923443 520
226 3300032004 Ga0307414_10037319 Ga0307414_100373194 520
227 3300032005 Ga0307411_10003832 Ga0307411_100038323 520
228 3300035695 Ga0373927_0000003 Ga0373927_0000003_74676_76316 520
229 3300037418 Ga0395900_0001467 Ga0395900_0001467_17546_19204 520
230 3300038443 Ga0395901_0012507 Ga0395901_0012507_3816_5447 520
231 3300039447 Ga0436361_0781898 Ga0436361_0781898_1840_3417 520
232 3300048913 Ga0496110_0094355 Ga0496110_0094355_729_2342 520
233 3300048920 Ga0496117_0001303 Ga0496117_0001303_23614_25260 520
234 3300049459 Ga0495678_036533 Ga0495678_036533_10_1572 520
235 3300049573 Ga0501037_0111685 Ga0501037_0111685_291_1877 520
236 3300049742 Ga0501080_0023606 Ga0501080_0023606_1344_2933 520
237 3300001904 JGI24736J21556_1000951 JGI24736J21556_10009513 521
238 3300001915 JGI24741J21665_1000304 JGI24741J21665_10003048 521
239 3300001979 JGI24740J21852_10000432 JGI24740J21852_100004328 521
240 3300001979 JGI24740J21852_10009450 JGI24740J21852_100094501 521
241 3300001989 JGI24739J22299_10005695 JGI24739J22299_100056953 521
242 3300001990 JGI24737J22298_10000312 JGI24737J22298_100003128 521
243 3300001990 JGI24737J22298_10003042 JGI24737J22298_100030423 521
244 3300001990 JGI24737J22298_10003936 JGI24737J22298_100039366 521
245 3300002067 JGI24735J21928_10001252 JGI24735J21928_100012526 521
246 3300003751 Ga0055538_1000002 Ga0055538_1000002469 521
247 3300003752 Ga0055539_1000002 Ga0055539_1000002469 521
248 3300003756 Ga0055533_1000004 Ga0055533_1000004469 521
249 3300003759 Ga0055525_1000002 Ga0055525_1000002469 521
250 3300003841 Ga0055541_1000002 Ga0055541_1000002373 521
251 3300005327 Ga0070658_10001393 Ga0070658_100013935 521
252 3300005327 Ga0070658_10005046 Ga0070658_1000504611 521
253 3300005327 Ga0070658_10025621 Ga0070658_100256213 521
254 3300005329 Ga0070683_100008343 Ga0070683_1000083433 521
255 3300005331 Ga0070670_100061958 Ga0070670_1000619583 521
256 3300005335 Ga0070666_10016189 Ga0070666_100161894 521
257 3300005336 Ga0070680_100001660 Ga0070680_10000166012 521
258 3300005336 Ga0070680_100006363 Ga0070680_1000063636 521
259 3300005337 Ga0070682_100009487 Ga0070682_1000094872 521
260 3300005337 Ga0070682_100054429 Ga0070682_1000544292 521
261 3300005339 Ga0070660_100000339 Ga0070660_10000033932 521
262 3300005339 Ga0070660_100001567 Ga0070660_10000156715 521
263 3300005339 Ga0070660_100036805 Ga0070660_1000368053 521
264 3300005339 Ga0070660_100045289 Ga0070660_1000452892 521
265 3300005343 Ga0070687_100062417 Ga0070687_1000624172 521
266 3300005344 Ga0070661_100000354 Ga0070661_10000035420 521
267 3300005344 Ga0070661_100043589 Ga0070661_1000435893 521
268 3300005345 Ga0070692_10001320 Ga0070692_100013206 521
269 3300005345 Ga0070692_10001825 Ga0070692_1000182510 521
270 3300005345 Ga0070692_10010870 Ga0070692_100108703 521
271 3300005366 Ga0070659_100000311 Ga0070659_1000003113 521
272 3300005366 Ga0070659_100002897 Ga0070659_10000289710 521
273 3300005455 Ga0070663_100001000 Ga0070663_10000100013 521
274 3300005455 Ga0070663_100004050 Ga0070663_10000405010 521
275 3300005455 Ga0070663_100031114 Ga0070663_1000311144 521
276 3300005457 Ga0070662_100001149 Ga0070662_1000011493 521
277 3300005457 Ga0070662_100001841 Ga0070662_1000018416 521
278 3300005457 Ga0070662_100002054 Ga0070662_1000020543 521
279 3300005530 Ga0070679_100046158 Ga0070679_1000461584 521
280 3300005530 Ga0070679_100094457 Ga0070679_1000944572 521
281 3300005539 Ga0068853_100001473 Ga0068853_1000014733 521
282 3300005539 Ga0068853_100025547 Ga0068853_1000255472 521
283 3300005539 Ga0068853_100059061 Ga0068853_1000590614 521
284 3300005548 Ga0070665_100002680 Ga0070665_10000268013 521
285 3300005563 Ga0068855_100000046 Ga0068855_1000000466 521
286 3300005563 Ga0068855_100000194 Ga0068855_10000019410 521
287 3300005563 Ga0068855_100008129 Ga0068855_1000081295 521
288 3300005563 Ga0068855_100024900 Ga0068855_1000249005 521
289 3300005563 Ga0068855_100054653 Ga0068855_1000546535 521
290 3300005563 Ga0068855_100092943 Ga0068855_1000929433 521
291 3300005564 Ga0070664_100000128 Ga0070664_10000012836 521
292 3300005578 Ga0068854_100001138 Ga0068854_1000011384 521
293 3300005578 Ga0068854_100025436 Ga0068854_1000254365 521
294 3300005614 Ga0068856_100001416 Ga0068856_1000014163 521
295 3300005614 Ga0068856_100021261 Ga0068856_1000212615 521
296 3300005614 Ga0068856_100026157 Ga0068856_1000261576 521
297 3300005616 Ga0068852_100014137 Ga0068852_1000141377 521
298 3300005616 Ga0068852_100054364 Ga0068852_1000543642 521
299 3300005985 Ga0081539_10009603 Ga0081539_100096032 521
300 3300006195 Ga0075366_10002461 Ga0075366_100024616 521
301 3300006844 Ga0075428_100002620 Ga0075428_1000026202 521
302 3300009093 Ga0105240_10010783 Ga0105240_1001078311 521
303 3300009093 Ga0105240_10126479 Ga0105240_101264792 521
304 3300009094 Ga0111539_10108820 Ga0111539_101088203 521
305 3300009177 Ga0105248_10000206 Ga0105248_1000020641 521
306 3300009545 Ga0105237_10071182 Ga0105237_100711821 521
307 3300009551 Ga0105238_10000917 Ga0105238_1000091721 521
308 3300009551 Ga0105238_10197933 Ga0105238_101979332 521
309 3300010375 Ga0105239_10072761 Ga0105239_100727612 521
310 3300010375 Ga0105239_10286261 Ga0105239_102862611 521
311 3300013100 Ga0157373_10006653 Ga0157373_100066538 521
312 3300013102 Ga0157371_10012007 Ga0157371_100120072 521
313 3300013102 Ga0157371_10025391 Ga0157371_100253914 521
314 3300013105 Ga0157369_10000043 Ga0157369_1000004349 521
315 3300013105 Ga0157369_10012852 Ga0157369_1001285210 521
316 3300013105 Ga0157369_10217039 Ga0157369_102170392 521
317 3300014325 Ga0163163_10000286 Ga0163163_1000028644 521
318 3300015261 Ga0182006_1007275 Ga0182006_10072753 521
319 3300015262 Ga0182007_10024530 Ga0182007_100245302 521
320 3300021361 Ga0213872_10004265 Ga0213872_100042656 521
321 3300021384 Ga0213876_10010656 Ga0213876_100106562 521
322 3300025224 Ga0209784_100002 Ga0209784_100002698 521
323 3300025225 Ga0209566_100003 Ga0209566_100003698 521
324 3300025226 Ga0209674_100004 Ga0209674_100004698 521
325 3300025230 Ga0209563_100006 Ga0209563_100006698 521
326 3300025253 Ga0209677_100003 Ga0209677_100003698 521
327 3300025903 Ga0207680_10004476 Ga0207680_100044763 521
328 3300025904 Ga0207647_10005488 Ga0207647_100054884 521
329 3300025909 Ga0207705_10000033 Ga0207705_10000033125 521
330 3300025909 Ga0207705_10000082 Ga0207705_100000825 521
331 3300025909 Ga0207705_10003295 Ga0207705_100032958 521
332 3300025909 Ga0207705_10004248 Ga0207705_1000424811 521
333 3300025909 Ga0207705_10006793 Ga0207705_100067939 521
334 3300025909 Ga0207705_10017711 Ga0207705_100177112 521
335 3300025909 Ga0207705_10085409 Ga0207705_100854092 521
336 3300025909 Ga0207705_10139239 Ga0207705_101392391 521
337 3300025912 Ga0207707_10002141 Ga0207707_1000214111 521
338 3300025912 Ga0207707_10142404 Ga0207707_101424042 521
339 3300025913 Ga0207695_10001065 Ga0207695_1000106515 521
340 3300025913 Ga0207695_10002063 Ga0207695_1000206331 521
341 3300025913 Ga0207695_10090792 Ga0207695_100907922 521
342 3300025917 Ga0207660_10004143 Ga0207660_100041436 521
343 3300025919 Ga0207657_10000360 Ga0207657_100003605 521
344 3300025919 Ga0207657_10000398 Ga0207657_1000039832 521
345 3300025919 Ga0207657_10000993 Ga0207657_1000099322 521
346 3300025919 Ga0207657_10002401 Ga0207657_100024018 521
347 3300025920 Ga0207649_10002077 Ga0207649_1000207711 521
348 3300025920 Ga0207649_10002320 Ga0207649_1000232012 521
349 3300025920 Ga0207649_10003730 Ga0207649_100037303 521
350 3300025920 Ga0207649_10045049 Ga0207649_100450492 521
351 3300025920 Ga0207649_10061057 Ga0207649_100610572 521
352 3300025921 Ga0207652_10018123 Ga0207652_100181232 521
353 3300025921 Ga0207652_10165523 Ga0207652_101655232 521
354 3300025924 Ga0207694_10000446 Ga0207694_1000044613 521
355 3300025932 Ga0207690_10000118 Ga0207690_1000011851 521
356 3300025932 Ga0207690_10001000 Ga0207690_1000100011 521
357 3300025932 Ga0207690_10007053 Ga0207690_100070538 521
358 3300025932 Ga0207690_10067009 Ga0207690_100670091 521
359 3300025933 Ga0207706_10000222 Ga0207706_100002223 521
360 3300025933 Ga0207706_10001030 Ga0207706_1000103010 521
361 3300025933 Ga0207706_10003172 Ga0207706_1000317210 521
362 3300025941 Ga0207711_10005230 Ga0207711_100052304 521
363 3300025944 Ga0207661_10016630 Ga0207661_100166306 521
364 3300025945 Ga0207679_10001626 Ga0207679_100016268 521
365 3300025945 Ga0207679_10002671 Ga0207679_100026713 521
366 3300025949 Ga0207667_10000036 Ga0207667_1000003692 521
367 3300025949 Ga0207667_10002436 Ga0207667_100024363 521
368 3300025949 Ga0207667_10003833 Ga0207667_100038335 521
369 3300025949 Ga0207667_10007100 Ga0207667_100071002 521
370 3300025949 Ga0207667_10044801 Ga0207667_100448015 521
371 3300025949 Ga0207667_10053912 Ga0207667_100539124 521
372 3300025949 Ga0207667_10093530 Ga0207667_100935302 521
373 3300025981 Ga0207640_10002534 Ga0207640_100025343 521
374 3300025981 Ga0207640_10020129 Ga0207640_100201293 521
375 3300026041 Ga0207639_10038013 Ga0207639_100380132 521
376 3300026041 Ga0207639_10068819 Ga0207639_100688192 521
377 3300026041 Ga0207639_10105535 Ga0207639_101055352 521
378 3300026067 Ga0207678_10002500 Ga0207678_100025004 521
379 3300026067 Ga0207678_10008428 Ga0207678_1000842810 521
380 3300026067 Ga0207678_10021777 Ga0207678_100217776 521
381 3300026067 Ga0207678_10088460 Ga0207678_100884602 521
382 3300026078 Ga0207702_10000074 Ga0207702_1000007492 521
383 3300026078 Ga0207702_10003066 Ga0207702_1000306615 521
384 3300026078 Ga0207702_10010296 Ga0207702_100102964 521
385 3300026078 Ga0207702_10014307 Ga0207702_100143073 521
386 3300026095 Ga0207676_10127970 Ga0207676_101279702 521
387 3300026116 Ga0207674_10001981 Ga0207674_1000198112 521
388 3300026116 Ga0207674_10003653 Ga0207674_100036534 521
389 3300026116 Ga0207674_10045072 Ga0207674_100450723 521
390 3300026142 Ga0207698_10023240 Ga0207698_100232402 521
391 3300026142 Ga0207698_10123835 Ga0207698_101238352 521
392 3300027907 Ga0207428_10006599 Ga0207428_100065998 521
393 3300028379 Ga0268266_10026710 Ga0268266_100267104 521
394 3300031727 Ga0316576_10082447 Ga0316576_100824473 521
395 3300031731 Ga0307405_10003196 Ga0307405_100031969 521
396 3300031731 Ga0307405_10029577 Ga0307405_100295772 521
397 3300031824 Ga0307413_10010021 Ga0307413_100100212 521
398 3300031824 Ga0307413_10024637 Ga0307413_100246373 521
399 3300031824 Ga0307413_10039218 Ga0307413_100392182 521
400 3300031852 Ga0307410_10000294 Ga0307410_1000029416 521
401 3300031852 Ga0307410_10001860 Ga0307410_100018605 521
402 3300031852 Ga0307410_10005981 Ga0307410_100059815 521
403 3300031901 Ga0307406_10064464 Ga0307406_100644642 521
404 3300031903 Ga0307407_10002081 Ga0307407_100020814 521
405 3300031911 Ga0307412_10010987 Ga0307412_100109873 521
406 3300031911 Ga0307412_10078750 Ga0307412_100787501 521
407 3300031995 Ga0307409_100004079 Ga0307409_1000040797 521
408 3300032002 Ga0307416_100008181 Ga0307416_1000081816 521
409 3300032002 Ga0307416_100011129 Ga0307416_1000111296 521
410 3300032005 Ga0307411_10001138 Ga0307411_100011382 521
411 3300032005 Ga0307411_10002818 Ga0307411_100028189 521
412 3300032005 Ga0307411_10003084 Ga0307411_100030843 521
413 3300032005 Ga0307411_10009183 Ga0307411_100091832 521
414 3300032005 Ga0307411_10028667 Ga0307411_100286673 521
415 3300032126 Ga0307415_100005101 Ga0307415_1000051016 521
416 3300035398 Ga0316574_0006348 Ga0316574_0006348_2791_4419 521
417 3300036401 Ga0373937_0038714 Ga0373937_0038714_1407_2987 521
418 3300037312 Ga0395899_0000340 Ga0395899_0000340_29350_30930 521
419 3300037312 Ga0395899_0004516 Ga0395899_0004516_2456_4036 521
420 3300037312 Ga0395899_0011814 Ga0395899_0011814_868_2448 521
421 3300037312 Ga0395899_0035196 Ga0395899_0035196_191_1771 521
422 3300037312 Ga0395899_0038478 Ga0395899_0038478_1674_3254 521
423 3300037312 Ga0395899_0057997 Ga0395899_0057997_1086_2666 521
424 3300037418 Ga0395900_0000794 Ga0395900_0000794_29529_31109 521
425 3300037418 Ga0395900_0043084 Ga0395900_0043084_186_1766 521
426 3300037418 Ga0395900_0062683 Ga0395900_0062683_1636_3252 521
427 3300037418 Ga0395900_0091525 Ga0395900_0091525_155_1735 521
428 3300037418 Ga0395900_0099657 Ga0395900_0099657_878_2458 521
429 3300037418 Ga0395900_0104381 Ga0395900_0104381_191_1771 521
430 3300037418 Ga0395900_0104385 Ga0395900_0104385_191_1771 521
431 3300037418 Ga0395900_0123248 Ga0395900_0123248_609_2189 521
432 3300037418 Ga0395900_0168469 Ga0395900_0168469_57_1637 521
433 3300037418 Ga0395900_0229732 Ga0395900_0229732_27_1607 521
434 3300037466 Ga0395898_0007116 Ga0395898_0007116_3376_4956 521
435 3300037466 Ga0395898_0018136 Ga0395898_0018136_5582_7162 521
436 3300037466 Ga0395898_0062547 Ga0395898_0062547_1844_3424 521
437 3300037466 Ga0395898_0069413 Ga0395898_0069413_1114_2694 521
438 3300037466 Ga0395898_0224572 Ga0395898_0224572_21_1601 521
439 3300037471 Ga0395905_0003152 Ga0395905_0003152_6614_8206 521
440 3300037471 Ga0395905_0026797 Ga0395905_0026797_980_2560 521
441 3300037471 Ga0395905_0037369 Ga0395905_0037369_2678_4258 521
442 3300037471 Ga0395905_0073161 Ga0395905_0073161_683_2263 521
443 3300037471 Ga0395905_0129360 Ga0395905_0129360_186_1766 521
444 3300038443 Ga0395901_0000031 Ga0395901_0000031_163055_164635 521
445 3300038443 Ga0395901_0005395 Ga0395901_0005395_10117_11697 521
446 3300038443 Ga0395901_0021440 Ga0395901_0021440_4218_5798 521
447 3300038443 Ga0395901_0041316 Ga0395901_0041316_2740_4320 521
448 3300038443 Ga0395901_0045185 Ga0395901_0045185_1969_3549 521
449 3300038443 Ga0395901_0049456 Ga0395901_0049456_507_2087 521
450 3300038443 Ga0395901_0072778 Ga0395901_0072778_944_2524 521
451 3300039447 Ga0436361_0301994 Ga0436361_0301994_1886_3502 521
452 3300044684 Ga0466966_0000021 Ga0466966_0000021_71128_72708 521
453 3300044684 Ga0466966_0001996 Ga0466966_0001996_9772_11352 521
454 3300044694 Ga0466963_0011415 Ga0466963_0011415_2481_4061 521
455 3300044694 Ga0466963_0018282 Ga0466963_0018282_788_2368 521
456 3300044694 Ga0466963_0019094 Ga0466963_0019094_821_2401 521
457 3300044694 Ga0466963_0104858 Ga0466963_0104858_116_1696 521
458 3300044719 Ga0466971_0000846 Ga0466971_0000846_563_2143 521
459 3300044765 Ga0466970_0006718 Ga0466970_0006718_1719_3299 521
460 3300044842 Ga0466957_0011895 Ga0466957_0011895_1872_3452 521
461 3300045049 Ga0466959_0006500 Ga0466959_0006500_5582_7162 521
462 3300045049 Ga0466959_0030822 Ga0466959_0030822_2188_3768 521
463 3300045836 Ga0466958_0019206 Ga0466958_0019206_917_2497 521
464 3300045976 Ga0466967_0016713 Ga0466967_0016713_115_1695 521
465 3300048911 Ga0496108_0018831 Ga0496108_0018831_3606_5198 521
466 3300049571 Ga0501034_0128889 Ga0501034_0128889_578_2182 521
467 3300049575 Ga0501039_0078159 Ga0501039_0078159_134_1771 521
468 3300049581 Ga0501047_0106518 Ga0501047_0106518_61_1665 521
469 3300049742 Ga0501080_0009290 Ga0501080_0009290_1546_3126 521
470 3300050493 nmdc:mga0k408_2076_c1 nmdc:mga0k408_2076_c1_4474_6144 521
471 3300050511 nmdc:mga08y16_5671_c1 nmdc:mga08y16_5671_c1_1877_3496 521
472 3300061719 Ga0466962_0002938 Ga0466962_0002938_5817_7397 521
473 3300005546 Ga0070696_100070184 Ga0070696_1000701842 522
474 3300031691 Ga0316579_10000057 Ga0316579_1000005713 522
475 3300031733 Ga0316577_10012570 Ga0316577_100125704 522
476 3300036712 Ga0316584_0001968 Ga0316584_0001968_9905_11551 522
477 3300037471 Ga0395905_0011002 Ga0395905_0011002_3822_5441 522
478 3300053158 Ga0500627_0000021 Ga0500627_0000021_58046_59635 522
479 iso_pu_bacteria 8015556637 8015559784 522
480 2162886007 SwRhRL2b_contig_1759361 SwRhRL2b_0440.00007370 523
481 3300005289 Ga0065704_10070132 Ga0065704_100701321473 523
482 3300005335 Ga0070666_10001251 Ga0070666_1000125111 523
483 3300005367 Ga0070667_100027760 Ga0070667_1000277602 523
484 3300005456 Ga0070678_100062610 Ga0070678_1000626102 523
485 3300009177 Ga0105248_10048227 Ga0105248_100482273 523
486 3300013306 Ga0163162_10000679 Ga0163162_1000067914 523
487 3300013306 Ga0163162_10175249 Ga0163162_101752492 523
488 3300013308 Ga0157375_10009709 Ga0157375_100097093 523
489 3300025903 Ga0207680_10006494 Ga0207680_100064942 523
490 3300025941 Ga0207711_10029756 Ga0207711_100297564 523
491 3300025972 Ga0207668_10063376 Ga0207668_100633763 523
492 3300025986 Ga0207658_10020941 Ga0207658_100209414 523
493 3300038741 Ga0400488_48403 Ga0400488_48403_22603_24222 523
494 3300039110 Ga0400487_24198 Ga0400487_24198_9576_11252 523
495 3300045051 Ga0451576_0000426 Ga0451576_0000426_47494_49089 523
496 3300046454 Ga0495592_0083298 Ga0495592_0083298_473_2071 523
497 3300046460 Ga0495638_0022488 Ga0495638_0022488_1222_2820 523
498 3300046474 Ga0495605_0014459 Ga0495605_0014459_1445_3043 523
499 3300046507 Ga0495606_0004545 Ga0495606_0004545_8940_10538 523
500 3300046516 Ga0495628_0028498 Ga0495628_0028498_2810_4408 523
501 3300046543 Ga0495645_0039638 Ga0495645_0039638_1148_2746 523
502 3300046691 Ga0495670_0012502 Ga0495670_0012502_1341_2939 523
503 3300046794 Ga0495589_0006680 Ga0495589_0006680_3725_5323 523
504 3300047472 Ga0495686_0000002 Ga0495686_0000002_107258_108856 523
505 3300048920 Ga0496117_0000663 Ga0496117_0000663_6126_7721 523
506 3300048921 Ga0496118_0012340 Ga0496118_0012340_471_2066 523
507 3300048929 Ga0496126_0000651 Ga0496126_0000651_5258_6853 523
508 3300049686 Ga0501257_000023 Ga0501257_000023_40362_41948 523
509 iso_pu_bacteria 2574179768 2574431739 523
510 3300020082 Ga0206353_10185733 Ga0206353_101857332 524
511 3300031691 Ga0316579_10002450 Ga0316579_100024503 524
512 3300032133 Ga0316583_10006565 Ga0316583_100065656 524
513 3300036647 Ga0316582_0000694 Ga0316582_0000694_10679_12307 524
514 3300045051 Ga0451576_0079174 Ga0451576_0079174_1324_2925 524
515 3300046615 Ga0495656_0023683 Ga0495656_0023683_331_1944 524
516 3300047318 Ga0495636_0006632 Ga0495636_0006632_2035_3648 524
517 3300048913 Ga0496110_0094889 Ga0496110_0094889_226_1887 524
518 iso_pu_bacteria 2885427238 2885429247 524
519 3300005331 Ga0070670_100000011 Ga0070670_10000001129 525
520 3300005335 Ga0070666_10008077 Ga0070666_100080774 525
521 3300005339 Ga0070660_100006022 Ga0070660_1000060226 525
522 3300005347 Ga0070668_100000011 Ga0070668_10000001118 525
523 3300005353 Ga0070669_100002205 Ga0070669_1000022055 525
524 3300005355 Ga0070671_100000036 Ga0070671_10000003687 525
525 3300005355 Ga0070671_100000707 Ga0070671_1000007072 525
526 3300005367 Ga0070667_100000123 Ga0070667_10000012373 525
527 3300005466 Ga0070685_10000004 Ga0070685_10000004154 525
528 3300005548 Ga0070665_100057371 Ga0070665_1000573712 525
529 3300005617 Ga0068859_100007228 Ga0068859_1000072285 525
530 3300005618 Ga0068864_100000020 Ga0068864_100000020225 525
531 3300005841 Ga0068863_100000186 Ga0068863_10000018619 525
532 3300005842 Ga0068858_100081833 Ga0068858_1000818333 525
533 3300005843 Ga0068860_100202184 Ga0068860_1002021842 525
534 3300005844 Ga0068862_100001921 Ga0068862_1000019218 525
535 3300005844 Ga0068862_100012269 Ga0068862_1000122693 525
536 3300006846 Ga0075430_100067350 Ga0075430_1000673503 525
537 3300006931 Ga0097620_100007228 Ga0097620_1000072285 525
538 3300009177 Ga0105248_10156410 Ga0105248_101564101 525
539 3300009553 Ga0105249_10003057 Ga0105249_100030575 525
540 3300014325 Ga0163163_10001043 Ga0163163_1000104313 525
541 3300021358 Ga0213873_10000016 Ga0213873_1000001668 525
542 3300021384 Ga0213876_10000056 Ga0213876_1000005670 525
543 3300025923 Ga0207681_10000504 Ga0207681_1000050411 525
544 3300025925 Ga0207650_10000025 Ga0207650_1000002528 525
545 3300025931 Ga0207644_10000015 Ga0207644_1000001517 525
546 3300025931 Ga0207644_10000032 Ga0207644_1000003222 525
547 3300025941 Ga0207711_10000375 Ga0207711_1000037536 525
548 3300025941 Ga0207711_10000559 Ga0207711_100005596 525
549 3300025961 Ga0207712_10011186 Ga0207712_100111863 525
550 3300025972 Ga0207668_10000034 Ga0207668_1000003419 525
551 3300025986 Ga0207658_10000008 Ga0207658_10000008226 525
552 3300026088 Ga0207641_10000031 Ga0207641_10000031210 525
553 3300026088 Ga0207641_10088322 Ga0207641_100883222 525
554 3300026095 Ga0207676_10000024 Ga0207676_1000002428 525
555 3300028379 Ga0268266_10010441 Ga0268266_100104417 525
556 3300028379 Ga0268266_10061309 Ga0268266_100613092 525
557 3300028380 Ga0268265_10000583 Ga0268265_1000058313 525
558 3300028380 Ga0268265_10018262 Ga0268265_100182623 525
559 3300028381 Ga0268264_10000036 Ga0268264_10000036110 525
560 3300028381 Ga0268264_10057726 Ga0268264_100577263 525
561 3300031251 Ga0265327_10000282 Ga0265327_1000028255 525
562 3300031691 Ga0316579_10001576 Ga0316579_100015765 525
563 3300032133 Ga0316583_10006807 Ga0316583_100068075 525
564 3300032168 Ga0316593_10022077 Ga0316593_100220772 525
565 3300036712 Ga0316584_0026225 Ga0316584_0026225_1639_3261 525
566 3300039062 Ga0400483_042324 Ga0400483_042324_15840_17438 525
567 3300039062 Ga0400483_246600 Ga0400483_246600_10915_12513 525
568 3300039437 Ga0436365_0869628 Ga0436365_0869628_62253_63854 525
569 3300039453 Ga0436362_0580304 Ga0436362_0580304_62253_63854 525
570 3300044673 Ga0453683_0016598 Ga0453683_0016598_3008_4612 525
571 3300045051 Ga0451576_0000552 Ga0451576_0000552_15624_17228 525
572 3300045051 Ga0451576_0010707 Ga0451576_0010707_4142_5746 525
573 3300046506 Ga0495583_0000010 Ga0495583_0000010_285915_287510 525
574 3300046691 Ga0495670_0017566 Ga0495670_0017566_582_2177 525
575 3300049460 Ga0495682_0020536 Ga0495682_0020536_90_1685 525
576 3300049571 Ga0501034_0119233 Ga0501034_0119233_375_1985 525
577 3300053098 Ga0500650_0000060 Ga0500650_0000060_13745_15358 525
578 3300053103 Ga0500555_000370 Ga0500555_000370_11777_13372 525
579 3300053138 Ga0500564_002145 Ga0500564_002145_4061_5683 525
580 iso_pu_bacteria 8002745576 8002747717 526
581 3300013307 Ga0157372_10004696 Ga0157372_100046965 527
582 3300031251 Ga0265327_10001065 Ga0265327_1000106523 527
583 3300039110 Ga0400487_57461 Ga0400487_57461_315_1919 527
584 3300041405 Ga0439438_000850 Ga0439438_000850_4655_6247 527
585 3300044712 Ga0453684_0003583 Ga0453684_0003583_15239_16849 527
586 3300044712 Ga0453684_0004640 Ga0453684_0004640_15871_17481 527
587 3300048925 Ga0496122_0048017 Ga0496122_0048017_24_1613 527
588 iso_pu_bacteria 2643221665 2644365333 527
589 iso_pu_bacteria 2675903507 2678232109 527
590 iso_pu_bacteria 2744054655 2745161841 527
591 iso_pu_bacteria 2773857761 2774389834 527
592 iso_pu_bacteria 2916699645 2916701893 527
593 iso_pu_bacteria 2919182534 2919183292 527
594 iso_pu_bacteria 2919506607 2919508215 527
595 iso_pu_bacteria 2928515477 2928515868 527
596 iso_pu_bacteria 2984568884 2984570362 527
597 iso_pu_bacteria 8033232454 8033233961 527
598 3300029957 Ga0265324_10009981 Ga0265324_100099813 528
599 3300031239 Ga0265328_10002145 Ga0265328_100021453 528
600 3300031240 Ga0265320_10017340 Ga0265320_100173403 528
601 3300031250 Ga0265331_10000377 Ga0265331_100003776 528
602 3300031691 Ga0316579_10000290 Ga0316579_1000029013 528
603 3300031691 Ga0316579_10001181 Ga0316579_100011816 528
604 3300031727 Ga0316576_10042366 Ga0316576_100423662 528
605 3300031728 Ga0316578_10066439 Ga0316578_100664392 528
606 3300032133 Ga0316583_10005624 Ga0316583_100056244 528
607 3300032133 Ga0316583_10016938 Ga0316583_100169383 528
608 3300036647 Ga0316582_0007888 Ga0316582_0007888_832_2427 528
609 3300038725 Ga0400484_18004 Ga0400484_18004_3255_4868 528
610 3300038726 Ga0400490_16093 Ga0400490_16093_24715_26328 528
611 3300038726 Ga0400490_22207 Ga0400490_22207_46227_47840 528
612 3300038726 Ga0400490_37813 Ga0400490_37813_5874_7487 528
613 3300038741 Ga0400488_43050 Ga0400488_43050_4959_6572 528
614 3300038741 Ga0400488_60045 Ga0400488_60045_322_1935 528
615 3300038742 Ga0400486_12219 Ga0400486_12219_14092_15705 528
616 3300039062 Ga0400483_105417 Ga0400483_105417_287_1897 528
617 3300039062 Ga0400483_229745 Ga0400483_229745_3195_4808 528
618 3300039110 Ga0400487_04871 Ga0400487_04871_7614_9227 528
619 3300041405 Ga0439438_014528 Ga0439438_014528_27_1613 528
620 3300046519 Ga0495632_0018221 Ga0495632_0018221_464_2050 528
621 iso_pu_bacteria 2537561728 2538427193 528
622 iso_pu_bacteria 2706794495 2707099646 528
623 iso_pu_bacteria 2738541276 2738715508 528
624 iso_pu_bacteria 2846540461 2846542880 528
625 iso_pu_bacteria 2847085930 2847086188 528
626 iso_pu_bacteria 2852103415 2852104757 528
627 iso_pu_bacteria 2854601825 2854602785 528
628 iso_pu_bacteria 2855195626 2855196468 528
629 iso_pu_bacteria 2858466076 2858468297 528
630 iso_pu_bacteria 2869551831 2869555844 528
631 iso_pu_bacteria 2871272651 2871275740 528
632 iso_pu_bacteria 2871282230 2871286210 528
633 iso_pu_bacteria 2887630918 2887632770 528
634 iso_pu_bacteria 2888366609 2888370489 528
635 iso_pu_bacteria 2888373701 2888377025 528
636 iso_pu_bacteria 2900051742 2900053314 528
637 iso_pu_bacteria 2919688452 2919690994 528
638 iso_pu_bacteria 8054357960 8054359669 528
639 3300003856 Ga0058692_1000001 Ga0058692_1000001689 529
640 3300005272 Ga0065703_1000284 Ga0065703_100028412 529
641 3300005353 Ga0070669_100064671 Ga0070669_1000646712 529
642 3300005367 Ga0070667_100146179 Ga0070667_1001461791 529
643 3300005435 Ga0070714_100003869 Ga0070714_10000386911 529
644 3300005548 Ga0070665_100031217 Ga0070665_1000312172 529
645 3300005841 Ga0068863_100200733 Ga0068863_1002007332 529
646 3300006177 Ga0075362_10023192 Ga0075362_100231924 529
647 3300009036 Ga0105244_10018049 Ga0105244_100180494 529
648 3300009036 Ga0105244_10044649 Ga0105244_100446492 529
649 3300009036 Ga0105244_10044714 Ga0105244_100447142 529
650 3300009092 Ga0105250_10024156 Ga0105250_100241562 529
651 3300009093 Ga0105240_10022569 Ga0105240_100225698 529
652 3300009101 Ga0105247_10000540 Ga0105247_100005409 529
653 3300009148 Ga0105243_10000013 Ga0105243_10000013144 529
654 3300025728 Ga0207655_1003690 Ga0207655_10036906 529
655 3300025728 Ga0207655_1003969 Ga0207655_10039695 529
656 3300025728 Ga0207655_1036336 Ga0207655_10363361 529
657 3300025735 Ga0207713_1006461 Ga0207713_10064617 529
658 3300025900 Ga0207710_10000005 Ga0207710_10000005132 529
659 3300025923 Ga0207681_10055011 Ga0207681_100550112 529
660 3300025929 Ga0207664_10011079 Ga0207664_100110791 529
661 3300025935 Ga0207709_10000001 Ga0207709_10000001140 529
662 3300025961 Ga0207712_10016898 Ga0207712_100168984 529
663 3300025986 Ga0207658_10149676 Ga0207658_101496761 529
664 3300026095 Ga0207676_10058351 Ga0207676_100583513 529
665 3300027312 Ga0209371_1000008 Ga0209371_1000008810 529
666 3300028379 Ga0268266_10051032 Ga0268266_100510324 529
667 3300030500 Ga0268256_1000009 Ga0268256_1000009810 529
668 3300031595 Ga0265313_10000004 Ga0265313_1000000469 529
669 3300031691 Ga0316579_10011392 Ga0316579_100113923 529
670 3300031691 Ga0316579_10019648 Ga0316579_100196482 529
671 3300031727 Ga0316576_10000479 Ga0316576_1000047917 529
672 3300031728 Ga0316578_10021721 Ga0316578_100217214 529
673 3300031728 Ga0316578_10094147 Ga0316578_100941471 529
674 3300031733 Ga0316577_10029526 Ga0316577_100295262 529
675 3300031733 Ga0316577_10036451 Ga0316577_100364511 529
676 3300032139 Ga0316580_10000319 Ga0316580_1000031910 529
677 3300032139 Ga0316580_10003240 Ga0316580_100032404 529
678 3300032139 Ga0316580_10008215 Ga0316580_100082153 529
679 3300032139 Ga0316580_10011392 Ga0316580_100113922 529
680 3300033524 Ga0316592_1000685 Ga0316592_10006853 529
681 3300033528 Ga0316588_1004722 Ga0316588_10047221 529
682 3300033541 Ga0316596_1000647 Ga0316596_10006476 529
683 3300035398 Ga0316574_0000243 Ga0316574_0000243_4754_6373 529
684 3300035398 Ga0316574_0014766 Ga0316574_0014766_1551_3221 529
685 3300035398 Ga0316574_0022521 Ga0316574_0022521_1980_3611 529
686 3300036647 Ga0316582_0001269 Ga0316582_0001269_8104_9774 529
687 3300036647 Ga0316582_0017585 Ga0316582_0017585_2000_3631 529
688 3300036712 Ga0316584_0025404 Ga0316584_0025404_1511_3196 529
689 3300036712 Ga0316584_0066105 Ga0316584_0066105_696_2318 529
690 3300036712 Ga0316584_0072089 Ga0316584_0072089_228_1859 529
691 3300039062 Ga0400483_169513 Ga0400483_169513_539_2161 529
692 3300039110 Ga0400487_20689 Ga0400487_20689_7506_9125 529
693 3300044712 Ga0453684_0005291 Ga0453684_0005291_15513_17135 529
694 3300049570 Ga0501033_0002742 Ga0501033_0002742_12136_13758 529
695 3300049571 Ga0501034_0033359 Ga0501034_0033359_3164_4786 529
696 3300049573 Ga0501037_0012887 Ga0501037_0012887_1625_3247 529
697 3300049579 Ga0501043_0008855 Ga0501043_0008855_3109_4731 529
698 3300049581 Ga0501047_0056016 Ga0501047_0056016_1664_3286 529
699 3300049589 Ga0501073_0001320 Ga0501073_0001320_4753_6375 529
700 3300049590 Ga0501074_0034332 Ga0501074_0034332_47_1669 529
701 3300049742 Ga0501080_0008771 Ga0501080_0008771_2365_3987 529
702 iso_pu_bacteria 2551306352 2552746839 529
703 iso_pu_bacteria 2639762793 2640735243 529
704 iso_pu_bacteria 2773857770 2774436426 529
705 3300002737 JGI25162J39368_1000003 JGI25162J39368_1000003134 530
706 3300002771 JGI25163J39215_1000026 JGI25163J39215_100002633 530
707 3300002772 JGI25164J39214_1000009 JGI25164J39214_1000009157 530
708 3300003751 Ga0055538_1000005 Ga0055538_1000005134 530
709 3300003752 Ga0055539_1000007 Ga0055539_1000007134 530
710 3300003756 Ga0055533_1000009 Ga0055533_1000009134 530
711 3300003759 Ga0055525_1000010 Ga0055525_1000010134 530
712 3300003841 Ga0055541_1000005 Ga0055541_1000005430 530
713 3300005289 Ga0065704_10000444 Ga0065704_1000044481 530
714 3300009011 Ga0105251_10003243 Ga0105251_100032436 530
715 3300009011 Ga0105251_10005047 Ga0105251_100050472 530
716 3300009011 Ga0105251_10005052 Ga0105251_100050522 530
717 3300009011 Ga0105251_10019862 Ga0105251_100198623 530
718 3300009036 Ga0105244_10000031 Ga0105244_1000003198 530
719 3300009036 Ga0105244_10001014 Ga0105244_1000101418 530
720 3300009036 Ga0105244_10002328 Ga0105244_100023287 530
721 3300009092 Ga0105250_10000048 Ga0105250_1000004868 530
722 3300009092 Ga0105250_10000433 Ga0105250_100004333 530
723 3300009092 Ga0105250_10003490 Ga0105250_100034904 530
724 3300009101 Ga0105247_10000048 Ga0105247_1000004875 530
725 3300009174 Ga0105241_10000011 Ga0105241_10000011191 530
726 3300013100 Ga0157373_10003274 Ga0157373_100032742 530
727 3300013102 Ga0157371_10000007 Ga0157371_10000007114 530
728 3300013104 Ga0157370_10000572 Ga0157370_1000057217 530
729 3300014497 Ga0182008_10001519 Ga0182008_1000151910 530
730 3300017792 Ga0163161_10000005 Ga0163161_10000005209 530
731 3300025207 Ga0209760_100069 Ga0209760_10006978 530
732 3300025224 Ga0209784_100001 Ga0209784_100001680 530
733 3300025225 Ga0209566_100001 Ga0209566_100001680 530
734 3300025226 Ga0209674_100002 Ga0209674_100002680 530
735 3300025230 Ga0209563_100008 Ga0209563_100008683 530
736 3300025231 Ga0207427_100002 Ga0207427_100002597 530
737 3300025233 Ga0209437_100007 Ga0209437_100007135 530
738 3300025253 Ga0209677_100004 Ga0209677_100004683 530
739 3300025261 Ga0209233_1002485 Ga0209233_10024852 530
740 3300025711 Ga0207696_1000004 Ga0207696_100000466 530
741 3300025711 Ga0207696_1000039 Ga0207696_100003985 530
742 3300025711 Ga0207696_1000688 Ga0207696_100068821 530
743 3300025728 Ga0207655_1000029 Ga0207655_100002971 530
744 3300025728 Ga0207655_1000078 Ga0207655_1000078126 530
745 3300025728 Ga0207655_1001509 Ga0207655_100150916 530
746 3300025735 Ga0207713_1000086 Ga0207713_100008669 530
747 3300025735 Ga0207713_1002512 Ga0207713_10025126 530
748 3300025735 Ga0207713_1004318 Ga0207713_10043188 530
749 3300025900 Ga0207710_10000026 Ga0207710_1000002669 530
750 3300025911 Ga0207654_10000012 Ga0207654_10000012191 530
751 3300027111 Ga0209281_1000184 Ga0209281_100018470 530
752 3300031727 Ga0316576_10005569 Ga0316576_100055692 530
753 3300031727 Ga0316576_10063353 Ga0316576_100633532 530
754 3300031728 Ga0316578_10001696 Ga0316578_100016963 530
755 3300031733 Ga0316577_10000204 Ga0316577_100002048 530
756 3300031733 Ga0316577_10006901 Ga0316577_100069014 530
757 3300032137 Ga0316585_10000009 Ga0316585_1000000928 530
758 3300036647 Ga0316582_0001388 Ga0316582_0001388_1118_2749 530
759 3300036712 Ga0316584_0004957 Ga0316584_0004957_6339_7970 530
760 3300039062 Ga0400483_049231 Ga0400483_049231_351_1973 530
761 3300044712 Ga0453684_0007674 Ga0453684_0007674_3689_5326 530
762 3300046453 Ga0495627_000128 Ga0495627_000128_19654_21255 530
763 3300046458 Ga0495591_000293 Ga0495591_000293_25485_27086 530
764 3300046471 Ga0495650_0000016 Ga0495650_0000016_550631_552232 530
765 3300046471 Ga0495650_0000149 Ga0495650_0000149_119366_120967 530
766 3300046507 Ga0495606_0001713 Ga0495606_0001713_6254_7855 530
767 3300046522 Ga0495643_0046000 Ga0495643_0046000_346_1947 530
768 3300046523 Ga0495644_0005922 Ga0495644_0005922_1886_3487 530
769 3300046524 Ga0495648_0012725 Ga0495648_0012725_784_2385 530
770 3300046530 Ga0495654_0000055 Ga0495654_0000055_31624_33225 530
771 3300046530 Ga0495654_0003774 Ga0495654_0003774_1639_3240 530
772 3300046794 Ga0495589_0000040 Ga0495589_0000040_56988_58589 530
773 3300046810 Ga0495660_0000007 Ga0495660_0000007_481231_482832 530
774 3300046810 Ga0495660_0000017 Ga0495660_0000017_280130_281731 530
775 3300047320 Ga0495672_0000001 Ga0495672_0000001_1418132_1419733 530
776 3300047469 Ga0495673_0000019 Ga0495673_0000019_513939_515540 530
777 3300047470 Ga0495681_0010935 Ga0495681_0010935_2558_4195 530
778 3300048906 Ga0496103_0018552 Ga0496103_0018552_836_2437 530
779 3300048907 Ga0496104_0000598 Ga0496104_0000598_422_2023 530
780 3300048919 Ga0496116_0000007 Ga0496116_0000007_729476_731077 530
781 3300048919 Ga0496116_0000886 Ga0496116_0000886_33281_34882 530
782 3300048920 Ga0496117_0000422 Ga0496117_0000422_5433_7034 530
783 3300048920 Ga0496117_0004828 Ga0496117_0004828_63_1664 530
784 3300048921 Ga0496118_0001555 Ga0496118_0001555_31359_32960 530
785 3300048921 Ga0496118_0007584 Ga0496118_0007584_2465_4066 530
786 3300048921 Ga0496118_0026044 Ga0496118_0026044_2339_3940 530
787 3300048922 Ga0496119_0000214 Ga0496119_0000214_12421_14022 530
788 3300048923 Ga0496120_0000064 Ga0496120_0000064_66129_67730 530
789 3300048925 Ga0496122_0001842 Ga0496122_0001842_2464_4065 530
790 3300048926 Ga0496123_0001505 Ga0496123_0001505_28248_29849 530
791 3300048927 Ga0496124_0000010 Ga0496124_0000010_312506_314107 530
792 3300048927 Ga0496124_0000049 Ga0496124_0000049_189332_190933 530
793 3300048928 Ga0496125_0000019 Ga0496125_0000019_470850_472451 530
794 3300048929 Ga0496126_0001458 Ga0496126_0001458_2154_3755 530
795 3300049459 Ga0495678_001704 Ga0495678_001704_14624_16225 530
796 3300049460 Ga0495682_0000011 Ga0495682_0000011_50396_51997 530
797 3300049573 Ga0501037_0002564 Ga0501037_0002564_4313_5917 530
798 3300049580 Ga0501046_0001861 Ga0501046_0001861_3599_5203 530
799 3300049585 Ga0501069_0037065 Ga0501069_0037065_529_2133 530
800 3300049591 Ga0501075_0007483 Ga0501075_0007483_4738_6342 530
801 3300053126 Ga0500621_000005 Ga0500621_000005_279529_281130 530
802 iso_pu_bacteria 2506520007 2506579955 530
803 iso_pu_bacteria 2506520008 2506585094 530
804 iso_pu_bacteria 2508501071 2508853746 530
805 iso_pu_bacteria 2511231024 2511375571 530
806 iso_pu_bacteria 2554235231 2555244589 530
807 iso_pu_bacteria 2585427591 2585828378 530
808 iso_pu_bacteria 2585427592 2585831434 530
809 iso_pu_bacteria 2654587920 2656275625 530
810 iso_pu_bacteria 2667528173 2671108534 530
811 iso_pu_bacteria 2687453601 2689446495 530
812 iso_pu_bacteria 2765235841 2765585702 530
813 iso_pu_bacteria 2772190666 2772440382 530
814 iso_pu_bacteria 2806310673 2807177325 530
815 iso_pu_bacteria 2919155634 2919159275 530
816 iso_pu_bacteria 2932406140 2932409134 530
817 iso_pu_bacteria 2937967321 2937971877 530
818 iso_pu_bacteria 2939577877 2939582458 530
819 iso_pu_bacteria 3007803356 3007808420 530
820 iso_pu_bacteria 3007872151 3007875419 530
821 iso_pu_bacteria 640753048 640939228 530
822 iso_pu_bacteria 8004592986 8004594679 530
823 iso_pu_bacteria 8015394850 8015399268 530
824 iso_pu_bacteria 8052494512 8052495663 530
825 iso_pu_bacteria 8054929484 8054933229 530
826 iso_pu_bacteria 8055087960 8055089842 530
827 iso_pu_bacteria 8055693939 8055694971 530
828 iso_pu_bacteria 8056137416 8056138567 530
829 3300006946 Ga0079104_1008605 Ga0079104_10086052 531
830 3300031727 Ga0316576_10095809 Ga0316576_100958092 531
831 3300032168 Ga0316593_10019209 Ga0316593_100192091 531
832 3300033541 Ga0316596_1000021 Ga0316596_100002115 531
833 3300035398 Ga0316574_0033913 Ga0316574_0033913_731_2365 531
834 3300038725 Ga0400484_14499 Ga0400484_14499_1277_2896 531
835 3300038725 Ga0400484_38937 Ga0400484_38937_11408_13084 531
836 3300038725 Ga0400484_40435 Ga0400484_40435_2701_4320 531
837 3300038726 Ga0400490_05485 Ga0400490_05485_26225_27844 531
838 3300038726 Ga0400490_37780 Ga0400490_37780_27578_29197 531
839 3300038726 Ga0400490_42866 Ga0400490_42866_222_1841 531
840 3300038726 Ga0400490_47679 Ga0400490_47679_970_2589 531
841 3300038727 Ga0400491_04720 Ga0400491_04720_413_2032 531
842 3300038727 Ga0400491_06102 Ga0400491_06102_1615_3234 531
843 3300038735 Ga0400485_07750 Ga0400485_07750_71995_73614 531
844 3300038735 Ga0400485_16880 Ga0400485_16880_6467_8086 531
845 3300038741 Ga0400488_01902 Ga0400488_01902_2167_3786 531
846 3300038741 Ga0400488_59715 Ga0400488_59715_238_1857 531
847 3300038742 Ga0400486_04085 Ga0400486_04085_5021_6640 531
848 3300038742 Ga0400486_15402 Ga0400486_15402_10345_11964 531
849 3300038742 Ga0400486_15788 Ga0400486_15788_8526_10145 531
850 3300038742 Ga0400486_32041 Ga0400486_32041_169_1788 531
851 3300039062 Ga0400483_015695 Ga0400483_015695_1471_3090 531
852 3300039062 Ga0400483_067590 Ga0400483_067590_38146_39753 531
853 3300039062 Ga0400483_108103 Ga0400483_108103_6648_8267 531
854 3300039062 Ga0400483_146661 Ga0400483_146661_33343_34962 531
855 3300039062 Ga0400483_155721 Ga0400483_155721_617_2236 531
856 3300039062 Ga0400483_162357 Ga0400483_162357_3691_5310 531
857 3300039062 Ga0400483_208313 Ga0400483_208313_160_1779 531
858 3300039062 Ga0400483_211867 Ga0400483_211867_1591_3210 531
859 3300039062 Ga0400483_212256 Ga0400483_212256_9967_11586 531
860 3300039062 Ga0400483_218030 Ga0400483_218030_7592_9211 531
861 3300039110 Ga0400487_18391 Ga0400487_18391_3176_4795 531
862 3300039110 Ga0400487_24791 Ga0400487_24791_60980_62599 531
863 3300039110 Ga0400487_26493 Ga0400487_26493_6345_7964 531
864 3300044712 Ga0453684_0000006 Ga0453684_0000006_630410_632029 531
865 3300044712 Ga0453684_0000031 Ga0453684_0000031_410771_412384 531
866 3300049574 Ga0501038_0003639 Ga0501038_0003639_11357_12976 531
867 3300049589 Ga0501073_0123389 Ga0501073_0123389_65_1684 531
868 3300049590 Ga0501074_0001273 Ga0501074_0001273_8783_10402 531
869 3300049742 Ga0501080_0021925 Ga0501080_0021925_2526_4145 531
870 iso_pu_bacteria 2565956521 2566036468 531
871 iso_pu_bacteria 2643221713 2644623656 531
872 iso_pu_bacteria 2738541294 2738809497 531
873 iso_pu_bacteria 2738541309 2738896857 531
874 iso_pu_bacteria 2881714928 2881715360 531
875 iso_pu_bacteria 2919063839 2919064322 531
876 iso_pu_bacteria 2919493220 2919496817 531
877 iso_pu_bacteria 2919543075 2919546390 531
878 iso_pu_bacteria 2923525760 2923529942 531
879 iso_pu_bacteria 8057798959 8057803724 531
880 3300003323 rootH1_10014691 rootH1_1001469119 532
881 3300003323 rootH1_10147070 rootH1_101470707 532
882 3300003856 Ga0058692_1001110 Ga0058692_100111011 532
883 3300003856 Ga0058692_1001965 Ga0058692_10019656 532
884 3300003856 Ga0058692_1005488 Ga0058692_10054882 532
885 3300027312 Ga0209371_1001966 Ga0209371_10019666 532
886 3300027312 Ga0209371_1003503 Ga0209371_10035034 532
887 3300030500 Ga0268256_1001952 Ga0268256_10019527 532
888 3300030500 Ga0268256_1003207 Ga0268256_10032074 532
889 3300030500 Ga0268256_1011975 Ga0268256_10119751 532
890 3300031548 Ga0307408_100001669 Ga0307408_10000166917 532
891 3300031548 Ga0307408_100002529 Ga0307408_10000252910 532
892 3300031665 Ga0316575_10019157 Ga0316575_100191573 532
893 3300031728 Ga0316578_10047827 Ga0316578_100478273 532
894 3300031824 Ga0307413_10032676 Ga0307413_100326762 532
895 3300031901 Ga0307406_10001631 Ga0307406_100016314 532
896 3300032168 Ga0316593_10002145 Ga0316593_100021455 532
897 3300035398 Ga0316574_0004491 Ga0316574_0004491_62_1690 532
898 3300036647 Ga0316582_0009738 Ga0316582_0009738_47_1675 532
899 3300036647 Ga0316582_0018704 Ga0316582_0018704_381_2009 532
900 3300036647 Ga0316582_0032839 Ga0316582_0032839_766_2376 532
901 3300036712 Ga0316584_0008822 Ga0316584_0008822_4764_6392 532
902 3300036712 Ga0316584_0120222 Ga0316584_0120222_143_1786 532
903 3300039062 Ga0400483_004725 Ga0400483_004725_65635_67266 532
904 3300039062 Ga0400483_066147 Ga0400483_066147_977_2608 532
905 3300039062 Ga0400483_169970 Ga0400483_169970_6481_8112 532
906 3300046452 Ga0495617_008387 Ga0495617_008387_1150_2757 532
907 3300046458 Ga0495591_000001 Ga0495591_000001_9801_11408 532
908 3300046530 Ga0495654_0000033 Ga0495654_0000033_151518_153125 532
909 3300049571 Ga0501034_0058320 Ga0501034_0058320_1894_3531 532
910 3300049576 Ga0501040_0000283 Ga0501040_0000283_24541_26292 532
911 3300049578 Ga0501042_0010878 Ga0501042_0010878_195_1946 532
912 iso_pu_bacteria 2510065053 2510284909 532
913 iso_pu_bacteria 2510065058 2510312287 532
914 iso_pu_bacteria 2511231035 2511433423 532
915 iso_pu_bacteria 2648501241 2649121332 532
916 iso_pu_bacteria 2651869818 2652974551 532
917 iso_pu_bacteria 2690315857 2691330968 532
918 iso_pu_bacteria 2773857672 2774132323 532
919 iso_pu_bacteria 2791355275 2793404542 532
920 iso_pu_bacteria 2891670763 2891675282 532
921 iso_pu_bacteria 2908669403 2908672745 532
922 iso_pu_bacteria 2917832318 2917834058 532
923 iso_pu_bacteria 2919125081 2919127637 532
924 iso_pu_bacteria 2919534386 2919534523 532
925 iso_pu_bacteria 2939602548 2939604301 532
926 iso_pu_bacteria 2974298342 2974298750 532
927 iso_pu_bacteria 2984499530 2984501043 532
928 iso_pu_bacteria 2984504281 2984505510 532
929 iso_pu_bacteria 8054849141 8054852210 532
930 3300021361 Ga0213872_10000888 Ga0213872_1000088815 533
931 3300021361 Ga0213872_10001442 Ga0213872_1000144210 533
932 3300021361 Ga0213872_10005001 Ga0213872_100050017 533
933 3300036647 Ga0316582_0006919 Ga0316582_0006919_3800_5434 533
934 3300036647 Ga0316582_0057372 Ga0316582_0057372_227_1861 533
935 3300039447 Ga0436361_0251195 Ga0436361_0251195_7028_8644 533
936 3300039447 Ga0436361_0539675 Ga0436361_0539675_314_1933 533
937 3300045836 Ga0466958_0004044 Ga0466958_0004044_3225_4844 533
938 3300046665 Ga0495661_0000304 Ga0495661_0000304_48145_49746 533
939 iso_pu_bacteria 2511231025 2511378231 533
940 iso_pu_bacteria 2547132181 2547697790 533
941 iso_pu_bacteria 2547132416 2548648851 533
942 iso_pu_bacteria 2554235234 2555260090 533
943 iso_pu_bacteria 2561511199 2562463865 533
944 iso_pu_bacteria 2599185169 2599412514 533
945 iso_pu_bacteria 2600255254 2601524043 533
946 iso_pu_bacteria 2600255255 2601529197 533
947 iso_pu_bacteria 2600255256 2601536293 533
948 iso_pu_bacteria 2600255257 2601541601 533
949 iso_pu_bacteria 2600255280 2601616031 533
950 iso_pu_bacteria 2600255281 2601620756 533
951 iso_pu_bacteria 2600255287 2601644095 533
952 iso_pu_bacteria 2600255288 2601649153 533
953 iso_pu_bacteria 2600255289 2601654080 533
954 iso_pu_bacteria 2600255290 2601659502 533
955 iso_pu_bacteria 2600255291 2601663920 533
956 iso_pu_bacteria 2600255298 2601696877 533
957 iso_pu_bacteria 2600255299 2601701926 533
958 iso_pu_bacteria 2600255300 2601706824 533
959 iso_pu_bacteria 2600255301 2601712225 533
960 iso_pu_bacteria 2600255302 2601717341 533
961 iso_pu_bacteria 2600255303 2601722394 533
962 iso_pu_bacteria 2600255304 2601727269 533
963 iso_pu_bacteria 2600255305 2601732666 533
964 iso_pu_bacteria 2600255306 2601736819 533
965 iso_pu_bacteria 2600255307 2601743241 533
966 iso_pu_bacteria 2600255309 2601754035 533
967 iso_pu_bacteria 2600255310 2601760024 533
968 iso_pu_bacteria 2600255311 2601765362 533
969 iso_pu_bacteria 2600255392 2602021129 533
970 iso_pu_bacteria 2602042046 2603636569 533
971 iso_pu_bacteria 2602042047 2603645650 533
972 iso_pu_bacteria 2602042052 2603662076 533
973 iso_pu_bacteria 2602042053 2603666975 533
974 iso_pu_bacteria 2602042066 2603699559 533
975 iso_pu_bacteria 2602042067 2603705618 533
976 iso_pu_bacteria 2602042103 2603839693 533
977 iso_pu_bacteria 2602042104 2603844767 533
978 iso_pu_bacteria 2602042105 2603850226 533
979 iso_pu_bacteria 2602042106 2603854910 533
980 iso_pu_bacteria 2602042109 2603867664 533
981 iso_pu_bacteria 2602042110 2603872486 533
982 iso_pu_bacteria 2602042111 2603877787 533
983 iso_pu_bacteria 2603880178 2606050055 533
984 iso_pu_bacteria 2603880184 2606071720 533
985 iso_pu_bacteria 2603880202 2606147353 533
986 iso_pu_bacteria 2603880211 2606177945 533
987 iso_pu_bacteria 2608642108 2608670255 533
988 iso_pu_bacteria 2609459761 2609909371 533
989 iso_pu_bacteria 2636415599 2637223852 533
990 iso_pu_bacteria 2667528172 2671105407 533
991 iso_pu_bacteria 2675903046 2676405257 533
992 iso_pu_bacteria 2681812866 2681994852 533
993 iso_pu_bacteria 2681812869 2682006671 533
994 iso_pu_bacteria 2711768156 2712472715 533
995 iso_pu_bacteria 2751185917 2753857150 533
996 iso_pu_bacteria 2765235842 2765590249 533
997 iso_pu_bacteria 2775506706 2775541006 533
998 iso_pu_bacteria 2775507074 2777023168 533
999 iso_pu_bacteria 2791354903 2791922693 533
1000 iso_pu_bacteria 2791355010 2792311761 533
1001 iso_pu_bacteria 2806310737 2807406913 533
1002 iso_pu_bacteria 2806310745 2807455245 533
1003 iso_pu_bacteria 2811995292 2813727582 533
1004 iso_pu_bacteria 2814123068 2814695129 533
1005 iso_pu_bacteria 2821118458 2821121286 533
1006 iso_pu_bacteria 2823373977 2823375902 533
1007 iso_pu_bacteria 2844425489 2844428592 533
1008 iso_pu_bacteria 2844528606 2844529383 533
1009 iso_pu_bacteria 2847797336 2847798687 533
1010 iso_pu_bacteria 2865014394 2865017195 533
1011 iso_pu_bacteria 2876601092 2876603020 533
1012 iso_pu_bacteria 2884086401 2884087586 533
1013 iso_pu_bacteria 2904513164 2904517901 533
1014 iso_pu_bacteria 2916178963 2916180386 533
1015 iso_pu_bacteria 2919108558 2919111216 533
1016 iso_pu_bacteria 2919497567 2919498728 533
1017 iso_pu_bacteria 2923634449 2923636148 533
1018 iso_pu_bacteria 2927833300 2927837362 533
1019 iso_pu_bacteria 2935625433 2935625446 533
1020 iso_pu_bacteria 2937539931 2937542191 533
1021 iso_pu_bacteria 2939568625 2939570244 533
1022 iso_pu_bacteria 2939573065 2939575686 533
1023 iso_pu_bacteria 2939607340 2939608452 533
1024 iso_pu_bacteria 2939617950 2939618815 533
1025 iso_pu_bacteria 2939642701 2939642713 533
1026 iso_pu_bacteria 2945874760 2945876504 533
1027 iso_pu_bacteria 2945951305 2945951886 533
1028 iso_pu_bacteria 2969079654 2969080863 533
1029 iso_pu_bacteria 2971820967 2971822259 533
1030 iso_pu_bacteria 2974310843 2974310860 533
1031 iso_pu_bacteria 2974435778 2974439623 533
1032 iso_pu_bacteria 2984559226 2984563324 533
1033 iso_pu_bacteria 2984595703 2984596059 533
1034 iso_pu_bacteria 3000376612 3000378095 533
1035 iso_pu_bacteria 8016733728 8016734816 533
1036 iso_pu_bacteria 8018405270 8018409011 533
1037 iso_pu_bacteria 8019499862 8019501697 533
1038 iso_pu_bacteria 8019504834 8019504847 533
1039 iso_pu_bacteria 8055092621 8055095730 533
1040 iso_pu_bacteria 8055097453 8055100478 533
1041 iso_pu_bacteria 8056115690 8056117429 533
1042 iso_pu_bacteria 8056120720 8056124785 533
1043 iso_pu_bacteria 8057304971 8057306507 533
1044 3300005289 Ga0065704_10103689 Ga0065704_101036892 534
1045 3300005289 Ga0065704_10121991 Ga0065704_101219911 534
1046 3300006051 Ga0075364_10032810 Ga0075364_100328102 534
1047 3300009011 Ga0105251_10003460 Ga0105251_100034608 534
1048 3300009036 Ga0105244_10005910 Ga0105244_100059107 534
1049 3300009036 Ga0105244_10020345 Ga0105244_100203453 534
1050 3300009036 Ga0105244_10020480 Ga0105244_100204802 534
1051 3300009036 Ga0105244_10021545 Ga0105244_100215453 534
1052 3300009036 Ga0105244_10040502 Ga0105244_100405021 534
1053 3300009092 Ga0105250_10000982 Ga0105250_100009824 534
1054 3300009148 Ga0105243_10043323 Ga0105243_100433231 534
1055 3300013104 Ga0157370_10046862 Ga0157370_100468624 534
1056 3300013307 Ga0157372_10000815 Ga0157372_1000081525 534
1057 3300025292 Ga0209676_1000721 Ga0209676_100072129 534
1058 3300025711 Ga0207696_1000022 Ga0207696_100002297 534
1059 3300025711 Ga0207696_1000452 Ga0207696_100045225 534
1060 3300025711 Ga0207696_1005554 Ga0207696_10055541 534
1061 3300025711 Ga0207696_1012431 Ga0207696_10124314 534
1062 3300025728 Ga0207655_1000240 Ga0207655_100024041 534
1063 3300025728 Ga0207655_1000516 Ga0207655_100051640 534
1064 3300025728 Ga0207655_1004830 Ga0207655_100483010 534
1065 3300025728 Ga0207655_1005936 Ga0207655_10059366 534
1066 3300025728 Ga0207655_1020047 Ga0207655_10200472 534
1067 3300025728 Ga0207655_1025031 Ga0207655_10250312 534
1068 3300025735 Ga0207713_1000812 Ga0207713_10008122 534
1069 3300025735 Ga0207713_1003887 Ga0207713_10038878 534
1070 3300025735 Ga0207713_1015403 Ga0207713_10154032 534
1071 3300025935 Ga0207709_10047673 Ga0207709_100476731 534
1072 3300027111 Ga0209281_1000079 Ga0209281_1000079223 534
1073 3300027296 Ga0209389_1000002 Ga0209389_1000002257 534
1074 3300027312 Ga0209371_1000414 Ga0209371_100041441 534
1075 3300030500 Ga0268256_1000355 Ga0268256_100035541 534
1076 3300031665 Ga0316575_10017295 Ga0316575_100172951 534
1077 3300031665 Ga0316575_10022522 Ga0316575_100225222 534
1078 3300031691 Ga0316579_10007724 Ga0316579_100077241 534
1079 3300031728 Ga0316578_10002977 Ga0316578_100029774 534
1080 3300031733 Ga0316577_10011054 Ga0316577_100110541 534
1081 3300032137 Ga0316585_10000423 Ga0316585_100004237 534
1082 3300032139 Ga0316580_10001717 Ga0316580_100017173 534
1083 3300032168 Ga0316593_10005164 Ga0316593_100051642 534
1084 3300033528 Ga0316588_1002067 Ga0316588_10020673 534
1085 3300033541 Ga0316596_1001108 Ga0316596_10011083 534
1086 3300035398 Ga0316574_0001093 Ga0316574_0001093_3821_5467 534
1087 3300035398 Ga0316574_0017482 Ga0316574_0017482_329_1984 534
1088 3300036647 Ga0316582_0000155 Ga0316582_0000155_2749_4395 534
1089 3300036712 Ga0316584_0001910 Ga0316584_0001910_6940_8586 534
1090 3300042137 Ga0450902_000689 Ga0450902_000689_474_2078 534
1091 3300042142 Ga0450905_000074 Ga0450905_000074_5013_6617 534
1092 3300042533 Ga0450901_000212 Ga0450901_000212_874_2478 534
1093 3300046515 Ga0495620_0000013 Ga0495620_0000013_108772_110376 534
1094 3300046519 Ga0495632_0000217 Ga0495632_0000217_6612_8216 534
1095 3300046522 Ga0495643_0002001 Ga0495643_0002001_4446_6050 534
1096 3300046522 Ga0495643_0002058 Ga0495643_0002058_10493_12097 534
1097 3300046524 Ga0495648_0000491 Ga0495648_0000491_36024_37628 534
1098 3300046542 Ga0495597_0000319 Ga0495597_0000319_29346_30962 534
1099 3300046674 Ga0495588_0006984 Ga0495588_0006984_2749_4386 534
1100 3300047320 Ga0495672_0000156 Ga0495672_0000156_84703_86355 534
1101 3300047323 Ga0495683_0009108 Ga0495683_0009108_2004_3608 534
1102 3300047446 Ga0495679_000169 Ga0495679_000169_12562_14214 534
1103 3300048919 Ga0496116_0000283 Ga0496116_0000283_71616_73229 534
1104 3300048920 Ga0496117_0000833 Ga0496117_0000833_45693_47297 534
1105 3300048920 Ga0496117_0006498 Ga0496117_0006498_5653_7257 534
1106 3300048920 Ga0496117_0006832 Ga0496117_0006832_9160_10764 534
1107 3300048921 Ga0496118_0001807 Ga0496118_0001807_20514_22118 534
1108 3300048921 Ga0496118_0004616 Ga0496118_0004616_8649_10253 534
1109 3300048922 Ga0496119_0000112 Ga0496119_0000112_112308_113912 534
1110 3300048922 Ga0496119_0000573 Ga0496119_0000573_38893_40506 534
1111 3300048923 Ga0496120_0000035 Ga0496120_0000035_116294_117907 534
1112 3300048923 Ga0496120_0009793 Ga0496120_0009793_4715_6319 534
1113 3300048925 Ga0496122_0019568 Ga0496122_0019568_14_1618 534
1114 3300048926 Ga0496123_0000391 Ga0496123_0000391_26054_27658 534
1115 3300048927 Ga0496124_0011593 Ga0496124_0011593_6499_8103 534
1116 3300048927 Ga0496124_0013032 Ga0496124_0013032_6020_7624 534
1117 3300048927 Ga0496124_0104844 Ga0496124_0104844_60_1664 534
1118 3300048928 Ga0496125_0055167 Ga0496125_0055167_635_2239 534
1119 3300048928 Ga0496125_0056039 Ga0496125_0056039_977_2581 534
1120 3300048929 Ga0496126_0030629 Ga0496126_0030629_692_2296 534
1121 3300049571 Ga0501034_0000137 Ga0501034_0000137_94770_96374 534
1122 3300050491 nmdc:mga00v17_17981_c1 nmdc:mga00v17_17981_c1_2265_3881 534
1123 3300053135 Ga0500659_0002202 Ga0500659_0002202_6856_8460 534
1124 iso_pu_bacteria 2511231004 2511254426 534
1125 iso_pu_bacteria 2511231006 2511267877 534
1126 iso_pu_bacteria 2511231007 2511274283 534
1127 iso_pu_bacteria 2511231008 2511276421 534
1128 iso_pu_bacteria 2511231010 2511291888 534
1129 iso_pu_bacteria 2511231011 2511294986 534
1130 iso_pu_bacteria 2511231012 2511304399 534
1131 iso_pu_bacteria 2511231014 2511312891 534
1132 iso_pu_bacteria 2511231015 2511319162 534
1133 iso_pu_bacteria 2511231016 2511329309 534
1134 iso_pu_bacteria 2511231017 2511333078 534
1135 iso_pu_bacteria 2511231018 2511341257 534
1136 iso_pu_bacteria 2511231019 2511341800 534
1137 iso_pu_bacteria 2511231020 2511350899 534
1138 iso_pu_bacteria 2511231021 2511354633 534
1139 iso_pu_bacteria 2511231022 2511364931 534
1140 iso_pu_bacteria 2511231023 2511366927 534
1141 iso_pu_bacteria 2511231031 2511412245 534
1142 iso_pu_bacteria 2511231156 2511823400 534
1143 iso_pu_bacteria 2512047018 2512328994 534
1144 iso_pu_bacteria 2554235132 2554817015 534
1145 iso_pu_bacteria 2554235341 2555668425 534
1146 iso_pu_bacteria 2582580891 2583790629 534
1147 iso_pu_bacteria 2597489887 2597856608 534
1148 iso_pu_bacteria 2597489888 2597862709 534
1149 iso_pu_bacteria 2597489889 2597868551 534
1150 iso_pu_bacteria 2599185160 2599355425 534
1151 iso_pu_bacteria 2599185161 2599360756 534
1152 iso_pu_bacteria 2599185162 2599367078 534
1153 iso_pu_bacteria 2599185163 2599373868 534
1154 iso_pu_bacteria 2599185164 2599380531 534
1155 iso_pu_bacteria 2599185165 2599386978 534
1156 iso_pu_bacteria 2599185166 2599392726 534
1157 iso_pu_bacteria 2599185167 2599396688 534
1158 iso_pu_bacteria 2599185168 2599404493 534
1159 iso_pu_bacteria 2599185179 2599453252 534
1160 iso_pu_bacteria 2599185181 2599462259 534
1161 iso_pu_bacteria 2599185182 2599466699 534
1162 iso_pu_bacteria 2599185185 2599483142 534
1163 iso_pu_bacteria 2599185186 2599490649 534
1164 iso_pu_bacteria 2599185188 2599505301 534
1165 iso_pu_bacteria 2599185189 2599507669 534
1166 iso_pu_bacteria 2599185190 2599514584 534
1167 iso_pu_bacteria 2599185191 2599517485 534
1168 iso_pu_bacteria 2599185212 2599615491 534
1169 iso_pu_bacteria 2599185248 2599772789 534
1170 iso_pu_bacteria 2599185257 2599805043 534
1171 iso_pu_bacteria 2599185288 2599880026 534
1172 iso_pu_bacteria 2599185289 2599889285 534
1173 iso_pu_bacteria 2599185290 2599894151 534
1174 iso_pu_bacteria 2599185291 2599896607 534
1175 iso_pu_bacteria 2599185300 2599931855 534
1176 iso_pu_bacteria 2599185302 2599945506 534
1177 iso_pu_bacteria 2599185303 2599948527 534
1178 iso_pu_bacteria 2599185304 2599956624 534
1179 iso_pu_bacteria 2599185305 2599962562 534
1180 iso_pu_bacteria 2599185306 2599968374 534
1181 iso_pu_bacteria 2599185307 2599974098 534
1182 iso_pu_bacteria 2599185308 2599979561 534
1183 iso_pu_bacteria 2599185309 2599985454 534
1184 iso_pu_bacteria 2599185310 2599991795 534
1185 iso_pu_bacteria 2599185311 2599996617 534
1186 iso_pu_bacteria 2599185312 2600002408 534
1187 iso_pu_bacteria 2599185313 2600006825 534
1188 iso_pu_bacteria 2599185314 2600013373 534
1189 iso_pu_bacteria 2599185315 2600020080 534
1190 iso_pu_bacteria 2599185316 2600026083 534
1191 iso_pu_bacteria 2599185317 2600031727 534
1192 iso_pu_bacteria 2599185318 2600036370 534
1193 iso_pu_bacteria 2599185319 2600043669 534
1194 iso_pu_bacteria 2599185320 2600049941 534
1195 iso_pu_bacteria 2599185321 2600053463 534
1196 iso_pu_bacteria 2599185323 2600067111 534
1197 iso_pu_bacteria 2599185324 2600070451 534
1198 iso_pu_bacteria 2599185325 2600080061 534
1199 iso_pu_bacteria 2599185356 2600214881 534
1200 iso_pu_bacteria 2600254930 2600361502 534
1201 iso_pu_bacteria 2600254931 2600363756 534
1202 iso_pu_bacteria 2600254954 2600442972 534
1203 iso_pu_bacteria 2600255283 2601625742 534
1204 iso_pu_bacteria 2600255296 2601691280 534
1205 iso_pu_bacteria 2600255313 2601774414 534
1206 iso_pu_bacteria 2600255318 2601799909 534
1207 iso_pu_bacteria 2600255389 2602009552 534
1208 iso_pu_bacteria 2603880185 2606074292 534
1209 iso_pu_bacteria 2603880199 2606127154 534
1210 iso_pu_bacteria 2606217733 2608379666 534
1211 iso_pu_bacteria 2619619299 2621301160 534
1212 iso_pu_bacteria 2623620443 2624479192 534
1213 iso_pu_bacteria 2623620446 2624493807 534
1214 iso_pu_bacteria 2643221565 2643845205 534
1215 iso_pu_bacteria 2643221571 2643873068 534
1216 iso_pu_bacteria 2643221589 2643951969 534
1217 iso_pu_bacteria 2643221602 2644024272 534
1218 iso_pu_bacteria 2643221633 2644187533 534
1219 iso_pu_bacteria 2643221650 2644283573 534
1220 iso_pu_bacteria 2651869719 2652548243 534
1221 iso_pu_bacteria 2667528170 2671090482 534
1222 iso_pu_bacteria 2667528171 2671098027 534
1223 iso_pu_bacteria 2667528176 2671127786 534
1224 iso_pu_bacteria 2671180115 2671587110 534
1225 iso_pu_bacteria 2671180172 2671768223 534
1226 iso_pu_bacteria 2675903420 2677897324 534
1227 iso_pu_bacteria 2675903515 2678262326 534
1228 iso_pu_bacteria 2713897148 2715751729 534
1229 iso_pu_bacteria 2713897149 2715759719 534
1230 iso_pu_bacteria 2718217725 2718633060 534
1231 iso_pu_bacteria 2721755607 2723247580 534
1232 iso_pu_bacteria 2728369097 2729145908 534
1233 iso_pu_bacteria 2738541265 2738670142 534
1234 iso_pu_bacteria 2738541271 2738691560 534
1235 iso_pu_bacteria 2738541282 2738748535 534
1236 iso_pu_bacteria 2738541303 2738857577 534
1237 iso_pu_bacteria 2738543004 2739198709 534
1238 iso_pu_bacteria 2738543016 2739267335 534
1239 iso_pu_bacteria 2738543020 2739286212 534
1240 iso_pu_bacteria 2738543021 2739291525 534
1241 iso_pu_bacteria 2738543025 2739314343 534
1242 iso_pu_bacteria 2740892503 2743736032 534
1243 iso_pu_bacteria 2744054620 2745008673 534
1244 iso_pu_bacteria 2773857670 2774121401 534
1245 iso_pu_bacteria 2773857673 2774136034 534
1246 iso_pu_bacteria 2784132063 2784260104 534
1247 iso_pu_bacteria 2784132072 2784315711 534
1248 iso_pu_bacteria 2791355520 2794596124 534
1249 iso_pu_bacteria 2808606361 2808856807 534
1250 iso_pu_bacteria 2808606373 2808904671 534
1251 iso_pu_bacteria 2808606376 2808924088 534
1252 iso_pu_bacteria 2808606377 2808929281 534
1253 iso_pu_bacteria 2808606378 2808936744 534
1254 iso_pu_bacteria 2808606379 2808941645 534
1255 iso_pu_bacteria 2808606380 2808946029 534
1256 iso_pu_bacteria 2808606381 2808951611 534
1257 iso_pu_bacteria 2808606382 2808957413 534
1258 iso_pu_bacteria 2808606383 2808965194 534
1259 iso_pu_bacteria 2808606385 2808975646 534
1260 iso_pu_bacteria 2808606388 2808990715 534
1261 iso_pu_bacteria 2808606389 2809000086 534
1262 iso_pu_bacteria 2808606445 2809216145 534
1263 iso_pu_bacteria 2811994881 2812368123 534
1264 iso_pu_bacteria 2816332298 2817489486 534
1265 iso_pu_bacteria 2818991456 2819654592 534
1266 iso_pu_bacteria 2818991464 2819703112 534
1267 iso_pu_bacteria 2823421272 2823424601 534
1268 iso_pu_bacteria 2825651385 2825653319 534
1269 iso_pu_bacteria 2826581358 2826585727 534
1270 iso_pu_bacteria 2834028612 2834029408 534
1271 iso_pu_bacteria 2842805378 2842805617 534
1272 iso_pu_bacteria 2842815866 2842818597 534
1273 iso_pu_bacteria 2842826826 2842830205 534
1274 iso_pu_bacteria 2842832357 2842832986 534
1275 iso_pu_bacteria 2842837860 2842839981 534
1276 iso_pu_bacteria 2842843487 2842848398 534
1277 iso_pu_bacteria 2842849001 2842853819 534
1278 iso_pu_bacteria 2842854478 2842858934 534
1279 iso_pu_bacteria 2844665904 2844668939 534
1280 iso_pu_bacteria 2852612431 2852615112 534
1281 iso_pu_bacteria 2852657418 2852658666 534
1282 iso_pu_bacteria 2852667396 2852670080 534
1283 iso_pu_bacteria 2860339153 2860340300 534
1284 iso_pu_bacteria 2860867994 2860869413 534
1285 iso_pu_bacteria 2878029506 2878031153 534
1286 iso_pu_bacteria 2880230671 2880232051 534
1287 iso_pu_bacteria 2904518522 2904522414 534
1288 iso_pu_bacteria 2904550169 2904551557 534
1289 iso_pu_bacteria 2908446538 2908448316 534
1290 iso_pu_bacteria 2912963787 2912967966 534
1291 iso_pu_bacteria 2913036834 2913038301 534
1292 iso_pu_bacteria 2917070673 2917072193 534
1293 iso_pu_bacteria 2919385768 2919386179 534
1294 iso_pu_bacteria 2919456309 2919462050 534
1295 iso_pu_bacteria 2919481497 2919481570 534
1296 iso_pu_bacteria 2919487758 2919491739 534
1297 iso_pu_bacteria 2919501602 2919504331 534
1298 iso_pu_bacteria 2919697872 2919700288 534
1299 iso_pu_bacteria 2923153595 2923155042 534
1300 iso_pu_bacteria 2923519811 2923522176 534
1301 iso_pu_bacteria 2923586266 2923587582 534
1302 iso_pu_bacteria 2926063275 2926065096 534
1303 iso_pu_bacteria 2929144301 2929145742 534
1304 iso_pu_bacteria 2929189879 2929191394 534
1305 iso_pu_bacteria 2931369376 2931370921 534
1306 iso_pu_bacteria 2931390751 2931392413 534
1307 iso_pu_bacteria 2931396565 2931399794 534
1308 iso_pu_bacteria 2935353572 2935354364 534
1309 iso_pu_bacteria 2939636861 2939637737 534
1310 iso_pu_bacteria 2939651529 2939652395 534
1311 iso_pu_bacteria 2945928738 2945929181 534
1312 iso_pu_bacteria 2945961074 2945961678 534
1313 iso_pu_bacteria 2946006987 2946011420 534
1314 iso_pu_bacteria 2946027586 2946029617 534
1315 iso_pu_bacteria 2947233263 2947236223 534
1316 iso_pu_bacteria 2969304461 2969305980 534
1317 iso_pu_bacteria 2974289157 2974292434 534
1318 iso_pu_bacteria 2984286254 2984290998 534
1319 iso_pu_bacteria 2988728565 2988733281 534
1320 iso_pu_bacteria 2990196909 2990198331 534
1321 iso_pu_bacteria 2998139840 2998141387 534
1322 iso_pu_bacteria 3007252601 3007253701 534
1323 iso_pu_bacteria 3007315729 3007317526 534
1324 iso_pu_bacteria 3007395558 3007400572 534
1325 iso_pu_bacteria 3007419365 3007420837 534
1326 iso_pu_bacteria 3007511990 3007512766 534
1327 iso_pu_bacteria 3007614139 3007616231 534
1328 iso_pu_bacteria 3007619802 3007620458 534
1329 iso_pu_bacteria 3007718800 3007723040 534
1330 iso_pu_bacteria 3007855910 3007855981 534
1331 iso_pu_bacteria 3007861166 3007863381 534
1332 iso_pu_bacteria 3007866637 3007867933 534
1333 iso_pu_bacteria 651053060 651175054 534
1334 iso_pu_bacteria 8011350971 8011353188 534
1335 iso_pu_bacteria 8015687852 8015689264 534
1336 iso_pu_bacteria 8019769354 8019770977 534
1337 iso_pu_bacteria 8019775933 8019776943 534
1338 iso_pu_bacteria 8029995093 8029999363 534
1339 iso_pu_bacteria 8034962539 8034962585 534
1340 iso_pu_bacteria 8054285046 8054288748 534
1341 iso_pu_bacteria 8054347763 8054351839 534
1342 iso_pu_bacteria 8054503363 8054504956 534
1343 iso_pu_bacteria 8054844752 8054846889 534
1344 iso_pu_bacteria 8055770955 8055772380 534
1345 iso_pu_bacteria 8055817908 8055819434 534
1346 iso_pu_bacteria 8055878733 8055884054 534
1347 iso_pu_bacteria 8056125926 8056127428 534
1348 iso_pu_bacteria 8056131705 8056133332 534
1349 iso_pu_bacteria 8056143049 8056147534 534
1350 iso_pu_bacteria 8056148874 8056149578 534
1351 iso_pu_bacteria 8056155041 8056159381 534
1352 iso_pu_bacteria 8056161164 8056164737 534
1353 iso_pu_bacteria 8056166840 8056169673 534
1354 iso_pu_bacteria 8056172158 8056175782 534
1355 iso_pu_bacteria 8056177738 8056180231 534
1356 iso_pu_bacteria 8056569372 8056570049 534
1357 2162886007 SwRhRL2b_contig_2166766 SwRhRL2b_0754.00007130 535
1358 2162886007 SwRhRL2b_contig_2174536 SwRhRL2b_0265.00006460 535
1359 3300002773 JGI25152J39213_1000449 JGI25152J39213_100044914 535
1360 3300003856 Ga0058692_1000186 Ga0058692_10001866 535
1361 3300003856 Ga0058692_1000818 Ga0058692_10008186 535
1362 3300003856 Ga0058692_1007364 Ga0058692_10073642 535
1363 3300003856 Ga0058692_1007655 Ga0058692_10076552 535
1364 3300003856 Ga0058692_1007732 Ga0058692_10077321 535
1365 3300005289 Ga0065704_10004583 Ga0065704_100045833 535
1366 3300005289 Ga0065704_10072410 Ga0065704_100724105 535
1367 3300005347 Ga0070668_100004229 Ga0070668_1000042294 535
1368 3300005457 Ga0070662_100038399 Ga0070662_1000383992 535
1369 3300005548 Ga0070665_100004617 Ga0070665_1000046171 535
1370 3300005834 Ga0068851_10000048 Ga0068851_1000004847 535
1371 3300006946 Ga0079104_1000075 Ga0079104_100007514 535
1372 3300006946 Ga0079104_1000531 Ga0079104_100053127 535
1373 3300006946 Ga0079104_1003936 Ga0079104_10039366 535
1374 3300006946 Ga0079104_1005384 Ga0079104_10053841 535
1375 3300006946 Ga0079104_1006582 Ga0079104_10065825 535
1376 3300006946 Ga0079104_1007645 Ga0079104_10076452 535
1377 3300006946 Ga0079104_1012471 Ga0079104_10124711 535
1378 3300009011 Ga0105251_10001902 Ga0105251_100019028 535
1379 3300009011 Ga0105251_10004491 Ga0105251_100044918 535
1380 3300009011 Ga0105251_10012135 Ga0105251_100121353 535
1381 3300009011 Ga0105251_10019235 Ga0105251_100192352 535
1382 3300009011 Ga0105251_10021160 Ga0105251_100211602 535
1383 3300009011 Ga0105251_10021760 Ga0105251_100217602 535
1384 3300009011 Ga0105251_10036942 Ga0105251_100369422 535
1385 3300009011 Ga0105251_10042998 Ga0105251_100429982 535
1386 3300009011 Ga0105251_10045823 Ga0105251_100458231 535
1387 3300009036 Ga0105244_10000497 Ga0105244_1000049729 535
1388 3300009036 Ga0105244_10000700 Ga0105244_1000070018 535
1389 3300009036 Ga0105244_10001237 Ga0105244_1000123713 535
1390 3300009036 Ga0105244_10028285 Ga0105244_100282851 535
1391 3300009036 Ga0105244_10031832 Ga0105244_100318321 535
1392 3300009092 Ga0105250_10000300 Ga0105250_1000030024 535
1393 3300009092 Ga0105250_10000303 Ga0105250_1000030313 535
1394 3300009092 Ga0105250_10014915 Ga0105250_100149152 535
1395 3300009148 Ga0105243_10009620 Ga0105243_100096206 535
1396 3300011119 Ga0105246_10000228 Ga0105246_1000022828 535
1397 3300013100 Ga0157373_10000473 Ga0157373_1000047321 535
1398 3300013100 Ga0157373_10007338 Ga0157373_100073386 535
1399 3300013102 Ga0157371_10001666 Ga0157371_1000166616 535
1400 3300013102 Ga0157371_10003068 Ga0157371_1000306817 535
1401 3300013102 Ga0157371_10006320 Ga0157371_100063207 535
1402 3300013102 Ga0157371_10038723 Ga0157371_100387232 535
1403 3300013102 Ga0157371_10093381 Ga0157371_100933811 535
1404 3300013104 Ga0157370_10005514 Ga0157370_1000551412 535
1405 3300013104 Ga0157370_10161628 Ga0157370_101616281 535
1406 3300013105 Ga0157369_10006256 Ga0157369_100062563 535
1407 3300013105 Ga0157369_10086157 Ga0157369_100861572 535
1408 3300013307 Ga0157372_10002756 Ga0157372_1000275614 535
1409 3300013307 Ga0157372_10053705 Ga0157372_100537054 535
1410 3300015261 Ga0182006_1000024 Ga0182006_1000024216 535
1411 3300015261 Ga0182006_1004370 Ga0182006_10043705 535
1412 3300015679 Ga0183366_1001 Ga0183366_10012663 535
1413 3300015680 Ga0183370_1001 Ga0183370_10012663 535
1414 3300015685 Ga0183369_1001 Ga0183369_10012664 535
1415 3300015687 Ga0183368_1001 Ga0183368_10012663 535
1416 3300017792 Ga0163161_10004555 Ga0163161_1000455511 535
1417 3300017792 Ga0163161_10011830 Ga0163161_100118302 535
1418 3300021384 Ga0213876_10000065 Ga0213876_1000006525 535
1419 3300025233 Ga0209437_100115 Ga0209437_10011569 535
1420 3300025258 Ga0209129_1000104 Ga0209129_100010412 535
1421 3300025321 Ga0207656_10000040 Ga0207656_1000004046 535
1422 3300025711 Ga0207696_1000035 Ga0207696_1000035163 535
1423 3300025711 Ga0207696_1000131 Ga0207696_1000131103 535
1424 3300025711 Ga0207696_1000259 Ga0207696_100025913 535
1425 3300025711 Ga0207696_1000771 Ga0207696_100077120 535
1426 3300025711 Ga0207696_1007113 Ga0207696_10071134 535
1427 3300025728 Ga0207655_1000002 Ga0207655_100000214 535
1428 3300025728 Ga0207655_1000004 Ga0207655_100000418 535
1429 3300025728 Ga0207655_1000062 Ga0207655_1000062232 535
1430 3300025728 Ga0207655_1000199 Ga0207655_100019915 535
1431 3300025728 Ga0207655_1007890 Ga0207655_10078905 535
1432 3300025728 Ga0207655_1026256 Ga0207655_10262562 535
1433 3300025735 Ga0207713_1000001 Ga0207713_10000012163 535
1434 3300025735 Ga0207713_1000052 Ga0207713_1000052206 535
1435 3300025735 Ga0207713_1000069 Ga0207713_1000069163 535
1436 3300025735 Ga0207713_1000516 Ga0207713_100051624 535
1437 3300025735 Ga0207713_1012706 Ga0207713_10127063 535
1438 3300025735 Ga0207713_1013969 Ga0207713_10139693 535
1439 3300025735 Ga0207713_1027741 Ga0207713_10277412 535
1440 3300025735 Ga0207713_1029582 Ga0207713_10295821 535
1441 3300025935 Ga0207709_10017421 Ga0207709_100174212 535
1442 3300025935 Ga0207709_10021391 Ga0207709_100213912 535
1443 3300027111 Ga0209281_1000004 Ga0209281_100000413 535
1444 3300027111 Ga0209281_1000014 Ga0209281_100001413 535
1445 3300027111 Ga0209281_1000142 Ga0209281_100014214 535
1446 3300027111 Ga0209281_1000171 Ga0209281_100017115 535
1447 3300027111 Ga0209281_1000602 Ga0209281_100060226 535
1448 3300027111 Ga0209281_1001075 Ga0209281_10010758 535
1449 3300027111 Ga0209281_1001174 Ga0209281_100117413 535
1450 3300027111 Ga0209281_1002216 Ga0209281_10022164 535
1451 3300027111 Ga0209281_1002582 Ga0209281_10025821 535
1452 3300027312 Ga0209371_1000001 Ga0209371_10000012626 535
1453 3300027312 Ga0209371_1000015 Ga0209371_1000015610 535
1454 3300027312 Ga0209371_1000084 Ga0209371_100008455 535
1455 3300027312 Ga0209371_1000158 Ga0209371_100015842 535
1456 3300027312 Ga0209371_1000218 Ga0209371_100021859 535
1457 3300027312 Ga0209371_1000554 Ga0209371_10005542 535
1458 3300027312 Ga0209371_1001980 Ga0209371_10019806 535
1459 3300027312 Ga0209371_1003043 Ga0209371_10030438 535
1460 3300027312 Ga0209371_1003888 Ga0209371_10038886 535
1461 3300027312 Ga0209371_1005986 Ga0209371_10059865 535
1462 3300027312 Ga0209371_1010262 Ga0209371_10102621 535
1463 3300030500 Ga0268256_1000001 Ga0268256_100000114 535
1464 3300030500 Ga0268256_1000018 Ga0268256_100001813 535
1465 3300030500 Ga0268256_1000069 Ga0268256_100006949 535
1466 3300030500 Ga0268256_1000075 Ga0268256_1000075110 535
1467 3300030500 Ga0268256_1000174 Ga0268256_100017413 535
1468 3300030500 Ga0268256_1000430 Ga0268256_10004306 535
1469 3300030500 Ga0268256_1000444 Ga0268256_100044413 535
1470 3300030500 Ga0268256_1001695 Ga0268256_10016959 535
1471 3300030500 Ga0268256_1001751 Ga0268256_10017517 535
1472 3300030500 Ga0268256_1002422 Ga0268256_10024229 535
1473 3300030500 Ga0268256_1011004 Ga0268256_10110042 535
1474 3300030500 Ga0268256_1011574 Ga0268256_10115741 535
1475 3300030500 Ga0268256_1013302 Ga0268256_10133022 535
1476 3300031711 Ga0265314_10011130 Ga0265314_100111302 535
1477 3300031728 Ga0316578_10021501 Ga0316578_100215013 535
1478 3300031911 Ga0307412_10002982 Ga0307412_100029821 535
1479 3300036712 Ga0316584_0009954 Ga0316584_0009954_1807_3474 535
1480 3300039062 Ga0400483_025279 Ga0400483_025279_439_2064 535
1481 3300039062 Ga0400483_154029 Ga0400483_154029_6068_7756 535
1482 3300039437 Ga0436365_1613017 Ga0436365_1613017_100400_102019 535
1483 3300041405 Ga0439438_000002 Ga0439438_000002_568951_570666 535
1484 3300041405 Ga0439438_000537 Ga0439438_000537_12896_14515 535
1485 3300041405 Ga0439438_005518 Ga0439438_005518_1233_2852 535
1486 3300041407 Ga0439447_003338 Ga0439447_003338_147_1862 535
1487 3300041411 Ga0439466_0000001 Ga0439466_0000001_636098_637720 535
1488 3300041512 Ga0451853_0653488 Ga0451853_0653488_4591_6210 535
1489 3300042010 Ga0439452_000002 Ga0439452_000002_10819_12438 535
1490 3300042010 Ga0439452_000015 Ga0439452_000015_327952_329577 535
1491 3300042010 Ga0439452_000036 Ga0439452_000036_12636_14255 535
1492 3300042010 Ga0439452_000622 Ga0439452_000622_12939_14558 535
1493 3300042010 Ga0439452_000652 Ga0439452_000652_3346_4965 535
1494 3300042010 Ga0439452_001366 Ga0439452_001366_4250_5959 535
1495 3300042010 Ga0439452_006731 Ga0439452_006731_693_2315 535
1496 3300042137 Ga0450902_002270 Ga0450902_002270_921_2540 535
1497 3300042146 Ga0450907_000252 Ga0450907_000252_11616_13238 535
1498 3300042439 Ga0439464_0005768 Ga0439464_0005768_1066_2685 535
1499 3300042876 Ga0451577_0005576 Ga0451577_0005576_8105_9781 535
1500 3300042876 Ga0451577_0007694 Ga0451577_0007694_1393_3006 535
1501 3300044669 Ga0466981_0000169 Ga0466981_0000169_4825_6444 535
1502 3300044712 Ga0453684_0006884 Ga0453684_0006884_17013_18626 535
1503 3300046458 Ga0495591_000841 Ga0495591_000841_7751_9370 535
1504 3300046458 Ga0495591_004293 Ga0495591_004293_885_2504 535
1505 3300046458 Ga0495591_021794 Ga0495591_021794_325_1947 535
1506 3300046460 Ga0495638_0028077 Ga0495638_0028077_820_2439 535
1507 3300046471 Ga0495650_0000326 Ga0495650_0000326_71353_72972 535
1508 3300046471 Ga0495650_0024106 Ga0495650_0024106_640_2259 535
1509 3300046492 Ga0495585_0000559 Ga0495585_0000559_32398_34005 535
1510 3300046492 Ga0495585_0023384 Ga0495585_0023384_1236_2858 535
1511 3300046500 Ga0495596_0001221 Ga0495596_0001221_3967_5589 535
1512 3300046519 Ga0495632_0001435 Ga0495632_0001435_17620_19227 535
1513 3300046520 Ga0495637_0003452 Ga0495637_0003452_6154_7761 535
1514 3300046524 Ga0495648_0003997 Ga0495648_0003997_2096_3718 535
1515 3300046694 Ga0495649_0035138 Ga0495649_0035138_314_1933 535
1516 3300046694 Ga0495649_0035139 Ga0495649_0035139_314_1933 535
1517 3300046794 Ga0495589_0001652 Ga0495589_0001652_8456_10063 535
1518 3300047320 Ga0495672_0000052 Ga0495672_0000052_54306_55928 535
1519 3300047446 Ga0495679_004152 Ga0495679_004152_4325_5944 535
1520 3300047469 Ga0495673_0000343 Ga0495673_0000343_44896_46515 535
1521 3300048903 Ga0496100_0016256 Ga0496100_0016256_1028_2812 535
1522 3300048904 Ga0496101_0000120 Ga0496101_0000120_64383_66167 535
1523 3300048904 Ga0496101_0014234 Ga0496101_0014234_392_2011 535
1524 3300048904 Ga0496101_0059861 Ga0496101_0059861_377_1996 535
1525 3300048905 Ga0496102_0024014 Ga0496102_0024014_3013_4635 535
1526 3300048907 Ga0496104_0000415 Ga0496104_0000415_30482_32101 535
1527 3300048908 Ga0496105_0013356 Ga0496105_0013356_914_2536 535
1528 3300048908 Ga0496105_0021481 Ga0496105_0021481_3301_4920 535
1529 3300048919 Ga0496116_0002321 Ga0496116_0002321_7771_9396 535
1530 3300048919 Ga0496116_0003949 Ga0496116_0003949_497_2116 535
1531 3300048919 Ga0496116_0013314 Ga0496116_0013314_1234_3018 535
1532 3300048919 Ga0496116_0021801 Ga0496116_0021801_603_2222 535
1533 3300048919 Ga0496116_0029593 Ga0496116_0029593_156_1775 535
1534 3300048920 Ga0496117_0000073 Ga0496117_0000073_140994_142616 535
1535 3300048920 Ga0496117_0001182 Ga0496117_0001182_31231_32856 535
1536 3300048920 Ga0496117_0003799 Ga0496117_0003799_3193_4812 535
1537 3300048920 Ga0496117_0004482 Ga0496117_0004482_2894_4516 535
1538 3300048920 Ga0496117_0005668 Ga0496117_0005668_10978_12597 535
1539 3300048920 Ga0496117_0051300 Ga0496117_0051300_427_2046 535
1540 3300048921 Ga0496118_0000094 Ga0496118_0000094_70790_72412 535
1541 3300048921 Ga0496118_0003903 Ga0496118_0003903_3168_4790 535
1542 3300048921 Ga0496118_0007379 Ga0496118_0007379_6780_8405 535
1543 3300048921 Ga0496118_0024326 Ga0496118_0024326_3193_4812 535
1544 3300048922 Ga0496119_0000013 Ga0496119_0000013_309584_311203 535
1545 3300048922 Ga0496119_0000073 Ga0496119_0000073_79211_80833 535
1546 3300048922 Ga0496119_0000212 Ga0496119_0000212_32213_33835 535
1547 3300048922 Ga0496119_0014179 Ga0496119_0014179_3528_5312 535
1548 3300048922 Ga0496119_0015773 Ga0496119_0015773_875_2494 535
1549 3300048922 Ga0496119_0043227 Ga0496119_0043227_404_2023 535
1550 3300048923 Ga0496120_0000088 Ga0496120_0000088_70974_72596 535
1551 3300048923 Ga0496120_0000826 Ga0496120_0000826_4258_6042 535
1552 3300048923 Ga0496120_0030652 Ga0496120_0030652_777_2396 535
1553 3300048923 Ga0496120_0039361 Ga0496120_0039361_751_2370 535
1554 3300048923 Ga0496120_0039691 Ga0496120_0039691_268_1887 535
1555 3300048923 Ga0496120_0075953 Ga0496120_0075953_132_1751 535
1556 3300048924 Ga0496121_0000386 Ga0496121_0000386_51071_52693 535
1557 3300048924 Ga0496121_0014056 Ga0496121_0014056_572_2191 535
1558 3300048924 Ga0496121_0048109 Ga0496121_0048109_494_2113 535
1559 3300048924 Ga0496121_0074547 Ga0496121_0074547_356_1975 535
1560 3300048924 Ga0496121_0102714 Ga0496121_0102714_11_1630 535
1561 3300048925 Ga0496122_0001833 Ga0496122_0001833_26416_28035 535
1562 3300048925 Ga0496122_0002657 Ga0496122_0002657_11215_12834 535
1563 3300048925 Ga0496122_0005812 Ga0496122_0005812_494_2113 535
1564 3300048925 Ga0496122_0009580 Ga0496122_0009580_954_2576 535
1565 3300048925 Ga0496122_0011263 Ga0496122_0011263_4572_6356 535
1566 3300048925 Ga0496122_0011986 Ga0496122_0011986_6237_7856 535
1567 3300048925 Ga0496122_0037707 Ga0496122_0037707_435_2054 535
1568 3300048925 Ga0496122_0052489 Ga0496122_0052489_545_2167 535
1569 3300048925 Ga0496122_0058727 Ga0496122_0058727_267_1889 535
1570 3300048926 Ga0496123_0001483 Ga0496123_0001483_26514_28133 535
1571 3300048926 Ga0496123_0002012 Ga0496123_0002012_12130_13749 535
1572 3300048926 Ga0496123_0002139 Ga0496123_0002139_1036_2658 535
1573 3300048926 Ga0496123_0003830 Ga0496123_0003830_14342_15961 535
1574 3300048926 Ga0496123_0004535 Ga0496123_0004535_12390_14009 535
1575 3300048926 Ga0496123_0008108 Ga0496123_0008108_4581_6200 535
1576 3300048926 Ga0496123_0043135 Ga0496123_0043135_637_2256 535
1577 3300048926 Ga0496123_0043638 Ga0496123_0043638_615_2234 535
1578 3300048927 Ga0496124_0000877 Ga0496124_0000877_26300_27922 535
1579 3300048927 Ga0496124_0001183 Ga0496124_0001183_34930_36549 535
1580 3300048927 Ga0496124_0001847 Ga0496124_0001847_2782_4401 535
1581 3300048927 Ga0496124_0016740 Ga0496124_0016740_4366_5988 535
1582 3300048927 Ga0496124_0018827 Ga0496124_0018827_2649_4268 535
1583 3300048927 Ga0496124_0036623 Ga0496124_0036623_1836_3461 535
1584 3300048927 Ga0496124_0037374 Ga0496124_0037374_208_1992 535
1585 3300048927 Ga0496124_0042506 Ga0496124_0042506_2134_3753 535
1586 3300048927 Ga0496124_0057436 Ga0496124_0057436_888_2507 535
1587 3300048927 Ga0496124_0059681 Ga0496124_0059681_905_2527 535
1588 3300048928 Ga0496125_0017692 Ga0496125_0017692_1199_2821 535
1589 3300048928 Ga0496125_0020693 Ga0496125_0020693_602_2221 535
1590 3300048928 Ga0496125_0051178 Ga0496125_0051178_868_2490 535
1591 3300048928 Ga0496125_0053543 Ga0496125_0053543_803_2422 535
1592 3300048928 Ga0496125_0065887 Ga0496125_0065887_840_2459 535
1593 3300048929 Ga0496126_0007056 Ga0496126_0007056_1755_3374 535
1594 3300048929 Ga0496126_0034453 Ga0496126_0034453_2498_4117 535
1595 3300048929 Ga0496126_0042557 Ga0496126_0042557_1673_3292 535
1596 3300048929 Ga0496126_0070829 Ga0496126_0070829_855_2477 535
1597 3300048929 Ga0496126_0120265 Ga0496126_0120265_161_1780 535
1598 3300048929 Ga0496126_0150813 Ga0496126_0150813_293_1930 535
1599 3300049459 Ga0495678_004240 Ga0495678_004240_6152_7759 535
1600 3300050491 nmdc:mga00v17_34180_c1 nmdc:mga00v17_34180_c1_901_2520 535
1601 3300050493 nmdc:mga0k408_5102_c1 nmdc:mga0k408_5102_c1_4036_5655 535
1602 iso_pu_bacteria 2599185299 2599926787 535
1603 iso_pu_bacteria 2648501693 2650896029 535
1604 iso_pu_bacteria 2684622997 2686355996 535
1605 iso_pu_bacteria 2808606414 2809127300 535
1606 iso_pu_bacteria 2978975091 2978978436 535
1607 iso_pu_bacteria 2984494565 2984497815 535
1608 iso_pu_bacteria 2990261002 2990261759 535
1609 3300013105 Ga0157369_10016302 Ga0157369_100163025 536
1610 3300027665 Ga0209983_1000759 Ga0209983_10007595 537
1611 3300046460 Ga0495638_0017071 Ga0495638_0017071_1503_3116 537
1612 3300047321 Ga0495676_0006281 Ga0495676_0006281_1726_3339 537
1613 3300053125 Ga0500618_003175 Ga0500618_003175_696_2309 537
1614 2124908027 MRS2a_Contig_27 MRS2a_00170880 538
1615 2162886007 SwRhRL2b_contig_1578050 SwRhRL2b_0248.00005760 538
1616 3300002737 JGI25162J39368_1000054 JGI25162J39368_1000054134 538
1617 3300002737 JGI25162J39368_1000132 JGI25162J39368_100013210 538
1618 3300002771 JGI25163J39215_1000844 JGI25163J39215_10008441 538
1619 3300002771 JGI25163J39215_1000977 JGI25163J39215_10009771 538
1620 3300002772 JGI25164J39214_1000029 JGI25164J39214_100002910 538
1621 3300002772 JGI25164J39214_1000106 JGI25164J39214_100010677 538
1622 3300003214 JGI25165J46597_1000111 JGI25165J46597_1000111134 538
1623 3300003214 JGI25165J46597_1000217 JGI25165J46597_100021710 538
1624 3300003751 Ga0055538_1000099 Ga0055538_100009943 538
1625 3300003752 Ga0055539_1000147 Ga0055539_100014743 538
1626 3300003756 Ga0055533_1000151 Ga0055533_100015144 538
1627 3300003758 Ga0055532_1000108 Ga0055532_100010843 538
1628 3300003759 Ga0055525_1000199 Ga0055525_100019943 538
1629 3300003781 Ga0055536_1000043 Ga0055536_100004315 538
1630 3300003781 Ga0055536_1000474 Ga0055536_10004741 538
1631 3300003781 Ga0055536_1000583 Ga0055536_10005831 538
1632 3300003791 Ga0055530_10000031 Ga0055530_10000031107 538
1633 3300003791 Ga0055530_10000701 Ga0055530_1000070126 538
1634 3300003791 Ga0055530_10002189 Ga0055530_1000218913 538
1635 3300003792 Ga0055540_1000415 Ga0055540_100041520 538
1636 3300003792 Ga0055540_1000503 Ga0055540_100050328 538
1637 3300003792 Ga0055540_1000542 Ga0055540_100054226 538
1638 3300003794 Ga0055531_10000283 Ga0055531_1000028310 538
1639 3300003841 Ga0055541_1000099 Ga0055541_100009945 538
1640 3300005288 Ga0065714_10000009 Ga0065714_100000098 538
1641 3300005288 Ga0065714_10004204 Ga0065714_100042045 538
1642 3300005288 Ga0065714_10006149 Ga0065714_100061492 538
1643 3300005288 Ga0065714_10008077 Ga0065714_100080771 538
1644 3300005288 Ga0065714_10065522 Ga0065714_100655228 538
1645 3300005288 Ga0065714_10068565 Ga0065714_100685655 538
1646 3300005288 Ga0065714_10084286 Ga0065714_100842862 538
1647 3300005289 Ga0065704_10001998 Ga0065704_100019985 538
1648 3300005289 Ga0065704_10005150 Ga0065704_100051504 538
1649 3300005290 Ga0065712_10067895 Ga0065712_1006789512 538
1650 3300005331 Ga0070670_100000267 Ga0070670_10000026745 538
1651 3300005344 Ga0070661_100000081 Ga0070661_10000008136 538
1652 3300005457 Ga0070662_100000548 Ga0070662_10000054816 538
1653 3300005539 Ga0068853_100014562 Ga0068853_1000145627 538
1654 3300005564 Ga0070664_100000159 Ga0070664_10000015955 538
1655 3300005577 Ga0068857_100174445 Ga0068857_1001744451 538
1656 3300005578 Ga0068854_100020365 Ga0068854_1000203654 538
1657 3300006058 Ga0075432_10001832 Ga0075432_100018326 538
1658 3300006058 Ga0075432_10006691 Ga0075432_100066913 538
1659 3300006058 Ga0075432_10013639 Ga0075432_100136392 538
1660 3300006946 Ga0079104_1000090 Ga0079104_100009014 538
1661 3300006946 Ga0079104_1000134 Ga0079104_100013458 538
1662 3300006948 Ga0099826_10003760 Ga0099826_100037607 538
1663 3300009011 Ga0105251_10000004 Ga0105251_10000004121 538
1664 3300009011 Ga0105251_10001609 Ga0105251_1000160916 538
1665 3300009011 Ga0105251_10011947 Ga0105251_100119476 538
1666 3300009011 Ga0105251_10012530 Ga0105251_100125305 538
1667 3300009011 Ga0105251_10020323 Ga0105251_100203232 538
1668 3300009011 Ga0105251_10023354 Ga0105251_100233544 538
1669 3300009011 Ga0105251_10023987 Ga0105251_100239873 538
1670 3300009011 Ga0105251_10041371 Ga0105251_100413713 538
1671 3300009036 Ga0105244_10000922 Ga0105244_1000092220 538
1672 3300009036 Ga0105244_10002988 Ga0105244_1000298812 538
1673 3300009036 Ga0105244_10006961 Ga0105244_100069611 538
1674 3300009036 Ga0105244_10012584 Ga0105244_100125842 538
1675 3300009036 Ga0105244_10016429 Ga0105244_100164294 538
1676 3300009092 Ga0105250_10000106 Ga0105250_100001063 538
1677 3300009092 Ga0105250_10003140 Ga0105250_100031409 538
1678 3300009092 Ga0105250_10013182 Ga0105250_100131822 538
1679 3300009092 Ga0105250_10020233 Ga0105250_100202332 538
1680 3300009148 Ga0105243_10000144 Ga0105243_1000014472 538
1681 3300009148 Ga0105243_10000218 Ga0105243_1000021859 538
1682 3300009148 Ga0105243_10018270 Ga0105243_100182701 538
1683 3300009176 Ga0105242_10001485 Ga0105242_1000148512 538
1684 3300009177 Ga0105248_10021983 Ga0105248_100219837 538
1685 3300009545 Ga0105237_10000916 Ga0105237_1000091626 538
1686 3300011119 Ga0105246_10000106 Ga0105246_100001062 538
1687 3300011119 Ga0105246_10013274 Ga0105246_100132742 538
1688 3300012498 Ga0157345_1000028 Ga0157345_100002812 538
1689 3300013100 Ga0157373_10003627 Ga0157373_100036272 538
1690 3300013100 Ga0157373_10021164 Ga0157373_100211641 538
1691 3300013100 Ga0157373_10056917 Ga0157373_100569171 538
1692 3300013100 Ga0157373_10065008 Ga0157373_100650083 538
1693 3300013100 Ga0157373_10065559 Ga0157373_100655593 538
1694 3300013100 Ga0157373_10078654 Ga0157373_100786541 538
1695 3300013102 Ga0157371_10000230 Ga0157371_1000023072 538
1696 3300013102 Ga0157371_10000460 Ga0157371_1000046010 538
1697 3300013102 Ga0157371_10006518 Ga0157371_100065186 538
1698 3300013102 Ga0157371_10013816 Ga0157371_100138162 538
1699 3300013104 Ga0157370_10000162 Ga0157370_1000016282 538
1700 3300013104 Ga0157370_10012469 Ga0157370_100124691 538
1701 3300013104 Ga0157370_10042894 Ga0157370_100428941 538
1702 3300013104 Ga0157370_10076758 Ga0157370_100767581 538
1703 3300013104 Ga0157370_10094387 Ga0157370_100943872 538
1704 3300013105 Ga0157369_10007612 Ga0157369_100076121 538
1705 3300013105 Ga0157369_10007762 Ga0157369_100077622 538
1706 3300013105 Ga0157369_10022960 Ga0157369_100229601 538
1707 3300013105 Ga0157369_10119570 Ga0157369_101195701 538
1708 3300013105 Ga0157369_10119656 Ga0157369_101196561 538
1709 3300013105 Ga0157369_10162994 Ga0157369_101629941 538
1710 3300013306 Ga0163162_10027149 Ga0163162_100271494 538
1711 3300013306 Ga0163162_10041183 Ga0163162_100411835 538
1712 3300013307 Ga0157372_10007104 Ga0157372_100071041 538
1713 3300013308 Ga0157375_10024539 Ga0157375_100245396 538
1714 3300013308 Ga0157375_10117704 Ga0157375_101177043 538
1715 3300014497 Ga0182008_10000783 Ga0182008_1000078311 538
1716 3300014497 Ga0182008_10005713 Ga0182008_100057138 538
1717 3300014497 Ga0182008_10009438 Ga0182008_100094382 538
1718 3300014497 Ga0182008_10013208 Ga0182008_100132084 538
1719 3300014497 Ga0182008_10017015 Ga0182008_100170151 538
1720 3300014497 Ga0182008_10019315 Ga0182008_100193155 538
1721 3300014497 Ga0182008_10021622 Ga0182008_100216224 538
1722 3300015261 Ga0182006_1001311 Ga0182006_100131110 538
1723 3300015261 Ga0182006_1001590 Ga0182006_100159013 538
1724 3300015261 Ga0182006_1002240 Ga0182006_100224011 538
1725 3300015261 Ga0182006_1003761 Ga0182006_10037612 538
1726 3300015261 Ga0182006_1031039 Ga0182006_10310391 538
1727 3300015262 Ga0182007_10001309 Ga0182007_100013092 538
1728 3300015262 Ga0182007_10018386 Ga0182007_100183863 538
1729 3300015265 Ga0182005_1001728 Ga0182005_10017281 538
1730 3300015265 Ga0182005_1016463 Ga0182005_10164631 538
1731 3300017792 Ga0163161_10009858 Ga0163161_100098586 538
1732 3300017792 Ga0163161_10015005 Ga0163161_100150055 538
1733 3300017792 Ga0163161_10035861 Ga0163161_100358613 538
1734 3300017792 Ga0163161_10076103 Ga0163161_100761031 538
1735 3300017792 Ga0163161_10076332 Ga0163161_100763321 538
1736 3300025206 Ga0209435_101386 Ga0209435_1013861 538
1737 3300025207 Ga0209760_100015 Ga0209760_100015131 538
1738 3300025207 Ga0209760_100047 Ga0209760_100047101 538
1739 3300025224 Ga0209784_100015 Ga0209784_100015319 538
1740 3300025225 Ga0209566_100012 Ga0209566_100012319 538
1741 3300025226 Ga0209674_100027 Ga0209674_100027319 538
1742 3300025229 Ga0209147_100019 Ga0209147_100019319 538
1743 3300025230 Ga0209563_100031 Ga0209563_100031319 538
1744 3300025230 Ga0209563_100515 Ga0209563_10051512 538
1745 3300025231 Ga0207427_100001 Ga0207427_100001616 538
1746 3300025231 Ga0207427_100029 Ga0207427_100029107 538
1747 3300025233 Ga0209437_100003 Ga0209437_100003756 538
1748 3300025233 Ga0209437_100009 Ga0209437_100009362 538
1749 3300025242 Ga0209258_100364 Ga0209258_10036440 538
1750 3300025246 Ga0209646_1000199 Ga0209646_100019957 538
1751 3300025253 Ga0209677_100016 Ga0209677_100016319 538
1752 3300025256 Ga0209759_1003869 Ga0209759_10038696 538
1753 3300025261 Ga0209233_1000007 Ga0209233_1000007616 538
1754 3300025261 Ga0209233_1000032 Ga0209233_1000032362 538
1755 3300025292 Ga0209676_1000016 Ga0209676_1000016308 538
1756 3300025292 Ga0209676_1000033 Ga0209676_1000033135 538
1757 3300025292 Ga0209676_1000080 Ga0209676_100008059 538
1758 3300025292 Ga0209676_1001858 Ga0209676_100185812 538
1759 3300025292 Ga0209676_1003397 Ga0209676_10033975 538
1760 3300025298 Ga0209050_1000009 Ga0209050_100000972 538
1761 3300025298 Ga0209050_1000036 Ga0209050_1000036250 538
1762 3300025298 Ga0209050_1000117 Ga0209050_100011713 538
1763 3300025298 Ga0209050_1001816 Ga0209050_10018166 538
1764 3300025303 Ga0209051_1000053 Ga0209051_100005372 538
1765 3300025303 Ga0209051_1000077 Ga0209051_100007713 538
1766 3300025303 Ga0209051_1000094 Ga0209051_100009437 538
1767 3300025304 Ga0209257_1000173 Ga0209257_1000173153 538
1768 3300025304 Ga0209257_1015809 Ga0209257_10158092 538
1769 3300025711 Ga0207696_1000044 Ga0207696_100004496 538
1770 3300025711 Ga0207696_1000063 Ga0207696_1000063160 538
1771 3300025711 Ga0207696_1000083 Ga0207696_1000083147 538
1772 3300025711 Ga0207696_1006039 Ga0207696_10060392 538
1773 3300025711 Ga0207696_1010002 Ga0207696_10100022 538
1774 3300025728 Ga0207655_1000005 Ga0207655_1000005424 538
1775 3300025728 Ga0207655_1000015 Ga0207655_1000015513 538
1776 3300025728 Ga0207655_1000193 Ga0207655_100019347 538
1777 3300025728 Ga0207655_1000655 Ga0207655_10006553 538
1778 3300025728 Ga0207655_1001511 Ga0207655_10015114 538
1779 3300025728 Ga0207655_1002564 Ga0207655_100256413 538
1780 3300025728 Ga0207655_1005303 Ga0207655_10053031 538
1781 3300025728 Ga0207655_1010304 Ga0207655_10103042 538
1782 3300025728 Ga0207655_1030016 Ga0207655_10300161 538
1783 3300025735 Ga0207713_1000013 Ga0207713_1000013166 538
1784 3300025735 Ga0207713_1000104 Ga0207713_100010421 538
1785 3300025735 Ga0207713_1000230 Ga0207713_100023033 538
1786 3300025735 Ga0207713_1000933 Ga0207713_10009339 538
1787 3300025735 Ga0207713_1000977 Ga0207713_10009778 538
1788 3300025735 Ga0207713_1006328 Ga0207713_10063287 538
1789 3300025735 Ga0207713_1011701 Ga0207713_10117014 538
1790 3300025735 Ga0207713_1015340 Ga0207713_10153403 538
1791 3300025735 Ga0207713_1024580 Ga0207713_10245802 538
1792 3300025735 Ga0207713_1026812 Ga0207713_10268121 538
1793 3300025914 Ga0207671_10000339 Ga0207671_1000033929 538
1794 3300025920 Ga0207649_10000002 Ga0207649_10000002212 538
1795 3300025923 Ga0207681_10001290 Ga0207681_100012907 538
1796 3300025925 Ga0207650_10000655 Ga0207650_100006553 538
1797 3300025925 Ga0207650_10000796 Ga0207650_100007963 538
1798 3300025933 Ga0207706_10000362 Ga0207706_1000036216 538
1799 3300025934 Ga0207686_10001565 Ga0207686_100015656 538
1800 3300025935 Ga0207709_10000036 Ga0207709_10000036171 538
1801 3300025935 Ga0207709_10000250 Ga0207709_1000025056 538
1802 3300025935 Ga0207709_10014532 Ga0207709_100145322 538
1803 3300025945 Ga0207679_10000006 Ga0207679_10000006279 538
1804 3300026041 Ga0207639_10010150 Ga0207639_100101503 538
1805 3300027111 Ga0209281_1000013 Ga0209281_1000013592 538
1806 3300027111 Ga0209281_1000172 Ga0209281_100017260 538
1807 3300027312 Ga0209371_1000239 Ga0209371_100023948 538
1808 3300027907 Ga0207428_10063326 Ga0207428_100633262 538
1809 3300030500 Ga0268256_1000199 Ga0268256_100019920 538
1810 3300030521 Ga0307511_10070803 Ga0307511_100708031 538
1811 3300030735 Ga0316178_1048493 Ga0316178_104849310 538
1812 3300031548 Ga0307408_100000081 Ga0307408_10000008114 538
1813 3300031548 Ga0307408_100003809 Ga0307408_1000038099 538
1814 3300031548 Ga0307408_100009063 Ga0307408_1000090636 538
1815 3300031548 Ga0307408_100051624 Ga0307408_1000516243 538
1816 3300031731 Ga0307405_10003807 Ga0307405_100038071 538
1817 3300031731 Ga0307405_10029236 Ga0307405_100292364 538
1818 3300031731 Ga0307405_10067256 Ga0307405_100672563 538
1819 3300031824 Ga0307413_10042328 Ga0307413_100423281 538
1820 3300031901 Ga0307406_10036256 Ga0307406_100362563 538
1821 3300031901 Ga0307406_10054208 Ga0307406_100542081 538
1822 3300031911 Ga0307412_10003255 Ga0307412_1000325511 538
1823 3300031911 Ga0307412_10095249 Ga0307412_100952491 538
1824 3300031995 Ga0307409_100088588 Ga0307409_1000885883 538
1825 3300032004 Ga0307414_10011270 Ga0307414_100112701 538
1826 3300032004 Ga0307414_10018529 Ga0307414_100185295 538
1827 3300032005 Ga0307411_10008164 Ga0307411_100081641 538
1828 3300032005 Ga0307411_10053619 Ga0307411_100536191 538
1829 3300032005 Ga0307411_10088687 Ga0307411_100886873 538
1830 3300033180 Ga0307510_10054802 Ga0307510_100548025 538
1831 3300038705 Ga0237819_00586 Ga0237819_00586_8251_9867 538
1832 3300041405 Ga0439438_000992 Ga0439438_000992_8420_10036 538
1833 3300041405 Ga0439438_001945 Ga0439438_001945_6791_8407 538
1834 3300041405 Ga0439438_002440 Ga0439438_002440_5729_7345 538
1835 3300041405 Ga0439438_009356 Ga0439438_009356_826_2442 538
1836 3300041407 Ga0439447_000502 Ga0439447_000502_4129_5745 538
1837 3300041407 Ga0439447_002323 Ga0439447_002323_435_2051 538
1838 3300041407 Ga0439447_011139 Ga0439447_011139_581_2197 538
1839 3300041411 Ga0439466_0001434 Ga0439466_0001434_2904_4520 538
1840 3300041411 Ga0439466_0001459 Ga0439466_0001459_1293_2909 538
1841 3300041411 Ga0439466_0006472 Ga0439466_0006472_201_1817 538
1842 3300041411 Ga0439466_0007459 Ga0439466_0007459_1973_3589 538
1843 3300041411 Ga0439466_0008849 Ga0439466_0008849_946_2562 538
1844 3300041411 Ga0439466_0010442 Ga0439466_0010442_536_2152 538
1845 3300041997 Ga0439431_0004827 Ga0439431_0004827_604_2220 538
1846 3300042000 Ga0439437_000441 Ga0439437_000441_1652_3268 538
1847 3300042006 Ga0439432_002305 Ga0439432_002305_5293_6909 538
1848 3300042006 Ga0439432_006081 Ga0439432_006081_2169_3785 538
1849 3300042006 Ga0439432_015627 Ga0439432_015627_665_2281 538
1850 3300042009 Ga0439451_001403 Ga0439451_001403_1923_3539 538
1851 3300042009 Ga0439451_009906 Ga0439451_009906_29_1645 538
1852 3300042010 Ga0439452_000135 Ga0439452_000135_525_2141 538
1853 3300042010 Ga0439452_000500 Ga0439452_000500_10109_11725 538
1854 3300042010 Ga0439452_001277 Ga0439452_001277_8797_10413 538
1855 3300042013 Ga0439456_000039 Ga0439456_000039_21434_23050 538
1856 3300042013 Ga0439456_005258 Ga0439456_005258_547_2163 538
1857 3300042013 Ga0439456_005535 Ga0439456_005535_612_2228 538
1858 3300042016 Ga0439463_000242 Ga0439463_000242_370_1986 538
1859 3300042115 Ga0450911_000037 Ga0450911_000037_36214_37830 538
1860 3300042115 Ga0450911_000292 Ga0450911_000292_10074_11690 538
1861 3300042115 Ga0450911_002178 Ga0450911_002178_550_2166 538
1862 3300042115 Ga0450911_002891 Ga0450911_002891_539_2155 538
1863 3300042136 Ga0450900_001045 Ga0450900_001045_491_2107 538
1864 3300042138 Ga0450903_001649 Ga0450903_001649_613_2229 538
1865 3300042138 Ga0450903_002408 Ga0450903_002408_737_2353 538
1866 3300042138 Ga0450903_003619 Ga0450903_003619_514_2130 538
1867 3300042139 Ga0450904_000012 Ga0450904_000012_35900_37516 538
1868 3300042145 Ga0450906_000157 Ga0450906_000157_6685_8301 538
1869 3300042145 Ga0450906_000365 Ga0450906_000365_449_2065 538
1870 3300042146 Ga0450907_000041 Ga0450907_000041_845_2461 538
1871 3300042146 Ga0450907_002004 Ga0450907_002004_550_2166 538
1872 3300042156 Ga0439446_0003724 Ga0439446_0003724_1700_3316 538
1873 3300042156 Ga0439446_0008446 Ga0439446_0008446_556_2172 538
1874 3300042185 Ga0450909_000555 Ga0450909_000555_473_2089 538
1875 3300042435 Ga0439434_0000189 Ga0439434_0000189_7011_8627 538
1876 3300042461 Ga0439460_0000237 Ga0439460_0000237_864_2480 538
1877 3300042461 Ga0439460_0000244 Ga0439460_0000244_623_2239 538
1878 3300046452 Ga0495617_006320 Ga0495617_006320_1903_3519 538
1879 3300046452 Ga0495617_013991 Ga0495617_013991_483_2147 538
1880 3300046453 Ga0495627_000021 Ga0495627_000021_151317_152933 538
1881 3300046453 Ga0495627_000279 Ga0495627_000279_44343_45959 538
1882 3300046453 Ga0495627_001683 Ga0495627_001683_9341_10957 538
1883 3300046453 Ga0495627_002401 Ga0495627_002401_464_2080 538
1884 3300046453 Ga0495627_007877 Ga0495627_007877_1911_3527 538
1885 3300046453 Ga0495627_013515 Ga0495627_013515_486_2102 538
1886 3300046455 Ga0495603_0061619 Ga0495603_0061619_465_2081 538
1887 3300046457 Ga0495590_0000904 Ga0495590_0000904_10989_12605 538
1888 3300046457 Ga0495590_0000920 Ga0495590_0000920_7912_9528 538
1889 3300046457 Ga0495590_0021092 Ga0495590_0021092_20_1636 538
1890 3300046458 Ga0495591_000015 Ga0495591_000015_229669_231285 538
1891 3300046458 Ga0495591_000157 Ga0495591_000157_69886_71550 538
1892 3300046458 Ga0495591_001627 Ga0495591_001627_6189_7805 538
1893 3300046458 Ga0495591_002294 Ga0495591_002294_8782_10398 538
1894 3300046458 Ga0495591_003678 Ga0495591_003678_434_2050 538
1895 3300046458 Ga0495591_009294 Ga0495591_009294_1913_3529 538
1896 3300046458 Ga0495591_009694 Ga0495591_009694_435_2051 538
1897 3300046458 Ga0495591_014423 Ga0495591_014423_833_2449 538
1898 3300046458 Ga0495591_016712 Ga0495591_016712_852_2468 538
1899 3300046458 Ga0495591_017482 Ga0495591_017482_41_1657 538
1900 3300046459 Ga0495629_0009993 Ga0495629_0009993_4469_6085 538
1901 3300046460 Ga0495638_0004966 Ga0495638_0004966_543_2159 538
1902 3300046460 Ga0495638_0006497 Ga0495638_0006497_34_1650 538
1903 3300046460 Ga0495638_0007291 Ga0495638_0007291_1149_2765 538
1904 3300046460 Ga0495638_0021071 Ga0495638_0021071_1257_2921 538
1905 3300046460 Ga0495638_0055267 Ga0495638_0055267_509_2125 538
1906 3300046460 Ga0495638_0061408 Ga0495638_0061408_494_2158 538
1907 3300046463 Ga0495653_0001346 Ga0495653_0001346_441_2057 538
1908 3300046463 Ga0495653_0023818 Ga0495653_0023818_434_2098 538
1909 3300046463 Ga0495653_0028429 Ga0495653_0028429_2228_3844 538
1910 3300046471 Ga0495650_0001786 Ga0495650_0001786_8337_9953 538
1911 3300046471 Ga0495650_0004276 Ga0495650_0004276_7859_9523 538
1912 3300046471 Ga0495650_0014262 Ga0495650_0014262_1423_3039 538
1913 3300046471 Ga0495650_0034084 Ga0495650_0034084_35_1651 538
1914 3300046474 Ga0495605_0000016 Ga0495605_0000016_197926_199542 538
1915 3300046474 Ga0495605_0000031 Ga0495605_0000031_150838_152454 538
1916 3300046474 Ga0495605_0000558 Ga0495605_0000558_28241_29857 538
1917 3300046474 Ga0495605_0000917 Ga0495605_0000917_5040_6656 538
1918 3300046474 Ga0495605_0003396 Ga0495605_0003396_647_2263 538
1919 3300046474 Ga0495605_0013182 Ga0495605_0013182_2094_3710 538
1920 3300046474 Ga0495605_0014901 Ga0495605_0014901_859_2475 538
1921 3300046474 Ga0495605_0017011 Ga0495605_0017011_500_2164 538
1922 3300046475 Ga0495639_0000505 Ga0495639_0000505_647_2263 538
1923 3300046491 Ga0495584_0003475 Ga0495584_0003475_1124_2740 538
1924 3300046491 Ga0495584_0004191 Ga0495584_0004191_465_2081 538
1925 3300046491 Ga0495584_0004653 Ga0495584_0004653_605_2221 538
1926 3300046491 Ga0495584_0012803 Ga0495584_0012803_459_2123 538
1927 3300046491 Ga0495584_0014800 Ga0495584_0014800_841_2457 538
1928 3300046491 Ga0495584_0026322 Ga0495584_0026322_695_2311 538
1929 3300046491 Ga0495584_0030126 Ga0495584_0030126_821_2437 538
1930 3300046491 Ga0495584_0040636 Ga0495584_0040636_41_1657 538
1931 3300046492 Ga0495585_0003008 Ga0495585_0003008_418_2034 538
1932 3300046492 Ga0495585_0005559 Ga0495585_0005559_5561_7177 538
1933 3300046492 Ga0495585_0008243 Ga0495585_0008243_4195_5811 538
1934 3300046492 Ga0495585_0020410 Ga0495585_0020410_1809_3425 538
1935 3300046492 Ga0495585_0032362 Ga0495585_0032362_804_2420 538
1936 3300046492 Ga0495585_0039829 Ga0495585_0039829_388_2004 538
1937 3300046492 Ga0495585_0062919 Ga0495585_0062919_267_1883 538
1938 3300046499 Ga0495594_0002203 Ga0495594_0002203_6846_8462 538
1939 3300046499 Ga0495594_0018058 Ga0495594_0018058_557_2173 538
1940 3300046500 Ga0495596_0000073 Ga0495596_0000073_1068_2732 538
1941 3300046500 Ga0495596_0012665 Ga0495596_0012665_471_2087 538
1942 3300046501 Ga0495607_0000162 Ga0495607_0000162_65039_66655 538
1943 3300046501 Ga0495607_0000166 Ga0495607_0000166_67836_69452 538
1944 3300046501 Ga0495607_0000566 Ga0495607_0000566_30837_32453 538
1945 3300046501 Ga0495607_0001224 Ga0495607_0001224_11157_12773 538
1946 3300046501 Ga0495607_0001547 Ga0495607_0001547_406_2022 538
1947 3300046501 Ga0495607_0004193 Ga0495607_0004193_7862_9478 538
1948 3300046501 Ga0495607_0006473 Ga0495607_0006473_5709_7340 538
1949 3300046501 Ga0495607_0009546 Ga0495607_0009546_4441_6057 538
1950 3300046501 Ga0495607_0010940 Ga0495607_0010940_4030_5646 538
1951 3300046501 Ga0495607_0011018 Ga0495607_0011018_506_2122 538
1952 3300046501 Ga0495607_0016615 Ga0495607_0016615_23_1639 538
1953 3300046501 Ga0495607_0024910 Ga0495607_0024910_1634_3250 538
1954 3300046501 Ga0495607_0027712 Ga0495607_0027712_923_2539 538
1955 3300046501 Ga0495607_0042631 Ga0495607_0042631_536_2200 538
1956 3300046501 Ga0495607_0070979 Ga0495607_0070979_171_1787 538
1957 3300046506 Ga0495583_0000041 Ga0495583_0000041_53109_54725 538
1958 3300046506 Ga0495583_0000578 Ga0495583_0000578_48052_49668 538
1959 3300046506 Ga0495583_0001999 Ga0495583_0001999_12355_13971 538
1960 3300046506 Ga0495583_0002465 Ga0495583_0002465_585_2201 538
1961 3300046506 Ga0495583_0004895 Ga0495583_0004895_5897_7513 538
1962 3300046506 Ga0495583_0005316 Ga0495583_0005316_5300_6916 538
1963 3300046506 Ga0495583_0006354 Ga0495583_0006354_5706_7322 538
1964 3300046506 Ga0495583_0029429 Ga0495583_0029429_574_2190 538
1965 3300046507 Ga0495606_0000055 Ga0495606_0000055_186408_188024 538
1966 3300046507 Ga0495606_0000076 Ga0495606_0000076_36848_38464 538
1967 3300046507 Ga0495606_0003469 Ga0495606_0003469_815_2431 538
1968 3300046507 Ga0495606_0005454 Ga0495606_0005454_9826_11490 538
1969 3300046507 Ga0495606_0007319 Ga0495606_0007319_7831_9447 538
1970 3300046507 Ga0495606_0007485 Ga0495606_0007485_448_2064 538
1971 3300046507 Ga0495606_0010240 Ga0495606_0010240_5043_6659 538
1972 3300046507 Ga0495606_0010262 Ga0495606_0010262_503_2119 538
1973 3300046507 Ga0495606_0029907 Ga0495606_0029907_493_2109 538
1974 3300046507 Ga0495606_0053254 Ga0495606_0053254_544_2160 538
1975 3300046507 Ga0495606_0057647 Ga0495606_0057647_220_1836 538
1976 3300046512 Ga0495610_0005910 Ga0495610_0005910_24_1640 538
1977 3300046512 Ga0495610_0010229 Ga0495610_0010229_537_2153 538
1978 3300046512 Ga0495610_0015222 Ga0495610_0015222_2202_3866 538
1979 3300046512 Ga0495610_0023274 Ga0495610_0023274_510_2126 538
1980 3300046512 Ga0495610_0033482 Ga0495610_0033482_686_2302 538
1981 3300046512 Ga0495610_0033704 Ga0495610_0033704_542_2158 538
1982 3300046512 Ga0495610_0035149 Ga0495610_0035149_487_2103 538
1983 3300046512 Ga0495610_0045300 Ga0495610_0045300_312_1928 538
1984 3300046513 Ga0495616_0001130 Ga0495616_0001130_8876_10492 538
1985 3300046513 Ga0495616_0001777 Ga0495616_0001777_1838_3454 538
1986 3300046513 Ga0495616_0003265 Ga0495616_0003265_7923_9539 538
1987 3300046513 Ga0495616_0025856 Ga0495616_0025856_931_2547 538
1988 3300046513 Ga0495616_0029377 Ga0495616_0029377_468_2084 538
1989 3300046513 Ga0495616_0037259 Ga0495616_0037259_693_2357 538
1990 3300046513 Ga0495616_0046658 Ga0495616_0046658_11_1627 538
1991 3300046515 Ga0495620_0000015 Ga0495620_0000015_53078_54694 538
1992 3300046515 Ga0495620_0000506 Ga0495620_0000506_21545_23161 538
1993 3300046515 Ga0495620_0000863 Ga0495620_0000863_4649_6265 538
1994 3300046515 Ga0495620_0004849 Ga0495620_0004849_1046_2710 538
1995 3300046515 Ga0495620_0009210 Ga0495620_0009210_426_2042 538
1996 3300046515 Ga0495620_0015063 Ga0495620_0015063_458_2074 538
1997 3300046518 Ga0495631_0000635 Ga0495631_0000635_6916_8532 538
1998 3300046518 Ga0495631_0001850 Ga0495631_0001850_8994_10610 538
1999 3300046518 Ga0495631_0007239 Ga0495631_0007239_603_2219 538
2000 3300046518 Ga0495631_0016114 Ga0495631_0016114_1351_2967 538
2001 3300046519 Ga0495632_0001837 Ga0495632_0001837_14804_16420 538
2002 3300046519 Ga0495632_0006118 Ga0495632_0006118_5582_7198 538
2003 3300046519 Ga0495632_0015299 Ga0495632_0015299_605_2221 538
2004 3300046519 Ga0495632_0027745 Ga0495632_0027745_45_1661 538
2005 3300046519 Ga0495632_0028197 Ga0495632_0028197_889_2553 538
2006 3300046519 Ga0495632_0028404 Ga0495632_0028404_682_2298 538
2007 3300046519 Ga0495632_0034455 Ga0495632_0034455_641_2257 538
2008 3300046519 Ga0495632_0039049 Ga0495632_0039049_654_2270 538
2009 3300046520 Ga0495637_0000381 Ga0495637_0000381_26929_28545 538
2010 3300046520 Ga0495637_0000578 Ga0495637_0000578_578_2194 538
2011 3300046520 Ga0495637_0001350 Ga0495637_0001350_11985_13649 538
2012 3300046520 Ga0495637_0001569 Ga0495637_0001569_11208_12824 538
2013 3300046520 Ga0495637_0012799 Ga0495637_0012799_610_2226 538
2014 3300046520 Ga0495637_0018735 Ga0495637_0018735_54_1718 538
2015 3300046520 Ga0495637_0019429 Ga0495637_0019429_384_2000 538
2016 3300046520 Ga0495637_0028371 Ga0495637_0028371_390_2006 538
2017 3300046520 Ga0495637_0030715 Ga0495637_0030715_13_1629 538
2018 3300046520 Ga0495637_0030988 Ga0495637_0030988_54_1718 538
2019 3300046520 Ga0495637_0031003 Ga0495637_0031003_540_2156 538
2020 3300046522 Ga0495643_0000223 Ga0495643_0000223_20790_22406 538
2021 3300046522 Ga0495643_0027695 Ga0495643_0027695_962_2578 538
2022 3300046522 Ga0495643_0032971 Ga0495643_0032971_607_2223 538
2023 3300046523 Ga0495644_0002017 Ga0495644_0002017_5666_7330 538
2024 3300046523 Ga0495644_0006147 Ga0495644_0006147_23_1639 538
2025 3300046523 Ga0495644_0024578 Ga0495644_0024578_157_1821 538
2026 3300046524 Ga0495648_0003497 Ga0495648_0003497_11008_12624 538
2027 3300046524 Ga0495648_0006371 Ga0495648_0006371_3314_4930 538
2028 3300046524 Ga0495648_0007480 Ga0495648_0007480_6456_8072 538
2029 3300046524 Ga0495648_0008162 Ga0495648_0008162_6042_7658 538
2030 3300046524 Ga0495648_0017358 Ga0495648_0017358_3011_4675 538
2031 3300046524 Ga0495648_0022434 Ga0495648_0022434_494_2110 538
2032 3300046524 Ga0495648_0027629 Ga0495648_0027629_515_2131 538
2033 3300046524 Ga0495648_0027743 Ga0495648_0027743_496_2160 538
2034 3300046524 Ga0495648_0039285 Ga0495648_0039285_542_2158 538
2035 3300046524 Ga0495648_0045503 Ga0495648_0045503_536_2152 538
2036 3300046526 Ga0495666_0006365 Ga0495666_0006365_4317_5933 538
2037 3300046528 Ga0495642_0000097 Ga0495642_0000097_11430_13046 538
2038 3300046528 Ga0495642_0000956 Ga0495642_0000956_11268_12884 538
2039 3300046528 Ga0495642_0000978 Ga0495642_0000978_11056_12672 538
2040 3300046530 Ga0495654_0001879 Ga0495654_0001879_1114_2730 538
2041 3300046530 Ga0495654_0002407 Ga0495654_0002407_4833_6449 538
2042 3300046530 Ga0495654_0005990 Ga0495654_0005990_544_2160 538
2043 3300046530 Ga0495654_0016014 Ga0495654_0016014_1752_3368 538
2044 3300046530 Ga0495654_0017768 Ga0495654_0017768_1255_2919 538
2045 3300046530 Ga0495654_0025486 Ga0495654_0025486_835_2451 538
2046 3300046530 Ga0495654_0030034 Ga0495654_0030034_487_2103 538
2047 3300046530 Ga0495654_0038082 Ga0495654_0038082_565_2229 538
2048 3300046538 Ga0495609_0000015 Ga0495609_0000015_267647_269263 538
2049 3300046538 Ga0495609_0000066 Ga0495609_0000066_5684_7300 538
2050 3300046538 Ga0495609_0000070 Ga0495609_0000070_107061_108677 538
2051 3300046538 Ga0495609_0002544 Ga0495609_0002544_1245_2861 538
2052 3300046538 Ga0495609_0003946 Ga0495609_0003946_6043_7659 538
2053 3300046538 Ga0495609_0025564 Ga0495609_0025564_650_2266 538
2054 3300046538 Ga0495609_0030470 Ga0495609_0030470_352_1968 538
2055 3300046542 Ga0495597_0000005 Ga0495597_0000005_169848_171464 538
2056 3300046542 Ga0495597_0002158 Ga0495597_0002158_5545_7161 538
2057 3300046542 Ga0495597_0007453 Ga0495597_0007453_431_2095 538
2058 3300046542 Ga0495597_0009234 Ga0495597_0009234_2252_3916 538
2059 3300046542 Ga0495597_0011716 Ga0495597_0011716_739_2355 538
2060 3300046557 Ga0495622_0000912 Ga0495622_0000912_631_2247 538
2061 3300046557 Ga0495622_0002180 Ga0495622_0002180_7379_8995 538
2062 3300046557 Ga0495622_0003574 Ga0495622_0003574_672_2288 538
2063 3300046557 Ga0495622_0032303 Ga0495622_0032303_506_2122 538
2064 3300046558 Ga0495633_0000060 Ga0495633_0000060_104138_105754 538
2065 3300046558 Ga0495633_0002293 Ga0495633_0002293_10646_12262 538
2066 3300046616 Ga0495668_0000770 Ga0495668_0000770_35266_36930 538
2067 3300046616 Ga0495668_0004101 Ga0495668_0004101_544_2160 538
2068 3300046616 Ga0495668_0009526 Ga0495668_0009526_3163_4779 538
2069 3300046616 Ga0495668_0032913 Ga0495668_0032913_542_2158 538
2070 3300046642 Ga0495634_0001715 Ga0495634_0001715_6956_8572 538
2071 3300046648 Ga0495611_0000817 Ga0495611_0000817_15127_16743 538
2072 3300046648 Ga0495611_0000934 Ga0495611_0000934_11130_12746 538
2073 3300046660 Ga0495625_0001491 Ga0495625_0001491_14555_16171 538
2074 3300046660 Ga0495625_0005089 Ga0495625_0005089_630_2246 538
2075 3300046660 Ga0495625_0007191 Ga0495625_0007191_6218_7834 538
2076 3300046660 Ga0495625_0009109 Ga0495625_0009109_6219_7835 538
2077 3300046660 Ga0495625_0056705 Ga0495625_0056705_451_2067 538
2078 3300046660 Ga0495625_0063687 Ga0495625_0063687_501_2117 538
2079 3300046663 Ga0495635_0005430 Ga0495635_0005430_6866_8482 538
2080 3300046663 Ga0495635_0018843 Ga0495635_0018843_2371_3987 538
2081 3300046664 Ga0495659_0000584 Ga0495659_0000584_11199_12815 538
2082 3300046665 Ga0495661_0000110 Ga0495661_0000110_46559_48175 538
2083 3300046665 Ga0495661_0000139 Ga0495661_0000139_68991_70607 538
2084 3300046665 Ga0495661_0000194 Ga0495661_0000194_36516_38132 538
2085 3300046665 Ga0495661_0003093 Ga0495661_0003093_9810_11474 538
2086 3300046665 Ga0495661_0003941 Ga0495661_0003941_8759_10375 538
2087 3300046665 Ga0495661_0026573 Ga0495661_0026573_288_1904 538
2088 3300046665 Ga0495661_0032582 Ga0495661_0032582_456_2072 538
2089 3300046665 Ga0495661_0066388 Ga0495661_0066388_229_1893 538
2090 3300046674 Ga0495588_0037245 Ga0495588_0037245_551_2167 538
2091 3300046680 Ga0495646_0017786 Ga0495646_0017786_1872_3488 538
2092 3300046680 Ga0495646_0047683 Ga0495646_0047683_324_1940 538
2093 3300046689 Ga0495613_0097248 Ga0495613_0097248_13_1629 538
2094 3300046690 Ga0495624_0000167 Ga0495624_0000167_46579_48195 538
2095 3300046691 Ga0495670_0007739 Ga0495670_0007739_1735_3351 538
2096 3300046691 Ga0495670_0030698 Ga0495670_0030698_42_1706 538
2097 3300046692 Ga0495671_0000168 Ga0495671_0000168_55069_56685 538
2098 3300046692 Ga0495671_0001706 Ga0495671_0001706_4935_6551 538
2099 3300046692 Ga0495671_0002259 Ga0495671_0002259_5085_6701 538
2100 3300046692 Ga0495671_0003125 Ga0495671_0003125_543_2159 538
2101 3300046692 Ga0495671_0015419 Ga0495671_0015419_1920_3536 538
2102 3300046692 Ga0495671_0017509 Ga0495671_0017509_1656_3272 538
2103 3300046692 Ga0495671_0028882 Ga0495671_0028882_673_2289 538
2104 3300046692 Ga0495671_0039306 Ga0495671_0039306_226_1890 538
2105 3300046694 Ga0495649_0001678 Ga0495649_0001678_892_2508 538
2106 3300046694 Ga0495649_0006007 Ga0495649_0006007_665_2281 538
2107 3300046694 Ga0495649_0016746 Ga0495649_0016746_1684_3300 538
2108 3300046694 Ga0495649_0017462 Ga0495649_0017462_541_2157 538
2109 3300046694 Ga0495649_0017528 Ga0495649_0017528_529_2145 538
2110 3300046694 Ga0495649_0020458 Ga0495649_0020458_1612_3228 538
2111 3300046694 Ga0495649_0030266 Ga0495649_0030266_1273_2937 538
2112 3300046694 Ga0495649_0034186 Ga0495649_0034186_603_2219 538
2113 3300046694 Ga0495649_0041991 Ga0495649_0041991_609_2225 538
2114 3300046794 Ga0495589_0000305 Ga0495589_0000305_36953_38569 538
2115 3300046794 Ga0495589_0001305 Ga0495589_0001305_1887_3503 538
2116 3300046794 Ga0495589_0035514 Ga0495589_0035514_514_2130 538
2117 3300046809 Ga0495600_0002016 Ga0495600_0002016_1221_2837 538
2118 3300046810 Ga0495660_0000469 Ga0495660_0000469_27925_29541 538
2119 3300046810 Ga0495660_0008400 Ga0495660_0008400_4173_5789 538
2120 3300046810 Ga0495660_0021215 Ga0495660_0021215_544_2160 538
2121 3300046810 Ga0495660_0023303 Ga0495660_0023303_1310_2926 538
2122 3300046810 Ga0495660_0028677 Ga0495660_0028677_670_2286 538
2123 3300046810 Ga0495660_0039762 Ga0495660_0039762_515_2131 538
2124 3300046810 Ga0495660_0049620 Ga0495660_0049620_119_1783 538
2125 3300047315 Ga0495581_0012130 Ga0495581_0012130_541_2157 538
2126 3300047317 Ga0495604_0005968 Ga0495604_0005968_1291_2907 538
2127 3300047320 Ga0495672_0000985 Ga0495672_0000985_650_2266 538
2128 3300047320 Ga0495672_0003898 Ga0495672_0003898_6890_8506 538
2129 3300047320 Ga0495672_0016049 Ga0495672_0016049_2489_4105 538
2130 3300047320 Ga0495672_0020674 Ga0495672_0020674_2085_3701 538
2131 3300047320 Ga0495672_0048488 Ga0495672_0048488_826_2490 538
2132 3300047320 Ga0495672_0051983 Ga0495672_0051983_556_2172 538
2133 3300047321 Ga0495676_0000013 Ga0495676_0000013_196885_198501 538
2134 3300047321 Ga0495676_0003992 Ga0495676_0003992_781_2397 538
2135 3300047322 Ga0495680_0000389 Ga0495680_0000389_11445_13061 538
2136 3300047322 Ga0495680_0095979 Ga0495680_0095979_441_2057 538
2137 3300047323 Ga0495683_0000027 Ga0495683_0000027_98637_100253 538
2138 3300047323 Ga0495683_0002053 Ga0495683_0002053_9935_11551 538
2139 3300047323 Ga0495683_0026805 Ga0495683_0026805_830_2446 538
2140 3300047323 Ga0495683_0027333 Ga0495683_0027333_603_2219 538
2141 3300047323 Ga0495683_0050937 Ga0495683_0050937_182_1846 538
2142 3300047443 Ga0495687_004846 Ga0495687_004846_665_2281 538
2143 3300047443 Ga0495687_027908 Ga0495687_027908_536_2152 538
2144 3300047444 Ga0495675_0001992 Ga0495675_0001992_7643_9259 538
2145 3300047446 Ga0495679_000206 Ga0495679_000206_35500_37116 538
2146 3300047446 Ga0495679_003887 Ga0495679_003887_292_1908 538
2147 3300047446 Ga0495679_008217 Ga0495679_008217_575_2191 538
2148 3300047469 Ga0495673_0001678 Ga0495673_0001678_551_2167 538
2149 3300047469 Ga0495673_0002278 Ga0495673_0002278_7243_8859 538
2150 3300047469 Ga0495673_0003117 Ga0495673_0003117_8817_10433 538
2151 3300047469 Ga0495673_0004241 Ga0495673_0004241_1053_2669 538
2152 3300047469 Ga0495673_0007619 Ga0495673_0007619_706_2370 538
2153 3300047469 Ga0495673_0023930 Ga0495673_0023930_695_2311 538
2154 3300047469 Ga0495673_0024795 Ga0495673_0024795_514_2130 538
2155 3300047469 Ga0495673_0026811 Ga0495673_0026811_1096_2712 538
2156 3300047469 Ga0495673_0026813 Ga0495673_0026813_1096_2712 538
2157 3300047469 Ga0495673_0031244 Ga0495673_0031244_459_2075 538
2158 3300047470 Ga0495681_0000933 Ga0495681_0000933_11152_12768 538
2159 3300047470 Ga0495681_0001629 Ga0495681_0001629_360_1976 538
2160 3300047470 Ga0495681_0002441 Ga0495681_0002441_11108_12724 538
2161 3300047470 Ga0495681_0002802 Ga0495681_0002802_1019_2683 538
2162 3300047470 Ga0495681_0004033 Ga0495681_0004033_109_1773 538
2163 3300047470 Ga0495681_0004844 Ga0495681_0004844_1637_3253 538
2164 3300047470 Ga0495681_0005072 Ga0495681_0005072_472_2088 538
2165 3300047470 Ga0495681_0015083 Ga0495681_0015083_2111_3727 538
2166 3300047470 Ga0495681_0022688 Ga0495681_0022688_64_1680 538
2167 3300047470 Ga0495681_0028181 Ga0495681_0028181_609_2273 538
2168 3300047470 Ga0495681_0034534 Ga0495681_0034534_160_1776 538
2169 3300047472 Ga0495686_0004515 Ga0495686_0004515_9273_10889 538
2170 3300047472 Ga0495686_0005865 Ga0495686_0005865_5020_6636 538
2171 3300047472 Ga0495686_0024698 Ga0495686_0024698_1846_3462 538
2172 3300047472 Ga0495686_0028435 Ga0495686_0028435_1473_3164 538
2173 3300048088 Ga0495602_0053327 Ga0495602_0053327_1583_3199 538
2174 3300048091 Ga0495626_0000056 Ga0495626_0000056_134493_136109 538
2175 3300048091 Ga0495626_0001227 Ga0495626_0001227_10188_11852 538
2176 3300048091 Ga0495626_0002338 Ga0495626_0002338_11200_12816 538
2177 3300048091 Ga0495626_0002462 Ga0495626_0002462_1000_2664 538
2178 3300048091 Ga0495626_0003814 Ga0495626_0003814_7194_8810 538
2179 3300048091 Ga0495626_0012513 Ga0495626_0012513_665_2281 538
2180 3300048091 Ga0495626_0027322 Ga0495626_0027322_1079_2695 538
2181 3300048091 Ga0495626_0030868 Ga0495626_0030868_458_2074 538
2182 3300048905 Ga0496102_0000242 Ga0496102_0000242_10469_12085 538
2183 3300048918 Ga0496115_0086169 Ga0496115_0086169_402_2018 538
2184 3300048919 Ga0496116_0000126 Ga0496116_0000126_147190_148806 538
2185 3300048919 Ga0496116_0001433 Ga0496116_0001433_546_2162 538
2186 3300048919 Ga0496116_0002028 Ga0496116_0002028_11199_12815 538
2187 3300048919 Ga0496116_0031666 Ga0496116_0031666_1833_3449 538
2188 3300048919 Ga0496116_0034437 Ga0496116_0034437_1770_3386 538
2189 3300048920 Ga0496117_0003126 Ga0496117_0003126_8065_9681 538
2190 3300048920 Ga0496117_0009272 Ga0496117_0009272_7115_8731 538
2191 3300048920 Ga0496117_0061916 Ga0496117_0061916_138_1754 538
2192 3300048921 Ga0496118_0062275 Ga0496118_0062275_674_2290 538
2193 3300048921 Ga0496118_0063667 Ga0496118_0063667_821_2437 538
2194 3300048921 Ga0496118_0070883 Ga0496118_0070883_361_1977 538
2195 3300048924 Ga0496121_0000142 Ga0496121_0000142_146853_148469 538
2196 3300048924 Ga0496121_0003009 Ga0496121_0003009_14574_16190 538
2197 3300048924 Ga0496121_0003989 Ga0496121_0003989_5018_6634 538
2198 3300048924 Ga0496121_0031977 Ga0496121_0031977_557_2173 538
2199 3300048924 Ga0496121_0043290 Ga0496121_0043290_522_2138 538
2200 3300048924 Ga0496121_0055886 Ga0496121_0055886_1304_2920 538
2201 3300048925 Ga0496122_0000122 Ga0496122_0000122_166355_167971 538
2202 3300048925 Ga0496122_0011118 Ga0496122_0011118_5909_7525 538
2203 3300048925 Ga0496122_0012431 Ga0496122_0012431_554_2170 538
2204 3300048925 Ga0496122_0063098 Ga0496122_0063098_474_2090 538
2205 3300048926 Ga0496123_0001340 Ga0496123_0001340_8015_9631 538
2206 3300048926 Ga0496123_0007328 Ga0496123_0007328_8329_9945 538
2207 3300048926 Ga0496123_0057009 Ga0496123_0057009_80_1696 538
2208 3300048926 Ga0496123_0064934 Ga0496123_0064934_334_1950 538
2209 3300048926 Ga0496123_0093522 Ga0496123_0093522_70_1686 538
2210 3300048927 Ga0496124_0000222 Ga0496124_0000222_35045_36661 538
2211 3300048927 Ga0496124_0001779 Ga0496124_0001779_27854_29470 538
2212 3300048927 Ga0496124_0009865 Ga0496124_0009865_7679_9295 538
2213 3300048927 Ga0496124_0010893 Ga0496124_0010893_492_2156 538
2214 3300048927 Ga0496124_0060792 Ga0496124_0060792_277_1893 538
2215 3300048927 Ga0496124_0083438 Ga0496124_0083438_149_1765 538
2216 3300048928 Ga0496125_0010865 Ga0496125_0010865_467_2083 538
2217 3300048928 Ga0496125_0023874 Ga0496125_0023874_3782_5398 538
2218 3300048928 Ga0496125_0084512 Ga0496125_0084512_475_2091 538
2219 3300049459 Ga0495678_000031 Ga0495678_000031_98951_100567 538
2220 3300049459 Ga0495678_000039 Ga0495678_000039_136774_138390 538
2221 3300049459 Ga0495678_009205 Ga0495678_009205_1033_2649 538
2222 3300049459 Ga0495678_012322 Ga0495678_012322_543_2159 538
2223 3300049459 Ga0495678_012401 Ga0495678_012401_1779_3395 538
2224 3300049459 Ga0495678_015646 Ga0495678_015646_1846_3462 538
2225 3300049459 Ga0495678_015647 Ga0495678_015647_24_1640 538
2226 3300049459 Ga0495678_025008 Ga0495678_025008_498_2114 538
2227 3300049460 Ga0495682_0000078 Ga0495682_0000078_77886_79502 538
2228 3300049460 Ga0495682_0000860 Ga0495682_0000860_8901_10517 538
2229 3300049460 Ga0495682_0001344 Ga0495682_0001344_3295_4911 538
2230 3300049758 Ga0501241_000766 Ga0501241_000766_1929_3545 538
2231 3300049853 Ga0501226_000017 Ga0501226_000017_47480_49096 538
2232 3300053161 Ga0500634_0036039 Ga0500634_0036039_810_2426 538
2233 iso_pu_bacteria 2599185155 2599330088 538
2234 iso_pu_bacteria 2738543015 2739256526 538
2235 iso_pu_bacteria 640427133 640487178 538

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00890

FAD_binding_2

FAD binding domain

59

441

0.96

PF02910

Succ_DH_flav_C

Fumarate reductase flavoprotein C-term

489

581

0.91

PF01266

DAO

FAD dependent oxidoreductase

59

339

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kxj-assembly1.cif.gz_A crystal structure of l-aspartate oxidase from salmonella typhimurium in the complex with substrate l-aspartate 0.9706 1 535
5kxj-assembly1.cif.gz_A crystal structure of l-aspartate oxidase from salmonella typhimurium in the complex with substrate l-aspartate 0.9646 1 535
1chu-assembly1.cif.gz_A-2 structure of l-aspartate oxidase: implications for the succinate dehydrogenase/ fumarate reducatse family 0.9636 1 533
1chu-assembly1.cif.gz_A-2 structure of l-aspartate oxidase: implications for the succinate dehydrogenase/ fumarate reducatse family 0.9597 1 533
1knp-assembly1.cif.gz_A e. coli l-aspartate oxidase: mutant r386l in complex with succinate 0.9358 5 533
ID Description Score Start End Superfamily
5kxjA02 Alpha Beta;Alpha-Beta Complex;Flavocytochrome C3; Chain A, domain 1;Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.9946 245 348 3.90.700.10
5kxjA02 Alpha Beta;Alpha-Beta Complex;Flavocytochrome C3; Chain A, domain 1;Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.9852 245 348 3.90.700.10
1knrA03 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 0.9692 425 533 1.20.58.100
1knrA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9679 5 423 3.50.50.60
5kxjA03 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 0.9671 429 516 1.20.58.100
ID Description Score Start End GO Terms
AF-A0A3S4G8Q6-F1-model_v4 deleted 1 201 365
AF-A0A3D1YMH0-F1-model_v4 L-aspartate oxidase (EC 1.4.3.16) 0.9964 438 535 GO:0008734
GO:0034628
AF-A0A1W1DVC2-F1-model_v4 L-aspartate oxidase (EC 1.4.3.16) 0.9912 436 532 GO:0008734
GO:0034628
AF-A0A4U9UP29-F1-model_v4 L-aspartate oxidase (EC 1.4.3.16) 0.9909 159 423 GO:0008734
GO:0034628
AF-A0A6L5DJZ6-F1-model_v4 deleted 0.9897 1 530

Feature Viewer

pLDDT pTM Quality
92.32 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map