F496591

General Info

Members Datasets Scaffolds Average Seq Length
2243 657 4486 154

Family's Representative Sequence

Representative Sequence 3300035089|Ga0373944_0001645|Ga0373944_0001645_1804_2352
Length 172
Sequence MTLTGPNRVGYITGDFAGRTRSNSQGKIMKTYSATAADIEKKWVTIDATGLVVGRLASIVALRLRGKHKASYTPHVDDGDNVIVVNAAKAVLTGRTGYIGGIKDRTAKAILEGRFPERIVEKAVERMLPRGPLGRVQLGNLRVYPGPEHPHEAQKPEKVDVAAMNRKNVRSV

Samples

Sample ID Description Type Environment
1 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
8 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
9 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
10 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
11 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
12 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
13 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
18 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
19 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
20 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
21 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
22 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
23 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
24 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
25 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
26 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
27 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
28 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
29 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
30 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
31 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
32 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
33 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
34 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
35 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
39 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
40 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
48 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
49 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
50 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
51 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
55 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
56 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
57 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
58 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
62 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
63 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
64 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
65 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
66 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
67 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
68 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
69 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
70 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
71 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
72 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
73 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
74 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
75 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
76 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
77 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
78 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
79 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
80 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
81 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
82 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
83 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
84 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
85 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
86 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
87 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
88 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
89 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
90 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
91 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
92 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
93 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
94 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
95 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
96 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
97 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
98 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
99 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
100 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
101 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
102 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
103 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
104 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
105 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
106 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
107 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
108 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
109 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
110 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
111 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
112 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
113 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
114 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
115 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
116 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
117 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
118 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
119 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
120 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
121 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
122 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
123 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
124 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
125 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
126 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
127 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
128 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
129 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
130 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
131 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
132 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
133 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
134 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
135 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
136 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
137 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
138 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
139 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
140 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
141 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
142 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
143 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
144 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
145 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
146 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
147 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
148 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
149 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
150 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
151 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
152 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
153 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
154 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
155 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
156 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
157 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
158 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
159 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
160 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
161 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
162 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
163 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
164 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
165 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
166 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
167 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
168 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
169 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
170 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
171 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
172 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
173 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
174 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
175 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
176 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
177 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
178 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
179 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
180 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
181 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
182 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
183 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
184 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
185 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
186 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
187 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
188 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
189 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
190 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
191 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
192 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
193 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
194 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
195 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
196 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
197 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
199 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
201 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
202 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
203 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
274 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
276 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
280 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
281 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
282 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
286 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
287 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
288 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
289 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
290 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
291 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
294 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
295 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
296 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
297 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
298 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
299 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
300 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
301 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
302 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
303 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
304 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
305 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
306 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
307 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
308 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
309 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
310 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
311 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
312 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
313 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
314 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
315 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
316 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
317 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
318 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
319 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
320 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
321 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
322 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
323 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
324 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
325 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
326 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
327 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
328 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
329 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
330 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
331 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
332 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
333 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
334 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
335 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
336 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
337 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
338 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
339 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
340 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
341 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
342 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
343 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
344 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
345 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
346 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
347 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
348 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
349 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
350 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
351 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
352 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
353 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
354 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
355 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
356 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
357 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
358 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
359 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
360 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
361 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
362 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
363 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
364 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
365 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
366 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
367 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
368 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
369 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
370 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
371 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
372 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
373 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
374 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
375 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
376 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
377 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
378 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
379 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
380 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
381 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
382 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
383 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
384 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
385 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
386 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
387 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
388 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
389 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
390 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
391 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
392 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
393 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
394 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
395 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
396 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
397 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
398 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
399 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
400 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
401 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
402 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
403 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
404 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
405 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
406 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
407 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
408 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
409 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
410 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
411 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
412 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
413 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
414 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
415 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
416 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
417 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
418 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
419 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
420 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
421 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
422 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
423 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
424 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
425 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
426 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
427 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
428 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
429 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
430 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
431 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
432 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
433 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
434 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
435 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
436 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
437 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
438 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
439 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
440 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
441 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
442 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
443 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
444 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
445 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
446 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
447 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
448 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
449 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
450 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
451 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
452 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
453 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
454 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
455 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
456 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
457 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
458 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
459 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
460 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
461 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
462 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
463 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
464 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
465 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
466 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
467 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
468 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
469 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
470 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
471 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
472 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
473 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
474 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
475 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
476 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
477 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
478 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
479 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
480 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
481 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
482 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
483 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
484 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
485 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
486 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
487 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
488 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
489 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
490 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
491 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
492 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
493 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
494 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
495 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
496 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
497 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
498 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
499 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
500 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
501 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
502 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
503 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
504 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
505 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
506 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
507 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
508 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
509 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
510 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
511 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
512 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
513 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
514 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
515 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
516 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
517 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
518 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
519 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
520 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
521 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
522 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
523 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
524 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
525 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
526 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
527 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
528 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
529 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
530 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
531 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
532 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
533 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
534 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
535 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
536 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
537 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
538 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
542 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
543 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
544 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
545 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
546 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
547 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
548 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
549 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
550 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
551 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
552 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
553 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
554 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
555 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
556 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
557 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
558 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
559 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
560 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
561 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
562 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
563 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
564 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
565 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
566 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
567 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
568 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
569 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
570 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
571 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
572 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
573 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
574 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
575 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
576 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
577 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
578 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
579 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
580 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
581 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
582 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
583 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
584 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
585 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
586 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
587 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
588 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
589 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
590 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
591 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
592 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
593 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
594 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
595 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
596 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
597 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
598 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
599 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
600 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
601 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
602 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
603 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
604 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
605 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
606 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
607 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
608 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
609 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
610 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
611 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
612 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
613 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
614 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
615 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
616 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
617 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
618 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
619 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
620 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
621 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
622 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
623 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
624 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
625 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
626 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
627 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
628 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
629 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
630 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
631 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
632 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
633 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
634 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
635 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
636 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
637 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
638 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
639 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
640 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
641 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
642 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
643 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
644 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
645 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
646 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
647 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
648 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
649 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
650 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
651 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
652 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
653 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
654 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
655 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
656 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
657 2842694124 Methylopila sp. R-72369 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.12
Metatranscriptomes 3.79
Isolates 0.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.17
Nodule 0.22
Rhizoplane 6.29
Rhizosphere 86.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373944_0001645 3300035089 Bacteria 5649
2 2214761875 2209111006 Bacteria 2953
3 ARcpr5oldR_c000005 3300000041 Bacteria 43151
4 ARSoilYngRDRAFT_c00135 3300000042 Bacteria 12483
5 ARcpr5yngRDRAFT_c000073 3300000043 Bacteria 16772
6 ARSoilOldRDRAFT_c000012 3300000044 Bacteria 42830
7 ARCol0oldRDRAFT_c02295 3300000045 Bacteria 891
8 ARCol0yngRDRAFT_1000066 3300000652 Bacteria 19051
9 JGI24032J14994_100207 3300001430 Bacteria 3007
10 JGI24736J21556_1007134 3300001904 Bacteria 1882
11 JGI24736J21556_1079992 3300001904 Bacteria 513
12 JGI24752J21851_1002466 3300001976 Bacteria 2462
13 JGI24746J21847_1002567 3300001977 Bacteria 2885
14 JGI24747J21853_1000229 3300001978 Bacteria 3038
15 JGI24740J21852_10024312 3300001979 Bacteria 2057
16 JGI24739J22299_10000451 3300001989 Bacteria 14344
17 JGI24739J22299_10006960 3300001989 Bacteria 4260
18 JGI24739J22299_10207394 3300001989 Bacteria 575
19 JGI24737J22298_10003545 3300001990 Bacteria 5503
20 JGI24737J22298_10013316 3300001990 Bacteria 2678
21 JGI24737J22298_10044531 3300001990 Bacteria 1356
22 JGI24737J22298_10089320 3300001990 Bacteria 914
23 JGI24743J22301_10045512 3300001991 Bacteria 887
24 JGI24750J21931_1000063 3300002070 Bacteria 15488
25 JGI24750J21931_1017352 3300002070 Bacteria 984
26 JGI24745J21846_1000659 3300002073 Bacteria 3106
27 JGI24738J21930_10000026 3300002075 Bacteria 27501
28 JGI24749J21850_1001547 3300002076 Bacteria 3255
29 JGI24744J21845_10007253 3300002077 Bacteria 2291
30 JGI24744J21845_10009430 3300002077 Bacteria 2002
31 JGI24744J21845_10029022 3300002077 Bacteria 1064
32 JGI24035J26624_1000384 3300002126 Bacteria 4145
33 JGI24034J26672_10000450 3300002239 Bacteria 5314
34 JGI24742J22300_10000100 3300002244 Bacteria 12634
35 JGI24751J29686_10008012 3300002459 Bacteria 2159
36 JGI25151J46595_10000047 3300003187 Bacteria 166938
37 JGI25151J46595_10000086 3300003187 Bacteria 126250
38 JGI25165J46597_1000003 3300003214 Bacteria 694080
39 JGI25153J46596_10016624 3300003215 Bacteria 2936
40 Ga0007417J51691_1068927 3300003544 Bacteria 639
41 Ga0055526_1000102 3300003771 Bacteria 74957
42 Ga0055524_1000352 3300003775 Bacteria 41872
43 Ga0055534_1064744 3300003784 Bacteria 505
44 Ga0055531_10008796 3300003794 Bacteria 5262
45 JGI25405J52794_10005629 3300003911 Bacteria 2267
46 JGI25405J52794_10040755 3300003911 Bacteria 982
47 JGI25405J52794_10064746 3300003911 Bacteria 793
48 Ga0065165_1003966 3300005262 Bacteria 9697
49 Ga0065714_10210453 3300005288 Bacteria 868
50 Ga0065704_10078881 3300005289 Bacteria 4311
51 Ga0065704_10226081 3300005289 Bacteria 1058
52 Ga0065712_10000705 3300005290 Bacteria 9899
53 Ga0065712_10085237 3300005290 Bacteria 2698
54 Ga0065712_10125464 3300005290 Bacteria 1613
55 Ga0065715_10003686 3300005293 Bacteria 6503
56 Ga0065715_10090522 3300005293 Bacteria 6866
57 Ga0065715_10170204 3300005293 Bacteria 1553
58 Ga0065707_10257648 3300005295 Bacteria 1106
59 Ga0070658_10026441 3300005327 Bacteria 4655
60 Ga0070658_10027112 3300005327 Bacteria 4599
61 Ga0070658_10038663 3300005327 Bacteria 3847
62 Ga0070676_10001250 3300005328 Bacteria 12808
63 Ga0070676_10040362 3300005328 Bacteria 2703
64 Ga0070676_10137593 3300005328 Bacteria 1551
65 Ga0070676_10175776 3300005328 Bacteria 1388
66 Ga0070676_10353966 3300005328 Bacteria 1010
67 Ga0070683_100148475 3300005329 Bacteria 2222
68 Ga0070683_100164558 3300005329 Bacteria 2104
69 Ga0070683_100187663 3300005329 Bacteria 1963
70 Ga0070683_100199397 3300005329 Bacteria 1900
71 Ga0070683_100598761 3300005329 Bacteria 1055
72 Ga0070683_101034666 3300005329 Bacteria 788
73 Ga0070683_101545633 3300005329 Bacteria 638
74 Ga0070690_100008879 3300005330 Bacteria 5806
75 Ga0070690_100029592 3300005330 Bacteria 3398
76 Ga0070690_100119144 3300005330 Bacteria 1770
77 Ga0070690_100125557 3300005330 Bacteria 1727
78 Ga0070690_100270483 3300005330 Bacteria 1208
79 Ga0070690_100313837 3300005330 Bacteria 1128
80 Ga0070670_100011383 3300005331 Bacteria 7606
81 Ga0070670_100032043 3300005331 Bacteria 4526
82 Ga0070670_100414291 3300005331 Bacteria 1190
83 Ga0070670_100615852 3300005331 Bacteria 972
84 Ga0070677_10000055 3300005333 Bacteria 35005
85 Ga0070677_10305642 3300005333 Bacteria 810
86 Ga0068869_100001739 3300005334 Bacteria 13017
87 Ga0068869_100005143 3300005334 Bacteria 8205
88 Ga0068869_100035364 3300005334 Bacteria 3539
89 Ga0068869_100625513 3300005334 Bacteria 912
90 Ga0068869_100934871 3300005334 Bacteria 752
91 Ga0070666_10030353 3300005335 Bacteria 3560
92 Ga0070666_10041771 3300005335 Bacteria 3065
93 Ga0070666_10044519 3300005335 Bacteria 2973
94 Ga0070666_10053330 3300005335 Bacteria 2727
95 Ga0070666_10187419 3300005335 Bacteria 1453
96 Ga0070666_10255372 3300005335 Bacteria 1241
97 Ga0070666_10710186 3300005335 Bacteria 737
98 Ga0070666_10810409 3300005335 Bacteria 690
99 Ga0070680_100051886 3300005336 Bacteria 3347
100 Ga0070680_100053620 3300005336 Bacteria 3292
101 Ga0070680_100097846 3300005336 Bacteria 2433
102 Ga0070680_100249054 3300005336 Bacteria 1502
103 Ga0070680_100256283 3300005336 Bacteria 1480
104 Ga0070680_100345980 3300005336 Bacteria 1264
105 Ga0070680_100703492 3300005336 Bacteria 869
106 Ga0070682_100008777 3300005337 Bacteria 5704
107 Ga0070682_100060665 3300005337 Bacteria 2392
108 Ga0070682_100286001 3300005337 Bacteria 1204
109 Ga0070682_100398109 3300005337 Bacteria 1041
110 Ga0070682_100544002 3300005337 Bacteria 907
111 Ga0068868_100002440 3300005338 Bacteria 12889
112 Ga0068868_100188069 3300005338 Bacteria 1716
113 Ga0068868_100275076 3300005338 Bacteria 1424
114 Ga0068868_100570421 3300005338 Bacteria 999
115 Ga0068868_101084750 3300005338 Bacteria 736
116 Ga0068868_101217280 3300005338 Bacteria 697
117 Ga0070660_100009251 3300005339 Bacteria 6923
118 Ga0070660_100056274 3300005339 Bacteria 3042
119 Ga0070660_100500742 3300005339 Bacteria 1011
120 Ga0070660_100880426 3300005339 Bacteria 755
121 Ga0070660_100885150 3300005339 Bacteria 753
122 Ga0070689_100003427 3300005340 Bacteria 10550
123 Ga0070689_100042064 3300005340 Bacteria 3508
124 Ga0070689_100056550 3300005340 Bacteria 3042
125 Ga0070689_100382832 3300005340 Bacteria 1186
126 Ga0070689_100725162 3300005340 Bacteria 870
127 Ga0070691_10018238 3300005341 Bacteria 3234
128 Ga0070691_10022689 3300005341 Bacteria 2913
129 Ga0070691_10246927 3300005341 Bacteria 956
130 Ga0070691_10730788 3300005341 Bacteria 597
131 Ga0070687_100001219 3300005343 Bacteria 8915
132 Ga0070687_100120563 3300005343 Bacteria 1499
133 Ga0070687_100143043 3300005343 Bacteria 1395
134 Ga0070687_100291039 3300005343 Bacteria 1032
135 Ga0070661_100000019 3300005344 Bacteria 132428
136 Ga0070661_100005369 3300005344 Bacteria 8834
137 Ga0070661_100140071 3300005344 Bacteria 1822
138 Ga0070661_100164493 3300005344 Bacteria 1682
139 Ga0070661_100279043 3300005344 Bacteria 1296
140 Ga0070661_100362815 3300005344 Bacteria 1139
141 Ga0070692_10002445 3300005345 Bacteria 7215
142 Ga0070692_10029257 3300005345 Bacteria 2744
143 Ga0070668_100010381 3300005347 Bacteria 6918
144 Ga0070668_100018336 3300005347 Bacteria 5254
145 Ga0070668_100090379 3300005347 Bacteria 2412
146 Ga0070668_100191925 3300005347 Bacteria 1673
147 Ga0070668_100514223 3300005347 Bacteria 1038
148 Ga0070669_100003432 3300005353 Bacteria 11417
149 Ga0070669_100037713 3300005353 Bacteria 3506
150 Ga0070669_100097844 3300005353 Bacteria 2209
151 Ga0070669_100115265 3300005353 Bacteria 2044
152 Ga0070669_100586699 3300005353 Bacteria 932
153 Ga0070669_100680143 3300005353 Bacteria 868
154 Ga0070669_101579383 3300005353 Bacteria 571
155 Ga0070675_100009751 3300005354 Bacteria 7479
156 Ga0070675_100013224 3300005354 Bacteria 6485
157 Ga0070675_100063934 3300005354 Bacteria 3042
158 Ga0070675_100249883 3300005354 Bacteria 1552
159 Ga0070671_100000344 3300005355 Bacteria 31796
160 Ga0070671_100023576 3300005355 Bacteria 5038
161 Ga0070671_100043720 3300005355 Bacteria 3723
162 Ga0070671_100075836 3300005355 Bacteria 2809
163 Ga0070671_100880547 3300005355 Bacteria 782
164 Ga0070674_100000250 3300005356 Bacteria 26734
165 Ga0070674_100165387 3300005356 Bacteria 1682
166 Ga0070674_100443704 3300005356 Bacteria 1070
167 Ga0070673_100001701 3300005364 Bacteria 13067
168 Ga0070673_100198620 3300005364 Bacteria 1726
169 Ga0070673_100199611 3300005364 Bacteria 1722
170 Ga0070673_100216864 3300005364 Bacteria 1654
171 Ga0070673_100328174 3300005364 Bacteria 1353
172 Ga0070673_101077394 3300005364 Bacteria 750
173 Ga0070688_100005899 3300005365 Bacteria 6485
174 Ga0070688_100011287 3300005365 Bacteria 4961
175 Ga0070688_100069914 3300005365 Bacteria 2243
176 Ga0070659_100015535 3300005366 Bacteria 5701
177 Ga0070659_100066094 3300005366 Bacteria 2865
178 Ga0070659_100072266 3300005366 Bacteria 2744
179 Ga0070659_100274884 3300005366 Bacteria 1400
180 Ga0070659_100345762 3300005366 Bacteria 1247
181 Ga0070659_100369380 3300005366 Bacteria 1206
182 Ga0070667_100009616 3300005367 Bacteria 8018
183 Ga0070667_100010027 3300005367 Bacteria 7850
184 Ga0070667_100015965 3300005367 Bacteria 6213
185 Ga0070667_100170241 3300005367 Bacteria 1923
186 Ga0070667_100383742 3300005367 Bacteria 1276
187 Ga0070703_10003768 3300005406 Bacteria 4290
188 Ga0070709_10002940 3300005434 Bacteria 9174
189 Ga0070709_10058623 3300005434 Bacteria 2442
190 Ga0070709_10075450 3300005434 Bacteria 2188
191 Ga0070709_10080351 3300005434 Bacteria 2126
192 Ga0070714_100038980 3300005435 Bacteria 3998
193 Ga0070714_100044928 3300005435 Bacteria 3741
194 Ga0070714_100064144 3300005435 Bacteria 3161
195 Ga0070714_100167380 3300005435 Bacteria 1992
196 Ga0070714_100978931 3300005435 Bacteria 823
197 Ga0070714_101342156 3300005435 Bacteria 698
198 Ga0070713_100005484 3300005436 Bacteria 8680
199 Ga0070713_100100286 3300005436 Bacteria 2506
200 Ga0070713_100100653 3300005436 Bacteria 2502
201 Ga0070713_100457250 3300005436 Bacteria 1200
202 Ga0070713_100630439 3300005436 Bacteria 1020
203 Ga0070713_101097523 3300005436 Bacteria 769
204 Ga0070710_10008043 3300005437 Bacteria 5126
205 Ga0070710_10093518 3300005437 Bacteria 1777
206 Ga0070701_10002806 3300005438 Bacteria 6775
207 Ga0070701_10193715 3300005438 Bacteria 1197
208 Ga0070711_100002519 3300005439 Bacteria 10469
209 Ga0070711_100079918 3300005439 Bacteria 2327
210 Ga0070711_100239710 3300005439 Bacteria 1417
211 Ga0070711_100451133 3300005439 Bacteria 1053
212 Ga0070711_100648831 3300005439 Bacteria 885
213 Ga0070711_101384736 3300005439 Bacteria 612
214 Ga0070705_100014699 3300005440 Bacteria 4033
215 Ga0070705_100042721 3300005440 Bacteria 2593
216 Ga0070705_100077733 3300005440 Bacteria 2027
217 Ga0070700_100045586 3300005441 Bacteria 2705
218 Ga0070700_100141319 3300005441 Bacteria 1636
219 Ga0070700_100283134 3300005441 Bacteria 1203
220 Ga0070700_100380964 3300005441 Bacteria 1055
221 Ga0070694_100021143 3300005444 Bacteria 4155
222 Ga0070694_100113915 3300005444 Bacteria 1930
223 Ga0070694_100533491 3300005444 Bacteria 938
224 Ga0070694_100613062 3300005444 Bacteria 877
225 Ga0070694_100635640 3300005444 Bacteria 863
226 Ga0070708_100032307 3300005445 Bacteria 4538
227 Ga0070708_100062532 3300005445 Bacteria 3330
228 Ga0070708_100998906 3300005445 Bacteria 785
229 Ga0070663_100029594 3300005455 Bacteria 3744
230 Ga0070663_100063184 3300005455 Bacteria 2672
231 Ga0070663_100114973 3300005455 Bacteria 2026
232 Ga0070663_100539499 3300005455 Bacteria 973
233 Ga0070663_100898540 3300005455 Bacteria 765
234 Ga0070678_100000784 3300005456 Bacteria 15959
235 Ga0070678_100149910 3300005456 Bacteria 1877
236 Ga0070678_100330483 3300005456 Bacteria 1304
237 Ga0070678_100344505 3300005456 Bacteria 1279
238 Ga0070678_100432434 3300005456 Bacteria 1149
239 Ga0070662_100050231 3300005457 Bacteria 3008
240 Ga0070662_100062081 3300005457 Bacteria 2729
241 Ga0070662_100078824 3300005457 Bacteria 2448
242 Ga0070681_10021719 3300005458 Bacteria 6436
243 Ga0070681_10053171 3300005458 Bacteria 4035
244 Ga0070681_10156394 3300005458 Bacteria 2204
245 Ga0070681_10165291 3300005458 Bacteria 2136
246 Ga0070681_10226633 3300005458 Bacteria 1783
247 Ga0070681_10469003 3300005458 Bacteria 1171
248 Ga0068867_100002792 3300005459 Bacteria 12281
249 Ga0068867_100005970 3300005459 Bacteria 8636
250 Ga0068867_100021169 3300005459 Bacteria 4638
251 Ga0068867_100032862 3300005459 Bacteria 3753
252 Ga0068867_100406759 3300005459 Bacteria 1149
253 Ga0068867_100981517 3300005459 Bacteria 765
254 Ga0070685_10001307 3300005466 Bacteria 13125
255 Ga0070685_10004363 3300005466 Bacteria 7137
256 Ga0070685_10023513 3300005466 Bacteria 3375
257 Ga0070685_10261202 3300005466 Bacteria 1151
258 Ga0070707_100065762 3300005468 Bacteria 3484
259 Ga0070707_101006386 3300005468 Bacteria 799
260 Ga0070698_100045789 3300005471 Bacteria 4476
261 Ga0070698_100291936 3300005471 Bacteria 1562
262 Ga0074259_10113202 3300005507 Bacteria 953
263 Ga0070699_100089245 3300005518 Bacteria 2693
264 Ga0070679_100019810 3300005530 Bacteria 6550
265 Ga0070679_100029886 3300005530 Bacteria 5376
266 Ga0070679_100065568 3300005530 Bacteria 3620
267 Ga0070679_100075069 3300005530 Bacteria 3371
268 Ga0070679_100125965 3300005530 Bacteria 2544
269 Ga0070679_100130785 3300005530 Bacteria 2491
270 Ga0070679_100138507 3300005530 Bacteria 2414
271 Ga0070679_100255315 3300005530 Bacteria 1708
272 Ga0070679_100310154 3300005530 Bacteria 1528
273 Ga0070679_100478903 3300005530 Bacteria 1189
274 Ga0070679_101207180 3300005530 Bacteria 702
275 Ga0070684_100003800 3300005535 Bacteria 11409
276 Ga0070684_100074354 3300005535 Bacteria 2995
277 Ga0070684_100097748 3300005535 Bacteria 2619
278 Ga0070684_100138507 3300005535 Bacteria 2199
279 Ga0070684_100170317 3300005535 Bacteria 1978
280 Ga0070684_100698657 3300005535 Bacteria 945
281 Ga0070697_100461969 3300005536 Bacteria 1107
282 Ga0070697_101029753 3300005536 Bacteria 732
283 Ga0068853_100011082 3300005539 Bacteria 7312
284 Ga0068853_100024870 3300005539 Bacteria 5024
285 Ga0068853_100037962 3300005539 Bacteria 4101
286 Ga0068853_100066989 3300005539 Bacteria 3119
287 Ga0068853_100195671 3300005539 Bacteria 1839
288 Ga0068853_100236915 3300005539 Bacteria 1671
289 Ga0068853_100237056 3300005539 Bacteria 1671
290 Ga0068853_100243596 3300005539 Bacteria 1648
291 Ga0068853_100527773 3300005539 Bacteria 1116
292 Ga0068853_100652430 3300005539 Bacteria 1002
293 Ga0068853_100744453 3300005539 Bacteria 936
294 Ga0068853_101170748 3300005539 Bacteria 742
295 Ga0070672_100002659 3300005543 Bacteria 11417
296 Ga0070672_100019800 3300005543 Bacteria 4893
297 Ga0070672_100079029 3300005543 Bacteria 2632
298 Ga0070672_100368657 3300005543 Bacteria 1227
299 Ga0070672_100454588 3300005543 Bacteria 1103
300 Ga0070672_100728972 3300005543 Bacteria 869
301 Ga0070686_100005374 3300005544 Bacteria 7086
302 Ga0070686_100006315 3300005544 Bacteria 6582
303 Ga0070686_100038764 3300005544 Bacteria 2964
304 Ga0070686_100418755 3300005544 Bacteria 1023
305 Ga0070686_100444268 3300005544 Bacteria 995
306 Ga0070695_100048751 3300005545 Bacteria 2709
307 Ga0070695_100058121 3300005545 Bacteria 2500
308 Ga0070695_100176070 3300005545 Bacteria 1512
309 Ga0070696_100084241 3300005546 Bacteria 2255
310 Ga0070696_100099287 3300005546 Bacteria 2083
311 Ga0070696_100149510 3300005546 Bacteria 1713
312 Ga0070696_100156776 3300005546 Bacteria 1675
313 Ga0070696_100216148 3300005546 Bacteria 1436
314 Ga0070696_100510550 3300005546 Bacteria 958
315 Ga0070696_100949167 3300005546 Bacteria 716
316 Ga0070696_101264139 3300005546 Bacteria 625
317 Ga0070693_100051208 3300005547 Bacteria 2364
318 Ga0070693_100052511 3300005547 Bacteria 2337
319 Ga0070693_100096064 3300005547 Bacteria 1796
320 Ga0070693_100148217 3300005547 Bacteria 1483
321 Ga0070693_100296266 3300005547 Bacteria 1089
322 Ga0070693_100414919 3300005547 Bacteria 937
323 Ga0070665_100001666 3300005548 Bacteria 25601
324 Ga0070665_100064057 3300005548 Bacteria 3686
325 Ga0070665_100069966 3300005548 Bacteria 3516
326 Ga0070665_100078425 3300005548 Bacteria 3309
327 Ga0070665_100140532 3300005548 Bacteria 2418
328 Ga0070665_100148543 3300005548 Bacteria 2346
329 Ga0070665_100251134 3300005548 Bacteria 1769
330 Ga0070665_100296120 3300005548 Bacteria 1620
331 Ga0070665_100372487 3300005548 Bacteria 1435
332 Ga0070665_100395612 3300005548 Bacteria 1389
333 Ga0070665_100819901 3300005548 Bacteria 943
334 Ga0070665_101008890 3300005548 Bacteria 844
335 Ga0070665_101173653 3300005548 Bacteria 779
336 Ga0070665_101269534 3300005548 Bacteria 747
337 Ga0070704_100006508 3300005549 Bacteria 6885
338 Ga0070704_100067471 3300005549 Bacteria 2583
339 Ga0068855_100008197 3300005563 Bacteria 12629
340 Ga0068855_100012377 3300005563 Bacteria 10304
341 Ga0068855_100044569 3300005563 Bacteria 5249
342 Ga0068855_100086777 3300005563 Bacteria 3618
343 Ga0068855_100199544 3300005563 Bacteria 2253
344 Ga0068855_100206748 3300005563 Bacteria 2208
345 Ga0068855_100257719 3300005563 Bacteria 1944
346 Ga0068855_100495253 3300005563 Bacteria 1329
347 Ga0068855_100582375 3300005563 Bacteria 1208
348 Ga0068855_100848900 3300005563 Bacteria 968
349 Ga0068855_100953411 3300005563 Bacteria 904
350 Ga0068855_101020036 3300005563 Bacteria 868
351 Ga0070664_100016247 3300005564 Bacteria 6102
352 Ga0070664_100106987 3300005564 Bacteria 2438
353 Ga0070664_100161050 3300005564 Bacteria 1985
354 Ga0070664_100279846 3300005564 Bacteria 1504
355 Ga0070664_100857165 3300005564 Bacteria 851
356 Ga0068857_100007028 3300005577 Bacteria 9689
357 Ga0068857_100088413 3300005577 Bacteria 2772
358 Ga0068857_100139258 3300005577 Bacteria 2193
359 Ga0068857_100250095 3300005577 Bacteria 1625
360 Ga0068857_100537011 3300005577 Bacteria 1100
361 Ga0068857_100569377 3300005577 Bacteria 1068
362 Ga0068854_100003980 3300005578 Bacteria 9266
363 Ga0068854_100142780 3300005578 Bacteria 1839
364 Ga0068854_100430946 3300005578 Bacteria 1097
365 Ga0068854_100594912 3300005578 Bacteria 944
366 Ga0068856_100000406 3300005614 Bacteria 47326
367 Ga0068856_100181218 3300005614 Bacteria 2119
368 Ga0068856_100199039 3300005614 Bacteria 2018
369 Ga0068856_100408200 3300005614 Bacteria 1378
370 Ga0068856_100917226 3300005614 Bacteria 895
371 Ga0068856_100958480 3300005614 Bacteria 874
372 Ga0068856_101079300 3300005614 Bacteria 820
373 Ga0070702_100000099 3300005615 Bacteria 25765
374 Ga0070702_100008907 3300005615 Bacteria 4884
375 Ga0070702_100343183 3300005615 Bacteria 1049
376 Ga0070702_100358263 3300005615 Bacteria 1030
377 Ga0068852_100015801 3300005616 Bacteria 5868
378 Ga0068852_100026623 3300005616 Bacteria 4704
379 Ga0068852_100057377 3300005616 Bacteria 3369
380 Ga0068852_100173312 3300005616 Bacteria 2024
381 Ga0068852_100297706 3300005616 Bacteria 1560
382 Ga0068852_100389575 3300005616 Bacteria 1368
383 Ga0068852_100495730 3300005616 Bacteria 1216
384 Ga0068859_100002395 3300005617 Bacteria 19092
385 Ga0068859_100072467 3300005617 Bacteria 3481
386 Ga0068859_100094856 3300005617 Bacteria 3036
387 Ga0068859_100124644 3300005617 Bacteria 2644
388 Ga0068859_100617819 3300005617 Bacteria 1176
389 Ga0068859_101096576 3300005617 Bacteria 876
390 Ga0068864_100001957 3300005618 Bacteria 16937
391 Ga0068864_100021360 3300005618 Bacteria 5423
392 Ga0068864_100075862 3300005618 Bacteria 2936
393 Ga0068864_100467562 3300005618 Bacteria 1208
394 Ga0068864_101158573 3300005618 Bacteria 771
395 Ga0068864_101858767 3300005618 Bacteria 608
396 Ga0068866_10001585 3300005718 Bacteria 9648
397 Ga0068866_10008946 3300005718 Bacteria 4239
398 Ga0068866_10039117 3300005718 Bacteria 2340
399 Ga0068866_10141830 3300005718 Bacteria 1380
400 Ga0068866_10219924 3300005718 Bacteria 1145
401 Ga0068866_10778945 3300005718 Bacteria 663
402 Ga0068861_100000354 3300005719 Bacteria 26182
403 Ga0068861_100021977 3300005719 Bacteria 4590
404 Ga0068861_100061718 3300005719 Bacteria 2877
405 Ga0068861_100345957 3300005719 Bacteria 1302
406 Ga0068861_100727202 3300005719 Bacteria 925
407 Ga0068861_101316366 3300005719 Bacteria 703
408 Ga0068851_10105288 3300005834 Bacteria 1501
409 Ga0068851_10565114 3300005834 Bacteria 689
410 Ga0068851_10651429 3300005834 Bacteria 645
411 Ga0068870_10000165 3300005840 Bacteria 23495
412 Ga0068870_10049113 3300005840 Bacteria 2224
413 Ga0068870_10170947 3300005840 Bacteria 1297
414 Ga0068870_10241834 3300005840 Bacteria 1115
415 Ga0068863_100001449 3300005841 Bacteria 23543
416 Ga0068863_100016627 3300005841 Bacteria 7059
417 Ga0068863_100385215 3300005841 Bacteria 1369
418 Ga0068863_102342338 3300005841 Bacteria 544
419 Ga0068858_100018513 3300005842 Bacteria 6520
420 Ga0068858_100045467 3300005842 Bacteria 4069
421 Ga0068858_100052996 3300005842 Bacteria 3754
422 Ga0068858_100360279 3300005842 Bacteria 1394
423 Ga0068858_100390938 3300005842 Bacteria 1335
424 Ga0068858_100411830 3300005842 Bacteria 1299
425 Ga0068858_100710224 3300005842 Bacteria 978
426 Ga0068858_100936687 3300005842 Bacteria 848
427 Ga0068860_100001477 3300005843 Bacteria 25388
428 Ga0068860_100015564 3300005843 Bacteria 7429
429 Ga0068860_100105189 3300005843 Bacteria 2695
430 Ga0068860_100472835 3300005843 Bacteria 1248
431 Ga0068862_100014775 3300005844 Bacteria 6485
432 Ga0068862_100062072 3300005844 Bacteria 3213
433 Ga0068862_100082075 3300005844 Bacteria 2797
434 Ga0068862_100327025 3300005844 Bacteria 1416
435 Ga0081455_10000327 3300005937 Bacteria 62253
436 Ga0081455_10001293 3300005937 Bacteria 31137
437 Ga0081455_10615716 3300005937 Bacteria 705
438 Ga0081538_10014654 3300005981 Bacteria 6126
439 Ga0081540_1000108 3300005983 Bacteria 88825
440 Ga0081540_1019974 3300005983 Bacteria 4047
441 Ga0081540_1055343 3300005983 Bacteria 1933
442 Ga0081540_1096624 3300005983 Bacteria 1285
443 Ga0081540_1110301 3300005983 Bacteria 1165
444 Ga0081539_10209184 3300005985 Bacteria 895
445 Ga0081539_10232325 3300005985 Bacteria 832
446 Ga0070717_10001121 3300006028 Bacteria 18099
447 Ga0070717_10038847 3300006028 Bacteria 3870
448 Ga0070717_10160743 3300006028 Bacteria 1948
449 Ga0070717_10447794 3300006028 Bacteria 1163
450 Ga0075365_10000253 3300006038 Bacteria 18331
451 Ga0075365_10006417 3300006038 Bacteria 6470
452 Ga0075365_10182519 3300006038 Bacteria 1467
453 Ga0075365_10244030 3300006038 Bacteria 1261
454 Ga0075365_10254072 3300006038 Bacteria 1235
455 Ga0075365_10480691 3300006038 Bacteria 878
456 Ga0075368_10019183 3300006042 Bacteria 2580
457 Ga0075368_10162350 3300006042 Bacteria 936
458 Ga0075368_10291057 3300006042 Bacteria 703
459 Ga0075363_100111876 3300006048 Bacteria 1518
460 Ga0075363_100401880 3300006048 Bacteria 805
461 Ga0075363_100522274 3300006048 Bacteria 706
462 Ga0075363_100528928 3300006048 Bacteria 702
463 Ga0075363_100688219 3300006048 Bacteria 617
464 Ga0075364_10374816 3300006051 Bacteria 971
465 Ga0075432_10047301 3300006058 Bacteria 1512
466 Ga0070715_10026313 3300006163 Bacteria 2314
467 Ga0070715_10084938 3300006163 Bacteria 1445
468 Ga0070715_10459969 3300006163 Bacteria 720
469 Ga0070715_10780685 3300006163 Bacteria 578
470 Ga0070716_100001226 3300006173 Bacteria 11292
471 Ga0070716_100014276 3300006173 Bacteria 4066
472 Ga0070716_100161095 3300006173 Bacteria 1454
473 Ga0070716_100203854 3300006173 Bacteria 1317
474 Ga0070716_100345556 3300006173 Bacteria 1051
475 Ga0070716_100655030 3300006173 Bacteria 797
476 Ga0070712_100000244 3300006175 Bacteria 30649
477 Ga0070712_100000983 3300006175 Bacteria 17123
478 Ga0070712_100021619 3300006175 Bacteria 4228
479 Ga0070712_100052038 3300006175 Bacteria 2854
480 Ga0070712_100109751 3300006175 Bacteria 2057
481 Ga0070712_100165502 3300006175 Bacteria 1711
482 Ga0070712_100240294 3300006175 Bacteria 1442
483 Ga0070712_100444422 3300006175 Bacteria 1078
484 Ga0070712_100502869 3300006175 Bacteria 1016
485 Ga0075362_10035265 3300006177 Bacteria 2183
486 Ga0075362_10059826 3300006177 Bacteria 1721
487 Ga0075362_10064177 3300006177 Bacteria 1666
488 Ga0075362_10212101 3300006177 Bacteria 945
489 Ga0075362_10238835 3300006177 Bacteria 892
490 Ga0075367_10002242 3300006178 Bacteria 8739
491 Ga0075367_10008688 3300006178 Bacteria 5274
492 Ga0075367_10315627 3300006178 Bacteria 985
493 Ga0075369_10004804 3300006186 Bacteria 5025
494 Ga0075369_10034041 3300006186 Bacteria 2161
495 Ga0075369_10101868 3300006186 Bacteria 1289
496 Ga0075369_10134756 3300006186 Bacteria 1124
497 Ga0075366_10002628 3300006195 Bacteria 9242
498 Ga0075366_10032261 3300006195 Bacteria 3084
499 Ga0075366_10150985 3300006195 Bacteria 1407
500 Ga0075366_10430188 3300006195 Bacteria 814
501 Ga0075366_10467746 3300006195 Bacteria 778
502 Ga0075366_10519606 3300006195 Bacteria 736
503 Ga0075366_10539806 3300006195 Bacteria 722
504 Ga0097621_100000841 3300006237 Bacteria 21627
505 Ga0097621_100001124 3300006237 Bacteria 18635
506 Ga0097621_100012671 3300006237 Bacteria 6261
507 Ga0097621_100021911 3300006237 Bacteria 4951
508 Ga0097621_100058357 3300006237 Bacteria 3158
509 Ga0097621_100170557 3300006237 Bacteria 1875
510 Ga0097621_100274064 3300006237 Bacteria 1483
511 Ga0097621_100423828 3300006237 Bacteria 1195
512 Ga0075370_10080473 3300006353 Bacteria 1872
513 Ga0075370_10316348 3300006353 Bacteria 929
514 Ga0075370_10316890 3300006353 Bacteria 929
515 Ga0075370_10544435 3300006353 Bacteria 702
516 Ga0068871_100000243 3300006358 Bacteria 37961
517 Ga0068871_100001352 3300006358 Bacteria 16421
518 Ga0068871_100052112 3300006358 Bacteria 3313
519 Ga0068871_100168956 3300006358 Bacteria 1873
520 Ga0068871_100181937 3300006358 Bacteria 1807
521 Ga0068871_100249544 3300006358 Bacteria 1545
522 Ga0068871_100274060 3300006358 Bacteria 1474
523 Ga0068871_100464386 3300006358 Bacteria 1136
524 Ga0068871_101372948 3300006358 Bacteria 666
525 Ga0075428_100048667 3300006844 Bacteria 4653
526 Ga0075428_100441727 3300006844 Bacteria 1393
527 Ga0075428_100924867 3300006844 Bacteria 924
528 Ga0075428_101120323 3300006844 Bacteria 831
529 Ga0075430_100000370 3300006846 Bacteria 32941
530 Ga0075430_100018050 3300006846 Bacteria 6005
531 Ga0075431_100111850 3300006847 Bacteria 2818
532 Ga0075431_100337906 3300006847 Bacteria 1516
533 Ga0075431_100658515 3300006847 Bacteria 1027
534 Ga0075433_10010812 3300006852 Bacteria 7341
535 Ga0075433_10137753 3300006852 Bacteria 2169
536 Ga0075433_10195773 3300006852 Bacteria 1798
537 Ga0075434_100029863 3300006871 Bacteria 5366
538 Ga0075434_100041047 3300006871 Bacteria 4582
539 Ga0075434_100287613 3300006871 Bacteria 1664
540 Ga0075434_101223636 3300006871 Bacteria 763
541 Ga0075434_102073236 3300006871 Bacteria 573
542 Ga0075434_102092829 3300006871 Bacteria 571
543 Ga0075429_100580959 3300006880 Bacteria 982
544 Ga0075429_101058960 3300006880 Bacteria 709
545 Ga0075429_101625113 3300006880 Bacteria 562
546 Ga0068865_100002923 3300006881 Bacteria 10190
547 Ga0068865_100005706 3300006881 Bacteria 7564
548 Ga0068865_100035796 3300006881 Bacteria 3342
549 Ga0068865_100224391 3300006881 Bacteria 1470
550 Ga0068865_100473200 3300006881 Bacteria 1040
551 Ga0075436_100000154 3300006914 Bacteria 42705
552 Ga0075436_100137482 3300006914 Bacteria 1716
553 Ga0075436_100194953 3300006914 Bacteria 1434
554 Ga0075436_100482059 3300006914 Bacteria 906
555 Ga0097620_100002395 3300006931 Bacteria 19092
556 Ga0097620_100072465 3300006931 Bacteria 3481
557 Ga0097620_100094848 3300006931 Bacteria 3036
558 Ga0097620_100124645 3300006931 Bacteria 2644
559 Ga0097620_100554409 3300006931 Bacteria 1244
560 Ga0097620_100617827 3300006931 Bacteria 1176
561 Ga0097620_101096581 3300006931 Bacteria 876
562 Ga0099826_10007363 3300006948 Bacteria 8121
563 Ga0075435_100067160 3300007076 Bacteria 2919
564 Ga0075435_100069794 3300007076 Bacteria 2866
565 Ga0075435_100545496 3300007076 Bacteria 1004
566 Ga0075435_101245873 3300007076 Bacteria 651
567 Ga0075435_101287641 3300007076 Bacteria 640
568 Ga0099795_10210522 3300007788 Bacteria 824
569 Ga0105251_10132490 3300009011 Bacteria 1129
570 Ga0105244_10047531 3300009036 Bacteria 2200
571 Ga0105250_10069439 3300009092 Bacteria 1423
572 Ga0105240_10000091 3300009093 Bacteria 182507
573 Ga0105240_10170039 3300009093 Bacteria 2582
574 Ga0105240_10173356 3300009093 Bacteria 2552
575 Ga0105240_10320690 3300009093 Bacteria 1766
576 Ga0105240_10481483 3300009093 Bacteria 1383
577 Ga0105240_10579113 3300009093 Bacteria 1238
578 Ga0105240_10748525 3300009093 Bacteria 1063
579 Ga0105240_10788767 3300009093 Bacteria 1030
580 Ga0105240_11013378 3300009093 Bacteria 887
581 Ga0105240_11287149 3300009093 Bacteria 771
582 Ga0111539_10025567 3300009094 Bacteria 7237
583 Ga0111539_10055658 3300009094 Bacteria 4703
584 Ga0111539_10190643 3300009094 Bacteria 2392
585 Ga0111539_10658795 3300009094 Bacteria 1219
586 Ga0105245_10004161 3300009098 Bacteria 12852
587 Ga0105245_10194373 3300009098 Bacteria 1945
588 Ga0105245_10202644 3300009098 Bacteria 1906
589 Ga0105245_10402780 3300009098 Bacteria 1368
590 Ga0105245_11039365 3300009098 Bacteria 864
591 Ga0105245_12557584 3300009098 Bacteria 564
592 Ga0105247_10005197 3300009101 Bacteria 8229
593 Ga0105247_10040176 3300009101 Bacteria 2859
594 Ga0105247_10049429 3300009101 Bacteria 2586
595 Ga0105247_10107846 3300009101 Bacteria 1788
596 Ga0105247_10311757 3300009101 Bacteria 1095
597 Ga0105247_10636072 3300009101 Bacteria 795
598 Ga0105247_10647205 3300009101 Bacteria 789
599 Ga0114129_10109918 3300009147 Bacteria 3805
600 Ga0114129_10135209 3300009147 Bacteria 3383
601 Ga0114129_10237149 3300009147 Bacteria 2454
602 Ga0114129_11501824 3300009147 Bacteria 828
603 Ga0114129_11503238 3300009147 Bacteria 827
604 Ga0114129_11561835 3300009147 Bacteria 809
605 Ga0114129_12891134 3300009147 Bacteria 568
606 Ga0105243_10010549 3300009148 Bacteria 7016
607 Ga0105243_10015650 3300009148 Bacteria 5734
608 Ga0105243_10135945 3300009148 Bacteria 2091
609 Ga0105243_10170071 3300009148 Bacteria 1886
610 Ga0105243_10304173 3300009148 Bacteria 1446
611 Ga0105243_10351342 3300009148 Bacteria 1354
612 Ga0105243_10531602 3300009148 Bacteria 1120
613 Ga0105243_10947932 3300009148 Bacteria 859
614 Ga0105243_12256637 3300009148 Bacteria 581
615 Ga0105241_10002326 3300009174 Bacteria 14273
616 Ga0105241_10011311 3300009174 Bacteria 6543
617 Ga0105241_10168721 3300009174 Bacteria 1806
618 Ga0105241_10261128 3300009174 Bacteria 1472
619 Ga0105241_10336954 3300009174 Bacteria 1306
620 Ga0105241_10415320 3300009174 Bacteria 1183
621 Ga0105242_10000036 3300009176 Bacteria 91470
622 Ga0105242_10014436 3300009176 Bacteria 6120
623 Ga0105242_10050007 3300009176 Bacteria 3402
624 Ga0105242_10121938 3300009176 Bacteria 2238
625 Ga0105242_10197178 3300009176 Bacteria 1786
626 Ga0105242_10556096 3300009176 Bacteria 1101
627 Ga0105242_11162946 3300009176 Bacteria 789
628 Ga0105242_11344786 3300009176 Bacteria 740
629 Ga0105248_10012352 3300009177 Bacteria 9424
630 Ga0105248_10065276 3300009177 Bacteria 4087
631 Ga0105248_10067514 3300009177 Bacteria 4015
632 Ga0105248_10398023 3300009177 Bacteria 1551
633 Ga0105248_11070150 3300009177 Bacteria 911
634 Ga0105237_10022578 3300009545 Bacteria 6454
635 Ga0105237_10244885 3300009545 Bacteria 1794
636 Ga0105237_10329906 3300009545 Bacteria 1530
637 Ga0105237_10390996 3300009545 Bacteria 1395
638 Ga0105237_10414189 3300009545 Bacteria 1353
639 Ga0105237_10521250 3300009545 Bacteria 1195
640 Ga0105237_10579072 3300009545 Bacteria 1129
641 Ga0105237_10610602 3300009545 Bacteria 1098
642 Ga0105237_10636774 3300009545 Bacteria 1073
643 Ga0105237_11116579 3300009545 Bacteria 795
644 Ga0105238_10013730 3300009551 Bacteria 8184
645 Ga0105238_10052375 3300009551 Bacteria 4103
646 Ga0105238_10164597 3300009551 Bacteria 2193
647 Ga0105238_10198474 3300009551 Bacteria 1982
648 Ga0105238_10210749 3300009551 Bacteria 1919
649 Ga0105238_10435178 3300009551 Bacteria 1307
650 Ga0105238_10519077 3300009551 Bacteria 1194
651 Ga0105238_10723284 3300009551 Bacteria 1008
652 Ga0105238_10755623 3300009551 Bacteria 986
653 Ga0105238_10845925 3300009551 Bacteria 932
654 Ga0105238_10916218 3300009551 Bacteria 895
655 Ga0105238_10971212 3300009551 Bacteria 870
656 Ga0105238_11322479 3300009551 Bacteria 747
657 Ga0105238_11822837 3300009551 Bacteria 641
658 Ga0105249_10012949 3300009553 Bacteria 7360
659 Ga0105249_10071587 3300009553 Bacteria 3203
660 Ga0105249_10132524 3300009553 Bacteria 2381
661 Ga0105249_10409755 3300009553 Bacteria 1387
662 Ga0105249_11318830 3300009553 Bacteria 793
663 Ga0099796_10031323 3300010159 Bacteria 1734
664 Ga0099796_10095703 3300010159 Bacteria 1110
665 Ga0105239_10001368 3300010375 Bacteria 32749
666 Ga0105239_10010593 3300010375 Bacteria 10310
667 Ga0105239_10044590 3300010375 Bacteria 4861
668 Ga0105239_10180022 3300010375 Bacteria 2365
669 Ga0105239_10299664 3300010375 Bacteria 1810
670 Ga0105239_10330928 3300010375 Bacteria 1718
671 Ga0105239_10365864 3300010375 Bacteria 1629
672 Ga0105239_10369618 3300010375 Bacteria 1620
673 Ga0105239_10504509 3300010375 Bacteria 1376
674 Ga0105239_10932036 3300010375 Bacteria 997
675 Ga0105239_10977177 3300010375 Bacteria 973
676 Ga0105239_11490681 3300010375 Bacteria 782
677 Ga0105246_10000666 3300011119 Bacteria 19263
678 Ga0105246_10027737 3300011119 Bacteria 3714
679 Ga0105246_10052929 3300011119 Bacteria 2792
680 Ga0105246_10199853 3300011119 Bacteria 1553
681 Ga0105246_10377047 3300011119 Bacteria 1171
682 Ga0105246_10672648 3300011119 Bacteria 904
683 Ga0105246_11398775 3300011119 Bacteria 653
684 Ga0105246_12119292 3300011119 Bacteria 545
685 Ga0157321_1002565 3300012487 Bacteria 1021
686 Ga0157329_1010456 3300012491 Bacteria 728
687 Ga0157341_1005141 3300012494 Bacteria 972
688 Ga0157345_1004704 3300012498 Bacteria 1032
689 Ga0157314_1002125 3300012500 Bacteria 1371
690 Ga0157347_1003490 3300012502 Bacteria 1413
691 Ga0157313_1004446 3300012503 Bacteria 964
692 Ga0157315_1000717 3300012508 Bacteria 1616
693 Ga0157373_10058615 3300013100 Bacteria 2730
694 Ga0157373_10179986 3300013100 Bacteria 1488
695 Ga0157373_10200916 3300013100 Bacteria 1405
696 Ga0157373_10220314 3300013100 Bacteria 1339
697 Ga0157371_10005746 3300013102 Bacteria 10391
698 Ga0157371_10581906 3300013102 Bacteria 832
699 Ga0157370_10044538 3300013104 Bacteria 4263
700 Ga0157370_10250286 3300013104 Bacteria 1639
701 Ga0157370_10329113 3300013104 Bacteria 1409
702 Ga0157369_10003501 3300013105 Bacteria 18649
703 Ga0157369_10141190 3300013105 Bacteria 2549
704 Ga0157369_10443076 3300013105 Bacteria 1345
705 Ga0157369_10451625 3300013105 Bacteria 1331
706 Ga0157369_10756014 3300013105 Bacteria 1000
707 Ga0157369_10982849 3300013105 Bacteria 864
708 Ga0157369_11055180 3300013105 Bacteria 831
709 Ga0157369_11128870 3300013105 Bacteria 801
710 Ga0171463_1001 3300013249 Bacteria 1406070
711 Ga0157374_10005236 3300013296 Bacteria 10879
712 Ga0157374_10176078 3300013296 Bacteria 2088
713 Ga0157374_10293868 3300013296 Bacteria 1606
714 Ga0157374_10339671 3300013296 Bacteria 1491
715 Ga0157374_10891600 3300013296 Bacteria 907
716 Ga0157374_11448412 3300013296 Bacteria 710
717 Ga0157378_10000462 3300013297 Bacteria 38648
718 Ga0157378_10025132 3300013297 Bacteria 5248
719 Ga0157378_10050491 3300013297 Bacteria 3701
720 Ga0157378_10342232 3300013297 Bacteria 1459
721 Ga0157378_10636662 3300013297 Bacteria 1081
722 Ga0157378_10861997 3300013297 Bacteria 934
723 Ga0163162_10010706 3300013306 Bacteria 8921
724 Ga0163162_10062995 3300013306 Bacteria 3750
725 Ga0163162_10097014 3300013306 Bacteria 3036
726 Ga0163162_10370999 3300013306 Bacteria 1564
727 Ga0163162_10475748 3300013306 Bacteria 1380
728 Ga0163162_10640948 3300013306 Bacteria 1187
729 Ga0163162_10801590 3300013306 Bacteria 1059
730 Ga0157372_10444747 3300013307 Bacteria 1511
731 Ga0157372_11197676 3300013307 Bacteria 878
732 Ga0157372_11591447 3300013307 Bacteria 752
733 Ga0157375_10003826 3300013308 Bacteria 13052
734 Ga0157375_10014386 3300013308 Bacteria 7057
735 Ga0157375_10029710 3300013308 Bacteria 5144
736 Ga0157375_10046446 3300013308 Bacteria 4234
737 Ga0157375_10095419 3300013308 Bacteria 3045
738 Ga0157375_10834559 3300013308 Bacteria 1069
739 Ga0163163_10000002 3300014325 Bacteria 609846
740 Ga0163163_10006875 3300014325 Bacteria 9986
741 Ga0163163_10016380 3300014325 Bacteria 6886
742 Ga0163163_10106629 3300014325 Bacteria 2828
743 Ga0163163_10109840 3300014325 Bacteria 2785
744 Ga0157380_10000274 3300014326 Bacteria 30965
745 Ga0157380_10036448 3300014326 Bacteria 3805
746 Ga0157380_12239955 3300014326 Bacteria 610
747 Ga0157377_10007030 3300014745 Bacteria 5405
748 Ga0157377_10008998 3300014745 Bacteria 4889
749 Ga0157377_10220668 3300014745 Bacteria 1213
750 Ga0157377_10247728 3300014745 Bacteria 1153
751 Ga0157377_10712668 3300014745 Bacteria 730
752 Ga0157379_10002580 3300014968 Bacteria 15213
753 Ga0157379_10002641 3300014968 Bacteria 15074
754 Ga0157379_10028886 3300014968 Bacteria 4932
755 Ga0157379_10037035 3300014968 Bacteria 4349
756 Ga0157379_10144901 3300014968 Bacteria 2142
757 Ga0157379_10295511 3300014968 Bacteria 1476
758 Ga0157379_10399245 3300014968 Bacteria 1264
759 Ga0157379_10889691 3300014968 Bacteria 844
760 Ga0157379_11108840 3300014968 Bacteria 758
761 Ga0157376_10001158 3300014969 Bacteria 17347
762 Ga0157376_10023691 3300014969 Bacteria 4809
763 Ga0157376_10480581 3300014969 Bacteria 1217
764 Ga0157376_10502217 3300014969 Bacteria 1192
765 Ga0157376_10619608 3300014969 Bacteria 1079
766 Ga0157376_11482769 3300014969 Bacteria 711
767 Ga0157376_11671690 3300014969 Bacteria 672
768 Ga0157376_12475529 3300014969 Bacteria 559
769 Ga0183363_1082 3300015690 Bacteria 28896
770 Ga0163161_10001021 3300017792 Bacteria 21333
771 Ga0163161_10077117 3300017792 Bacteria 2447
772 Ga0163161_10108639 3300017792 Bacteria 2071
773 Ga0163161_10117035 3300017792 Bacteria 1998
774 Ga0163161_10213653 3300017792 Bacteria 1491
775 Ga0163161_10372707 3300017792 Bacteria 1139
776 Ga0163161_10691513 3300017792 Bacteria 848
777 Ga0206354_10832954 3300020081 Bacteria 739
778 Ga0206353_10469384 3300020082 Bacteria 708
779 Ga0214542_1000006 3300021321 Bacteria 345164
780 Ga0214543_1000014 3300021327 Bacteria 324986
781 Ga0213876_10203602 3300021384 Bacteria 1052
782 Ga0209563_107071 3300025230 Bacteria 1873
783 Ga0209233_1000015 3300025261 Bacteria 980563
784 Ga0209233_1020178 3300025261 Bacteria 1753
785 Ga0207666_1001232 3300025271 Bacteria 3011
786 Ga0207666_1001599 3300025271 Bacteria 2678
787 Ga0207673_1000144 3300025290 Bacteria 6906
788 Ga0209564_1000023 3300025295 Bacteria 555102
789 Ga0209758_1000013 3300025297 Bacteria 873003
790 Ga0209256_1000215 3300025299 Bacteria 106454
791 Ga0207697_10016806 3300025315 Bacteria 3011
792 Ga0207697_10020928 3300025315 Bacteria 2678
793 Ga0207697_10069735 3300025315 Bacteria 1472
794 Ga0207656_10087008 3300025321 Bacteria 1413
795 Ga0207656_10142756 3300025321 Bacteria 1129
796 Ga0207656_10389120 3300025321 Bacteria 700
797 Ga0207655_1043901 3300025728 Bacteria 1884
798 Ga0207653_10014097 3300025885 Bacteria 2506
799 Ga0207682_10000399 3300025893 Bacteria 19986
800 Ga0207692_10013438 3300025898 Bacteria 3552
801 Ga0207692_10060724 3300025898 Bacteria 1956
802 Ga0207642_10000073 3300025899 Bacteria 27837
803 Ga0207642_10014044 3300025899 Bacteria 2942
804 Ga0207642_10232406 3300025899 Bacteria 1037
805 Ga0207642_10437580 3300025899 Bacteria 790
806 Ga0207710_10005066 3300025900 Bacteria 5706
807 Ga0207710_10009984 3300025900 Bacteria 3993
808 Ga0207710_10014743 3300025900 Bacteria 3300
809 Ga0207710_10130165 3300025900 Bacteria 1208
810 Ga0207688_10003955 3300025901 Bacteria 8083
811 Ga0207688_10005485 3300025901 Bacteria 6897
812 Ga0207688_10153228 3300025901 Bacteria 1362
813 Ga0207680_10043923 3300025903 Bacteria 2624
814 Ga0207680_10053309 3300025903 Bacteria 2428
815 Ga0207680_10054255 3300025903 Bacteria 2410
816 Ga0207680_10102398 3300025903 Bacteria 1842
817 Ga0207680_10151730 3300025903 Bacteria 1545
818 Ga0207680_10652022 3300025903 Bacteria 754
819 Ga0207647_10016554 3300025904 Bacteria 5029
820 Ga0207647_10038761 3300025904 Bacteria 3011
821 Ga0207647_10078124 3300025904 Bacteria 1988
822 Ga0207685_10085879 3300025905 Bacteria 1314
823 Ga0207685_10150833 3300025905 Bacteria 1052
824 Ga0207685_10280116 3300025905 Bacteria 818
825 Ga0207699_10132348 3300025906 Bacteria 1628
826 Ga0207699_10155697 3300025906 Bacteria 1516
827 Ga0207699_10418372 3300025906 Bacteria 957
828 Ga0207699_11006821 3300025906 Bacteria 616
829 Ga0207699_11028687 3300025906 Bacteria 609
830 Ga0207645_10000457 3300025907 Bacteria 33747
831 Ga0207645_10029158 3300025907 Bacteria 3558
832 Ga0207645_10036551 3300025907 Bacteria 3153
833 Ga0207645_10098702 3300025907 Bacteria 1883
834 Ga0207645_10654728 3300025907 Bacteria 714
835 Ga0207643_10000571 3300025908 Bacteria 23315
836 Ga0207643_10002630 3300025908 Bacteria 9724
837 Ga0207643_10098989 3300025908 Bacteria 1708
838 Ga0207705_10048589 3300025909 Bacteria 3052
839 Ga0207705_10705432 3300025909 Bacteria 784
840 Ga0207654_10003110 3300025911 Bacteria 8405
841 Ga0207654_10009634 3300025911 Bacteria 4911
842 Ga0207654_10065176 3300025911 Bacteria 2144
843 Ga0207654_10074488 3300025911 Bacteria 2026
844 Ga0207654_10138718 3300025911 Bacteria 1548
845 Ga0207654_10310641 3300025911 Bacteria 1075
846 Ga0207654_10412874 3300025911 Bacteria 941
847 Ga0207707_10015257 3300025912 Bacteria 6690
848 Ga0207707_10086200 3300025912 Bacteria 2744
849 Ga0207707_10274287 3300025912 Bacteria 1461
850 Ga0207707_10440360 3300025912 Bacteria 1116
851 Ga0207707_10486076 3300025912 Bacteria 1054
852 Ga0207695_10000018 3300025913 Bacteria 766611
853 Ga0207695_10008517 3300025913 Bacteria 12823
854 Ga0207695_10048036 3300025913 Bacteria 4510
855 Ga0207695_10089023 3300025913 Bacteria 3105
856 Ga0207695_10197922 3300025913 Bacteria 1925
857 Ga0207695_10313989 3300025913 Bacteria 1457
858 Ga0207695_10431413 3300025913 Bacteria 1202
859 Ga0207695_10481448 3300025913 Bacteria 1123
860 Ga0207671_10024799 3300025914 Bacteria 4506
861 Ga0207671_10048973 3300025914 Bacteria 3127
862 Ga0207671_10135543 3300025914 Bacteria 1893
863 Ga0207671_10206408 3300025914 Bacteria 1536
864 Ga0207671_10730776 3300025914 Bacteria 787
865 Ga0207693_10005098 3300025915 Bacteria 11009
866 Ga0207693_10005593 3300025915 Bacteria 10447
867 Ga0207693_10009660 3300025915 Bacteria 7855
868 Ga0207693_10014290 3300025915 Bacteria 6388
869 Ga0207693_10019432 3300025915 Bacteria 5403
870 Ga0207693_10043855 3300025915 Bacteria 3516
871 Ga0207693_10092320 3300025915 Bacteria 2373
872 Ga0207693_10220803 3300025915 Bacteria 1489
873 Ga0207693_10273873 3300025915 Bacteria 1323
874 Ga0207693_10508504 3300025915 Bacteria 940
875 Ga0207693_10847395 3300025915 Bacteria 703
876 Ga0207693_10879762 3300025915 Bacteria 688
877 Ga0207663_10004209 3300025916 Bacteria 7133
878 Ga0207663_10062301 3300025916 Bacteria 2370
879 Ga0207663_10077839 3300025916 Bacteria 2160
880 Ga0207663_10104850 3300025916 Bacteria 1907
881 Ga0207663_10287762 3300025916 Bacteria 1223
882 Ga0207663_10348782 3300025916 Bacteria 1120
883 Ga0207663_10404805 3300025916 Bacteria 1044
884 Ga0207663_10515822 3300025916 Bacteria 930
885 Ga0207663_10607554 3300025916 Bacteria 860
886 Ga0207663_11145540 3300025916 Bacteria 626
887 Ga0207663_11240168 3300025916 Bacteria 600
888 Ga0207660_10055466 3300025917 Bacteria 2832
889 Ga0207660_10191967 3300025917 Bacteria 1591
890 Ga0207660_10270394 3300025917 Bacteria 1346
891 Ga0207660_10291351 3300025917 Bacteria 1298
892 Ga0207660_10369830 3300025917 Bacteria 1151
893 Ga0207660_10492157 3300025917 Bacteria 994
894 Ga0207660_10504012 3300025917 Bacteria 982
895 Ga0207662_10014634 3300025918 Bacteria 4405
896 Ga0207662_10042209 3300025918 Bacteria 2688
897 Ga0207662_10148603 3300025918 Bacteria 1489
898 Ga0207662_10203785 3300025918 Bacteria 1282
899 Ga0207657_10011285 3300025919 Bacteria 8873
900 Ga0207657_10048362 3300025919 Bacteria 3714
901 Ga0207657_10075993 3300025919 Bacteria 2834
902 Ga0207657_10545993 3300025919 Bacteria 906
903 Ga0207657_10679486 3300025919 Bacteria 800
904 Ga0207657_10940354 3300025919 Bacteria 665
905 Ga0207657_11031480 3300025919 Bacteria 630
906 Ga0207657_11182985 3300025919 Bacteria 582
907 Ga0207649_10000382 3300025920 Bacteria 33119
908 Ga0207649_10000473 3300025920 Bacteria 28708
909 Ga0207649_10042350 3300025920 Bacteria 2777
910 Ga0207649_10092203 3300025920 Bacteria 1986
911 Ga0207649_10445485 3300025920 Bacteria 976
912 Ga0207649_11019040 3300025920 Bacteria 652
913 Ga0207652_10000764 3300025921 Bacteria 30807
914 Ga0207652_10074576 3300025921 Bacteria 2954
915 Ga0207652_10084337 3300025921 Bacteria 2783
916 Ga0207652_10273321 3300025921 Bacteria 1524
917 Ga0207652_10719074 3300025921 Bacteria 890
918 Ga0207652_10810748 3300025921 Bacteria 831
919 Ga0207652_10891499 3300025921 Bacteria 786
920 Ga0207646_10183787 3300025922 Bacteria 1888
921 Ga0207646_10542508 3300025922 Bacteria 1046
922 Ga0207681_10000065 3300025923 Bacteria 98832
923 Ga0207681_10097091 3300025923 Bacteria 2117
924 Ga0207681_10145468 3300025923 Bacteria 1770
925 Ga0207681_10368702 3300025923 Bacteria 1153
926 Ga0207681_11456687 3300025923 Bacteria 574
927 Ga0207694_10000018 3300025924 Bacteria 331281
928 Ga0207694_10050126 3300025924 Bacteria 3232
929 Ga0207694_10071161 3300025924 Bacteria 2717
930 Ga0207694_10152383 3300025924 Bacteria 1863
931 Ga0207694_10249149 3300025924 Bacteria 1453
932 Ga0207694_10315055 3300025924 Bacteria 1290
933 Ga0207694_10527923 3300025924 Bacteria 989
934 Ga0207694_10552850 3300025924 Bacteria 966
935 Ga0207694_10803911 3300025924 Bacteria 794
936 Ga0207694_10828139 3300025924 Bacteria 782
937 Ga0207650_10031294 3300025925 Bacteria 3841
938 Ga0207650_10154835 3300025925 Bacteria 1812
939 Ga0207659_10000142 3300025926 Bacteria 42302
940 Ga0207659_11245042 3300025926 Bacteria 639
941 Ga0207659_11256605 3300025926 Bacteria 636
942 Ga0207687_10000125 3300025927 Bacteria 51567
943 Ga0207687_10031496 3300025927 Bacteria 3585
944 Ga0207687_10060565 3300025927 Bacteria 2670
945 Ga0207687_10093905 3300025927 Bacteria 2194
946 Ga0207687_10187599 3300025927 Bacteria 1607
947 Ga0207700_10000017 3300025928 Bacteria 195983
948 Ga0207700_10000747 3300025928 Bacteria 18702
949 Ga0207700_10073961 3300025928 Bacteria 2634
950 Ga0207700_10079991 3300025928 Bacteria 2547
951 Ga0207700_10298008 3300025928 Bacteria 1391
952 Ga0207700_10305525 3300025928 Bacteria 1375
953 Ga0207700_10411772 3300025928 Bacteria 1186
954 Ga0207664_10067421 3300025929 Bacteria 2872
955 Ga0207664_10068459 3300025929 Bacteria 2851
956 Ga0207664_10255318 3300025929 Bacteria 1531
957 Ga0207664_10391397 3300025929 Bacteria 1235
958 Ga0207664_11266876 3300025929 Bacteria 656
959 Ga0207644_10002374 3300025931 Bacteria 12154
960 Ga0207644_10037849 3300025931 Bacteria 3395
961 Ga0207644_10102001 3300025931 Bacteria 2157
962 Ga0207644_10198856 3300025931 Bacteria 1580
963 Ga0207644_10491362 3300025931 Bacteria 1012
964 Ga0207644_10998833 3300025931 Bacteria 702
965 Ga0207644_11076415 3300025931 Bacteria 675
966 Ga0207690_10000900 3300025932 Bacteria 18977
967 Ga0207690_10036628 3300025932 Bacteria 3178
968 Ga0207690_10410684 3300025932 Bacteria 1081
969 Ga0207690_11265078 3300025932 Bacteria 616
970 Ga0207706_10005077 3300025933 Bacteria 12296
971 Ga0207706_10008604 3300025933 Bacteria 9403
972 Ga0207706_10024616 3300025933 Bacteria 5396
973 Ga0207706_10425950 3300025933 Bacteria 1149
974 Ga0207706_10502538 3300025933 Bacteria 1046
975 Ga0207706_10915503 3300025933 Bacteria 740
976 Ga0207686_10000344 3300025934 Bacteria 33461
977 Ga0207686_10031417 3300025934 Bacteria 3153
978 Ga0207686_10157483 3300025934 Bacteria 1588
979 Ga0207686_10848597 3300025934 Bacteria 735
980 Ga0207709_10001385 3300025935 Bacteria 16967
981 Ga0207709_10080067 3300025935 Bacteria 2102
982 Ga0207709_10233337 3300025935 Bacteria 1334
983 Ga0207709_10308234 3300025935 Bacteria 1180
984 Ga0207709_10311163 3300025935 Bacteria 1175
985 Ga0207670_10000288 3300025936 Bacteria 30769
986 Ga0207670_10683832 3300025936 Bacteria 848
987 Ga0207669_10002658 3300025937 Bacteria 7649
988 Ga0207669_10518945 3300025937 Bacteria 956
989 Ga0207704_10000121 3300025938 Bacteria 42395
990 Ga0207704_10007421 3300025938 Bacteria 5179
991 Ga0207704_10039546 3300025938 Bacteria 2747
992 Ga0207704_10872266 3300025938 Bacteria 755
993 Ga0207704_11075309 3300025938 Bacteria 683
994 Ga0207704_11191832 3300025938 Bacteria 649
995 Ga0207665_10001147 3300025939 Bacteria 17826
996 Ga0207665_10002353 3300025939 Bacteria 12764
997 Ga0207665_10052377 3300025939 Bacteria 2749
998 Ga0207665_10176043 3300025939 Bacteria 1547
999 Ga0207665_10506305 3300025939 Bacteria 933
1000 Ga0207665_10611188 3300025939 Bacteria 852
1001 Ga0207665_11291053 3300025939 Bacteria 582
1002 Ga0207691_10005469 3300025940 Bacteria 12263
1003 Ga0207691_10059048 3300025940 Bacteria 3489
1004 Ga0207691_10258670 3300025940 Bacteria 1501
1005 Ga0207691_10680548 3300025940 Bacteria 868
1006 Ga0207691_10695801 3300025940 Bacteria 857
1007 Ga0207711_10004828 3300025941 Bacteria 11454
1008 Ga0207711_10011260 3300025941 Bacteria 7433
1009 Ga0207711_10097260 3300025941 Bacteria 2599
1010 Ga0207711_10260277 3300025941 Bacteria 1594
1011 Ga0207711_10719565 3300025941 Bacteria 931
1012 Ga0207689_10000696 3300025942 Bacteria 32214
1013 Ga0207689_10028922 3300025942 Bacteria 4633
1014 Ga0207689_10109494 3300025942 Bacteria 2270
1015 Ga0207689_10263483 3300025942 Bacteria 1426
1016 Ga0207689_10614714 3300025942 Bacteria 915
1017 Ga0207689_10811817 3300025942 Bacteria 790
1018 Ga0207689_10873315 3300025942 Bacteria 759
1019 Ga0207661_10290662 3300025944 Bacteria 1463
1020 Ga0207661_10294799 3300025944 Bacteria 1452
1021 Ga0207661_10689357 3300025944 Bacteria 939
1022 Ga0207661_10728358 3300025944 Bacteria 912
1023 Ga0207661_11136803 3300025944 Bacteria 719
1024 Ga0207661_11169900 3300025944 Bacteria 708
1025 Ga0207661_12002364 3300025944 Bacteria 525
1026 Ga0207679_10000064 3300025945 Bacteria 98118
1027 Ga0207679_10153156 3300025945 Bacteria 1879
1028 Ga0207679_10325676 3300025945 Bacteria 1332
1029 Ga0207679_10431484 3300025945 Bacteria 1165
1030 Ga0207679_11509539 3300025945 Bacteria 616
1031 Ga0207667_10000052 3300025949 Bacteria 232415
1032 Ga0207667_10032084 3300025949 Bacteria 5662
1033 Ga0207667_10101281 3300025949 Bacteria 2971
1034 Ga0207667_10638609 3300025949 Bacteria 1071
1035 Ga0207667_10668500 3300025949 Bacteria 1043
1036 Ga0207667_10725487 3300025949 Bacteria 995
1037 Ga0207667_10733516 3300025949 Bacteria 988
1038 Ga0207667_10764371 3300025949 Bacteria 965
1039 Ga0207667_11482663 3300025949 Bacteria 650
1040 Ga0207667_11647654 3300025949 Bacteria 609
1041 Ga0207651_10000338 3300025960 Bacteria 19898
1042 Ga0207651_10035164 3300025960 Bacteria 3254
1043 Ga0207651_10573507 3300025960 Bacteria 984
1044 Ga0207651_11070946 3300025960 Bacteria 722
1045 Ga0207651_11288289 3300025960 Bacteria 657
1046 Ga0207651_11604014 3300025960 Bacteria 586
1047 Ga0207712_10000944 3300025961 Bacteria 20980
1048 Ga0207712_10059836 3300025961 Bacteria 2698
1049 Ga0207712_10300964 3300025961 Bacteria 1316
1050 Ga0207712_10621121 3300025961 Bacteria 937
1051 Ga0207712_10922498 3300025961 Bacteria 773
1052 Ga0207668_10000503 3300025972 Bacteria 24507
1053 Ga0207668_10051908 3300025972 Bacteria 2835
1054 Ga0207668_10069526 3300025972 Bacteria 2507
1055 Ga0207668_10111894 3300025972 Bacteria 2050
1056 Ga0207668_10357542 3300025972 Bacteria 1223
1057 Ga0207668_10766473 3300025972 Bacteria 852
1058 Ga0207640_10000320 3300025981 Bacteria 32131
1059 Ga0207640_10412873 3300025981 Bacteria 1102
1060 Ga0207640_10429227 3300025981 Bacteria 1084
1061 Ga0207640_11006824 3300025981 Bacteria 733
1062 Ga0207658_10033265 3300025986 Bacteria 3676
1063 Ga0207658_10093915 3300025986 Bacteria 2333
1064 Ga0207658_10226324 3300025986 Bacteria 1576
1065 Ga0207658_10334802 3300025986 Bacteria 1314
1066 Ga0207658_10340798 3300025986 Bacteria 1303
1067 Ga0207658_10497179 3300025986 Bacteria 1086
1068 Ga0207658_10519645 3300025986 Bacteria 1062
1069 Ga0207658_10622047 3300025986 Bacteria 971
1070 Ga0207677_10002365 3300026023 Bacteria 9887
1071 Ga0207677_10043233 3300026023 Bacteria 2994
1072 Ga0207677_10059931 3300026023 Bacteria 2628
1073 Ga0207677_10193770 3300026023 Bacteria 1609
1074 Ga0207703_10001400 3300026035 Bacteria 21963
1075 Ga0207703_10116527 3300026035 Bacteria 2287
1076 Ga0207703_10347161 3300026035 Bacteria 1365
1077 Ga0207703_10607109 3300026035 Bacteria 1035
1078 Ga0207703_10682504 3300026035 Bacteria 976
1079 Ga0207703_11831890 3300026035 Bacteria 583
1080 Ga0207639_10016982 3300026041 Bacteria 5157
1081 Ga0207639_10036966 3300026041 Bacteria 3623
1082 Ga0207639_10152705 3300026041 Bacteria 1936
1083 Ga0207639_10289311 3300026041 Bacteria 1444
1084 Ga0207639_10342408 3300026041 Bacteria 1333
1085 Ga0207678_10002811 3300026067 Bacteria 15790
1086 Ga0207678_10007889 3300026067 Bacteria 9392
1087 Ga0207678_10012694 3300026067 Bacteria 7399
1088 Ga0207678_10636038 3300026067 Bacteria 937
1089 Ga0207678_10696169 3300026067 Bacteria 894
1090 Ga0207708_10004148 3300026075 Bacteria 10659
1091 Ga0207708_10055846 3300026075 Bacteria 3011
1092 Ga0207708_10070399 3300026075 Bacteria 2678
1093 Ga0207702_10001217 3300026078 Bacteria 26109
1094 Ga0207702_10224763 3300026078 Bacteria 1751
1095 Ga0207702_10265280 3300026078 Bacteria 1618
1096 Ga0207702_10461937 3300026078 Bacteria 1233
1097 Ga0207702_10550579 3300026078 Bacteria 1128
1098 Ga0207702_10554544 3300026078 Bacteria 1124
1099 Ga0207702_10571020 3300026078 Bacteria 1108
1100 Ga0207702_11083492 3300026078 Bacteria 795
1101 Ga0207641_10006750 3300026088 Bacteria 9617
1102 Ga0207641_10029971 3300026088 Bacteria 4502
1103 Ga0207641_10034969 3300026088 Bacteria 4182
1104 Ga0207641_10339544 3300026088 Bacteria 1429
1105 Ga0207641_10392344 3300026088 Bacteria 1331
1106 Ga0207641_11228628 3300026088 Bacteria 749
1107 Ga0207641_11256465 3300026088 Bacteria 741
1108 Ga0207648_10013636 3300026089 Bacteria 7545
1109 Ga0207648_10023005 3300026089 Bacteria 5588
1110 Ga0207648_10032835 3300026089 Bacteria 4580
1111 Ga0207648_10080154 3300026089 Bacteria 2848
1112 Ga0207648_10510992 3300026089 Bacteria 1100
1113 Ga0207676_10000079 3300026095 Bacteria 94811
1114 Ga0207676_10012315 3300026095 Bacteria 6124
1115 Ga0207676_10147763 3300026095 Bacteria 2020
1116 Ga0207676_10373573 3300026095 Bacteria 1325
1117 Ga0207676_10658726 3300026095 Bacteria 1011
1118 Ga0207676_11633136 3300026095 Bacteria 642
1119 Ga0207674_10032977 3300026116 Bacteria 5427
1120 Ga0207674_10058304 3300026116 Bacteria 3912
1121 Ga0207674_10109763 3300026116 Bacteria 2734
1122 Ga0207674_10154052 3300026116 Bacteria 2254
1123 Ga0207674_10579849 3300026116 Bacteria 1083
1124 Ga0207674_10607276 3300026116 Bacteria 1057
1125 Ga0207674_11227253 3300026116 Bacteria 719
1126 Ga0207675_100003030 3300026118 Bacteria 16479
1127 Ga0207675_100009836 3300026118 Bacteria 8947
1128 Ga0207675_100038364 3300026118 Bacteria 4470
1129 Ga0207675_100371496 3300026118 Bacteria 1405
1130 Ga0207675_100662765 3300026118 Bacteria 1050
1131 Ga0207675_101514243 3300026118 Bacteria 691
1132 Ga0207683_10000037 3300026121 Bacteria 100920
1133 Ga0207683_10011813 3300026121 Bacteria 7450
1134 Ga0207683_10019746 3300026121 Bacteria 5757
1135 Ga0207683_10153884 3300026121 Bacteria 2076
1136 Ga0207683_10178740 3300026121 Bacteria 1924
1137 Ga0207698_10002906 3300026142 Bacteria 10245
1138 Ga0207698_10213954 3300026142 Bacteria 1736
1139 Ga0207698_10547741 3300026142 Bacteria 1133
1140 Ga0207698_10736152 3300026142 Bacteria 984
1141 Ga0207698_12179949 3300026142 Bacteria 567
1142 Ga0209973_1049671 3300027252 Bacteria 630
1143 Ga0210002_1008968 3300027617 Bacteria 1526
1144 Ga0209983_1012323 3300027665 Bacteria 1755
1145 Ga0209282_1006157 3300027666 Bacteria 7430
1146 Ga0209282_1039336 3300027666 Bacteria 2822
1147 Ga0209971_1007881 3300027682 Bacteria 2526
1148 Ga0209966_1001939 3300027695 Bacteria 3470
1149 Ga0209966_1081754 3300027695 Bacteria 717
1150 Ga0209998_10004140 3300027717 Bacteria 3095
1151 Ga0209998_10008721 3300027717 Bacteria 2101
1152 Ga0209998_10010527 3300027717 Bacteria 1915
1153 Ga0209813_10010127 3300027866 Bacteria 2430
1154 Ga0209813_10104459 3300027866 Bacteria 968
1155 Ga0209813_10174229 3300027866 Bacteria 783
1156 Ga0209974_10013409 3300027876 Bacteria 2729
1157 Ga0209974_10115603 3300027876 Bacteria 947
1158 Ga0209974_10278017 3300027876 Bacteria 636
1159 Ga0207428_10000064 3300027907 Bacteria 151185
1160 Ga0207428_10014192 3300027907 Bacteria 6934
1161 Ga0207428_10024254 3300027907 Bacteria 5095
1162 Ga0207428_10598387 3300027907 Bacteria 795
1163 Ga0268266_10001539 3300028379 Bacteria 26986
1164 Ga0268266_10006859 3300028379 Bacteria 10367
1165 Ga0268266_10017082 3300028379 Bacteria 6196
1166 Ga0268266_10028988 3300028379 Bacteria 4704
1167 Ga0268266_10039850 3300028379 Bacteria 4002
1168 Ga0268266_10068757 3300028379 Bacteria 3067
1169 Ga0268266_10071989 3300028379 Bacteria 2996
1170 Ga0268266_10122755 3300028379 Bacteria 2313
1171 Ga0268266_10243948 3300028379 Bacteria 1659
1172 Ga0268266_10691767 3300028379 Bacteria 982
1173 Ga0268266_10703261 3300028379 Bacteria 974
1174 Ga0268266_11773268 3300028379 Bacteria 592
1175 Ga0268265_10019014 3300028380 Bacteria 4769
1176 Ga0268265_10103099 3300028380 Bacteria 2309
1177 Ga0268265_10111508 3300028380 Bacteria 2234
1178 Ga0268265_10247208 3300028380 Bacteria 1578
1179 Ga0268265_10324600 3300028380 Bacteria 1396
1180 Ga0268264_10000022 3300028381 Bacteria 476624
1181 Ga0268264_10000805 3300028381 Bacteria 33825
1182 Ga0268264_10017880 3300028381 Bacteria 5801
1183 Ga0268264_10155682 3300028381 Bacteria 2053
1184 Ga0268264_10651541 3300028381 Bacteria 1042
1185 Ga0268264_11727751 3300028381 Bacteria 636
1186 Ga0265334_10027907 3300028573 Bacteria 2271
1187 Ga0265318_10046767 3300028577 Bacteria 1633
1188 Ga0307517_10198111 3300028786 Bacteria 1261
1189 Ga0265338_10000100 3300028800 Bacteria 159619
1190 Ga0265338_10005075 3300028800 Bacteria 17376
1191 Ga0265338_10391674 3300028800 Bacteria 992
1192 Ga0265338_11035473 3300028800 Bacteria 555
1193 Ga0307511_10235350 3300030521 Bacteria 900
1194 Ga0316181_1235153 3300030744 Bacteria 2507
1195 Ga0265762_1045705 3300030760 Bacteria 867
1196 Ga0265760_10040801 3300031090 Bacteria 1383
1197 Ga0265760_10086139 3300031090 Bacteria 978
1198 Ga0265330_10025049 3300031235 Bacteria 2706
1199 Ga0265330_10131468 3300031235 Bacteria 1065
1200 Ga0265332_10019940 3300031238 Bacteria 2961
1201 Ga0265328_10000006 3300031239 Bacteria 227698
1202 Ga0265328_10199454 3300031239 Bacteria 759
1203 Ga0265320_10030229 3300031240 Bacteria 2795
1204 Ga0265320_10231140 3300031240 Bacteria 822
1205 Ga0265325_10000014 3300031241 Bacteria 131579
1206 Ga0265325_10001421 3300031241 Bacteria 16859
1207 Ga0265325_10002235 3300031241 Bacteria 13138
1208 Ga0265325_10068420 3300031241 Bacteria 1787
1209 Ga0265325_10121365 3300031241 Bacteria 1259
1210 Ga0265325_10175390 3300031241 Bacteria 1001
1211 Ga0265325_10227582 3300031241 Bacteria 851
1212 Ga0265325_10244737 3300031241 Bacteria 814
1213 Ga0265329_10024737 3300031242 Bacteria 1991
1214 Ga0265329_10122316 3300031242 Bacteria 835
1215 Ga0265340_10001571 3300031247 Bacteria 13097
1216 Ga0265340_10068201 3300031247 Bacteria 1689
1217 Ga0265340_10069214 3300031247 Bacteria 1675
1218 Ga0265340_10096216 3300031247 Bacteria 1379
1219 Ga0265340_10104206 3300031247 Bacteria 1316
1220 Ga0265340_10108961 3300031247 Bacteria 1281
1221 Ga0265340_10119645 3300031247 Bacteria 1212
1222 Ga0265339_10003369 3300031249 Bacteria 11184
1223 Ga0265339_10023668 3300031249 Bacteria 3549
1224 Ga0265339_10033703 3300031249 Bacteria 2881
1225 Ga0265339_10147201 3300031249 Bacteria 1194
1226 Ga0265339_10363500 3300031249 Bacteria 680
1227 Ga0265339_10443082 3300031249 Bacteria 603
1228 Ga0265331_10000113 3300031250 Bacteria 105472
1229 Ga0265331_10002319 3300031250 Bacteria 12973
1230 Ga0265331_10008036 3300031250 Bacteria 6032
1231 Ga0265331_10034635 3300031250 Bacteria 2489
1232 Ga0265331_10041860 3300031250 Bacteria 2224
1233 Ga0265331_10078310 3300031250 Bacteria 1539
1234 Ga0265331_10131853 3300031250 Bacteria 1140
1235 Ga0265327_10000124 3300031251 Bacteria 169233
1236 Ga0265327_10020547 3300031251 Bacteria 4018
1237 Ga0265327_10244006 3300031251 Bacteria 802
1238 Ga0265316_10000333 3300031344 Bacteria 52789
1239 Ga0265316_10061583 3300031344 Bacteria 2914
1240 Ga0265316_10111693 3300031344 Bacteria 2069
1241 Ga0265316_10141249 3300031344 Bacteria 1808
1242 Ga0307509_10144098 3300031507 Bacteria 2311
1243 Ga0307509_10224553 3300031507 Bacteria 1687
1244 Ga0307408_101200854 3300031548 Bacteria 707
1245 Ga0265313_10001667 3300031595 Bacteria 20546
1246 Ga0265313_10008310 3300031595 Bacteria 6919
1247 Ga0265313_10020687 3300031595 Bacteria 3622
1248 Ga0265313_10123304 3300031595 Bacteria 1128
1249 Ga0265313_10131512 3300031595 Bacteria 1084
1250 Ga0307508_10259527 3300031616 Bacteria 1332
1251 Ga0316575_10060235 3300031665 Bacteria 1516
1252 Ga0265314_10025240 3300031711 Bacteria 4489
1253 Ga0265314_10025603 3300031711 Bacteria 4447
1254 Ga0265314_10028930 3300031711 Bacteria 4124
1255 Ga0265314_10138567 3300031711 Bacteria 1507
1256 Ga0265314_10170464 3300031711 Bacteria 1314
1257 Ga0265342_10018213 3300031712 Bacteria 4555
1258 Ga0265342_10257285 3300031712 Bacteria 930
1259 Ga0265342_10276896 3300031712 Bacteria 889
1260 Ga0265342_10286059 3300031712 Bacteria 872
1261 Ga0265342_10515928 3300031712 Bacteria 609
1262 Ga0307516_10021961 3300031730 Bacteria 6557
1263 Ga0307516_10325126 3300031730 Bacteria 1208
1264 Ga0307516_10458714 3300031730 Bacteria 930
1265 Ga0307406_10627668 3300031901 Bacteria 889
1266 Ga0307412_11269709 3300031911 Bacteria 662
1267 Ga0307409_100222329 3300031995 Bacteria 1705
1268 Ga0307414_10156200 3300032004 Bacteria 1806
1269 Ga0307411_10096960 3300032005 Bacteria 2074
1270 Ga0307415_101203249 3300032126 Bacteria 714
1271 Ga0316583_10000123 3300032133 Bacteria 17891
1272 Ga0307507_10006782 3300033179 Bacteria 17185
1273 Ga0307507_10230487 3300033179 Bacteria 1229
1274 Ga0307510_10151214 3300033180 Bacteria 1940
1275 Ga0373930_0000972 3300034816 Bacteria 4110
1276 Ga0373930_0136284 3300034816 Bacteria 607
1277 Ga0373948_0000169 3300034817 Bacteria 7326
1278 Ga0373948_0007214 3300034817 Bacteria 1862
1279 Ga0373948_0020187 3300034817 Bacteria 1266
1280 Ga0373950_0000253 3300034818 Bacteria 6788
1281 Ga0373950_0001897 3300034818 Bacteria 2810
1282 Ga0373958_0003084 3300034819 Bacteria 2382
1283 Ga0373958_0008410 3300034819 Bacteria 1670
1284 Ga0373958_0180879 3300034819 Bacteria 543
1285 Ga0373959_0004517 3300034820 Bacteria 2247
1286 Ga0373938_0000142 3300034957 Bacteria 10404
1287 Ga0373938_0009131 3300034957 Bacteria 1788
1288 Ga0373926_0004179 3300035083 Bacteria 4710
1289 Ga0373926_0012751 3300035083 Bacteria 2845
1290 Ga0373926_0055880 3300035083 Bacteria 1431
1291 Ga0373928_0000634 3300035084 Bacteria 6910
1292 Ga0373928_0001826 3300035084 Bacteria 4148
1293 Ga0373928_0159033 3300035084 Bacteria 630
1294 Ga0373929_0001528 3300035085 Bacteria 4395
1295 Ga0373929_0017852 3300035085 Bacteria 1405
1296 Ga0373929_0059575 3300035085 Bacteria 891
1297 Ga0373929_0095483 3300035085 Bacteria 743
1298 Ga0373934_0017218 3300035086 Bacteria 2756
1299 Ga0373934_0028536 3300035086 Bacteria 2176
1300 Ga0373940_0002260 3300035088 Bacteria 3709
1301 Ga0373940_0126892 3300035088 Bacteria 796
1302 Ga0373940_0155809 3300035088 Bacteria 730
1303 Ga0373944_0033583 3300035089 Bacteria 1555
1304 Ga0373944_0056645 3300035089 Bacteria 1248
1305 Ga0373944_0062132 3300035089 Bacteria 1200
1306 Ga0373949_0001704 3300035090 Bacteria 6098
1307 Ga0373949_0011869 3300035090 Bacteria 1923
1308 Ga0373951_0004113 3300035091 Bacteria 3479
1309 Ga0373951_0021701 3300035091 Bacteria 1475
1310 Ga0373951_0108142 3300035091 Bacteria 746
1311 Ga0373952_0000469 3300035092 Bacteria 7042
1312 Ga0373952_0010817 3300035092 Bacteria 1769
1313 Ga0373952_0216138 3300035092 Bacteria 567
1314 Ga0373923_0039986 3300035111 Bacteria 1928
1315 Ga0373923_0048739 3300035111 Bacteria 1769
1316 Ga0373923_0275965 3300035111 Bacteria 791
1317 Ga0373932_0001947 3300035112 Bacteria 5467
1318 Ga0373932_0026515 3300035112 Bacteria 1577
1319 Ga0373932_0299378 3300035112 Bacteria 600
1320 Ga0373936_0032209 3300035113 Bacteria 2072
1321 Ga0373936_0045202 3300035113 Bacteria 1773
1322 Ga0373936_0130971 3300035113 Bacteria 1078
1323 Ga0373939_0000711 3300035114 Bacteria 8243
1324 Ga0373939_0001236 3300035114 Bacteria 6246
1325 Ga0373939_0003388 3300035114 Bacteria 3737
1326 Ga0373939_0040228 3300035114 Bacteria 1403
1327 Ga0373941_0000186 3300035115 Bacteria 11728
1328 Ga0373941_0000584 3300035115 Bacteria 7361
1329 Ga0373941_0134427 3300035115 Bacteria 894
1330 Ga0373945_0000073 3300035116 Bacteria 22978
1331 Ga0373945_0016156 3300035116 Bacteria 2514
1332 Ga0373945_0029055 3300035116 Bacteria 1940
1333 Ga0373953_0018005 3300035117 Bacteria 2606
1334 Ga0373953_0190111 3300035117 Bacteria 887
1335 Ga0373954_0016841 3300035118 Bacteria 3278
1336 Ga0373954_0032391 3300035118 Bacteria 2416
1337 Ga0373954_0115093 3300035118 Bacteria 1303
1338 Ga0373954_0367224 3300035118 Bacteria 711
1339 Ga0373956_0006007 3300035119 Bacteria 4860
1340 Ga0373956_0145837 3300035119 Bacteria 1113
1341 Ga0373957_0001780 3300035120 Bacteria 5942
1342 Ga0373957_0074433 3300035120 Bacteria 1333
1343 Ga0373960_0004138 3300035121 Bacteria 3314
1344 Ga0373960_0004588 3300035121 Bacteria 3169
1345 Ga0373960_0136153 3300035121 Bacteria 828
1346 Ga0373960_0177632 3300035121 Bacteria 742
1347 Ga0373943_0004682 3300035170 Bacteria 6189
1348 Ga0373943_0007039 3300035170 Bacteria 5046
1349 Ga0373943_0197375 3300035170 Bacteria 1112
1350 Ga0373943_0590573 3300035170 Bacteria 653
1351 Ga0373946_0000371 3300035171 Bacteria 14535
1352 Ga0373946_0033119 3300035171 Bacteria 2078
1353 Ga0373955_0004122 3300035172 Bacteria 6414
1354 Ga0373955_0008798 3300035172 Bacteria 4704
1355 Ga0373955_0480211 3300035172 Bacteria 758
1356 Ga0373942_0000298 3300035207 Bacteria 13554
1357 Ga0373942_0043844 3300035207 Bacteria 1230
1358 Ga0373961_0002218 3300035241 Bacteria 5133
1359 Ga0373961_0003878 3300035241 Bacteria 3648
1360 Ga0373961_0008934 3300035241 Bacteria 2444
1361 Ga0373961_0105092 3300035241 Bacteria 919
1362 Ga0373962_0000374 3300035242 Bacteria 9797
1363 Ga0373962_0000988 3300035242 Bacteria 6569
1364 Ga0373962_0244872 3300035242 Bacteria 621
1365 Ga0373924_0125940 3300035410 Bacteria 1113
1366 Ga0373924_0203294 3300035410 Bacteria 874
1367 Ga0373924_0412048 3300035410 Bacteria 604
1368 Ga0373931_0000823 3300035691 Bacteria 13016
1369 Ga0373931_0004447 3300035691 Bacteria 6404
1370 Ga0373931_0023006 3300035691 Bacteria 3142
1371 Ga0373931_0279364 3300035691 Bacteria 1025
1372 Ga0373931_0495182 3300035691 Bacteria 787
1373 Ga0373935_0002812 3300035692 Bacteria 10017
1374 Ga0373935_0021250 3300035692 Bacteria 3973
1375 Ga0373935_0040171 3300035692 Bacteria 2935
1376 Ga0373935_0119875 3300035692 Bacteria 1756
1377 Ga0373935_0570055 3300035692 Bacteria 826
1378 Ga0373935_0651173 3300035692 Bacteria 773
1379 Ga0373927_0008749 3300035695 Bacteria 6800
1380 Ga0373927_0024429 3300035695 Bacteria 3954
1381 Ga0373927_0034147 3300035695 Bacteria 3309
1382 Ga0373927_0046748 3300035695 Bacteria 2799
1383 Ga0373927_0157489 3300035695 Bacteria 1488
1384 Ga0373927_0354026 3300035695 Bacteria 968
1385 Ga0373927_0429267 3300035695 Bacteria 872
1386 Ga0373927_0723049 3300035695 Bacteria 658
1387 Ga0373933_0010116 3300035724 Bacteria 5163
1388 Ga0373933_0054991 3300035724 Bacteria 2386
1389 Ga0373933_0275336 3300035724 Bacteria 1087
1390 Ga0373933_0324897 3300035724 Bacteria 998
1391 Ga0373933_0494312 3300035724 Bacteria 801
1392 Ga0373947_0002721 3300035725 Bacteria 10615
1393 Ga0373947_0027881 3300035725 Bacteria 3307
1394 Ga0373947_0046588 3300035725 Bacteria 2597
1395 Ga0373947_0065071 3300035725 Bacteria 2223
1396 Ga0373947_0099201 3300035725 Bacteria 1828
1397 Ga0373947_0178733 3300035725 Bacteria 1380
1398 Ga0373947_0897924 3300035725 Bacteria 605
1399 Ga0373937_0000998 3300036401 Bacteria 23980
1400 Ga0373937_0002122 3300036401 Bacteria 16578
1401 Ga0373937_0138612 3300036401 Bacteria 2275
1402 Ga0373937_0408434 3300036401 Bacteria 1288
1403 Ga0373937_0431780 3300036401 Bacteria 1250
1404 Ga0373937_0806671 3300036401 Bacteria 887
1405 Ga0373925_0001693 3300037068 Bacteria 18543
1406 Ga0373925_0018327 3300037068 Bacteria 5088
1407 Ga0373925_0052406 3300037068 Bacteria 3048
1408 Ga0373925_0092836 3300037068 Bacteria 2309
1409 Ga0373925_0157095 3300037068 Bacteria 1789
1410 Ga0373925_0184517 3300037068 Bacteria 1653
1411 Ga0373925_0457823 3300037068 Bacteria 1045
1412 Ga0373925_0497421 3300037068 Bacteria 1001
1413 Ga0373925_0684594 3300037068 Bacteria 845
1414 Ga0373925_1041493 3300037068 Bacteria 674
1415 Ga0395900_0689921 3300037418 Bacteria 955
1416 Ga0395900_1659714 3300037418 Bacteria 550
1417 Ga0395898_0041641 3300037466 Bacteria 4536
1418 Ga0395898_0186242 3300037466 Bacteria 1983
1419 Ga0395898_0323733 3300037466 Bacteria 1470
1420 Ga0395898_0929445 3300037466 Bacteria 807
1421 Ga0395905_0013091 3300037471 Bacteria 7964
1422 Ga0436364_0825876 3300037853 Bacteria 806
1423 Ga0436364_0871904 3300037853 Bacteria 2904
1424 Ga0395901_0038182 3300038443 Bacteria 4968
1425 Ga0395901_0216910 3300038443 Bacteria 2001
1426 Ga0395901_0335515 3300038443 Bacteria 1562
1427 Ga0395901_0636587 3300038443 Bacteria 1071
1428 Ga0395901_1466114 3300038443 Bacteria 639
1429 Ga0242420_027537 3300038996 Bacteria 1042
1430 Ga0436365_0256272 3300039437 Bacteria 1330
1431 Ga0436365_0306351 3300039437 Bacteria 2598
1432 Ga0436365_0309386 3300039437 Bacteria 599
1433 Ga0436365_0333374 3300039437 Bacteria 2196
1434 Ga0436365_1152734 3300039437 Bacteria 2798
1435 Ga0436360_0027830 3300039438 Bacteria 1292
1436 Ga0436360_0485954 3300039438 Bacteria 760
1437 Ga0436360_0500281 3300039438 Bacteria 1138
1438 Ga0436360_0503632 3300039438 Bacteria 1009
1439 Ga0436360_0853818 3300039438 Bacteria 1684
1440 Ga0436360_1207847 3300039438 Bacteria 1248
1441 Ga0436360_1263043 3300039438 Bacteria 833
1442 Ga0436361_0067895 3300039447 Bacteria 839
1443 Ga0436361_0704126 3300039447 Bacteria 805
1444 Ga0436363_0481699 3300039450 Bacteria 814
1445 Ga0436362_0162245 3300039453 Bacteria 614
1446 Ga0436362_0910219 3300039453 Bacteria 924
1447 Ga0436362_0939360 3300039453 Bacteria 692
1448 Ga0439466_0152580 3300041411 Bacteria 707
1449 Ga0451793_1361258 3300041452 Bacteria 1922
1450 Ga0451797_0545593 3300041453 Bacteria 1627
1451 Ga0451798_0980934 3300041458 Bacteria 1128
1452 Ga0451800_0001266 3300041459 Bacteria 577
1453 Ga0451802_0105263 3300041460 Bacteria 667
1454 Ga0451804_0971913 3300041463 Bacteria 729
1455 Ga0451807_1645706 3300041486 Bacteria 679
1456 Ga0451807_2770020 3300041486 Bacteria 671
1457 Ga0451833_1211953 3300041491 Bacteria 616
1458 Ga0451847_0188795 3300041503 Bacteria 781
1459 Ga0451851_1057867 3300041507 Bacteria 2330
1460 Ga0439449_0191478 3300042007 Bacteria 765
1461 Ga0439450_040119 3300042008 Bacteria 1084
1462 Ga0439455_0193604 3300042012 Bacteria 587
1463 Ga0439463_006824 3300042016 Bacteria 2820
1464 Ga0450923_083758 3300042125 Bacteria 720
1465 Ga0450908_027224 3300042184 Bacteria 997
1466 Ga0439459_0017909 3300042438 Bacteria 1326
1467 Ga0451577_0054974 3300042876 Bacteria 3554
1468 Ga0466969_0407110 3300044656 Bacteria 618
1469 Ga0466972_0082820 3300044658 Bacteria 1527
1470 Ga0466965_0550848 3300044683 Bacteria 651
1471 Ga0466966_0374420 3300044684 Bacteria 855
1472 Ga0466961_0312723 3300044693 Bacteria 958
1473 Ga0466963_0188785 3300044694 Bacteria 1440
1474 Ga0466963_0372580 3300044694 Bacteria 1006
1475 Ga0466963_0858346 3300044694 Bacteria 640
1476 Ga0453684_0244131 3300044712 Bacteria 2066
1477 Ga0453684_0629404 3300044712 Bacteria 1173
1478 Ga0466968_0082045 3300044735 Bacteria 1418
1479 Ga0466970_0211324 3300044765 Bacteria 1081
1480 Ga0466957_0195572 3300044842 Bacteria 1326
1481 Ga0466957_0552410 3300044842 Bacteria 803
1482 Ga0466960_0107277 3300044901 Bacteria 1446
1483 Ga0466959_0028187 3300045049 Bacteria 4164
1484 Ga0451576_0025688 3300045051 Bacteria 6344
1485 Ga0466958_0387133 3300045836 Bacteria 902
1486 Ga0495627_039646 3300046453 Bacteria 1453
1487 Ga0495592_0007338 3300046454 Bacteria 8245
1488 Ga0495592_0009724 3300046454 Bacteria 7239
1489 Ga0495592_0240363 3300046454 Bacteria 1202
1490 Ga0495592_0281699 3300046454 Bacteria 1087
1491 Ga0495603_0010082 3300046455 Bacteria 5717
1492 Ga0495603_0043405 3300046455 Bacteria 2685
1493 Ga0495603_0072095 3300046455 Bacteria 2029
1494 Ga0495603_0080224 3300046455 Bacteria 1912
1495 Ga0495629_0002415 3300046459 Bacteria 14376
1496 Ga0495629_0008648 3300046459 Bacteria 7498
1497 Ga0495629_0196068 3300046459 Bacteria 1397
1498 Ga0495629_0311662 3300046459 Bacteria 1076
1499 Ga0495629_0643281 3300046459 Bacteria 707
1500 Ga0495629_0690006 3300046459 Bacteria 678
1501 Ga0495638_0045067 3300046460 Bacteria 2776
1502 Ga0495638_0062547 3300046460 Bacteria 2297
1503 Ga0495641_0007056 3300046461 Bacteria 7119
1504 Ga0495641_0028225 3300046461 Bacteria 2718
1505 Ga0495651_0038171 3300046462 Bacteria 3740
1506 Ga0495651_0127351 3300046462 Bacteria 1863
1507 Ga0495653_0001564 3300046463 Bacteria 17908
1508 Ga0495653_0037648 3300046463 Bacteria 3798
1509 Ga0495580_0104325 3300046472 Bacteria 1970
1510 Ga0495580_0145000 3300046472 Bacteria 1645
1511 Ga0495580_0297767 3300046472 Bacteria 1099
1512 Ga0495580_0418642 3300046472 Bacteria 901
1513 Ga0495580_0721769 3300046472 Bacteria 651
1514 Ga0495582_0194853 3300046473 Bacteria 1156
1515 Ga0495605_0103108 3300046474 Bacteria 1309
1516 Ga0495639_0001235 3300046475 Bacteria 11524
1517 Ga0495639_0014386 3300046475 Bacteria 3426
1518 Ga0495639_0033442 3300046475 Bacteria 2296
1519 Ga0495662_0005171 3300046476 Bacteria 6540
1520 Ga0495662_0031740 3300046476 Bacteria 2552
1521 Ga0495662_0171713 3300046476 Bacteria 1068
1522 Ga0495664_0001468 3300046477 Bacteria 12483
1523 Ga0495664_0004629 3300046477 Bacteria 7524
1524 Ga0495664_0104250 3300046477 Bacteria 1709
1525 Ga0495664_0497989 3300046477 Bacteria 728
1526 Ga0495584_0006069 3300046491 Bacteria 6360
1527 Ga0495584_0033197 3300046491 Bacteria 2611
1528 Ga0495584_0106761 3300046491 Bacteria 1416
1529 Ga0495585_0023251 3300046492 Bacteria 3557
1530 Ga0495585_0256071 3300046492 Bacteria 872
1531 Ga0495594_0000885 3300046499 Bacteria 15447
1532 Ga0495594_0047293 3300046499 Bacteria 2362
1533 Ga0495594_0137014 3300046499 Bacteria 1388
1534 Ga0495596_0016289 3300046500 Bacteria 3091
1535 Ga0495596_0318019 3300046500 Bacteria 605
1536 Ga0495607_0146650 3300046501 Bacteria 1212
1537 Ga0495583_0134087 3300046506 Bacteria 1035
1538 Ga0495606_0147045 3300046507 Bacteria 1386
1539 Ga0495606_0270425 3300046507 Bacteria 934
1540 Ga0495606_0318004 3300046507 Bacteria 837
1541 Ga0495606_0414019 3300046507 Bacteria 699
1542 Ga0495608_0004913 3300046511 Bacteria 9575
1543 Ga0495608_0011240 3300046511 Bacteria 6232
1544 Ga0495616_0139249 3300046513 Bacteria 1106
1545 Ga0495618_0007887 3300046514 Bacteria 6443
1546 Ga0495618_0048797 3300046514 Bacteria 2673
1547 Ga0495618_0224550 3300046514 Bacteria 1184
1548 Ga0495628_0121770 3300046516 Bacteria 2000
1549 Ga0495628_0200556 3300046516 Bacteria 1503
1550 Ga0495630_0023958 3300046517 Bacteria 4513
1551 Ga0495630_0449427 3300046517 Bacteria 987
1552 Ga0495630_0556283 3300046517 Bacteria 880
1553 Ga0495630_0568859 3300046517 Bacteria 869
1554 Ga0495631_0071504 3300046518 Bacteria 1499
1555 Ga0495637_0035852 3300046520 Bacteria 2165
1556 Ga0495637_0139854 3300046520 Bacteria 919
1557 Ga0495644_0061992 3300046523 Bacteria 1405
1558 Ga0495644_0126491 3300046523 Bacteria 973
1559 Ga0495666_0008960 3300046526 Bacteria 5007
1560 Ga0495666_0243431 3300046526 Bacteria 820
1561 Ga0495666_0356301 3300046526 Bacteria 659
1562 Ga0495652_0006569 3300046529 Bacteria 10804
1563 Ga0495652_0112959 3300046529 Bacteria 2181
1564 Ga0495652_0244946 3300046529 Bacteria 1332
1565 Ga0495665_0010456 3300046531 Bacteria 5021
1566 Ga0495665_0066400 3300046531 Bacteria 1904
1567 Ga0495665_0238104 3300046531 Bacteria 939
1568 Ga0495665_0454537 3300046531 Bacteria 647
1569 Ga0495640_0097308 3300046533 Bacteria 1935
1570 Ga0495640_0119515 3300046533 Bacteria 1714
1571 Ga0495640_0616370 3300046533 Bacteria 655
1572 Ga0495586_0006626 3300046535 Bacteria 6185
1573 Ga0495586_0108693 3300046535 Bacteria 1542
1574 Ga0495586_0385101 3300046535 Bacteria 807
1575 Ga0495587_0009864 3300046536 Bacteria 6097
1576 Ga0495587_0021655 3300046536 Bacteria 3966
1577 Ga0495587_0097944 3300046536 Bacteria 1691
1578 Ga0495598_0013282 3300046537 Bacteria 2038
1579 Ga0495609_0158595 3300046538 Bacteria 960
1580 Ga0495621_0092527 3300046539 Bacteria 1141
1581 Ga0495645_0005648 3300046543 Bacteria 8612
1582 Ga0495645_0162120 3300046543 Bacteria 1545
1583 Ga0495645_0688952 3300046543 Bacteria 621
1584 Ga0495622_0018025 3300046557 Bacteria 3287
1585 Ga0495622_0096837 3300046557 Bacteria 1354
1586 Ga0495622_0097993 3300046557 Bacteria 1345
1587 Ga0495667_0002438 3300046559 Bacteria 12418
1588 Ga0495667_0071062 3300046559 Bacteria 2270
1589 Ga0495667_0679497 3300046559 Bacteria 639
1590 Ga0495656_0017072 3300046615 Bacteria 2764
1591 Ga0495656_0047340 3300046615 Bacteria 1823
1592 Ga0495634_0051519 3300046642 Bacteria 2762
1593 Ga0495634_0064532 3300046642 Bacteria 2427
1594 Ga0495634_0113159 3300046642 Bacteria 1743
1595 Ga0495634_0850820 3300046642 Bacteria 518
1596 Ga0495611_0087587 3300046648 Bacteria 1437
1597 Ga0495625_0651455 3300046660 Bacteria 627
1598 Ga0495635_0001320 3300046663 Bacteria 16508
1599 Ga0495635_0237066 3300046663 Bacteria 1231
1600 Ga0495659_0047341 3300046664 Bacteria 1555
1601 Ga0495659_0063621 3300046664 Bacteria 1368
1602 Ga0495661_0150947 3300046665 Bacteria 1255
1603 Ga0495661_0241783 3300046665 Bacteria 926
1604 Ga0495588_0088582 3300046674 Bacteria 1620
1605 Ga0495657_0004369 3300046675 Bacteria 11284
1606 Ga0495657_0201003 3300046675 Bacteria 1215
1607 Ga0495657_0504188 3300046675 Bacteria 706
1608 Ga0495599_0014982 3300046678 Bacteria 4805
1609 Ga0495599_0032053 3300046678 Bacteria 3298
1610 Ga0495623_0005523 3300046679 Bacteria 8259
1611 Ga0495646_0001863 3300046680 Bacteria 12680
1612 Ga0495646_0002260 3300046680 Bacteria 11775
1613 Ga0495647_0000406 3300046681 Bacteria 12338
1614 Ga0495647_0005548 3300046681 Bacteria 4140
1615 Ga0495647_0014711 3300046681 Bacteria 2730
1616 Ga0495647_0116523 3300046681 Bacteria 1120
1617 Ga0495658_0000992 3300046683 Bacteria 15035
1618 Ga0495658_0003451 3300046683 Bacteria 7814
1619 Ga0495658_0044958 3300046683 Bacteria 2476
1620 Ga0495658_0437053 3300046683 Bacteria 835
1621 Ga0495658_0573697 3300046683 Bacteria 723
1622 Ga0495669_0025391 3300046684 Bacteria 2584
1623 Ga0495669_0209154 3300046684 Bacteria 934
1624 Ga0495613_0008131 3300046689 Bacteria 7802
1625 Ga0495613_0082724 3300046689 Bacteria 2331
1626 Ga0495613_0115123 3300046689 Bacteria 1935
1627 Ga0495624_0003021 3300046690 Bacteria 12596
1628 Ga0495624_0095937 3300046690 Bacteria 1827
1629 Ga0495624_0164681 3300046690 Bacteria 1353
1630 Ga0495624_0182713 3300046690 Bacteria 1277
1631 Ga0495624_0204350 3300046690 Bacteria 1199
1632 Ga0495624_0254278 3300046690 Bacteria 1062
1633 Ga0495671_0028600 3300046692 Bacteria 2870
1634 Ga0495671_0264196 3300046692 Bacteria 830
1635 Ga0495649_0361839 3300046694 Bacteria 732
1636 Ga0495649_0378185 3300046694 Bacteria 713
1637 Ga0495589_0231183 3300046794 Bacteria 867
1638 Ga0495600_0004026 3300046809 Bacteria 8734
1639 Ga0495600_0025145 3300046809 Bacteria 3837
1640 Ga0495660_0106434 3300046810 Bacteria 1437
1641 Ga0495581_0004714 3300047315 Bacteria 7872
1642 Ga0495581_0025832 3300047315 Bacteria 3406
1643 Ga0495581_0175629 3300047315 Bacteria 1252
1644 Ga0495581_0369917 3300047315 Bacteria 837
1645 Ga0495581_0464850 3300047315 Bacteria 736
1646 Ga0495604_0004371 3300047317 Bacteria 11195
1647 Ga0495604_0014285 3300047317 Bacteria 6330
1648 Ga0495636_0195845 3300047318 Bacteria 921
1649 Ga0495674_0050447 3300047319 Bacteria 3671
1650 Ga0495674_0063241 3300047319 Bacteria 3219
1651 Ga0495674_0065328 3300047319 Bacteria 3161
1652 Ga0495674_0080891 3300047319 Bacteria 2787
1653 Ga0495674_0158381 3300047319 Bacteria 1896
1654 Ga0495674_0683556 3300047319 Bacteria 807
1655 Ga0495672_0174321 3300047320 Bacteria 1094
1656 Ga0495672_0215502 3300047320 Bacteria 951
1657 Ga0495676_0086776 3300047321 Bacteria 2353
1658 Ga0495676_0206580 3300047321 Bacteria 1361
1659 Ga0495676_0271913 3300047321 Bacteria 1149
1660 Ga0495676_0358073 3300047321 Bacteria 974
1661 Ga0495676_0398758 3300047321 Bacteria 913
1662 Ga0495676_0535528 3300047321 Bacteria 766
1663 Ga0495680_0004581 3300047322 Bacteria 13185
1664 Ga0495680_0021543 3300047322 Bacteria 5394
1665 Ga0495680_0068859 3300047322 Bacteria 2702
1666 Ga0495680_0131854 3300047322 Bacteria 1836
1667 Ga0495680_0376506 3300047322 Bacteria 984
1668 Ga0495680_0680692 3300047322 Bacteria 681
1669 Ga0495675_0058076 3300047444 Bacteria 2453
1670 Ga0495675_0294671 3300047444 Bacteria 965
1671 Ga0495677_0020410 3300047445 Bacteria 2402
1672 Ga0495677_0140963 3300047445 Bacteria 926
1673 Ga0495679_075892 3300047446 Bacteria 961
1674 Ga0495685_073476 3300047447 Bacteria 1144
1675 Ga0495673_0125246 3300047469 Bacteria 1014
1676 Ga0495684_0000665 3300047471 Bacteria 27695
1677 Ga0495684_0049452 3300047471 Bacteria 3212
1678 Ga0495684_0157389 3300047471 Bacteria 1696
1679 Ga0495684_0586580 3300047471 Bacteria 754
1680 Ga0495686_0208209 3300047472 Bacteria 1119
1681 Ga0495593_0002227 3300047673 Bacteria 11631
1682 Ga0495593_0026621 3300047673 Bacteria 3191
1683 Ga0495602_0003946 3300048088 Bacteria 15466
1684 Ga0495602_0078824 3300048088 Bacteria 2781
1685 Ga0495602_0177367 3300048088 Bacteria 1647
1686 Ga0495602_0399205 3300048088 Bacteria 981
1687 Ga0495602_0935539 3300048088 Bacteria 575
1688 Ga0495614_0013298 3300048089 Bacteria 3610
1689 Ga0495614_0073117 3300048089 Bacteria 1480
1690 Ga0495615_0036334 3300048090 Bacteria 1208
1691 Ga0496100_0003652 3300048903 Bacteria 8047
1692 Ga0496100_0013089 3300048903 Bacteria 4775
1693 Ga0496100_0025032 3300048903 Bacteria 3646
1694 Ga0496100_0107162 3300048903 Bacteria 1935
1695 Ga0496100_0121395 3300048903 Bacteria 1828
1696 Ga0496100_0151296 3300048903 Bacteria 1655
1697 Ga0496100_0190031 3300048903 Bacteria 1490
1698 Ga0496100_0220313 3300048903 Bacteria 1392
1699 Ga0496100_0421157 3300048903 Bacteria 1020
1700 Ga0496101_0000964 3300048904 Bacteria 16964
1701 Ga0496101_0001534 3300048904 Bacteria 13845
1702 Ga0496101_0022529 3300048904 Bacteria 4337
1703 Ga0496101_0263881 3300048904 Bacteria 1343
1704 Ga0496101_0408679 3300048904 Bacteria 1069
1705 Ga0496101_0594301 3300048904 Bacteria 875
1706 Ga0496101_0910390 3300048904 Bacteria 692
1707 Ga0496102_0018417 3300048905 Bacteria 6137
1708 Ga0496102_0041498 3300048905 Bacteria 4166
1709 Ga0496102_0081943 3300048905 Bacteria 2975
1710 Ga0496102_0134424 3300048905 Bacteria 2317
1711 Ga0496102_0202829 3300048905 Bacteria 1869
1712 Ga0496102_0277278 3300048905 Bacteria 1580
1713 Ga0496102_0415258 3300048905 Bacteria 1264
1714 Ga0496102_0954277 3300048905 Bacteria 778
1715 Ga0496102_1002107 3300048905 Bacteria 756
1716 Ga0496103_0002627 3300048906 Bacteria 11256
1717 Ga0496103_0060798 3300048906 Bacteria 2348
1718 Ga0496103_0077179 3300048906 Bacteria 2091
1719 Ga0496103_0133772 3300048906 Bacteria 1584
1720 Ga0496103_0140554 3300048906 Bacteria 1544
1721 Ga0496103_0240986 3300048906 Bacteria 1163
1722 Ga0496103_0433272 3300048906 Bacteria 844
1723 Ga0496103_0540409 3300048906 Bacteria 744
1724 Ga0496104_0000062 3300048907 Bacteria 117255
1725 Ga0496104_0003859 3300048907 Bacteria 12970
1726 Ga0496104_0005449 3300048907 Bacteria 11138
1727 Ga0496104_0006088 3300048907 Bacteria 10586
1728 Ga0496104_0012447 3300048907 Bacteria 7650
1729 Ga0496104_0019562 3300048907 Bacteria 6198
1730 Ga0496104_0328086 3300048907 Bacteria 1443
1731 Ga0496104_0351141 3300048907 Bacteria 1387
1732 Ga0496104_0369650 3300048907 Bacteria 1346
1733 Ga0496104_0869670 3300048907 Bacteria 807
1734 Ga0496104_1839788 3300048907 Bacteria 507
1735 Ga0496105_0000069 3300048908 Bacteria 80917
1736 Ga0496105_0002521 3300048908 Bacteria 13283
1737 Ga0496105_0005334 3300048908 Bacteria 9741
1738 Ga0496105_0012965 3300048908 Bacteria 6605
1739 Ga0496105_0013368 3300048908 Bacteria 6514
1740 Ga0496105_0020223 3300048908 Bacteria 5378
1741 Ga0496106_0005548 3300048909 Bacteria 9340
1742 Ga0496106_0010045 3300048909 Bacteria 6992
1743 Ga0496106_0014992 3300048909 Bacteria 5735
1744 Ga0496106_0021945 3300048909 Bacteria 4743
1745 Ga0496106_0282868 3300048909 Bacteria 1329
1746 Ga0496106_0730589 3300048909 Bacteria 788
1747 Ga0496106_1394956 3300048909 Bacteria 541
1748 Ga0496107_0009919 3300048910 Bacteria 6609
1749 Ga0496107_0030691 3300048910 Bacteria 3831
1750 Ga0496107_0033427 3300048910 Bacteria 3679
1751 Ga0496107_0036189 3300048910 Bacteria 3540
1752 Ga0496107_0065471 3300048910 Bacteria 2634
1753 Ga0496107_0161334 3300048910 Bacteria 1661
1754 Ga0496107_0258524 3300048910 Bacteria 1296
1755 Ga0496108_0005674 3300048911 Bacteria 10103
1756 Ga0496108_0014484 3300048911 Bacteria 6438
1757 Ga0496108_0016715 3300048911 Bacteria 5993
1758 Ga0496108_0048390 3300048911 Bacteria 3555
1759 Ga0496108_0076490 3300048911 Bacteria 2829
1760 Ga0496108_0105509 3300048911 Bacteria 2406
1761 Ga0496108_0113341 3300048911 Bacteria 2320
1762 Ga0496108_0196494 3300048911 Bacteria 1749
1763 Ga0496108_0378916 3300048911 Bacteria 1235
1764 Ga0496109_0001018 3300048912 Bacteria 23151
1765 Ga0496109_0003269 3300048912 Bacteria 13520
1766 Ga0496109_0006704 3300048912 Bacteria 9692
1767 Ga0496109_0018236 3300048912 Bacteria 6164
1768 Ga0496109_0036180 3300048912 Bacteria 4456
1769 Ga0496109_0043990 3300048912 Bacteria 4049
1770 Ga0496109_0123518 3300048912 Bacteria 2413
1771 Ga0496109_0326010 3300048912 Bacteria 1449
1772 Ga0496109_0526720 3300048912 Bacteria 1115
1773 Ga0496109_0566068 3300048912 Bacteria 1072
1774 Ga0496110_0003889 3300048913 Bacteria 11494
1775 Ga0496110_0004123 3300048913 Bacteria 11228
1776 Ga0496110_0008786 3300048913 Bacteria 8140
1777 Ga0496110_0010013 3300048913 Bacteria 7693
1778 Ga0496110_0017504 3300048913 Bacteria 5996
1779 Ga0496110_0088669 3300048913 Bacteria 2763
1780 Ga0496110_0139440 3300048913 Bacteria 2192
1781 Ga0496110_0186049 3300048913 Bacteria 1886
1782 Ga0496110_0226468 3300048913 Bacteria 1700
1783 Ga0496110_0303999 3300048913 Bacteria 1453
1784 Ga0496110_1545798 3300048913 Bacteria 573
1785 Ga0496111_0009604 3300048914 Bacteria 6461
1786 Ga0496111_0020260 3300048914 Bacteria 4627
1787 Ga0496111_0026058 3300048914 Bacteria 4127
1788 Ga0496111_0252017 3300048914 Bacteria 1310
1789 Ga0496112_0000079 3300048915 Bacteria 64101
1790 Ga0496112_0014236 3300048915 Bacteria 7371
1791 Ga0496112_0025757 3300048915 Bacteria 5649
1792 Ga0496112_0067442 3300048915 Bacteria 3532
1793 Ga0496112_0104117 3300048915 Bacteria 2808
1794 Ga0496112_0188627 3300048915 Bacteria 2024
1795 Ga0496112_0228031 3300048915 Bacteria 1818
1796 Ga0496112_0306080 3300048915 Bacteria 1534
1797 Ga0496112_0486692 3300048915 Bacteria 1170
1798 Ga0496112_0582312 3300048915 Bacteria 1052
1799 Ga0496113_0001952 3300048916 Bacteria 11807
1800 Ga0496113_0002550 3300048916 Bacteria 10630
1801 Ga0496113_0038672 3300048916 Bacteria 3508
1802 Ga0496113_0049794 3300048916 Bacteria 3121
1803 Ga0496113_0109928 3300048916 Bacteria 2144
1804 Ga0496113_0131767 3300048916 Bacteria 1962
1805 Ga0496113_0324454 3300048916 Bacteria 1234
1806 Ga0496114_0005552 3300048917 Bacteria 9884
1807 Ga0496114_0052754 3300048917 Bacteria 3388
1808 Ga0496114_0130190 3300048917 Bacteria 2172
1809 Ga0496114_0133737 3300048917 Bacteria 2143
1810 Ga0496114_0296768 3300048917 Bacteria 1426
1811 Ga0496114_0301128 3300048917 Bacteria 1416
1812 Ga0496114_0544100 3300048917 Bacteria 1026
1813 Ga0496115_0009587 3300048918 Bacteria 7198
1814 Ga0496115_0038830 3300048918 Bacteria 3780
1815 Ga0496115_0045916 3300048918 Bacteria 3488
1816 Ga0496115_0065973 3300048918 Bacteria 2925
1817 Ga0496115_0134504 3300048918 Bacteria 2038
1818 Ga0496115_0361080 3300048918 Bacteria 1183
1819 Ga0496115_0380730 3300048918 Bacteria 1147
1820 Ga0496115_0470906 3300048918 Bacteria 1012
1821 Ga0496115_0759519 3300048918 Bacteria 757
1822 Ga0496115_0829709 3300048918 Bacteria 717
1823 Ga0496116_0032483 3300048919 Bacteria 3719
1824 Ga0496116_0235587 3300048919 Bacteria 924
1825 Ga0496117_0018894 3300048920 Bacteria 5686
1826 Ga0496118_0003967 3300048921 Bacteria 18059
1827 Ga0496119_0008884 3300048922 Bacteria 8740
1828 Ga0496119_0021564 3300048922 Bacteria 4650
1829 Ga0496119_0347648 3300048922 Bacteria 719
1830 Ga0496120_0172926 3300048923 Bacteria 1067
1831 Ga0496121_0000576 3300048924 Bacteria 69005
1832 Ga0496121_0001526 3300048924 Bacteria 38831
1833 Ga0496121_0466583 3300048924 Bacteria 810
1834 Ga0496122_0000160 3300048925 Bacteria 159236
1835 Ga0496122_0503000 3300048925 Bacteria 588
1836 Ga0496123_0000034 3300048926 Bacteria 274836
1837 Ga0496123_0242564 3300048926 Bacteria 894
1838 Ga0496124_0055299 3300048927 Bacteria 3354
1839 Ga0496124_0366719 3300048927 Bacteria 1013
1840 Ga0496125_0034194 3300048928 Bacteria 4484
1841 Ga0496125_0357155 3300048928 Bacteria 870
1842 Ga0496125_0497614 3300048928 Bacteria 687
1843 Ga0496126_0008516 3300048929 Bacteria 11055
1844 Ga0496126_0300824 3300048929 Bacteria 1323
1845 Ga0496126_0346193 3300048929 Bacteria 1216
1846 Ga0496126_0465985 3300048929 Bacteria 1015
1847 Ga0501306_011394 3300049127 Bacteria 1133
1848 Ga0501306_022221 3300049127 Bacteria 894
1849 Ga0501306_074175 3300049127 Bacteria 578
1850 Ga0501308_027067 3300049128 Bacteria 751
1851 Ga0501309_084324 3300049129 Bacteria 536
1852 Ga0501345_03992 3300049134 Bacteria 651
1853 Ga0501304_007279 3300049160 Bacteria 910
1854 Ga0501305_032249 3300049161 Bacteria 822
1855 Ga0501305_033893 3300049161 Bacteria 808
1856 Ga0501305_108060 3300049161 Bacteria 524
1857 Ga0501307_014408 3300049162 Bacteria 966
1858 Ga0501307_019821 3300049162 Bacteria 865
1859 Ga0495682_0001739 3300049460 Bacteria 11047
1860 Ga0495682_0069478 3300049460 Bacteria 1268
1861 Ga0501311_013856 3300049527 Bacteria 1023
1862 Ga0501311_056326 3300049527 Bacteria 626
1863 Ga0501312_087642 3300049528 Bacteria 571
1864 Ga0501313_033449 3300049529 Bacteria 673
1865 Ga0501313_051383 3300049529 Bacteria 570
1866 Ga0501314_006563 3300049530 Bacteria 1016
1867 Ga0501315_017382 3300049531 Bacteria 940
1868 Ga0501316_035020 3300049532 Bacteria 684
1869 Ga0501316_052286 3300049532 Bacteria 590
1870 Ga0501316_066641 3300049532 Bacteria 540
1871 Ga0501317_054853 3300049533 Bacteria 642
1872 Ga0501318_052024 3300049534 Bacteria 611
1873 Ga0501319_004718 3300049535 Bacteria 956
1874 Ga0501319_030601 3300049535 Bacteria 517
1875 Ga0501320_016699 3300049536 Bacteria 814
1876 Ga0501320_044408 3300049536 Bacteria 590
1877 Ga0501321_030603 3300049537 Bacteria 717
1878 Ga0501321_031387 3300049537 Bacteria 711
1879 Ga0501321_063682 3300049537 Bacteria 562
1880 Ga0501322_008464 3300049538 Bacteria 764
1881 Ga0501323_013727 3300049539 Bacteria 1005
1882 Ga0501323_029143 3300049539 Bacteria 768
1883 Ga0501324_009375 3300049540 Bacteria 877
1884 Ga0501325_008441 3300049541 Bacteria 894
1885 Ga0501325_010379 3300049541 Bacteria 843
1886 Ga0501325_017743 3300049541 Bacteria 723
1887 Ga0501325_040955 3300049541 Bacteria 564
1888 Ga0501325_041014 3300049541 Bacteria 563
1889 Ga0501327_08600 3300049543 Bacteria 652
1890 Ga0501328_10531 3300049544 Bacteria 524
1891 Ga0501329_09609 3300049545 Bacteria 596
1892 Ga0501329_10195 3300049545 Bacteria 585
1893 Ga0501330_008594 3300049546 Bacteria 702
1894 Ga0501331_15584 3300049547 Bacteria 504
1895 Ga0501335_029033 3300049551 Bacteria 619
1896 Ga0501336_021297 3300049552 Bacteria 591
1897 Ga0501031_0585608 3300049568 Bacteria 718
1898 Ga0501031_0715726 3300049568 Bacteria 643
1899 Ga0501031_0955429 3300049568 Bacteria 548
1900 Ga0501032_0057878 3300049569 Bacteria 2603
1901 Ga0501032_0078899 3300049569 Bacteria 2192
1902 Ga0501032_0138096 3300049569 Bacteria 1606
1903 Ga0501032_0283490 3300049569 Bacteria 1072
1904 Ga0501033_0000763 3300049570 Bacteria 29600
1905 Ga0501033_0013758 3300049570 Bacteria 6155
1906 Ga0501033_0041417 3300049570 Bacteria 3437
1907 Ga0501033_0068350 3300049570 Bacteria 2612
1908 Ga0501033_0105075 3300049570 Bacteria 2058
1909 Ga0501033_0187357 3300049570 Bacteria 1482
1910 Ga0501033_0211894 3300049570 Bacteria 1381
1911 Ga0501033_0267769 3300049570 Bacteria 1208
1912 Ga0501033_0303176 3300049570 Bacteria 1124
1913 Ga0501033_0860020 3300049570 Bacteria 611
1914 Ga0501034_0109420 3300049571 Bacteria 2754
1915 Ga0501034_0206828 3300049571 Bacteria 1919
1916 Ga0501034_0220111 3300049571 Bacteria 1851
1917 Ga0501034_0262996 3300049571 Bacteria 1668
1918 Ga0501034_0351742 3300049571 Bacteria 1401
1919 Ga0501034_0502154 3300049571 Bacteria 1127
1920 Ga0501034_1018463 3300049571 Bacteria 711
1921 Ga0501034_1249833 3300049571 Bacteria 620
1922 Ga0501034_1529601 3300049571 Bacteria 541
1923 Ga0501036_0023988 3300049572 Bacteria 5142
1924 Ga0501036_0059405 3300049572 Bacteria 3240
1925 Ga0501036_0276944 3300049572 Bacteria 1404
1926 Ga0501036_0404901 3300049572 Bacteria 1138
1927 Ga0501036_1057402 3300049572 Bacteria 664
1928 Ga0501037_0061556 3300049573 Bacteria 2737
1929 Ga0501037_0077620 3300049573 Bacteria 2410
1930 Ga0501037_0092344 3300049573 Bacteria 2189
1931 Ga0501037_0096455 3300049573 Bacteria 2137
1932 Ga0501037_0166391 3300049573 Bacteria 1570
1933 Ga0501037_0823041 3300049573 Bacteria 612
1934 Ga0501038_0064087 3300049574 Bacteria 3135
1935 Ga0501038_0096710 3300049574 Bacteria 2464
1936 Ga0501038_0126590 3300049574 Bacteria 2102
1937 Ga0501038_0187470 3300049574 Bacteria 1666
1938 Ga0501038_0215822 3300049574 Bacteria 1533
1939 Ga0501038_0428605 3300049574 Bacteria 1019
1940 Ga0501038_0928801 3300049574 Bacteria 641
1941 Ga0501038_0982752 3300049574 Bacteria 620
1942 Ga0501038_1067581 3300049574 Bacteria 591
1943 Ga0501039_0420782 3300049575 Bacteria 1049
1944 Ga0501039_0668118 3300049575 Bacteria 813
1945 Ga0501039_0843268 3300049575 Bacteria 714
1946 Ga0501040_0347397 3300049576 Bacteria 1062
1947 Ga0501041_0150747 3300049577 Bacteria 1452
1948 Ga0501042_0151831 3300049578 Bacteria 1670
1949 Ga0501042_0272239 3300049578 Bacteria 1223
1950 Ga0501042_0357926 3300049578 Bacteria 1056
1951 Ga0501042_0358368 3300049578 Bacteria 1055
1952 Ga0501042_0650562 3300049578 Bacteria 766
1953 Ga0501043_0028008 3300049579 Bacteria 4422
1954 Ga0501043_0065904 3300049579 Bacteria 2844
1955 Ga0501043_0146293 3300049579 Bacteria 1850
1956 Ga0501043_0182295 3300049579 Bacteria 1636
1957 Ga0501043_0247472 3300049579 Bacteria 1374
1958 Ga0501043_0297076 3300049579 Bacteria 1235
1959 Ga0501043_0512099 3300049579 Bacteria 895
1960 Ga0501046_0024970 3300049580 Bacteria 4896
1961 Ga0501046_0338508 3300049580 Bacteria 1094
1962 Ga0501046_0409153 3300049580 Bacteria 979
1963 Ga0501046_0606871 3300049580 Bacteria 776
1964 Ga0501046_0776205 3300049580 Bacteria 672
1965 Ga0501047_0009361 3300049581 Bacteria 9252
1966 Ga0501047_0027159 3300049581 Bacteria 5514
1967 Ga0501047_0042561 3300049581 Bacteria 4389
1968 Ga0501047_0055535 3300049581 Bacteria 3829
1969 Ga0501047_0079894 3300049581 Bacteria 3144
1970 Ga0501047_0105031 3300049581 Bacteria 2705
1971 Ga0501047_0138409 3300049581 Bacteria 2314
1972 Ga0501047_0299684 3300049581 Bacteria 1450
1973 Ga0501047_0441750 3300049581 Bacteria 1131
1974 Ga0501047_0705864 3300049581 Bacteria 826
1975 Ga0501047_1071807 3300049581 Bacteria 619
1976 Ga0501048_0368864 3300049582 Bacteria 1025
1977 Ga0501067_0003431 3300049583 Bacteria 8721
1978 Ga0501067_0062663 3300049583 Bacteria 2059
1979 Ga0501068_0191040 3300049584 Bacteria 1297
1980 Ga0501068_0402926 3300049584 Bacteria 882
1981 Ga0501069_0464584 3300049585 Bacteria 753
1982 Ga0501070_0013211 3300049586 Bacteria 6961
1983 Ga0501070_0060200 3300049586 Bacteria 3148
1984 Ga0501070_0065603 3300049586 Bacteria 3006
1985 Ga0501070_0084233 3300049586 Bacteria 2632
1986 Ga0501070_0106670 3300049586 Bacteria 2315
1987 Ga0501070_0240323 3300049586 Bacteria 1482
1988 Ga0501071_0261423 3300049587 Bacteria 1307
1989 Ga0501071_0293848 3300049587 Bacteria 1231
1990 Ga0501072_0006469 3300049588 Bacteria 8920
1991 Ga0501072_0007497 3300049588 Bacteria 8280
1992 Ga0501072_0298024 3300049588 Bacteria 1282
1993 Ga0501072_0693278 3300049588 Bacteria 801
1994 Ga0501073_0030301 3300049589 Bacteria 3863
1995 Ga0501073_0111058 3300049589 Bacteria 1902
1996 Ga0501073_0202041 3300049589 Bacteria 1374
1997 Ga0501073_0217534 3300049589 Bacteria 1320
1998 Ga0501073_0438839 3300049589 Bacteria 902
1999 Ga0501073_0507685 3300049589 Bacteria 833
2000 Ga0501073_0513554 3300049589 Bacteria 828
2001 Ga0501073_0669927 3300049589 Bacteria 716
2002 Ga0501074_0279253 3300049590 Bacteria 1187
2003 Ga0501074_0399881 3300049590 Bacteria 974
2004 Ga0501074_0750382 3300049590 Bacteria 688
2005 Ga0501075_0091594 3300049591 Bacteria 2307
2006 Ga0501075_0298241 3300049591 Bacteria 1228
2007 Ga0501075_0584864 3300049591 Bacteria 852
2008 Ga0501076_0019729 3300049592 Bacteria 5156
2009 Ga0501076_0111236 3300049592 Bacteria 2214
2010 Ga0501076_0124026 3300049592 Bacteria 2092
2011 Ga0501076_0264061 3300049592 Bacteria 1410
2012 Ga0501077_0135215 3300049593 Bacteria 1564
2013 Ga0501243_055495 3300049675 Bacteria 724
2014 Ga0501253_131304 3300049683 Bacteria 616
2015 Ga0501259_142044 3300049688 Bacteria 588
2016 Ga0501079_0019839 3300049741 Bacteria 5136
2017 Ga0501079_0101613 3300049741 Bacteria 2230
2018 Ga0501079_0339646 3300049741 Bacteria 1176
2019 Ga0501079_0659442 3300049741 Bacteria 824
2020 Ga0501079_0754810 3300049741 Bacteria 766
2021 Ga0501079_0863338 3300049741 Bacteria 713
2022 Ga0501080_0027939 3300049742 Bacteria 5246
2023 Ga0501080_0032171 3300049742 Bacteria 4890
2024 Ga0501080_0079896 3300049742 Bacteria 3040
2025 Ga0501080_0097738 3300049742 Bacteria 2726
2026 Ga0501080_0151156 3300049742 Bacteria 2146
2027 Ga0501080_0330730 3300049742 Bacteria 1378
2028 Ga0501081_0004665 3300049743 Bacteria 8811
2029 Ga0501081_0066924 3300049743 Bacteria 2499
2030 Ga0501081_0122167 3300049743 Bacteria 1856
2031 Ga0501083_0005990 3300049744 Bacteria 8611
2032 Ga0501083_0042949 3300049744 Bacteria 3063
2033 Ga0501083_0083005 3300049744 Bacteria 2122
2034 Ga0501083_0270798 3300049744 Bacteria 1105
2035 Ga0501083_0399139 3300049744 Bacteria 895
2036 Ga0501083_0697781 3300049744 Bacteria 660
2037 Ga0501268_023113 3300049765 Bacteria 1078
2038 Ga0501280_075591 3300049776 Bacteria 611
2039 Ga0501035_0055995 3300049822 Bacteria 3520
2040 Ga0501035_0073162 3300049822 Bacteria 3032
2041 Ga0501035_0090103 3300049822 Bacteria 2700
2042 Ga0501035_0120821 3300049822 Bacteria 2290
2043 Ga0501035_0126146 3300049822 Bacteria 2234
2044 Ga0501035_0229518 3300049822 Bacteria 1582
2045 Ga0501035_0321314 3300049822 Bacteria 1300
2046 Ga0501035_0493632 3300049822 Bacteria 1008
2047 Ga0501044_0007994 3300049823 Bacteria 11621
2048 Ga0501044_0009855 3300049823 Bacteria 10385
2049 Ga0501044_0076782 3300049823 Bacteria 3389
2050 Ga0501044_0083877 3300049823 Bacteria 3221
2051 Ga0501044_0093477 3300049823 Bacteria 3032
2052 Ga0501044_0154315 3300049823 Bacteria 2276
2053 Ga0501044_0154552 3300049823 Bacteria 2274
2054 Ga0501044_0161764 3300049823 Bacteria 2215
2055 Ga0501044_0191698 3300049823 Bacteria 2006
2056 Ga0501044_0368466 3300049823 Bacteria 1353
2057 Ga0501044_0384559 3300049823 Bacteria 1318
2058 Ga0501044_0463960 3300049823 Bacteria 1171
2059 Ga0501044_0471468 3300049823 Bacteria 1159
2060 Ga0501044_0574218 3300049823 Bacteria 1023
2061 Ga0501044_0722177 3300049823 Bacteria 880
2062 Ga0501044_1096889 3300049823 Bacteria 665
2063 nmdc:mga03683_192237_c1 3300050489 Bacteria 934
2064 nmdc:mga03683_33053_c1 3300050489 Bacteria 2084
2065 nmdc:mga03683_97080_c1 3300050489 Bacteria 1291
2066 nmdc:mga03n38_636598_c1 3300050490 Bacteria 610
2067 nmdc:mga03n38_699629_c1 3300050490 Bacteria 584
2068 nmdc:mga00v17_179599_c1 3300050491 Bacteria 1366
2069 nmdc:mga00v17_254254_c1 3300050491 Bacteria 1139
2070 nmdc:mga00v17_850766_c1 3300050491 Bacteria 579
2071 nmdc:mga0yw44_197226_c1 3300050492 Bacteria 1329
2072 nmdc:mga0yw44_24684_c1 3300050492 Bacteria 3406
2073 nmdc:mga0yw44_320641_c1 3300050492 Bacteria 1040
2074 nmdc:mga0yw44_5178_c1 3300050492 Bacteria 6110
2075 nmdc:mga0yw44_72129_c1 3300050492 Bacteria 2146
2076 nmdc:mga0k408_176885_c1 3300050493 Bacteria 1272
2077 nmdc:mga0k408_43959_c1 3300050493 Bacteria 2575
2078 nmdc:mga06z11_105625_c1 3300050494 Bacteria 1552
2079 nmdc:mga06z11_206429_c1 3300050494 Bacteria 1143
2080 nmdc:mga06z11_28022_c1 3300050494 Bacteria 2699
2081 nmdc:mga06z11_403118_c1 3300050494 Bacteria 823
2082 nmdc:mga06z11_413932_c1 3300050494 Bacteria 812
2083 nmdc:mga06z11_455955_c1 3300050494 Bacteria 773
2084 nmdc:mga06z11_5834_c1 3300050494 Bacteria 4970
2085 nmdc:mga04h51_28279_c1 3300050495 Bacteria 1748
2086 nmdc:mga04h51_303378_c1 3300050495 Bacteria 651
2087 nmdc:mga07m45_325211_c1 3300050496 Bacteria 894
2088 nmdc:mga07m45_514818_c1 3300050496 Bacteria 693
2089 nmdc:mga05p37_1103959_c1 3300050507 Bacteria 830
2090 nmdc:mga05p37_1402269_c1 3300050507 Bacteria 703
2091 nmdc:mga05p37_203667_c1 3300050507 Bacteria 2395
2092 nmdc:mga05p37_295714_c1 3300050507 Bacteria 1926
2093 nmdc:mga05p37_346454_c1 3300050507 Bacteria 1750
2094 nmdc:mga05p37_427886_c1 3300050507 Bacteria 1539
2095 nmdc:mga05p37_478293_c1 3300050507 Bacteria 1435
2096 nmdc:mga05p37_843418_c1 3300050507 Bacteria 996
2097 nmdc:mga09592_110127_c1 3300050508 Bacteria 2362
2098 nmdc:mga09592_572805_c1 3300050508 Bacteria 969
2099 nmdc:mga09592_583050_c1 3300050508 Bacteria 959
2100 nmdc:mga0qj67_110_c1 3300050509 Bacteria 54139
2101 nmdc:mga0qj67_192888_c1 3300050509 Bacteria 1655
2102 nmdc:mga0qj67_210707_c1 3300050509 Bacteria 1578
2103 nmdc:mga0qj67_45773_c1 3300050509 Bacteria 3452
2104 nmdc:mga0qj67_895066_c1 3300050509 Bacteria 699
2105 nmdc:mga06r32_140579_c1 3300050510 Bacteria 2390
2106 nmdc:mga06r32_240550_c1 3300050510 Bacteria 1798
2107 nmdc:mga06r32_357616_c1 3300050510 Bacteria 1444
2108 nmdc:mga06r32_69907_c1 3300050510 Bacteria 3394
2109 nmdc:mga08y16_1040336_c1 3300050511 Bacteria 797
2110 nmdc:mga08y16_105316_c1 3300050511 Bacteria 2936
2111 nmdc:mga08y16_112073_c1 3300050511 Bacteria 2840
2112 nmdc:mga08y16_1179181_c1 3300050511 Bacteria 737
2113 nmdc:mga08y16_16917_c1 3300050511 Bacteria 7680
2114 nmdc:mga08y16_20977_c1 3300050511 Bacteria 6897
2115 nmdc:mga08y16_311778_c1 3300050511 Bacteria 1620
2116 nmdc:mga0n895_1204055_c1 3300050512 Bacteria 731
2117 nmdc:mga0n895_30484_c1 3300050512 Bacteria 5155
2118 nmdc:mga0n895_313048_c1 3300050512 Bacteria 1591
2119 nmdc:mga0n895_32647_c1 3300050512 Bacteria 4998
2120 nmdc:mga0n895_43218_c1 3300050512 Bacteria 4390
2121 nmdc:mga0n895_821186_c1 3300050512 Bacteria 616
2122 nmdc:mga0n895_848429_c1 3300050512 Bacteria 901
2123 nmdc:mga0rr50_106113_c1 3300050513 Bacteria 2216
2124 nmdc:mga0rr50_1154146_c1 3300050513 Bacteria 658
2125 nmdc:mga0rr50_295143_c1 3300050513 Bacteria 1355
2126 nmdc:mga0rr50_304657_c1 3300050513 Bacteria 1333
2127 nmdc:mga0rr50_509303_c1 3300050513 Bacteria 1024
2128 nmdc:mga08x19_197103_c1 3300050514 Bacteria 1379
2129 nmdc:mga08x19_348162_c1 3300050514 Bacteria 1034
2130 nmdc:mga08x19_62131_c1 3300050514 Bacteria 2421
2131 nmdc:mga08x19_7671_c1 3300050514 Bacteria 6406
2132 nmdc:mga08x19_96968_c1 3300050514 Bacteria 1952
2133 nmdc:mga0a205_199291_c1 3300050515 Bacteria 1893
2134 nmdc:mga0a205_485_c2 3300050515 Bacteria 14949
2135 nmdc:mga0a205_80824_c1 3300050515 Bacteria 3140
2136 nmdc:mga0a205_815016_c1 3300050515 Bacteria 781
2137 nmdc:mga0sz30_39284_c1 3300050516 Bacteria 1985
2138 Ga0495601_0001249 3300053077 Bacteria 13944
2139 Ga0495601_0005437 3300053077 Bacteria 7418
2140 Ga0495601_0020790 3300053077 Bacteria 4011
2141 Ga0495601_0029740 3300053077 Bacteria 3390
2142 Ga0495601_0165209 3300053077 Bacteria 1447
2143 Ga0495612_0001253 3300053078 Bacteria 10465
2144 Ga0495612_0008705 3300053078 Bacteria 4115
2145 Ga0495612_0130839 3300053078 Bacteria 1084
2146 Ga0495612_0198168 3300053078 Bacteria 885
2147 Ga0500635_0015409 3300053080 Bacteria 2258
2148 Ga0495655_0012906 3300053083 Bacteria 1714
2149 Ga0495595_0000908 3300053084 Bacteria 11418
2150 Ga0495595_0002372 3300053084 Bacteria 7341
2151 Ga0495595_0169026 3300053084 Bacteria 1082
2152 Ga0495619_0003156 3300053085 Bacteria 10692
2153 Ga0495619_0005876 3300053085 Bacteria 7774
2154 Ga0495619_0040506 3300053085 Bacteria 3045
2155 Ga0495619_0060676 3300053085 Bacteria 2514
2156 Ga0495619_0061545 3300053085 Bacteria 2498
2157 Ga0500643_000003 3300053087 Bacteria 876659
2158 Ga0500647_0278844 3300053091 Bacteria 723
2159 Ga0500566_0103446 3300053094 Bacteria 1558
2160 Ga0500566_0430688 3300053094 Bacteria 582
2161 Ga0500641_0080812 3300053096 Bacteria 1379
2162 Ga0500648_199276 3300053097 Bacteria 1008
2163 Ga0500558_143487 3300053106 Bacteria 896
2164 Ga0500592_040571 3300053116 Bacteria 753
2165 Ga0500595_000096 3300053119 Bacteria 61002
2166 Ga0500595_036587 3300053119 Bacteria 1607
2167 Ga0500595_041856 3300053119 Bacteria 1470
2168 Ga0500595_088417 3300053119 Bacteria 899
2169 Ga0500618_003035 3300053125 Bacteria 5964
2170 Ga0500628_152685 3300053129 Bacteria 647
2171 Ga0500642_0147330 3300053130 Bacteria 1105
2172 Ga0500559_0167038 3300053136 Bacteria 1034
2173 Ga0500564_235778 3300053138 Bacteria 733
2174 Ga0500568_0009896 3300053139 Bacteria 4504
2175 Ga0500573_0000002 3300053140 Bacteria 407088
2176 Ga0500573_0013140 3300053140 Bacteria 4660
2177 Ga0500603_058966 3300053150 Bacteria 1069
2178 Ga0500616_0002365 3300053153 Bacteria 15857
2179 Ga0500616_0259111 3300053153 Bacteria 739
2180 Ga0500619_147881 3300053154 Bacteria 800
2181 Ga0500638_149454 3300053162 Bacteria 1040
2182 Ga0500639_135040 3300053163 Bacteria 1163
2183 Ga0500636_0000044 3300053177 Bacteria 66762
2184 Ga0500636_0087924 3300053177 Bacteria 1782
2185 Ga0500636_0253672 3300053177 Bacteria 895
2186 Ga0500645_034726 3300053730 Bacteria 1506
2187 Ga0500645_078168 3300053730 Bacteria 945
2188 Ga0500596_019464 3300053735 Bacteria 1020
2189 Ga0501084_0000049 3300054114 Bacteria 94947
2190 Ga0501084_0006919 3300054114 Bacteria 9335
2191 Ga0501084_0014455 3300054114 Bacteria 6542
2192 Ga0501084_0071047 3300054114 Bacteria 2914
2193 Ga0501084_0093223 3300054114 Bacteria 2528
2194 Ga0501084_0143212 3300054114 Bacteria 2013
2195 Ga0501084_0176012 3300054114 Bacteria 1806
2196 Ga0501084_0482857 3300054114 Bacteria 1047
2197 Ga0501084_0554901 3300054114 Bacteria 971
2198 Ga0501084_0953143 3300054114 Bacteria 721
2199 Ga0501084_1160584 3300054114 Bacteria 648
2200 Ga0501084_1386455 3300054114 Bacteria 589
2201 Ga0587084_013044 3300059477 Bacteria 1136
2202 Ga0587066_020471 3300059490 Bacteria 1087
2203 Ga0587070_022744 3300059491 Bacteria 1070
2204 Ga0587073_0060983 3300059492 Bacteria 884
2205 Ga0587077_018926 3300059493 Bacteria 1192
2206 Ga0587077_081476 3300059493 Bacteria 744
2207 Ga0587080_025810 3300059503 Bacteria 994
2208 Ga0587080_026354 3300059503 Bacteria 987
2209 Ga0587083_0035659 3300059505 Bacteria 1015
2210 Ga0587085_019087 3300059506 Bacteria 1024
2211 Ga0587088_026948 3300059508 Bacteria 1001
2212 Ga0587089_042684 3300059509 Bacteria 706
2213 Ga0587089_050426 3300059509 Bacteria 667
2214 Ga0587090_018670 3300059510 Bacteria 1062
2215 Ga0587091_018613 3300059511 Bacteria 1184
2216 Ga0587101_008409 3300059623 Bacteria 1246
2217 Ga0587109_013812 3300059624 Bacteria 1346
2218 Ga0587115_013681 3300059626 Bacteria 1053
2219 Ga0587128_019433 3300059630 Bacteria 1029
2220 Ga0587062_014590 3300059639 Bacteria 1039
2221 Ga0587067_013983 3300059640 Bacteria 1280
2222 Ga0587072_020857 3300059643 Bacteria 1158
2223 Ga0587075_017541 3300059644 Bacteria 1031
2224 Ga0587076_023815 3300059645 Bacteria 1034
2225 Ga0587076_132310 3300059645 Bacteria 589
2226 Ga0587078_010640 3300059646 Bacteria 1059
2227 Ga0587079_070651 3300059647 Bacteria 778
2228 Ga0587105_001741 3300059651 Bacteria 1168
2229 Ga0587107_013776 3300059652 Bacteria 1031
2230 Ga0587110_038127 3300059654 Bacteria 609
2231 Ga0587111_0036701 3300060346 Bacteria 1027
2232 Ga0501082_0031765 3300060353 Bacteria 4554
2233 Ga0501082_0053384 3300060353 Bacteria 3484
2234 Ga0501082_0406412 3300060353 Bacteria 1188
2235 Ga0501082_0409845 3300060353 Bacteria 1183
2236 Ga0501082_0566261 3300060353 Bacteria 994
2237 Ga0501082_0823041 3300060353 Bacteria 812
2238 Ga0501082_1549695 3300060353 Bacteria 579
2239 Ga0530510_0081435 3300061734 Bacteria 2357
2240 Ga0530510_0468780 3300061734 Bacteria 953
2241 Ga0530510_0494603 3300061734 Bacteria 927
2242 2600201226 2599185354 Bacteria 4398675
2243 2842695820 2842694124 Bacteria 4063419
2244 Ga0373944_0001645
2245 2214761875
2246 ARcpr5oldR_c000005
2247 ARSoilYngRDRAFT_c00135
2248 ARcpr5yngRDRAFT_c000073
2249 ARSoilOldRDRAFT_c000012
2250 ARCol0oldRDRAFT_c02295
2251 ARCol0yngRDRAFT_1000066
2252 JGI24032J14994_100207
2253 JGI24736J21556_1007134
2254 JGI24736J21556_1079992
2255 JGI24752J21851_1002466
2256 JGI24746J21847_1002567
2257 JGI24747J21853_1000229
2258 JGI24740J21852_10024312
2259 JGI24739J22299_10000451
2260 JGI24739J22299_10006960
2261 JGI24739J22299_10207394
2262 JGI24737J22298_10003545
2263 JGI24737J22298_10013316
2264 JGI24737J22298_10044531
2265 JGI24737J22298_10089320
2266 JGI24743J22301_10045512
2267 JGI24750J21931_1000063
2268 JGI24750J21931_1017352
2269 JGI24745J21846_1000659
2270 JGI24738J21930_10000026
2271 JGI24749J21850_1001547
2272 JGI24744J21845_10007253
2273 JGI24744J21845_10009430
2274 JGI24744J21845_10029022
2275 JGI24035J26624_1000384
2276 JGI24034J26672_10000450
2277 JGI24742J22300_10000100
2278 JGI24751J29686_10008012
2279 JGI25151J46595_10000047
2280 JGI25151J46595_10000086
2281 JGI25165J46597_1000003
2282 JGI25153J46596_10016624
2283 Ga0007417J51691_1068927
2284 Ga0055526_1000102
2285 Ga0055524_1000352
2286 Ga0055534_1064744
2287 Ga0055531_10008796
2288 JGI25405J52794_10005629
2289 JGI25405J52794_10040755
2290 JGI25405J52794_10064746
2291 Ga0065165_1003966
2292 Ga0065714_10210453
2293 Ga0065704_10078881
2294 Ga0065704_10226081
2295 Ga0065712_10000705
2296 Ga0065712_10085237
2297 Ga0065712_10125464
2298 Ga0065715_10003686
2299 Ga0065715_10090522
2300 Ga0065715_10170204
2301 Ga0065707_10257648
2302 Ga0070658_10026441
2303 Ga0070658_10027112
2304 Ga0070658_10038663
2305 Ga0070676_10001250
2306 Ga0070676_10040362
2307 Ga0070676_10137593
2308 Ga0070676_10175776
2309 Ga0070676_10353966
2310 Ga0070683_100148475
2311 Ga0070683_100164558
2312 Ga0070683_100187663
2313 Ga0070683_100199397
2314 Ga0070683_100598761
2315 Ga0070683_101034666
2316 Ga0070683_101545633
2317 Ga0070690_100008879
2318 Ga0070690_100029592
2319 Ga0070690_100119144
2320 Ga0070690_100125557
2321 Ga0070690_100270483
2322 Ga0070690_100313837
2323 Ga0070670_100011383
2324 Ga0070670_100032043
2325 Ga0070670_100414291
2326 Ga0070670_100615852
2327 Ga0070677_10000055
2328 Ga0070677_10305642
2329 Ga0068869_100001739
2330 Ga0068869_100005143
2331 Ga0068869_100035364
2332 Ga0068869_100625513
2333 Ga0068869_100934871
2334 Ga0070666_10030353
2335 Ga0070666_10041771
2336 Ga0070666_10044519
2337 Ga0070666_10053330
2338 Ga0070666_10187419
2339 Ga0070666_10255372
2340 Ga0070666_10710186
2341 Ga0070666_10810409
2342 Ga0070680_100051886
2343 Ga0070680_100053620
2344 Ga0070680_100097846
2345 Ga0070680_100249054
2346 Ga0070680_100256283
2347 Ga0070680_100345980
2348 Ga0070680_100703492
2349 Ga0070682_100008777
2350 Ga0070682_100060665
2351 Ga0070682_100286001
2352 Ga0070682_100398109
2353 Ga0070682_100544002
2354 Ga0068868_100002440
2355 Ga0068868_100188069
2356 Ga0068868_100275076
2357 Ga0068868_100570421
2358 Ga0068868_101084750
2359 Ga0068868_101217280
2360 Ga0070660_100009251
2361 Ga0070660_100056274
2362 Ga0070660_100500742
2363 Ga0070660_100880426
2364 Ga0070660_100885150
2365 Ga0070689_100003427
2366 Ga0070689_100042064
2367 Ga0070689_100056550
2368 Ga0070689_100382832
2369 Ga0070689_100725162
2370 Ga0070691_10018238
2371 Ga0070691_10022689
2372 Ga0070691_10246927
2373 Ga0070691_10730788
2374 Ga0070687_100001219
2375 Ga0070687_100120563
2376 Ga0070687_100143043
2377 Ga0070687_100291039
2378 Ga0070661_100000019
2379 Ga0070661_100005369
2380 Ga0070661_100140071
2381 Ga0070661_100164493
2382 Ga0070661_100279043
2383 Ga0070661_100362815
2384 Ga0070692_10002445
2385 Ga0070692_10029257
2386 Ga0070668_100010381
2387 Ga0070668_100018336
2388 Ga0070668_100090379
2389 Ga0070668_100191925
2390 Ga0070668_100514223
2391 Ga0070669_100003432
2392 Ga0070669_100037713
2393 Ga0070669_100097844
2394 Ga0070669_100115265
2395 Ga0070669_100586699
2396 Ga0070669_100680143
2397 Ga0070669_101579383
2398 Ga0070675_100009751
2399 Ga0070675_100013224
2400 Ga0070675_100063934
2401 Ga0070675_100249883
2402 Ga0070671_100000344
2403 Ga0070671_100023576
2404 Ga0070671_100043720
2405 Ga0070671_100075836
2406 Ga0070671_100880547
2407 Ga0070674_100000250
2408 Ga0070674_100165387
2409 Ga0070674_100443704
2410 Ga0070673_100001701
2411 Ga0070673_100198620
2412 Ga0070673_100199611
2413 Ga0070673_100216864
2414 Ga0070673_100328174
2415 Ga0070673_101077394
2416 Ga0070688_100005899
2417 Ga0070688_100011287
2418 Ga0070688_100069914
2419 Ga0070659_100015535
2420 Ga0070659_100066094
2421 Ga0070659_100072266
2422 Ga0070659_100274884
2423 Ga0070659_100345762
2424 Ga0070659_100369380
2425 Ga0070667_100009616
2426 Ga0070667_100010027
2427 Ga0070667_100015965
2428 Ga0070667_100170241
2429 Ga0070667_100383742
2430 Ga0070703_10003768
2431 Ga0070709_10002940
2432 Ga0070709_10058623
2433 Ga0070709_10075450
2434 Ga0070709_10080351
2435 Ga0070714_100038980
2436 Ga0070714_100044928
2437 Ga0070714_100064144
2438 Ga0070714_100167380
2439 Ga0070714_100978931
2440 Ga0070714_101342156
2441 Ga0070713_100005484
2442 Ga0070713_100100286
2443 Ga0070713_100100653
2444 Ga0070713_100457250
2445 Ga0070713_100630439
2446 Ga0070713_101097523
2447 Ga0070710_10008043
2448 Ga0070710_10093518
2449 Ga0070701_10002806
2450 Ga0070701_10193715
2451 Ga0070711_100002519
2452 Ga0070711_100079918
2453 Ga0070711_100239710
2454 Ga0070711_100451133
2455 Ga0070711_100648831
2456 Ga0070711_101384736
2457 Ga0070705_100014699
2458 Ga0070705_100042721
2459 Ga0070705_100077733
2460 Ga0070700_100045586
2461 Ga0070700_100141319
2462 Ga0070700_100283134
2463 Ga0070700_100380964
2464 Ga0070694_100021143
2465 Ga0070694_100113915
2466 Ga0070694_100533491
2467 Ga0070694_100613062
2468 Ga0070694_100635640
2469 Ga0070708_100032307
2470 Ga0070708_100062532
2471 Ga0070708_100998906
2472 Ga0070663_100029594
2473 Ga0070663_100063184
2474 Ga0070663_100114973
2475 Ga0070663_100539499
2476 Ga0070663_100898540
2477 Ga0070678_100000784
2478 Ga0070678_100149910
2479 Ga0070678_100330483
2480 Ga0070678_100344505
2481 Ga0070678_100432434
2482 Ga0070662_100050231
2483 Ga0070662_100062081
2484 Ga0070662_100078824
2485 Ga0070681_10021719
2486 Ga0070681_10053171
2487 Ga0070681_10156394
2488 Ga0070681_10165291
2489 Ga0070681_10226633
2490 Ga0070681_10469003
2491 Ga0068867_100002792
2492 Ga0068867_100005970
2493 Ga0068867_100021169
2494 Ga0068867_100032862
2495 Ga0068867_100406759
2496 Ga0068867_100981517
2497 Ga0070685_10001307
2498 Ga0070685_10004363
2499 Ga0070685_10023513
2500 Ga0070685_10261202
2501 Ga0070707_100065762
2502 Ga0070707_101006386
2503 Ga0070698_100045789
2504 Ga0070698_100291936
2505 Ga0074259_10113202
2506 Ga0070699_100089245
2507 Ga0070679_100019810
2508 Ga0070679_100029886
2509 Ga0070679_100065568
2510 Ga0070679_100075069
2511 Ga0070679_100125965
2512 Ga0070679_100130785
2513 Ga0070679_100138507
2514 Ga0070679_100255315
2515 Ga0070679_100310154
2516 Ga0070679_100478903
2517 Ga0070679_101207180
2518 Ga0070684_100003800
2519 Ga0070684_100074354
2520 Ga0070684_100097748
2521 Ga0070684_100138507
2522 Ga0070684_100170317
2523 Ga0070684_100698657
2524 Ga0070697_100461969
2525 Ga0070697_101029753
2526 Ga0068853_100011082
2527 Ga0068853_100024870
2528 Ga0068853_100037962
2529 Ga0068853_100066989
2530 Ga0068853_100195671
2531 Ga0068853_100236915
2532 Ga0068853_100237056
2533 Ga0068853_100243596
2534 Ga0068853_100527773
2535 Ga0068853_100652430
2536 Ga0068853_100744453
2537 Ga0068853_101170748
2538 Ga0070672_100002659
2539 Ga0070672_100019800
2540 Ga0070672_100079029
2541 Ga0070672_100368657
2542 Ga0070672_100454588
2543 Ga0070672_100728972
2544 Ga0070686_100005374
2545 Ga0070686_100006315
2546 Ga0070686_100038764
2547 Ga0070686_100418755
2548 Ga0070686_100444268
2549 Ga0070695_100048751
2550 Ga0070695_100058121
2551 Ga0070695_100176070
2552 Ga0070696_100084241
2553 Ga0070696_100099287
2554 Ga0070696_100149510
2555 Ga0070696_100156776
2556 Ga0070696_100216148
2557 Ga0070696_100510550
2558 Ga0070696_100949167
2559 Ga0070696_101264139
2560 Ga0070693_100051208
2561 Ga0070693_100052511
2562 Ga0070693_100096064
2563 Ga0070693_100148217
2564 Ga0070693_100296266
2565 Ga0070693_100414919
2566 Ga0070665_100001666
2567 Ga0070665_100064057
2568 Ga0070665_100069966
2569 Ga0070665_100078425
2570 Ga0070665_100140532
2571 Ga0070665_100148543
2572 Ga0070665_100251134
2573 Ga0070665_100296120
2574 Ga0070665_100372487
2575 Ga0070665_100395612
2576 Ga0070665_100819901
2577 Ga0070665_101008890
2578 Ga0070665_101173653
2579 Ga0070665_101269534
2580 Ga0070704_100006508
2581 Ga0070704_100067471
2582 Ga0068855_100008197
2583 Ga0068855_100012377
2584 Ga0068855_100044569
2585 Ga0068855_100086777
2586 Ga0068855_100199544
2587 Ga0068855_100206748
2588 Ga0068855_100257719
2589 Ga0068855_100495253
2590 Ga0068855_100582375
2591 Ga0068855_100848900
2592 Ga0068855_100953411
2593 Ga0068855_101020036
2594 Ga0070664_100016247
2595 Ga0070664_100106987
2596 Ga0070664_100161050
2597 Ga0070664_100279846
2598 Ga0070664_100857165
2599 Ga0068857_100007028
2600 Ga0068857_100088413
2601 Ga0068857_100139258
2602 Ga0068857_100250095
2603 Ga0068857_100537011
2604 Ga0068857_100569377
2605 Ga0068854_100003980
2606 Ga0068854_100142780
2607 Ga0068854_100430946
2608 Ga0068854_100594912
2609 Ga0068856_100000406
2610 Ga0068856_100181218
2611 Ga0068856_100199039
2612 Ga0068856_100408200
2613 Ga0068856_100917226
2614 Ga0068856_100958480
2615 Ga0068856_101079300
2616 Ga0070702_100000099
2617 Ga0070702_100008907
2618 Ga0070702_100343183
2619 Ga0070702_100358263
2620 Ga0068852_100015801
2621 Ga0068852_100026623
2622 Ga0068852_100057377
2623 Ga0068852_100173312
2624 Ga0068852_100297706
2625 Ga0068852_100389575
2626 Ga0068852_100495730
2627 Ga0068859_100002395
2628 Ga0068859_100072467
2629 Ga0068859_100094856
2630 Ga0068859_100124644
2631 Ga0068859_100617819
2632 Ga0068859_101096576
2633 Ga0068864_100001957
2634 Ga0068864_100021360
2635 Ga0068864_100075862
2636 Ga0068864_100467562
2637 Ga0068864_101158573
2638 Ga0068864_101858767
2639 Ga0068866_10001585
2640 Ga0068866_10008946
2641 Ga0068866_10039117
2642 Ga0068866_10141830
2643 Ga0068866_10219924
2644 Ga0068866_10778945
2645 Ga0068861_100000354
2646 Ga0068861_100021977
2647 Ga0068861_100061718
2648 Ga0068861_100345957
2649 Ga0068861_100727202
2650 Ga0068861_101316366
2651 Ga0068851_10105288
2652 Ga0068851_10565114
2653 Ga0068851_10651429
2654 Ga0068870_10000165
2655 Ga0068870_10049113
2656 Ga0068870_10170947
2657 Ga0068870_10241834
2658 Ga0068863_100001449
2659 Ga0068863_100016627
2660 Ga0068863_100385215
2661 Ga0068863_102342338
2662 Ga0068858_100018513
2663 Ga0068858_100045467
2664 Ga0068858_100052996
2665 Ga0068858_100360279
2666 Ga0068858_100390938
2667 Ga0068858_100411830
2668 Ga0068858_100710224
2669 Ga0068858_100936687
2670 Ga0068860_100001477
2671 Ga0068860_100015564
2672 Ga0068860_100105189
2673 Ga0068860_100472835
2674 Ga0068862_100014775
2675 Ga0068862_100062072
2676 Ga0068862_100082075
2677 Ga0068862_100327025
2678 Ga0081455_10000327
2679 Ga0081455_10001293
2680 Ga0081455_10615716
2681 Ga0081538_10014654
2682 Ga0081540_1000108
2683 Ga0081540_1019974
2684 Ga0081540_1055343
2685 Ga0081540_1096624
2686 Ga0081540_1110301
2687 Ga0081539_10209184
2688 Ga0081539_10232325
2689 Ga0070717_10001121
2690 Ga0070717_10038847
2691 Ga0070717_10160743
2692 Ga0070717_10447794
2693 Ga0075365_10000253
2694 Ga0075365_10006417
2695 Ga0075365_10182519
2696 Ga0075365_10244030
2697 Ga0075365_10254072
2698 Ga0075365_10480691
2699 Ga0075368_10019183
2700 Ga0075368_10162350
2701 Ga0075368_10291057
2702 Ga0075363_100111876
2703 Ga0075363_100401880
2704 Ga0075363_100522274
2705 Ga0075363_100528928
2706 Ga0075363_100688219
2707 Ga0075364_10374816
2708 Ga0075432_10047301
2709 Ga0070715_10026313
2710 Ga0070715_10084938
2711 Ga0070715_10459969
2712 Ga0070715_10780685
2713 Ga0070716_100001226
2714 Ga0070716_100014276
2715 Ga0070716_100161095
2716 Ga0070716_100203854
2717 Ga0070716_100345556
2718 Ga0070716_100655030
2719 Ga0070712_100000244
2720 Ga0070712_100000983
2721 Ga0070712_100021619
2722 Ga0070712_100052038
2723 Ga0070712_100109751
2724 Ga0070712_100165502
2725 Ga0070712_100240294
2726 Ga0070712_100444422
2727 Ga0070712_100502869
2728 Ga0075362_10035265
2729 Ga0075362_10059826
2730 Ga0075362_10064177
2731 Ga0075362_10212101
2732 Ga0075362_10238835
2733 Ga0075367_10002242
2734 Ga0075367_10008688
2735 Ga0075367_10315627
2736 Ga0075369_10004804
2737 Ga0075369_10034041
2738 Ga0075369_10101868
2739 Ga0075369_10134756
2740 Ga0075366_10002628
2741 Ga0075366_10032261
2742 Ga0075366_10150985
2743 Ga0075366_10430188
2744 Ga0075366_10467746
2745 Ga0075366_10519606
2746 Ga0075366_10539806
2747 Ga0097621_100000841
2748 Ga0097621_100001124
2749 Ga0097621_100012671
2750 Ga0097621_100021911
2751 Ga0097621_100058357
2752 Ga0097621_100170557
2753 Ga0097621_100274064
2754 Ga0097621_100423828
2755 Ga0075370_10080473
2756 Ga0075370_10316348
2757 Ga0075370_10316890
2758 Ga0075370_10544435
2759 Ga0068871_100000243
2760 Ga0068871_100001352
2761 Ga0068871_100052112
2762 Ga0068871_100168956
2763 Ga0068871_100181937
2764 Ga0068871_100249544
2765 Ga0068871_100274060
2766 Ga0068871_100464386
2767 Ga0068871_101372948
2768 Ga0075428_100048667
2769 Ga0075428_100441727
2770 Ga0075428_100924867
2771 Ga0075428_101120323
2772 Ga0075430_100000370
2773 Ga0075430_100018050
2774 Ga0075431_100111850
2775 Ga0075431_100337906
2776 Ga0075431_100658515
2777 Ga0075433_10010812
2778 Ga0075433_10137753
2779 Ga0075433_10195773
2780 Ga0075434_100029863
2781 Ga0075434_100041047
2782 Ga0075434_100287613
2783 Ga0075434_101223636
2784 Ga0075434_102073236
2785 Ga0075434_102092829
2786 Ga0075429_100580959
2787 Ga0075429_101058960
2788 Ga0075429_101625113
2789 Ga0068865_100002923
2790 Ga0068865_100005706
2791 Ga0068865_100035796
2792 Ga0068865_100224391
2793 Ga0068865_100473200
2794 Ga0075436_100000154
2795 Ga0075436_100137482
2796 Ga0075436_100194953
2797 Ga0075436_100482059
2798 Ga0097620_100002395
2799 Ga0097620_100072465
2800 Ga0097620_100094848
2801 Ga0097620_100124645
2802 Ga0097620_100554409
2803 Ga0097620_100617827
2804 Ga0097620_101096581
2805 Ga0099826_10007363
2806 Ga0075435_100067160
2807 Ga0075435_100069794
2808 Ga0075435_100545496
2809 Ga0075435_101245873
2810 Ga0075435_101287641
2811 Ga0099795_10210522
2812 Ga0105251_10132490
2813 Ga0105244_10047531
2814 Ga0105250_10069439
2815 Ga0105240_10000091
2816 Ga0105240_10170039
2817 Ga0105240_10173356
2818 Ga0105240_10320690
2819 Ga0105240_10481483
2820 Ga0105240_10579113
2821 Ga0105240_10748525
2822 Ga0105240_10788767
2823 Ga0105240_11013378
2824 Ga0105240_11287149
2825 Ga0111539_10025567
2826 Ga0111539_10055658
2827 Ga0111539_10190643
2828 Ga0111539_10658795
2829 Ga0105245_10004161
2830 Ga0105245_10194373
2831 Ga0105245_10202644
2832 Ga0105245_10402780
2833 Ga0105245_11039365
2834 Ga0105245_12557584
2835 Ga0105247_10005197
2836 Ga0105247_10040176
2837 Ga0105247_10049429
2838 Ga0105247_10107846
2839 Ga0105247_10311757
2840 Ga0105247_10636072
2841 Ga0105247_10647205
2842 Ga0114129_10109918
2843 Ga0114129_10135209
2844 Ga0114129_10237149
2845 Ga0114129_11501824
2846 Ga0114129_11503238
2847 Ga0114129_11561835
2848 Ga0114129_12891134
2849 Ga0105243_10010549
2850 Ga0105243_10015650
2851 Ga0105243_10135945
2852 Ga0105243_10170071
2853 Ga0105243_10304173
2854 Ga0105243_10351342
2855 Ga0105243_10531602
2856 Ga0105243_10947932
2857 Ga0105243_12256637
2858 Ga0105241_10002326
2859 Ga0105241_10011311
2860 Ga0105241_10168721
2861 Ga0105241_10261128
2862 Ga0105241_10336954
2863 Ga0105241_10415320
2864 Ga0105242_10000036
2865 Ga0105242_10014436
2866 Ga0105242_10050007
2867 Ga0105242_10121938
2868 Ga0105242_10197178
2869 Ga0105242_10556096
2870 Ga0105242_11162946
2871 Ga0105242_11344786
2872 Ga0105248_10012352
2873 Ga0105248_10065276
2874 Ga0105248_10067514
2875 Ga0105248_10398023
2876 Ga0105248_11070150
2877 Ga0105237_10022578
2878 Ga0105237_10244885
2879 Ga0105237_10329906
2880 Ga0105237_10390996
2881 Ga0105237_10414189
2882 Ga0105237_10521250
2883 Ga0105237_10579072
2884 Ga0105237_10610602
2885 Ga0105237_10636774
2886 Ga0105237_11116579
2887 Ga0105238_10013730
2888 Ga0105238_10052375
2889 Ga0105238_10164597
2890 Ga0105238_10198474
2891 Ga0105238_10210749
2892 Ga0105238_10435178
2893 Ga0105238_10519077
2894 Ga0105238_10723284
2895 Ga0105238_10755623
2896 Ga0105238_10845925
2897 Ga0105238_10916218
2898 Ga0105238_10971212
2899 Ga0105238_11322479
2900 Ga0105238_11822837
2901 Ga0105249_10012949
2902 Ga0105249_10071587
2903 Ga0105249_10132524
2904 Ga0105249_10409755
2905 Ga0105249_11318830
2906 Ga0099796_10031323
2907 Ga0099796_10095703
2908 Ga0105239_10001368
2909 Ga0105239_10010593
2910 Ga0105239_10044590
2911 Ga0105239_10180022
2912 Ga0105239_10299664
2913 Ga0105239_10330928
2914 Ga0105239_10365864
2915 Ga0105239_10369618
2916 Ga0105239_10504509
2917 Ga0105239_10932036
2918 Ga0105239_10977177
2919 Ga0105239_11490681
2920 Ga0105246_10000666
2921 Ga0105246_10027737
2922 Ga0105246_10052929
2923 Ga0105246_10199853
2924 Ga0105246_10377047
2925 Ga0105246_10672648
2926 Ga0105246_11398775
2927 Ga0105246_12119292
2928 Ga0157321_1002565
2929 Ga0157329_1010456
2930 Ga0157341_1005141
2931 Ga0157345_1004704
2932 Ga0157314_1002125
2933 Ga0157347_1003490
2934 Ga0157313_1004446
2935 Ga0157315_1000717
2936 Ga0157373_10058615
2937 Ga0157373_10179986
2938 Ga0157373_10200916
2939 Ga0157373_10220314
2940 Ga0157371_10005746
2941 Ga0157371_10581906
2942 Ga0157370_10044538
2943 Ga0157370_10250286
2944 Ga0157370_10329113
2945 Ga0157369_10003501
2946 Ga0157369_10141190
2947 Ga0157369_10443076
2948 Ga0157369_10451625
2949 Ga0157369_10756014
2950 Ga0157369_10982849
2951 Ga0157369_11055180
2952 Ga0157369_11128870
2953 Ga0171463_1001
2954 Ga0157374_10005236
2955 Ga0157374_10176078
2956 Ga0157374_10293868
2957 Ga0157374_10339671
2958 Ga0157374_10891600
2959 Ga0157374_11448412
2960 Ga0157378_10000462
2961 Ga0157378_10025132
2962 Ga0157378_10050491
2963 Ga0157378_10342232
2964 Ga0157378_10636662
2965 Ga0157378_10861997
2966 Ga0163162_10010706
2967 Ga0163162_10062995
2968 Ga0163162_10097014
2969 Ga0163162_10370999
2970 Ga0163162_10475748
2971 Ga0163162_10640948
2972 Ga0163162_10801590
2973 Ga0157372_10444747
2974 Ga0157372_11197676
2975 Ga0157372_11591447
2976 Ga0157375_10003826
2977 Ga0157375_10014386
2978 Ga0157375_10029710
2979 Ga0157375_10046446
2980 Ga0157375_10095419
2981 Ga0157375_10834559
2982 Ga0163163_10000002
2983 Ga0163163_10006875
2984 Ga0163163_10016380
2985 Ga0163163_10106629
2986 Ga0163163_10109840
2987 Ga0157380_10000274
2988 Ga0157380_10036448
2989 Ga0157380_12239955
2990 Ga0157377_10007030
2991 Ga0157377_10008998
2992 Ga0157377_10220668
2993 Ga0157377_10247728
2994 Ga0157377_10712668
2995 Ga0157379_10002580
2996 Ga0157379_10002641
2997 Ga0157379_10028886
2998 Ga0157379_10037035
2999 Ga0157379_10144901
3000 Ga0157379_10295511
3001 Ga0157379_10399245
3002 Ga0157379_10889691
3003 Ga0157379_11108840
3004 Ga0157376_10001158
3005 Ga0157376_10023691
3006 Ga0157376_10480581
3007 Ga0157376_10502217
3008 Ga0157376_10619608
3009 Ga0157376_11482769
3010 Ga0157376_11671690
3011 Ga0157376_12475529
3012 Ga0183363_1082
3013 Ga0163161_10001021
3014 Ga0163161_10077117
3015 Ga0163161_10108639
3016 Ga0163161_10117035
3017 Ga0163161_10213653
3018 Ga0163161_10372707
3019 Ga0163161_10691513
3020 Ga0206354_10832954
3021 Ga0206353_10469384
3022 Ga0214542_1000006
3023 Ga0214543_1000014
3024 Ga0213876_10203602
3025 Ga0209563_107071
3026 Ga0209233_1000015
3027 Ga0209233_1020178
3028 Ga0207666_1001232
3029 Ga0207666_1001599
3030 Ga0207673_1000144
3031 Ga0209564_1000023
3032 Ga0209758_1000013
3033 Ga0209256_1000215
3034 Ga0207697_10016806
3035 Ga0207697_10020928
3036 Ga0207697_10069735
3037 Ga0207656_10087008
3038 Ga0207656_10142756
3039 Ga0207656_10389120
3040 Ga0207655_1043901
3041 Ga0207653_10014097
3042 Ga0207682_10000399
3043 Ga0207692_10013438
3044 Ga0207692_10060724
3045 Ga0207642_10000073
3046 Ga0207642_10014044
3047 Ga0207642_10232406
3048 Ga0207642_10437580
3049 Ga0207710_10005066
3050 Ga0207710_10009984
3051 Ga0207710_10014743
3052 Ga0207710_10130165
3053 Ga0207688_10003955
3054 Ga0207688_10005485
3055 Ga0207688_10153228
3056 Ga0207680_10043923
3057 Ga0207680_10053309
3058 Ga0207680_10054255
3059 Ga0207680_10102398
3060 Ga0207680_10151730
3061 Ga0207680_10652022
3062 Ga0207647_10016554
3063 Ga0207647_10038761
3064 Ga0207647_10078124
3065 Ga0207685_10085879
3066 Ga0207685_10150833
3067 Ga0207685_10280116
3068 Ga0207699_10132348
3069 Ga0207699_10155697
3070 Ga0207699_10418372
3071 Ga0207699_11006821
3072 Ga0207699_11028687
3073 Ga0207645_10000457
3074 Ga0207645_10029158
3075 Ga0207645_10036551
3076 Ga0207645_10098702
3077 Ga0207645_10654728
3078 Ga0207643_10000571
3079 Ga0207643_10002630
3080 Ga0207643_10098989
3081 Ga0207705_10048589
3082 Ga0207705_10705432
3083 Ga0207654_10003110
3084 Ga0207654_10009634
3085 Ga0207654_10065176
3086 Ga0207654_10074488
3087 Ga0207654_10138718
3088 Ga0207654_10310641
3089 Ga0207654_10412874
3090 Ga0207707_10015257
3091 Ga0207707_10086200
3092 Ga0207707_10274287
3093 Ga0207707_10440360
3094 Ga0207707_10486076
3095 Ga0207695_10000018
3096 Ga0207695_10008517
3097 Ga0207695_10048036
3098 Ga0207695_10089023
3099 Ga0207695_10197922
3100 Ga0207695_10313989
3101 Ga0207695_10431413
3102 Ga0207695_10481448
3103 Ga0207671_10024799
3104 Ga0207671_10048973
3105 Ga0207671_10135543
3106 Ga0207671_10206408
3107 Ga0207671_10730776
3108 Ga0207693_10005098
3109 Ga0207693_10005593
3110 Ga0207693_10009660
3111 Ga0207693_10014290
3112 Ga0207693_10019432
3113 Ga0207693_10043855
3114 Ga0207693_10092320
3115 Ga0207693_10220803
3116 Ga0207693_10273873
3117 Ga0207693_10508504
3118 Ga0207693_10847395
3119 Ga0207693_10879762
3120 Ga0207663_10004209
3121 Ga0207663_10062301
3122 Ga0207663_10077839
3123 Ga0207663_10104850
3124 Ga0207663_10287762
3125 Ga0207663_10348782
3126 Ga0207663_10404805
3127 Ga0207663_10515822
3128 Ga0207663_10607554
3129 Ga0207663_11145540
3130 Ga0207663_11240168
3131 Ga0207660_10055466
3132 Ga0207660_10191967
3133 Ga0207660_10270394
3134 Ga0207660_10291351
3135 Ga0207660_10369830
3136 Ga0207660_10492157
3137 Ga0207660_10504012
3138 Ga0207662_10014634
3139 Ga0207662_10042209
3140 Ga0207662_10148603
3141 Ga0207662_10203785
3142 Ga0207657_10011285
3143 Ga0207657_10048362
3144 Ga0207657_10075993
3145 Ga0207657_10545993
3146 Ga0207657_10679486
3147 Ga0207657_10940354
3148 Ga0207657_11031480
3149 Ga0207657_11182985
3150 Ga0207649_10000382
3151 Ga0207649_10000473
3152 Ga0207649_10042350
3153 Ga0207649_10092203
3154 Ga0207649_10445485
3155 Ga0207649_11019040
3156 Ga0207652_10000764
3157 Ga0207652_10074576
3158 Ga0207652_10084337
3159 Ga0207652_10273321
3160 Ga0207652_10719074
3161 Ga0207652_10810748
3162 Ga0207652_10891499
3163 Ga0207646_10183787
3164 Ga0207646_10542508
3165 Ga0207681_10000065
3166 Ga0207681_10097091
3167 Ga0207681_10145468
3168 Ga0207681_10368702
3169 Ga0207681_11456687
3170 Ga0207694_10000018
3171 Ga0207694_10050126
3172 Ga0207694_10071161
3173 Ga0207694_10152383
3174 Ga0207694_10249149
3175 Ga0207694_10315055
3176 Ga0207694_10527923
3177 Ga0207694_10552850
3178 Ga0207694_10803911
3179 Ga0207694_10828139
3180 Ga0207650_10031294
3181 Ga0207650_10154835
3182 Ga0207659_10000142
3183 Ga0207659_11245042
3184 Ga0207659_11256605
3185 Ga0207687_10000125
3186 Ga0207687_10031496
3187 Ga0207687_10060565
3188 Ga0207687_10093905
3189 Ga0207687_10187599
3190 Ga0207700_10000017
3191 Ga0207700_10000747
3192 Ga0207700_10073961
3193 Ga0207700_10079991
3194 Ga0207700_10298008
3195 Ga0207700_10305525
3196 Ga0207700_10411772
3197 Ga0207664_10067421
3198 Ga0207664_10068459
3199 Ga0207664_10255318
3200 Ga0207664_10391397
3201 Ga0207664_11266876
3202 Ga0207644_10002374
3203 Ga0207644_10037849
3204 Ga0207644_10102001
3205 Ga0207644_10198856
3206 Ga0207644_10491362
3207 Ga0207644_10998833
3208 Ga0207644_11076415
3209 Ga0207690_10000900
3210 Ga0207690_10036628
3211 Ga0207690_10410684
3212 Ga0207690_11265078
3213 Ga0207706_10005077
3214 Ga0207706_10008604
3215 Ga0207706_10024616
3216 Ga0207706_10425950
3217 Ga0207706_10502538
3218 Ga0207706_10915503
3219 Ga0207686_10000344
3220 Ga0207686_10031417
3221 Ga0207686_10157483
3222 Ga0207686_10848597
3223 Ga0207709_10001385
3224 Ga0207709_10080067
3225 Ga0207709_10233337
3226 Ga0207709_10308234
3227 Ga0207709_10311163
3228 Ga0207670_10000288
3229 Ga0207670_10683832
3230 Ga0207669_10002658
3231 Ga0207669_10518945
3232 Ga0207704_10000121
3233 Ga0207704_10007421
3234 Ga0207704_10039546
3235 Ga0207704_10872266
3236 Ga0207704_11075309
3237 Ga0207704_11191832
3238 Ga0207665_10001147
3239 Ga0207665_10002353
3240 Ga0207665_10052377
3241 Ga0207665_10176043
3242 Ga0207665_10506305
3243 Ga0207665_10611188
3244 Ga0207665_11291053
3245 Ga0207691_10005469
3246 Ga0207691_10059048
3247 Ga0207691_10258670
3248 Ga0207691_10680548
3249 Ga0207691_10695801
3250 Ga0207711_10004828
3251 Ga0207711_10011260
3252 Ga0207711_10097260
3253 Ga0207711_10260277
3254 Ga0207711_10719565
3255 Ga0207689_10000696
3256 Ga0207689_10028922
3257 Ga0207689_10109494
3258 Ga0207689_10263483
3259 Ga0207689_10614714
3260 Ga0207689_10811817
3261 Ga0207689_10873315
3262 Ga0207661_10290662
3263 Ga0207661_10294799
3264 Ga0207661_10689357
3265 Ga0207661_10728358
3266 Ga0207661_11136803
3267 Ga0207661_11169900
3268 Ga0207661_12002364
3269 Ga0207679_10000064
3270 Ga0207679_10153156
3271 Ga0207679_10325676
3272 Ga0207679_10431484
3273 Ga0207679_11509539
3274 Ga0207667_10000052
3275 Ga0207667_10032084
3276 Ga0207667_10101281
3277 Ga0207667_10638609
3278 Ga0207667_10668500
3279 Ga0207667_10725487
3280 Ga0207667_10733516
3281 Ga0207667_10764371
3282 Ga0207667_11482663
3283 Ga0207667_11647654
3284 Ga0207651_10000338
3285 Ga0207651_10035164
3286 Ga0207651_10573507
3287 Ga0207651_11070946
3288 Ga0207651_11288289
3289 Ga0207651_11604014
3290 Ga0207712_10000944
3291 Ga0207712_10059836
3292 Ga0207712_10300964
3293 Ga0207712_10621121
3294 Ga0207712_10922498
3295 Ga0207668_10000503
3296 Ga0207668_10051908
3297 Ga0207668_10069526
3298 Ga0207668_10111894
3299 Ga0207668_10357542
3300 Ga0207668_10766473
3301 Ga0207640_10000320
3302 Ga0207640_10412873
3303 Ga0207640_10429227
3304 Ga0207640_11006824
3305 Ga0207658_10033265
3306 Ga0207658_10093915
3307 Ga0207658_10226324
3308 Ga0207658_10334802
3309 Ga0207658_10340798
3310 Ga0207658_10497179
3311 Ga0207658_10519645
3312 Ga0207658_10622047
3313 Ga0207677_10002365
3314 Ga0207677_10043233
3315 Ga0207677_10059931
3316 Ga0207677_10193770
3317 Ga0207703_10001400
3318 Ga0207703_10116527
3319 Ga0207703_10347161
3320 Ga0207703_10607109
3321 Ga0207703_10682504
3322 Ga0207703_11831890
3323 Ga0207639_10016982
3324 Ga0207639_10036966
3325 Ga0207639_10152705
3326 Ga0207639_10289311
3327 Ga0207639_10342408
3328 Ga0207678_10002811
3329 Ga0207678_10007889
3330 Ga0207678_10012694
3331 Ga0207678_10636038
3332 Ga0207678_10696169
3333 Ga0207708_10004148
3334 Ga0207708_10055846
3335 Ga0207708_10070399
3336 Ga0207702_10001217
3337 Ga0207702_10224763
3338 Ga0207702_10265280
3339 Ga0207702_10461937
3340 Ga0207702_10550579
3341 Ga0207702_10554544
3342 Ga0207702_10571020
3343 Ga0207702_11083492
3344 Ga0207641_10006750
3345 Ga0207641_10029971
3346 Ga0207641_10034969
3347 Ga0207641_10339544
3348 Ga0207641_10392344
3349 Ga0207641_11228628
3350 Ga0207641_11256465
3351 Ga0207648_10013636
3352 Ga0207648_10023005
3353 Ga0207648_10032835
3354 Ga0207648_10080154
3355 Ga0207648_10510992
3356 Ga0207676_10000079
3357 Ga0207676_10012315
3358 Ga0207676_10147763
3359 Ga0207676_10373573
3360 Ga0207676_10658726
3361 Ga0207676_11633136
3362 Ga0207674_10032977
3363 Ga0207674_10058304
3364 Ga0207674_10109763
3365 Ga0207674_10154052
3366 Ga0207674_10579849
3367 Ga0207674_10607276
3368 Ga0207674_11227253
3369 Ga0207675_100003030
3370 Ga0207675_100009836
3371 Ga0207675_100038364
3372 Ga0207675_100371496
3373 Ga0207675_100662765
3374 Ga0207675_101514243
3375 Ga0207683_10000037
3376 Ga0207683_10011813
3377 Ga0207683_10019746
3378 Ga0207683_10153884
3379 Ga0207683_10178740
3380 Ga0207698_10002906
3381 Ga0207698_10213954
3382 Ga0207698_10547741
3383 Ga0207698_10736152
3384 Ga0207698_12179949
3385 Ga0209973_1049671
3386 Ga0210002_1008968
3387 Ga0209983_1012323
3388 Ga0209282_1006157
3389 Ga0209282_1039336
3390 Ga0209971_1007881
3391 Ga0209966_1001939
3392 Ga0209966_1081754
3393 Ga0209998_10004140
3394 Ga0209998_10008721
3395 Ga0209998_10010527
3396 Ga0209813_10010127
3397 Ga0209813_10104459
3398 Ga0209813_10174229
3399 Ga0209974_10013409
3400 Ga0209974_10115603
3401 Ga0209974_10278017
3402 Ga0207428_10000064
3403 Ga0207428_10014192
3404 Ga0207428_10024254
3405 Ga0207428_10598387
3406 Ga0268266_10001539
3407 Ga0268266_10006859
3408 Ga0268266_10017082
3409 Ga0268266_10028988
3410 Ga0268266_10039850
3411 Ga0268266_10068757
3412 Ga0268266_10071989
3413 Ga0268266_10122755
3414 Ga0268266_10243948
3415 Ga0268266_10691767
3416 Ga0268266_10703261
3417 Ga0268266_11773268
3418 Ga0268265_10019014
3419 Ga0268265_10103099
3420 Ga0268265_10111508
3421 Ga0268265_10247208
3422 Ga0268265_10324600
3423 Ga0268264_10000022
3424 Ga0268264_10000805
3425 Ga0268264_10017880
3426 Ga0268264_10155682
3427 Ga0268264_10651541
3428 Ga0268264_11727751
3429 Ga0265334_10027907
3430 Ga0265318_10046767
3431 Ga0307517_10198111
3432 Ga0265338_10000100
3433 Ga0265338_10005075
3434 Ga0265338_10391674
3435 Ga0265338_11035473
3436 Ga0307511_10235350
3437 Ga0316181_1235153
3438 Ga0265762_1045705
3439 Ga0265760_10040801
3440 Ga0265760_10086139
3441 Ga0265330_10025049
3442 Ga0265330_10131468
3443 Ga0265332_10019940
3444 Ga0265328_10000006
3445 Ga0265328_10199454
3446 Ga0265320_10030229
3447 Ga0265320_10231140
3448 Ga0265325_10000014
3449 Ga0265325_10001421
3450 Ga0265325_10002235
3451 Ga0265325_10068420
3452 Ga0265325_10121365
3453 Ga0265325_10175390
3454 Ga0265325_10227582
3455 Ga0265325_10244737
3456 Ga0265329_10024737
3457 Ga0265329_10122316
3458 Ga0265340_10001571
3459 Ga0265340_10068201
3460 Ga0265340_10069214
3461 Ga0265340_10096216
3462 Ga0265340_10104206
3463 Ga0265340_10108961
3464 Ga0265340_10119645
3465 Ga0265339_10003369
3466 Ga0265339_10023668
3467 Ga0265339_10033703
3468 Ga0265339_10147201
3469 Ga0265339_10363500
3470 Ga0265339_10443082
3471 Ga0265331_10000113
3472 Ga0265331_10002319
3473 Ga0265331_10008036
3474 Ga0265331_10034635
3475 Ga0265331_10041860
3476 Ga0265331_10078310
3477 Ga0265331_10131853
3478 Ga0265327_10000124
3479 Ga0265327_10020547
3480 Ga0265327_10244006
3481 Ga0265316_10000333
3482 Ga0265316_10061583
3483 Ga0265316_10111693
3484 Ga0265316_10141249
3485 Ga0307509_10144098
3486 Ga0307509_10224553
3487 Ga0307408_101200854
3488 Ga0265313_10001667
3489 Ga0265313_10008310
3490 Ga0265313_10020687
3491 Ga0265313_10123304
3492 Ga0265313_10131512
3493 Ga0307508_10259527
3494 Ga0316575_10060235
3495 Ga0265314_10025240
3496 Ga0265314_10025603
3497 Ga0265314_10028930
3498 Ga0265314_10138567
3499 Ga0265314_10170464
3500 Ga0265342_10018213
3501 Ga0265342_10257285
3502 Ga0265342_10276896
3503 Ga0265342_10286059
3504 Ga0265342_10515928
3505 Ga0307516_10021961
3506 Ga0307516_10325126
3507 Ga0307516_10458714
3508 Ga0307406_10627668
3509 Ga0307412_11269709
3510 Ga0307409_100222329
3511 Ga0307414_10156200
3512 Ga0307411_10096960
3513 Ga0307415_101203249
3514 Ga0316583_10000123
3515 Ga0307507_10006782
3516 Ga0307507_10230487
3517 Ga0307510_10151214
3518 Ga0373930_0000972
3519 Ga0373930_0136284
3520 Ga0373948_0000169
3521 Ga0373948_0007214
3522 Ga0373948_0020187
3523 Ga0373950_0000253
3524 Ga0373950_0001897
3525 Ga0373958_0003084
3526 Ga0373958_0008410
3527 Ga0373958_0180879
3528 Ga0373959_0004517
3529 Ga0373938_0000142
3530 Ga0373938_0009131
3531 Ga0373926_0004179
3532 Ga0373926_0012751
3533 Ga0373926_0055880
3534 Ga0373928_0000634
3535 Ga0373928_0001826
3536 Ga0373928_0159033
3537 Ga0373929_0001528
3538 Ga0373929_0017852
3539 Ga0373929_0059575
3540 Ga0373929_0095483
3541 Ga0373934_0017218
3542 Ga0373934_0028536
3543 Ga0373940_0002260
3544 Ga0373940_0126892
3545 Ga0373940_0155809
3546 Ga0373944_0033583
3547 Ga0373944_0056645
3548 Ga0373944_0062132
3549 Ga0373949_0001704
3550 Ga0373949_0011869
3551 Ga0373951_0004113
3552 Ga0373951_0021701
3553 Ga0373951_0108142
3554 Ga0373952_0000469
3555 Ga0373952_0010817
3556 Ga0373952_0216138
3557 Ga0373923_0039986
3558 Ga0373923_0048739
3559 Ga0373923_0275965
3560 Ga0373932_0001947
3561 Ga0373932_0026515
3562 Ga0373932_0299378
3563 Ga0373936_0032209
3564 Ga0373936_0045202
3565 Ga0373936_0130971
3566 Ga0373939_0000711
3567 Ga0373939_0001236
3568 Ga0373939_0003388
3569 Ga0373939_0040228
3570 Ga0373941_0000186
3571 Ga0373941_0000584
3572 Ga0373941_0134427
3573 Ga0373945_0000073
3574 Ga0373945_0016156
3575 Ga0373945_0029055
3576 Ga0373953_0018005
3577 Ga0373953_0190111
3578 Ga0373954_0016841
3579 Ga0373954_0032391
3580 Ga0373954_0115093
3581 Ga0373954_0367224
3582 Ga0373956_0006007
3583 Ga0373956_0145837
3584 Ga0373957_0001780
3585 Ga0373957_0074433
3586 Ga0373960_0004138
3587 Ga0373960_0004588
3588 Ga0373960_0136153
3589 Ga0373960_0177632
3590 Ga0373943_0004682
3591 Ga0373943_0007039
3592 Ga0373943_0197375
3593 Ga0373943_0590573
3594 Ga0373946_0000371
3595 Ga0373946_0033119
3596 Ga0373955_0004122
3597 Ga0373955_0008798
3598 Ga0373955_0480211
3599 Ga0373942_0000298
3600 Ga0373942_0043844
3601 Ga0373961_0002218
3602 Ga0373961_0003878
3603 Ga0373961_0008934
3604 Ga0373961_0105092
3605 Ga0373962_0000374
3606 Ga0373962_0000988
3607 Ga0373962_0244872
3608 Ga0373924_0125940
3609 Ga0373924_0203294
3610 Ga0373924_0412048
3611 Ga0373931_0000823
3612 Ga0373931_0004447
3613 Ga0373931_0023006
3614 Ga0373931_0279364
3615 Ga0373931_0495182
3616 Ga0373935_0002812
3617 Ga0373935_0021250
3618 Ga0373935_0040171
3619 Ga0373935_0119875
3620 Ga0373935_0570055
3621 Ga0373935_0651173
3622 Ga0373927_0008749
3623 Ga0373927_0024429
3624 Ga0373927_0034147
3625 Ga0373927_0046748
3626 Ga0373927_0157489
3627 Ga0373927_0354026
3628 Ga0373927_0429267
3629 Ga0373927_0723049
3630 Ga0373933_0010116
3631 Ga0373933_0054991
3632 Ga0373933_0275336
3633 Ga0373933_0324897
3634 Ga0373933_0494312
3635 Ga0373947_0002721
3636 Ga0373947_0027881
3637 Ga0373947_0046588
3638 Ga0373947_0065071
3639 Ga0373947_0099201
3640 Ga0373947_0178733
3641 Ga0373947_0897924
3642 Ga0373937_0000998
3643 Ga0373937_0002122
3644 Ga0373937_0138612
3645 Ga0373937_0408434
3646 Ga0373937_0431780
3647 Ga0373937_0806671
3648 Ga0373925_0001693
3649 Ga0373925_0018327
3650 Ga0373925_0052406
3651 Ga0373925_0092836
3652 Ga0373925_0157095
3653 Ga0373925_0184517
3654 Ga0373925_0457823
3655 Ga0373925_0497421
3656 Ga0373925_0684594
3657 Ga0373925_1041493
3658 Ga0395900_0689921
3659 Ga0395900_1659714
3660 Ga0395898_0041641
3661 Ga0395898_0186242
3662 Ga0395898_0323733
3663 Ga0395898_0929445
3664 Ga0395905_0013091
3665 Ga0436364_0825876
3666 Ga0436364_0871904
3667 Ga0395901_0038182
3668 Ga0395901_0216910
3669 Ga0395901_0335515
3670 Ga0395901_0636587
3671 Ga0395901_1466114
3672 Ga0242420_027537
3673 Ga0436365_0256272
3674 Ga0436365_0306351
3675 Ga0436365_0309386
3676 Ga0436365_0333374
3677 Ga0436365_1152734
3678 Ga0436360_0027830
3679 Ga0436360_0485954
3680 Ga0436360_0500281
3681 Ga0436360_0503632
3682 Ga0436360_0853818
3683 Ga0436360_1207847
3684 Ga0436360_1263043
3685 Ga0436361_0067895
3686 Ga0436361_0704126
3687 Ga0436363_0481699
3688 Ga0436362_0162245
3689 Ga0436362_0910219
3690 Ga0436362_0939360
3691 Ga0439466_0152580
3692 Ga0451793_1361258
3693 Ga0451797_0545593
3694 Ga0451798_0980934
3695 Ga0451800_0001266
3696 Ga0451802_0105263
3697 Ga0451804_0971913
3698 Ga0451807_1645706
3699 Ga0451807_2770020
3700 Ga0451833_1211953
3701 Ga0451847_0188795
3702 Ga0451851_1057867
3703 Ga0439449_0191478
3704 Ga0439450_040119
3705 Ga0439455_0193604
3706 Ga0439463_006824
3707 Ga0450923_083758
3708 Ga0450908_027224
3709 Ga0439459_0017909
3710 Ga0451577_0054974
3711 Ga0466969_0407110
3712 Ga0466972_0082820
3713 Ga0466965_0550848
3714 Ga0466966_0374420
3715 Ga0466961_0312723
3716 Ga0466963_0188785
3717 Ga0466963_0372580
3718 Ga0466963_0858346
3719 Ga0453684_0244131
3720 Ga0453684_0629404
3721 Ga0466968_0082045
3722 Ga0466970_0211324
3723 Ga0466957_0195572
3724 Ga0466957_0552410
3725 Ga0466960_0107277
3726 Ga0466959_0028187
3727 Ga0451576_0025688
3728 Ga0466958_0387133
3729 Ga0495627_039646
3730 Ga0495592_0007338
3731 Ga0495592_0009724
3732 Ga0495592_0240363
3733 Ga0495592_0281699
3734 Ga0495603_0010082
3735 Ga0495603_0043405
3736 Ga0495603_0072095
3737 Ga0495603_0080224
3738 Ga0495629_0002415
3739 Ga0495629_0008648
3740 Ga0495629_0196068
3741 Ga0495629_0311662
3742 Ga0495629_0643281
3743 Ga0495629_0690006
3744 Ga0495638_0045067
3745 Ga0495638_0062547
3746 Ga0495641_0007056
3747 Ga0495641_0028225
3748 Ga0495651_0038171
3749 Ga0495651_0127351
3750 Ga0495653_0001564
3751 Ga0495653_0037648
3752 Ga0495580_0104325
3753 Ga0495580_0145000
3754 Ga0495580_0297767
3755 Ga0495580_0418642
3756 Ga0495580_0721769
3757 Ga0495582_0194853
3758 Ga0495605_0103108
3759 Ga0495639_0001235
3760 Ga0495639_0014386
3761 Ga0495639_0033442
3762 Ga0495662_0005171
3763 Ga0495662_0031740
3764 Ga0495662_0171713
3765 Ga0495664_0001468
3766 Ga0495664_0004629
3767 Ga0495664_0104250
3768 Ga0495664_0497989
3769 Ga0495584_0006069
3770 Ga0495584_0033197
3771 Ga0495584_0106761
3772 Ga0495585_0023251
3773 Ga0495585_0256071
3774 Ga0495594_0000885
3775 Ga0495594_0047293
3776 Ga0495594_0137014
3777 Ga0495596_0016289
3778 Ga0495596_0318019
3779 Ga0495607_0146650
3780 Ga0495583_0134087
3781 Ga0495606_0147045
3782 Ga0495606_0270425
3783 Ga0495606_0318004
3784 Ga0495606_0414019
3785 Ga0495608_0004913
3786 Ga0495608_0011240
3787 Ga0495616_0139249
3788 Ga0495618_0007887
3789 Ga0495618_0048797
3790 Ga0495618_0224550
3791 Ga0495628_0121770
3792 Ga0495628_0200556
3793 Ga0495630_0023958
3794 Ga0495630_0449427
3795 Ga0495630_0556283
3796 Ga0495630_0568859
3797 Ga0495631_0071504
3798 Ga0495637_0035852
3799 Ga0495637_0139854
3800 Ga0495644_0061992
3801 Ga0495644_0126491
3802 Ga0495666_0008960
3803 Ga0495666_0243431
3804 Ga0495666_0356301
3805 Ga0495652_0006569
3806 Ga0495652_0112959
3807 Ga0495652_0244946
3808 Ga0495665_0010456
3809 Ga0495665_0066400
3810 Ga0495665_0238104
3811 Ga0495665_0454537
3812 Ga0495640_0097308
3813 Ga0495640_0119515
3814 Ga0495640_0616370
3815 Ga0495586_0006626
3816 Ga0495586_0108693
3817 Ga0495586_0385101
3818 Ga0495587_0009864
3819 Ga0495587_0021655
3820 Ga0495587_0097944
3821 Ga0495598_0013282
3822 Ga0495609_0158595
3823 Ga0495621_0092527
3824 Ga0495645_0005648
3825 Ga0495645_0162120
3826 Ga0495645_0688952
3827 Ga0495622_0018025
3828 Ga0495622_0096837
3829 Ga0495622_0097993
3830 Ga0495667_0002438
3831 Ga0495667_0071062
3832 Ga0495667_0679497
3833 Ga0495656_0017072
3834 Ga0495656_0047340
3835 Ga0495634_0051519
3836 Ga0495634_0064532
3837 Ga0495634_0113159
3838 Ga0495634_0850820
3839 Ga0495611_0087587
3840 Ga0495625_0651455
3841 Ga0495635_0001320
3842 Ga0495635_0237066
3843 Ga0495659_0047341
3844 Ga0495659_0063621
3845 Ga0495661_0150947
3846 Ga0495661_0241783
3847 Ga0495588_0088582
3848 Ga0495657_0004369
3849 Ga0495657_0201003
3850 Ga0495657_0504188
3851 Ga0495599_0014982
3852 Ga0495599_0032053
3853 Ga0495623_0005523
3854 Ga0495646_0001863
3855 Ga0495646_0002260
3856 Ga0495647_0000406
3857 Ga0495647_0005548
3858 Ga0495647_0014711
3859 Ga0495647_0116523
3860 Ga0495658_0000992
3861 Ga0495658_0003451
3862 Ga0495658_0044958
3863 Ga0495658_0437053
3864 Ga0495658_0573697
3865 Ga0495669_0025391
3866 Ga0495669_0209154
3867 Ga0495613_0008131
3868 Ga0495613_0082724
3869 Ga0495613_0115123
3870 Ga0495624_0003021
3871 Ga0495624_0095937
3872 Ga0495624_0164681
3873 Ga0495624_0182713
3874 Ga0495624_0204350
3875 Ga0495624_0254278
3876 Ga0495671_0028600
3877 Ga0495671_0264196
3878 Ga0495649_0361839
3879 Ga0495649_0378185
3880 Ga0495589_0231183
3881 Ga0495600_0004026
3882 Ga0495600_0025145
3883 Ga0495660_0106434
3884 Ga0495581_0004714
3885 Ga0495581_0025832
3886 Ga0495581_0175629
3887 Ga0495581_0369917
3888 Ga0495581_0464850
3889 Ga0495604_0004371
3890 Ga0495604_0014285
3891 Ga0495636_0195845
3892 Ga0495674_0050447
3893 Ga0495674_0063241
3894 Ga0495674_0065328
3895 Ga0495674_0080891
3896 Ga0495674_0158381
3897 Ga0495674_0683556
3898 Ga0495672_0174321
3899 Ga0495672_0215502
3900 Ga0495676_0086776
3901 Ga0495676_0206580
3902 Ga0495676_0271913
3903 Ga0495676_0358073
3904 Ga0495676_0398758
3905 Ga0495676_0535528
3906 Ga0495680_0004581
3907 Ga0495680_0021543
3908 Ga0495680_0068859
3909 Ga0495680_0131854
3910 Ga0495680_0376506
3911 Ga0495680_0680692
3912 Ga0495675_0058076
3913 Ga0495675_0294671
3914 Ga0495677_0020410
3915 Ga0495677_0140963
3916 Ga0495679_075892
3917 Ga0495685_073476
3918 Ga0495673_0125246
3919 Ga0495684_0000665
3920 Ga0495684_0049452
3921 Ga0495684_0157389
3922 Ga0495684_0586580
3923 Ga0495686_0208209
3924 Ga0495593_0002227
3925 Ga0495593_0026621
3926 Ga0495602_0003946
3927 Ga0495602_0078824
3928 Ga0495602_0177367
3929 Ga0495602_0399205
3930 Ga0495602_0935539
3931 Ga0495614_0013298
3932 Ga0495614_0073117
3933 Ga0495615_0036334
3934 Ga0496100_0003652
3935 Ga0496100_0013089
3936 Ga0496100_0025032
3937 Ga0496100_0107162
3938 Ga0496100_0121395
3939 Ga0496100_0151296
3940 Ga0496100_0190031
3941 Ga0496100_0220313
3942 Ga0496100_0421157
3943 Ga0496101_0000964
3944 Ga0496101_0001534
3945 Ga0496101_0022529
3946 Ga0496101_0263881
3947 Ga0496101_0408679
3948 Ga0496101_0594301
3949 Ga0496101_0910390
3950 Ga0496102_0018417
3951 Ga0496102_0041498
3952 Ga0496102_0081943
3953 Ga0496102_0134424
3954 Ga0496102_0202829
3955 Ga0496102_0277278
3956 Ga0496102_0415258
3957 Ga0496102_0954277
3958 Ga0496102_1002107
3959 Ga0496103_0002627
3960 Ga0496103_0060798
3961 Ga0496103_0077179
3962 Ga0496103_0133772
3963 Ga0496103_0140554
3964 Ga0496103_0240986
3965 Ga0496103_0433272
3966 Ga0496103_0540409
3967 Ga0496104_0000062
3968 Ga0496104_0003859
3969 Ga0496104_0005449
3970 Ga0496104_0006088
3971 Ga0496104_0012447
3972 Ga0496104_0019562
3973 Ga0496104_0328086
3974 Ga0496104_0351141
3975 Ga0496104_0369650
3976 Ga0496104_0869670
3977 Ga0496104_1839788
3978 Ga0496105_0000069
3979 Ga0496105_0002521
3980 Ga0496105_0005334
3981 Ga0496105_0012965
3982 Ga0496105_0013368
3983 Ga0496105_0020223
3984 Ga0496106_0005548
3985 Ga0496106_0010045
3986 Ga0496106_0014992
3987 Ga0496106_0021945
3988 Ga0496106_0282868
3989 Ga0496106_0730589
3990 Ga0496106_1394956
3991 Ga0496107_0009919
3992 Ga0496107_0030691
3993 Ga0496107_0033427
3994 Ga0496107_0036189
3995 Ga0496107_0065471
3996 Ga0496107_0161334
3997 Ga0496107_0258524
3998 Ga0496108_0005674
3999 Ga0496108_0014484
4000 Ga0496108_0016715
4001 Ga0496108_0048390
4002 Ga0496108_0076490
4003 Ga0496108_0105509
4004 Ga0496108_0113341
4005 Ga0496108_0196494
4006 Ga0496108_0378916
4007 Ga0496109_0001018
4008 Ga0496109_0003269
4009 Ga0496109_0006704
4010 Ga0496109_0018236
4011 Ga0496109_0036180
4012 Ga0496109_0043990
4013 Ga0496109_0123518
4014 Ga0496109_0326010
4015 Ga0496109_0526720
4016 Ga0496109_0566068
4017 Ga0496110_0003889
4018 Ga0496110_0004123
4019 Ga0496110_0008786
4020 Ga0496110_0010013
4021 Ga0496110_0017504
4022 Ga0496110_0088669
4023 Ga0496110_0139440
4024 Ga0496110_0186049
4025 Ga0496110_0226468
4026 Ga0496110_0303999
4027 Ga0496110_1545798
4028 Ga0496111_0009604
4029 Ga0496111_0020260
4030 Ga0496111_0026058
4031 Ga0496111_0252017
4032 Ga0496112_0000079
4033 Ga0496112_0014236
4034 Ga0496112_0025757
4035 Ga0496112_0067442
4036 Ga0496112_0104117
4037 Ga0496112_0188627
4038 Ga0496112_0228031
4039 Ga0496112_0306080
4040 Ga0496112_0486692
4041 Ga0496112_0582312
4042 Ga0496113_0001952
4043 Ga0496113_0002550
4044 Ga0496113_0038672
4045 Ga0496113_0049794
4046 Ga0496113_0109928
4047 Ga0496113_0131767
4048 Ga0496113_0324454
4049 Ga0496114_0005552
4050 Ga0496114_0052754
4051 Ga0496114_0130190
4052 Ga0496114_0133737
4053 Ga0496114_0296768
4054 Ga0496114_0301128
4055 Ga0496114_0544100
4056 Ga0496115_0009587
4057 Ga0496115_0038830
4058 Ga0496115_0045916
4059 Ga0496115_0065973
4060 Ga0496115_0134504
4061 Ga0496115_0361080
4062 Ga0496115_0380730
4063 Ga0496115_0470906
4064 Ga0496115_0759519
4065 Ga0496115_0829709
4066 Ga0496116_0032483
4067 Ga0496116_0235587
4068 Ga0496117_0018894
4069 Ga0496118_0003967
4070 Ga0496119_0008884
4071 Ga0496119_0021564
4072 Ga0496119_0347648
4073 Ga0496120_0172926
4074 Ga0496121_0000576
4075 Ga0496121_0001526
4076 Ga0496121_0466583
4077 Ga0496122_0000160
4078 Ga0496122_0503000
4079 Ga0496123_0000034
4080 Ga0496123_0242564
4081 Ga0496124_0055299
4082 Ga0496124_0366719
4083 Ga0496125_0034194
4084 Ga0496125_0357155
4085 Ga0496125_0497614
4086 Ga0496126_0008516
4087 Ga0496126_0300824
4088 Ga0496126_0346193
4089 Ga0496126_0465985
4090 Ga0501306_011394
4091 Ga0501306_022221
4092 Ga0501306_074175
4093 Ga0501308_027067
4094 Ga0501309_084324
4095 Ga0501345_03992
4096 Ga0501304_007279
4097 Ga0501305_032249
4098 Ga0501305_033893
4099 Ga0501305_108060
4100 Ga0501307_014408
4101 Ga0501307_019821
4102 Ga0495682_0001739
4103 Ga0495682_0069478
4104 Ga0501311_013856
4105 Ga0501311_056326
4106 Ga0501312_087642
4107 Ga0501313_033449
4108 Ga0501313_051383
4109 Ga0501314_006563
4110 Ga0501315_017382
4111 Ga0501316_035020
4112 Ga0501316_052286
4113 Ga0501316_066641
4114 Ga0501317_054853
4115 Ga0501318_052024
4116 Ga0501319_004718
4117 Ga0501319_030601
4118 Ga0501320_016699
4119 Ga0501320_044408
4120 Ga0501321_030603
4121 Ga0501321_031387
4122 Ga0501321_063682
4123 Ga0501322_008464
4124 Ga0501323_013727
4125 Ga0501323_029143
4126 Ga0501324_009375
4127 Ga0501325_008441
4128 Ga0501325_010379
4129 Ga0501325_017743
4130 Ga0501325_040955
4131 Ga0501325_041014
4132 Ga0501327_08600
4133 Ga0501328_10531
4134 Ga0501329_09609
4135 Ga0501329_10195
4136 Ga0501330_008594
4137 Ga0501331_15584
4138 Ga0501335_029033
4139 Ga0501336_021297
4140 Ga0501031_0585608
4141 Ga0501031_0715726
4142 Ga0501031_0955429
4143 Ga0501032_0057878
4144 Ga0501032_0078899
4145 Ga0501032_0138096
4146 Ga0501032_0283490
4147 Ga0501033_0000763
4148 Ga0501033_0013758
4149 Ga0501033_0041417
4150 Ga0501033_0068350
4151 Ga0501033_0105075
4152 Ga0501033_0187357
4153 Ga0501033_0211894
4154 Ga0501033_0267769
4155 Ga0501033_0303176
4156 Ga0501033_0860020
4157 Ga0501034_0109420
4158 Ga0501034_0206828
4159 Ga0501034_0220111
4160 Ga0501034_0262996
4161 Ga0501034_0351742
4162 Ga0501034_0502154
4163 Ga0501034_1018463
4164 Ga0501034_1249833
4165 Ga0501034_1529601
4166 Ga0501036_0023988
4167 Ga0501036_0059405
4168 Ga0501036_0276944
4169 Ga0501036_0404901
4170 Ga0501036_1057402
4171 Ga0501037_0061556
4172 Ga0501037_0077620
4173 Ga0501037_0092344
4174 Ga0501037_0096455
4175 Ga0501037_0166391
4176 Ga0501037_0823041
4177 Ga0501038_0064087
4178 Ga0501038_0096710
4179 Ga0501038_0126590
4180 Ga0501038_0187470
4181 Ga0501038_0215822
4182 Ga0501038_0428605
4183 Ga0501038_0928801
4184 Ga0501038_0982752
4185 Ga0501038_1067581
4186 Ga0501039_0420782
4187 Ga0501039_0668118
4188 Ga0501039_0843268
4189 Ga0501040_0347397
4190 Ga0501041_0150747
4191 Ga0501042_0151831
4192 Ga0501042_0272239
4193 Ga0501042_0357926
4194 Ga0501042_0358368
4195 Ga0501042_0650562
4196 Ga0501043_0028008
4197 Ga0501043_0065904
4198 Ga0501043_0146293
4199 Ga0501043_0182295
4200 Ga0501043_0247472
4201 Ga0501043_0297076
4202 Ga0501043_0512099
4203 Ga0501046_0024970
4204 Ga0501046_0338508
4205 Ga0501046_0409153
4206 Ga0501046_0606871
4207 Ga0501046_0776205
4208 Ga0501047_0009361
4209 Ga0501047_0027159
4210 Ga0501047_0042561
4211 Ga0501047_0055535
4212 Ga0501047_0079894
4213 Ga0501047_0105031
4214 Ga0501047_0138409
4215 Ga0501047_0299684
4216 Ga0501047_0441750
4217 Ga0501047_0705864
4218 Ga0501047_1071807
4219 Ga0501048_0368864
4220 Ga0501067_0003431
4221 Ga0501067_0062663
4222 Ga0501068_0191040
4223 Ga0501068_0402926
4224 Ga0501069_0464584
4225 Ga0501070_0013211
4226 Ga0501070_0060200
4227 Ga0501070_0065603
4228 Ga0501070_0084233
4229 Ga0501070_0106670
4230 Ga0501070_0240323
4231 Ga0501071_0261423
4232 Ga0501071_0293848
4233 Ga0501072_0006469
4234 Ga0501072_0007497
4235 Ga0501072_0298024
4236 Ga0501072_0693278
4237 Ga0501073_0030301
4238 Ga0501073_0111058
4239 Ga0501073_0202041
4240 Ga0501073_0217534
4241 Ga0501073_0438839
4242 Ga0501073_0507685
4243 Ga0501073_0513554
4244 Ga0501073_0669927
4245 Ga0501074_0279253
4246 Ga0501074_0399881
4247 Ga0501074_0750382
4248 Ga0501075_0091594
4249 Ga0501075_0298241
4250 Ga0501075_0584864
4251 Ga0501076_0019729
4252 Ga0501076_0111236
4253 Ga0501076_0124026
4254 Ga0501076_0264061
4255 Ga0501077_0135215
4256 Ga0501243_055495
4257 Ga0501253_131304
4258 Ga0501259_142044
4259 Ga0501079_0019839
4260 Ga0501079_0101613
4261 Ga0501079_0339646
4262 Ga0501079_0659442
4263 Ga0501079_0754810
4264 Ga0501079_0863338
4265 Ga0501080_0027939
4266 Ga0501080_0032171
4267 Ga0501080_0079896
4268 Ga0501080_0097738
4269 Ga0501080_0151156
4270 Ga0501080_0330730
4271 Ga0501081_0004665
4272 Ga0501081_0066924
4273 Ga0501081_0122167
4274 Ga0501083_0005990
4275 Ga0501083_0042949
4276 Ga0501083_0083005
4277 Ga0501083_0270798
4278 Ga0501083_0399139
4279 Ga0501083_0697781
4280 Ga0501268_023113
4281 Ga0501280_075591
4282 Ga0501035_0055995
4283 Ga0501035_0073162
4284 Ga0501035_0090103
4285 Ga0501035_0120821
4286 Ga0501035_0126146
4287 Ga0501035_0229518
4288 Ga0501035_0321314
4289 Ga0501035_0493632
4290 Ga0501044_0007994
4291 Ga0501044_0009855
4292 Ga0501044_0076782
4293 Ga0501044_0083877
4294 Ga0501044_0093477
4295 Ga0501044_0154315
4296 Ga0501044_0154552
4297 Ga0501044_0161764
4298 Ga0501044_0191698
4299 Ga0501044_0368466
4300 Ga0501044_0384559
4301 Ga0501044_0463960
4302 Ga0501044_0471468
4303 Ga0501044_0574218
4304 Ga0501044_0722177
4305 Ga0501044_1096889
4306 nmdc:mga03683_192237_c1
4307 nmdc:mga03683_33053_c1
4308 nmdc:mga03683_97080_c1
4309 nmdc:mga03n38_636598_c1
4310 nmdc:mga03n38_699629_c1
4311 nmdc:mga00v17_179599_c1
4312 nmdc:mga00v17_254254_c1
4313 nmdc:mga00v17_850766_c1
4314 nmdc:mga0yw44_197226_c1
4315 nmdc:mga0yw44_24684_c1
4316 nmdc:mga0yw44_320641_c1
4317 nmdc:mga0yw44_5178_c1
4318 nmdc:mga0yw44_72129_c1
4319 nmdc:mga0k408_176885_c1
4320 nmdc:mga0k408_43959_c1
4321 nmdc:mga06z11_105625_c1
4322 nmdc:mga06z11_206429_c1
4323 nmdc:mga06z11_28022_c1
4324 nmdc:mga06z11_403118_c1
4325 nmdc:mga06z11_413932_c1
4326 nmdc:mga06z11_455955_c1
4327 nmdc:mga06z11_5834_c1
4328 nmdc:mga04h51_28279_c1
4329 nmdc:mga04h51_303378_c1
4330 nmdc:mga07m45_325211_c1
4331 nmdc:mga07m45_514818_c1
4332 nmdc:mga05p37_1103959_c1
4333 nmdc:mga05p37_1402269_c1
4334 nmdc:mga05p37_203667_c1
4335 nmdc:mga05p37_295714_c1
4336 nmdc:mga05p37_346454_c1
4337 nmdc:mga05p37_427886_c1
4338 nmdc:mga05p37_478293_c1
4339 nmdc:mga05p37_843418_c1
4340 nmdc:mga09592_110127_c1
4341 nmdc:mga09592_572805_c1
4342 nmdc:mga09592_583050_c1
4343 nmdc:mga0qj67_110_c1
4344 nmdc:mga0qj67_192888_c1
4345 nmdc:mga0qj67_210707_c1
4346 nmdc:mga0qj67_45773_c1
4347 nmdc:mga0qj67_895066_c1
4348 nmdc:mga06r32_140579_c1
4349 nmdc:mga06r32_240550_c1
4350 nmdc:mga06r32_357616_c1
4351 nmdc:mga06r32_69907_c1
4352 nmdc:mga08y16_1040336_c1
4353 nmdc:mga08y16_105316_c1
4354 nmdc:mga08y16_112073_c1
4355 nmdc:mga08y16_1179181_c1
4356 nmdc:mga08y16_16917_c1
4357 nmdc:mga08y16_20977_c1
4358 nmdc:mga08y16_311778_c1
4359 nmdc:mga0n895_1204055_c1
4360 nmdc:mga0n895_30484_c1
4361 nmdc:mga0n895_313048_c1
4362 nmdc:mga0n895_32647_c1
4363 nmdc:mga0n895_43218_c1
4364 nmdc:mga0n895_821186_c1
4365 nmdc:mga0n895_848429_c1
4366 nmdc:mga0rr50_106113_c1
4367 nmdc:mga0rr50_1154146_c1
4368 nmdc:mga0rr50_295143_c1
4369 nmdc:mga0rr50_304657_c1
4370 nmdc:mga0rr50_509303_c1
4371 nmdc:mga08x19_197103_c1
4372 nmdc:mga08x19_348162_c1
4373 nmdc:mga08x19_62131_c1
4374 nmdc:mga08x19_7671_c1
4375 nmdc:mga08x19_96968_c1
4376 nmdc:mga0a205_199291_c1
4377 nmdc:mga0a205_485_c2
4378 nmdc:mga0a205_80824_c1
4379 nmdc:mga0a205_815016_c1
4380 nmdc:mga0sz30_39284_c1
4381 Ga0495601_0001249
4382 Ga0495601_0005437
4383 Ga0495601_0020790
4384 Ga0495601_0029740
4385 Ga0495601_0165209
4386 Ga0495612_0001253
4387 Ga0495612_0008705
4388 Ga0495612_0130839
4389 Ga0495612_0198168
4390 Ga0500635_0015409
4391 Ga0495655_0012906
4392 Ga0495595_0000908
4393 Ga0495595_0002372
4394 Ga0495595_0169026
4395 Ga0495619_0003156
4396 Ga0495619_0005876
4397 Ga0495619_0040506
4398 Ga0495619_0060676
4399 Ga0495619_0061545
4400 Ga0500643_000003
4401 Ga0500647_0278844
4402 Ga0500566_0103446
4403 Ga0500566_0430688
4404 Ga0500641_0080812
4405 Ga0500648_199276
4406 Ga0500558_143487
4407 Ga0500592_040571
4408 Ga0500595_000096
4409 Ga0500595_036587
4410 Ga0500595_041856
4411 Ga0500595_088417
4412 Ga0500618_003035
4413 Ga0500628_152685
4414 Ga0500642_0147330
4415 Ga0500559_0167038
4416 Ga0500564_235778
4417 Ga0500568_0009896
4418 Ga0500573_0000002
4419 Ga0500573_0013140
4420 Ga0500603_058966
4421 Ga0500616_0002365
4422 Ga0500616_0259111
4423 Ga0500619_147881
4424 Ga0500638_149454
4425 Ga0500639_135040
4426 Ga0500636_0000044
4427 Ga0500636_0087924
4428 Ga0500636_0253672
4429 Ga0500645_034726
4430 Ga0500645_078168
4431 Ga0500596_019464
4432 Ga0501084_0000049
4433 Ga0501084_0006919
4434 Ga0501084_0014455
4435 Ga0501084_0071047
4436 Ga0501084_0093223
4437 Ga0501084_0143212
4438 Ga0501084_0176012
4439 Ga0501084_0482857
4440 Ga0501084_0554901
4441 Ga0501084_0953143
4442 Ga0501084_1160584
4443 Ga0501084_1386455
4444 Ga0587084_013044
4445 Ga0587066_020471
4446 Ga0587070_022744
4447 Ga0587073_0060983
4448 Ga0587077_018926
4449 Ga0587077_081476
4450 Ga0587080_025810
4451 Ga0587080_026354
4452 Ga0587083_0035659
4453 Ga0587085_019087
4454 Ga0587088_026948
4455 Ga0587089_042684
4456 Ga0587089_050426
4457 Ga0587090_018670
4458 Ga0587091_018613
4459 Ga0587101_008409
4460 Ga0587109_013812
4461 Ga0587115_013681
4462 Ga0587128_019433
4463 Ga0587062_014590
4464 Ga0587067_013983
4465 Ga0587072_020857
4466 Ga0587075_017541
4467 Ga0587076_023815
4468 Ga0587076_132310
4469 Ga0587078_010640
4470 Ga0587079_070651
4471 Ga0587105_001741
4472 Ga0587107_013776
4473 Ga0587110_038127
4474 Ga0587111_0036701
4475 Ga0501082_0031765
4476 Ga0501082_0053384
4477 Ga0501082_0406412
4478 Ga0501082_0409845
4479 Ga0501082_0566261
4480 Ga0501082_0823041
4481 Ga0501082_1549695
4482 Ga0530510_0081435
4483 Ga0530510_0468780
4484 Ga0530510_0494603
4485 2600201226
4486 2842695820

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00572

Ribosomal_L13

Ribosomal protein L13

41

150

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8c99-assembly1.cif.gz_J cryo-em captures early ribosome assembly in action 0.8694 1 143
8c99-assembly1.cif.gz_J cryo-em captures early ribosome assembly in action 0.8632 1 143
8c93-assembly1.cif.gz_J cryo-em captures early ribosome assembly in action 0.8377 1 143
8c93-assembly1.cif.gz_J cryo-em captures early ribosome assembly in action 0.832 1 143
8c91-assembly1.cif.gz_J cryo-em captures early ribosome assembly in action 0.8261 1 143
ID Description Score Start End Superfamily
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.8254 1 143 3.90.1180.10
4dhcN00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.8198 1 143 3.90.1180.10
af_O96222_56_212_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.8004 9 141 3.90.1180.10
af_Q4CZX3_36_177_3.90.1180.10 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.7921 13 141 3.90.1180.10
2v47N00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 0.7833 1 141 3.90.1180.10
ID Description Score Start End GO Terms
AF-C6XKJ9-F1-model_v4 Large ribosomal subunit protein uL13 0.8461 1 154 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-A0A8A8PMT4-F1-model_v4 deleted 0.8454 1 154
AF-A0A0M3BQI7-F1-model_v4 Large ribosomal subunit protein uL13 0.8447 1 154 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-Q8UFZ7-F1-model_v4 Large ribosomal subunit protein uL13 (50S ribosomal protein L13) 0.8446 1 154 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625
AF-Q1MIP2-F1-model_v4 Large ribosomal subunit protein uL13 (50S ribosomal protein L13) 0.8442 1 154 GO:0003729
GO:0003735
GO:0006412
GO:0017148
GO:0022625

Map