F496591
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2243 | 657 | 4486 | 154 |
Family's Representative Sequence
| Representative Sequence | 3300035089|Ga0373944_0001645|Ga0373944_0001645_1804_2352 |
| Length | 172 |
| Sequence | MTLTGPNRVGYITGDFAGRTRSNSQGKIMKTYSATAADIEKKWVTIDATGLVVGRLASIVALRLRGKHKASYTPHVDDGDNVIVVNAAKAVLTGRTGYIGGIKDRTAKAILEGRFPERIVEKAVERMLPRGPLGRVQLGNLRVYPGPEHPHEAQKPEKVDVAAMNRKNVRSV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 5 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 6 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 7 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 8 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 9 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 10 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 11 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 12 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 13 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 14 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 15 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 16 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 17 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 18 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 19 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 20 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 21 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 22 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 23 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 24 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 25 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 26 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 27 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 28 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 29 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 30 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 31 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 34 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 36 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 37 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 39 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 40 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 49 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 53 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 66 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 83 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 84 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 85 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 88 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 90 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 91 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 93 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 101 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 103 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 104 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 105 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 107 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 108 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 109 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 110 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 111 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 112 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 113 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 114 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 115 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 116 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 117 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 118 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 119 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 120 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 121 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 123 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 124 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 125 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 126 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 127 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 128 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 129 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 130 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 131 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 132 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 133 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 134 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 136 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 137 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 138 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 139 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 140 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 141 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 142 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 143 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 144 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 145 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 147 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 148 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 149 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 165 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 168 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 169 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 170 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 171 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 172 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 173 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 174 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 175 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 180 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 191 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 193 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 194 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 195 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 196 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 197 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 202 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 204 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 276 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 280 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 282 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 286 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 287 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 288 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 289 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 290 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 291 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 294 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 295 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 296 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 297 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 298 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 299 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 300 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 301 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 302 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 303 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 304 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 305 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 306 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 307 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 308 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 309 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 310 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 311 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 312 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 313 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 314 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 315 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 316 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 317 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 318 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 319 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 320 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 321 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 322 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 323 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 324 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 325 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 326 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 327 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 328 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 329 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 330 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 331 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 332 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 333 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 334 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 335 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 336 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 337 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 338 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 339 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 340 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 341 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 342 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 343 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 344 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 345 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 346 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 347 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 348 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 349 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 350 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 351 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 352 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 353 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 354 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 355 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 356 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 357 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 358 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 359 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 360 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 361 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 362 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 363 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 364 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 365 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 366 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 367 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 368 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 369 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 370 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 371 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 372 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 373 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 374 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 375 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 376 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 377 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 378 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 379 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 380 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 381 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 382 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 383 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 384 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 385 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 386 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 387 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 388 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 389 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 390 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 391 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 392 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 393 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 394 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 395 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 396 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 397 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 398 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 399 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 400 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 401 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 402 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 403 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 404 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 486 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 487 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 488 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 489 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 490 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 491 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 492 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 493 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 494 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 495 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 496 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 497 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 498 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 499 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 500 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 501 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 502 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 503 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 504 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 505 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 506 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 507 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 508 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 509 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 510 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 511 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 512 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 513 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 514 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 515 | 3300049134 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 516 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 517 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 518 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 519 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 521 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 522 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 523 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 524 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 525 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 526 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 527 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 528 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 529 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 530 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 531 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 532 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 533 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 534 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 535 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 536 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 537 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 538 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 539 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 540 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 541 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 542 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 543 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 544 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 545 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 546 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 547 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 548 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 549 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 550 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 551 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 552 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 553 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 554 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 555 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 556 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 557 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 558 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 559 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 560 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 561 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 562 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 563 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 564 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 565 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 566 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 567 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 568 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 569 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 570 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 571 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 572 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 573 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 574 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 575 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 576 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 577 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 578 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 579 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 580 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 581 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 582 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 583 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 584 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 585 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 586 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 587 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 588 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 589 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 590 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 591 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 592 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 593 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 594 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 595 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 596 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 597 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 600 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 604 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 605 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 606 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 607 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 608 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 609 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 610 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 611 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 612 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 613 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 614 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 615 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 616 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 617 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 618 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 619 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 620 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 621 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 622 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 623 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 624 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 625 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 626 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 627 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 628 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 629 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 630 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 631 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 632 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 633 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 634 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 635 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 636 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 637 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 638 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 639 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 640 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 641 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 642 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 643 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 644 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 645 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 646 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 647 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 648 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 649 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 650 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 651 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 652 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 653 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 654 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 655 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 656 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 657 | 2842694124 | Methylopila sp. R-72369 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.12 |
| Metatranscriptomes | 3.79 |
| Isolates | 0.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.17 |
| Nodule | 0.22 |
| Rhizoplane | 6.29 |
| Rhizosphere | 86.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373944_0001645 | 3300035089 | Bacteria | 5649 |
| 2 | 2214761875 | 2209111006 | Bacteria | 2953 |
| 3 | ARcpr5oldR_c000005 | 3300000041 | Bacteria | 43151 |
| 4 | ARSoilYngRDRAFT_c00135 | 3300000042 | Bacteria | 12483 |
| 5 | ARcpr5yngRDRAFT_c000073 | 3300000043 | Bacteria | 16772 |
| 6 | ARSoilOldRDRAFT_c000012 | 3300000044 | Bacteria | 42830 |
| 7 | ARCol0oldRDRAFT_c02295 | 3300000045 | Bacteria | 891 |
| 8 | ARCol0yngRDRAFT_1000066 | 3300000652 | Bacteria | 19051 |
| 9 | JGI24032J14994_100207 | 3300001430 | Bacteria | 3007 |
| 10 | JGI24736J21556_1007134 | 3300001904 | Bacteria | 1882 |
| 11 | JGI24736J21556_1079992 | 3300001904 | Bacteria | 513 |
| 12 | JGI24752J21851_1002466 | 3300001976 | Bacteria | 2462 |
| 13 | JGI24746J21847_1002567 | 3300001977 | Bacteria | 2885 |
| 14 | JGI24747J21853_1000229 | 3300001978 | Bacteria | 3038 |
| 15 | JGI24740J21852_10024312 | 3300001979 | Bacteria | 2057 |
| 16 | JGI24739J22299_10000451 | 3300001989 | Bacteria | 14344 |
| 17 | JGI24739J22299_10006960 | 3300001989 | Bacteria | 4260 |
| 18 | JGI24739J22299_10207394 | 3300001989 | Bacteria | 575 |
| 19 | JGI24737J22298_10003545 | 3300001990 | Bacteria | 5503 |
| 20 | JGI24737J22298_10013316 | 3300001990 | Bacteria | 2678 |
| 21 | JGI24737J22298_10044531 | 3300001990 | Bacteria | 1356 |
| 22 | JGI24737J22298_10089320 | 3300001990 | Bacteria | 914 |
| 23 | JGI24743J22301_10045512 | 3300001991 | Bacteria | 887 |
| 24 | JGI24750J21931_1000063 | 3300002070 | Bacteria | 15488 |
| 25 | JGI24750J21931_1017352 | 3300002070 | Bacteria | 984 |
| 26 | JGI24745J21846_1000659 | 3300002073 | Bacteria | 3106 |
| 27 | JGI24738J21930_10000026 | 3300002075 | Bacteria | 27501 |
| 28 | JGI24749J21850_1001547 | 3300002076 | Bacteria | 3255 |
| 29 | JGI24744J21845_10007253 | 3300002077 | Bacteria | 2291 |
| 30 | JGI24744J21845_10009430 | 3300002077 | Bacteria | 2002 |
| 31 | JGI24744J21845_10029022 | 3300002077 | Bacteria | 1064 |
| 32 | JGI24035J26624_1000384 | 3300002126 | Bacteria | 4145 |
| 33 | JGI24034J26672_10000450 | 3300002239 | Bacteria | 5314 |
| 34 | JGI24742J22300_10000100 | 3300002244 | Bacteria | 12634 |
| 35 | JGI24751J29686_10008012 | 3300002459 | Bacteria | 2159 |
| 36 | JGI25151J46595_10000047 | 3300003187 | Bacteria | 166938 |
| 37 | JGI25151J46595_10000086 | 3300003187 | Bacteria | 126250 |
| 38 | JGI25165J46597_1000003 | 3300003214 | Bacteria | 694080 |
| 39 | JGI25153J46596_10016624 | 3300003215 | Bacteria | 2936 |
| 40 | Ga0007417J51691_1068927 | 3300003544 | Bacteria | 639 |
| 41 | Ga0055526_1000102 | 3300003771 | Bacteria | 74957 |
| 42 | Ga0055524_1000352 | 3300003775 | Bacteria | 41872 |
| 43 | Ga0055534_1064744 | 3300003784 | Bacteria | 505 |
| 44 | Ga0055531_10008796 | 3300003794 | Bacteria | 5262 |
| 45 | JGI25405J52794_10005629 | 3300003911 | Bacteria | 2267 |
| 46 | JGI25405J52794_10040755 | 3300003911 | Bacteria | 982 |
| 47 | JGI25405J52794_10064746 | 3300003911 | Bacteria | 793 |
| 48 | Ga0065165_1003966 | 3300005262 | Bacteria | 9697 |
| 49 | Ga0065714_10210453 | 3300005288 | Bacteria | 868 |
| 50 | Ga0065704_10078881 | 3300005289 | Bacteria | 4311 |
| 51 | Ga0065704_10226081 | 3300005289 | Bacteria | 1058 |
| 52 | Ga0065712_10000705 | 3300005290 | Bacteria | 9899 |
| 53 | Ga0065712_10085237 | 3300005290 | Bacteria | 2698 |
| 54 | Ga0065712_10125464 | 3300005290 | Bacteria | 1613 |
| 55 | Ga0065715_10003686 | 3300005293 | Bacteria | 6503 |
| 56 | Ga0065715_10090522 | 3300005293 | Bacteria | 6866 |
| 57 | Ga0065715_10170204 | 3300005293 | Bacteria | 1553 |
| 58 | Ga0065707_10257648 | 3300005295 | Bacteria | 1106 |
| 59 | Ga0070658_10026441 | 3300005327 | Bacteria | 4655 |
| 60 | Ga0070658_10027112 | 3300005327 | Bacteria | 4599 |
| 61 | Ga0070658_10038663 | 3300005327 | Bacteria | 3847 |
| 62 | Ga0070676_10001250 | 3300005328 | Bacteria | 12808 |
| 63 | Ga0070676_10040362 | 3300005328 | Bacteria | 2703 |
| 64 | Ga0070676_10137593 | 3300005328 | Bacteria | 1551 |
| 65 | Ga0070676_10175776 | 3300005328 | Bacteria | 1388 |
| 66 | Ga0070676_10353966 | 3300005328 | Bacteria | 1010 |
| 67 | Ga0070683_100148475 | 3300005329 | Bacteria | 2222 |
| 68 | Ga0070683_100164558 | 3300005329 | Bacteria | 2104 |
| 69 | Ga0070683_100187663 | 3300005329 | Bacteria | 1963 |
| 70 | Ga0070683_100199397 | 3300005329 | Bacteria | 1900 |
| 71 | Ga0070683_100598761 | 3300005329 | Bacteria | 1055 |
| 72 | Ga0070683_101034666 | 3300005329 | Bacteria | 788 |
| 73 | Ga0070683_101545633 | 3300005329 | Bacteria | 638 |
| 74 | Ga0070690_100008879 | 3300005330 | Bacteria | 5806 |
| 75 | Ga0070690_100029592 | 3300005330 | Bacteria | 3398 |
| 76 | Ga0070690_100119144 | 3300005330 | Bacteria | 1770 |
| 77 | Ga0070690_100125557 | 3300005330 | Bacteria | 1727 |
| 78 | Ga0070690_100270483 | 3300005330 | Bacteria | 1208 |
| 79 | Ga0070690_100313837 | 3300005330 | Bacteria | 1128 |
| 80 | Ga0070670_100011383 | 3300005331 | Bacteria | 7606 |
| 81 | Ga0070670_100032043 | 3300005331 | Bacteria | 4526 |
| 82 | Ga0070670_100414291 | 3300005331 | Bacteria | 1190 |
| 83 | Ga0070670_100615852 | 3300005331 | Bacteria | 972 |
| 84 | Ga0070677_10000055 | 3300005333 | Bacteria | 35005 |
| 85 | Ga0070677_10305642 | 3300005333 | Bacteria | 810 |
| 86 | Ga0068869_100001739 | 3300005334 | Bacteria | 13017 |
| 87 | Ga0068869_100005143 | 3300005334 | Bacteria | 8205 |
| 88 | Ga0068869_100035364 | 3300005334 | Bacteria | 3539 |
| 89 | Ga0068869_100625513 | 3300005334 | Bacteria | 912 |
| 90 | Ga0068869_100934871 | 3300005334 | Bacteria | 752 |
| 91 | Ga0070666_10030353 | 3300005335 | Bacteria | 3560 |
| 92 | Ga0070666_10041771 | 3300005335 | Bacteria | 3065 |
| 93 | Ga0070666_10044519 | 3300005335 | Bacteria | 2973 |
| 94 | Ga0070666_10053330 | 3300005335 | Bacteria | 2727 |
| 95 | Ga0070666_10187419 | 3300005335 | Bacteria | 1453 |
| 96 | Ga0070666_10255372 | 3300005335 | Bacteria | 1241 |
| 97 | Ga0070666_10710186 | 3300005335 | Bacteria | 737 |
| 98 | Ga0070666_10810409 | 3300005335 | Bacteria | 690 |
| 99 | Ga0070680_100051886 | 3300005336 | Bacteria | 3347 |
| 100 | Ga0070680_100053620 | 3300005336 | Bacteria | 3292 |
| 101 | Ga0070680_100097846 | 3300005336 | Bacteria | 2433 |
| 102 | Ga0070680_100249054 | 3300005336 | Bacteria | 1502 |
| 103 | Ga0070680_100256283 | 3300005336 | Bacteria | 1480 |
| 104 | Ga0070680_100345980 | 3300005336 | Bacteria | 1264 |
| 105 | Ga0070680_100703492 | 3300005336 | Bacteria | 869 |
| 106 | Ga0070682_100008777 | 3300005337 | Bacteria | 5704 |
| 107 | Ga0070682_100060665 | 3300005337 | Bacteria | 2392 |
| 108 | Ga0070682_100286001 | 3300005337 | Bacteria | 1204 |
| 109 | Ga0070682_100398109 | 3300005337 | Bacteria | 1041 |
| 110 | Ga0070682_100544002 | 3300005337 | Bacteria | 907 |
| 111 | Ga0068868_100002440 | 3300005338 | Bacteria | 12889 |
| 112 | Ga0068868_100188069 | 3300005338 | Bacteria | 1716 |
| 113 | Ga0068868_100275076 | 3300005338 | Bacteria | 1424 |
| 114 | Ga0068868_100570421 | 3300005338 | Bacteria | 999 |
| 115 | Ga0068868_101084750 | 3300005338 | Bacteria | 736 |
| 116 | Ga0068868_101217280 | 3300005338 | Bacteria | 697 |
| 117 | Ga0070660_100009251 | 3300005339 | Bacteria | 6923 |
| 118 | Ga0070660_100056274 | 3300005339 | Bacteria | 3042 |
| 119 | Ga0070660_100500742 | 3300005339 | Bacteria | 1011 |
| 120 | Ga0070660_100880426 | 3300005339 | Bacteria | 755 |
| 121 | Ga0070660_100885150 | 3300005339 | Bacteria | 753 |
| 122 | Ga0070689_100003427 | 3300005340 | Bacteria | 10550 |
| 123 | Ga0070689_100042064 | 3300005340 | Bacteria | 3508 |
| 124 | Ga0070689_100056550 | 3300005340 | Bacteria | 3042 |
| 125 | Ga0070689_100382832 | 3300005340 | Bacteria | 1186 |
| 126 | Ga0070689_100725162 | 3300005340 | Bacteria | 870 |
| 127 | Ga0070691_10018238 | 3300005341 | Bacteria | 3234 |
| 128 | Ga0070691_10022689 | 3300005341 | Bacteria | 2913 |
| 129 | Ga0070691_10246927 | 3300005341 | Bacteria | 956 |
| 130 | Ga0070691_10730788 | 3300005341 | Bacteria | 597 |
| 131 | Ga0070687_100001219 | 3300005343 | Bacteria | 8915 |
| 132 | Ga0070687_100120563 | 3300005343 | Bacteria | 1499 |
| 133 | Ga0070687_100143043 | 3300005343 | Bacteria | 1395 |
| 134 | Ga0070687_100291039 | 3300005343 | Bacteria | 1032 |
| 135 | Ga0070661_100000019 | 3300005344 | Bacteria | 132428 |
| 136 | Ga0070661_100005369 | 3300005344 | Bacteria | 8834 |
| 137 | Ga0070661_100140071 | 3300005344 | Bacteria | 1822 |
| 138 | Ga0070661_100164493 | 3300005344 | Bacteria | 1682 |
| 139 | Ga0070661_100279043 | 3300005344 | Bacteria | 1296 |
| 140 | Ga0070661_100362815 | 3300005344 | Bacteria | 1139 |
| 141 | Ga0070692_10002445 | 3300005345 | Bacteria | 7215 |
| 142 | Ga0070692_10029257 | 3300005345 | Bacteria | 2744 |
| 143 | Ga0070668_100010381 | 3300005347 | Bacteria | 6918 |
| 144 | Ga0070668_100018336 | 3300005347 | Bacteria | 5254 |
| 145 | Ga0070668_100090379 | 3300005347 | Bacteria | 2412 |
| 146 | Ga0070668_100191925 | 3300005347 | Bacteria | 1673 |
| 147 | Ga0070668_100514223 | 3300005347 | Bacteria | 1038 |
| 148 | Ga0070669_100003432 | 3300005353 | Bacteria | 11417 |
| 149 | Ga0070669_100037713 | 3300005353 | Bacteria | 3506 |
| 150 | Ga0070669_100097844 | 3300005353 | Bacteria | 2209 |
| 151 | Ga0070669_100115265 | 3300005353 | Bacteria | 2044 |
| 152 | Ga0070669_100586699 | 3300005353 | Bacteria | 932 |
| 153 | Ga0070669_100680143 | 3300005353 | Bacteria | 868 |
| 154 | Ga0070669_101579383 | 3300005353 | Bacteria | 571 |
| 155 | Ga0070675_100009751 | 3300005354 | Bacteria | 7479 |
| 156 | Ga0070675_100013224 | 3300005354 | Bacteria | 6485 |
| 157 | Ga0070675_100063934 | 3300005354 | Bacteria | 3042 |
| 158 | Ga0070675_100249883 | 3300005354 | Bacteria | 1552 |
| 159 | Ga0070671_100000344 | 3300005355 | Bacteria | 31796 |
| 160 | Ga0070671_100023576 | 3300005355 | Bacteria | 5038 |
| 161 | Ga0070671_100043720 | 3300005355 | Bacteria | 3723 |
| 162 | Ga0070671_100075836 | 3300005355 | Bacteria | 2809 |
| 163 | Ga0070671_100880547 | 3300005355 | Bacteria | 782 |
| 164 | Ga0070674_100000250 | 3300005356 | Bacteria | 26734 |
| 165 | Ga0070674_100165387 | 3300005356 | Bacteria | 1682 |
| 166 | Ga0070674_100443704 | 3300005356 | Bacteria | 1070 |
| 167 | Ga0070673_100001701 | 3300005364 | Bacteria | 13067 |
| 168 | Ga0070673_100198620 | 3300005364 | Bacteria | 1726 |
| 169 | Ga0070673_100199611 | 3300005364 | Bacteria | 1722 |
| 170 | Ga0070673_100216864 | 3300005364 | Bacteria | 1654 |
| 171 | Ga0070673_100328174 | 3300005364 | Bacteria | 1353 |
| 172 | Ga0070673_101077394 | 3300005364 | Bacteria | 750 |
| 173 | Ga0070688_100005899 | 3300005365 | Bacteria | 6485 |
| 174 | Ga0070688_100011287 | 3300005365 | Bacteria | 4961 |
| 175 | Ga0070688_100069914 | 3300005365 | Bacteria | 2243 |
| 176 | Ga0070659_100015535 | 3300005366 | Bacteria | 5701 |
| 177 | Ga0070659_100066094 | 3300005366 | Bacteria | 2865 |
| 178 | Ga0070659_100072266 | 3300005366 | Bacteria | 2744 |
| 179 | Ga0070659_100274884 | 3300005366 | Bacteria | 1400 |
| 180 | Ga0070659_100345762 | 3300005366 | Bacteria | 1247 |
| 181 | Ga0070659_100369380 | 3300005366 | Bacteria | 1206 |
| 182 | Ga0070667_100009616 | 3300005367 | Bacteria | 8018 |
| 183 | Ga0070667_100010027 | 3300005367 | Bacteria | 7850 |
| 184 | Ga0070667_100015965 | 3300005367 | Bacteria | 6213 |
| 185 | Ga0070667_100170241 | 3300005367 | Bacteria | 1923 |
| 186 | Ga0070667_100383742 | 3300005367 | Bacteria | 1276 |
| 187 | Ga0070703_10003768 | 3300005406 | Bacteria | 4290 |
| 188 | Ga0070709_10002940 | 3300005434 | Bacteria | 9174 |
| 189 | Ga0070709_10058623 | 3300005434 | Bacteria | 2442 |
| 190 | Ga0070709_10075450 | 3300005434 | Bacteria | 2188 |
| 191 | Ga0070709_10080351 | 3300005434 | Bacteria | 2126 |
| 192 | Ga0070714_100038980 | 3300005435 | Bacteria | 3998 |
| 193 | Ga0070714_100044928 | 3300005435 | Bacteria | 3741 |
| 194 | Ga0070714_100064144 | 3300005435 | Bacteria | 3161 |
| 195 | Ga0070714_100167380 | 3300005435 | Bacteria | 1992 |
| 196 | Ga0070714_100978931 | 3300005435 | Bacteria | 823 |
| 197 | Ga0070714_101342156 | 3300005435 | Bacteria | 698 |
| 198 | Ga0070713_100005484 | 3300005436 | Bacteria | 8680 |
| 199 | Ga0070713_100100286 | 3300005436 | Bacteria | 2506 |
| 200 | Ga0070713_100100653 | 3300005436 | Bacteria | 2502 |
| 201 | Ga0070713_100457250 | 3300005436 | Bacteria | 1200 |
| 202 | Ga0070713_100630439 | 3300005436 | Bacteria | 1020 |
| 203 | Ga0070713_101097523 | 3300005436 | Bacteria | 769 |
| 204 | Ga0070710_10008043 | 3300005437 | Bacteria | 5126 |
| 205 | Ga0070710_10093518 | 3300005437 | Bacteria | 1777 |
| 206 | Ga0070701_10002806 | 3300005438 | Bacteria | 6775 |
| 207 | Ga0070701_10193715 | 3300005438 | Bacteria | 1197 |
| 208 | Ga0070711_100002519 | 3300005439 | Bacteria | 10469 |
| 209 | Ga0070711_100079918 | 3300005439 | Bacteria | 2327 |
| 210 | Ga0070711_100239710 | 3300005439 | Bacteria | 1417 |
| 211 | Ga0070711_100451133 | 3300005439 | Bacteria | 1053 |
| 212 | Ga0070711_100648831 | 3300005439 | Bacteria | 885 |
| 213 | Ga0070711_101384736 | 3300005439 | Bacteria | 612 |
| 214 | Ga0070705_100014699 | 3300005440 | Bacteria | 4033 |
| 215 | Ga0070705_100042721 | 3300005440 | Bacteria | 2593 |
| 216 | Ga0070705_100077733 | 3300005440 | Bacteria | 2027 |
| 217 | Ga0070700_100045586 | 3300005441 | Bacteria | 2705 |
| 218 | Ga0070700_100141319 | 3300005441 | Bacteria | 1636 |
| 219 | Ga0070700_100283134 | 3300005441 | Bacteria | 1203 |
| 220 | Ga0070700_100380964 | 3300005441 | Bacteria | 1055 |
| 221 | Ga0070694_100021143 | 3300005444 | Bacteria | 4155 |
| 222 | Ga0070694_100113915 | 3300005444 | Bacteria | 1930 |
| 223 | Ga0070694_100533491 | 3300005444 | Bacteria | 938 |
| 224 | Ga0070694_100613062 | 3300005444 | Bacteria | 877 |
| 225 | Ga0070694_100635640 | 3300005444 | Bacteria | 863 |
| 226 | Ga0070708_100032307 | 3300005445 | Bacteria | 4538 |
| 227 | Ga0070708_100062532 | 3300005445 | Bacteria | 3330 |
| 228 | Ga0070708_100998906 | 3300005445 | Bacteria | 785 |
| 229 | Ga0070663_100029594 | 3300005455 | Bacteria | 3744 |
| 230 | Ga0070663_100063184 | 3300005455 | Bacteria | 2672 |
| 231 | Ga0070663_100114973 | 3300005455 | Bacteria | 2026 |
| 232 | Ga0070663_100539499 | 3300005455 | Bacteria | 973 |
| 233 | Ga0070663_100898540 | 3300005455 | Bacteria | 765 |
| 234 | Ga0070678_100000784 | 3300005456 | Bacteria | 15959 |
| 235 | Ga0070678_100149910 | 3300005456 | Bacteria | 1877 |
| 236 | Ga0070678_100330483 | 3300005456 | Bacteria | 1304 |
| 237 | Ga0070678_100344505 | 3300005456 | Bacteria | 1279 |
| 238 | Ga0070678_100432434 | 3300005456 | Bacteria | 1149 |
| 239 | Ga0070662_100050231 | 3300005457 | Bacteria | 3008 |
| 240 | Ga0070662_100062081 | 3300005457 | Bacteria | 2729 |
| 241 | Ga0070662_100078824 | 3300005457 | Bacteria | 2448 |
| 242 | Ga0070681_10021719 | 3300005458 | Bacteria | 6436 |
| 243 | Ga0070681_10053171 | 3300005458 | Bacteria | 4035 |
| 244 | Ga0070681_10156394 | 3300005458 | Bacteria | 2204 |
| 245 | Ga0070681_10165291 | 3300005458 | Bacteria | 2136 |
| 246 | Ga0070681_10226633 | 3300005458 | Bacteria | 1783 |
| 247 | Ga0070681_10469003 | 3300005458 | Bacteria | 1171 |
| 248 | Ga0068867_100002792 | 3300005459 | Bacteria | 12281 |
| 249 | Ga0068867_100005970 | 3300005459 | Bacteria | 8636 |
| 250 | Ga0068867_100021169 | 3300005459 | Bacteria | 4638 |
| 251 | Ga0068867_100032862 | 3300005459 | Bacteria | 3753 |
| 252 | Ga0068867_100406759 | 3300005459 | Bacteria | 1149 |
| 253 | Ga0068867_100981517 | 3300005459 | Bacteria | 765 |
| 254 | Ga0070685_10001307 | 3300005466 | Bacteria | 13125 |
| 255 | Ga0070685_10004363 | 3300005466 | Bacteria | 7137 |
| 256 | Ga0070685_10023513 | 3300005466 | Bacteria | 3375 |
| 257 | Ga0070685_10261202 | 3300005466 | Bacteria | 1151 |
| 258 | Ga0070707_100065762 | 3300005468 | Bacteria | 3484 |
| 259 | Ga0070707_101006386 | 3300005468 | Bacteria | 799 |
| 260 | Ga0070698_100045789 | 3300005471 | Bacteria | 4476 |
| 261 | Ga0070698_100291936 | 3300005471 | Bacteria | 1562 |
| 262 | Ga0074259_10113202 | 3300005507 | Bacteria | 953 |
| 263 | Ga0070699_100089245 | 3300005518 | Bacteria | 2693 |
| 264 | Ga0070679_100019810 | 3300005530 | Bacteria | 6550 |
| 265 | Ga0070679_100029886 | 3300005530 | Bacteria | 5376 |
| 266 | Ga0070679_100065568 | 3300005530 | Bacteria | 3620 |
| 267 | Ga0070679_100075069 | 3300005530 | Bacteria | 3371 |
| 268 | Ga0070679_100125965 | 3300005530 | Bacteria | 2544 |
| 269 | Ga0070679_100130785 | 3300005530 | Bacteria | 2491 |
| 270 | Ga0070679_100138507 | 3300005530 | Bacteria | 2414 |
| 271 | Ga0070679_100255315 | 3300005530 | Bacteria | 1708 |
| 272 | Ga0070679_100310154 | 3300005530 | Bacteria | 1528 |
| 273 | Ga0070679_100478903 | 3300005530 | Bacteria | 1189 |
| 274 | Ga0070679_101207180 | 3300005530 | Bacteria | 702 |
| 275 | Ga0070684_100003800 | 3300005535 | Bacteria | 11409 |
| 276 | Ga0070684_100074354 | 3300005535 | Bacteria | 2995 |
| 277 | Ga0070684_100097748 | 3300005535 | Bacteria | 2619 |
| 278 | Ga0070684_100138507 | 3300005535 | Bacteria | 2199 |
| 279 | Ga0070684_100170317 | 3300005535 | Bacteria | 1978 |
| 280 | Ga0070684_100698657 | 3300005535 | Bacteria | 945 |
| 281 | Ga0070697_100461969 | 3300005536 | Bacteria | 1107 |
| 282 | Ga0070697_101029753 | 3300005536 | Bacteria | 732 |
| 283 | Ga0068853_100011082 | 3300005539 | Bacteria | 7312 |
| 284 | Ga0068853_100024870 | 3300005539 | Bacteria | 5024 |
| 285 | Ga0068853_100037962 | 3300005539 | Bacteria | 4101 |
| 286 | Ga0068853_100066989 | 3300005539 | Bacteria | 3119 |
| 287 | Ga0068853_100195671 | 3300005539 | Bacteria | 1839 |
| 288 | Ga0068853_100236915 | 3300005539 | Bacteria | 1671 |
| 289 | Ga0068853_100237056 | 3300005539 | Bacteria | 1671 |
| 290 | Ga0068853_100243596 | 3300005539 | Bacteria | 1648 |
| 291 | Ga0068853_100527773 | 3300005539 | Bacteria | 1116 |
| 292 | Ga0068853_100652430 | 3300005539 | Bacteria | 1002 |
| 293 | Ga0068853_100744453 | 3300005539 | Bacteria | 936 |
| 294 | Ga0068853_101170748 | 3300005539 | Bacteria | 742 |
| 295 | Ga0070672_100002659 | 3300005543 | Bacteria | 11417 |
| 296 | Ga0070672_100019800 | 3300005543 | Bacteria | 4893 |
| 297 | Ga0070672_100079029 | 3300005543 | Bacteria | 2632 |
| 298 | Ga0070672_100368657 | 3300005543 | Bacteria | 1227 |
| 299 | Ga0070672_100454588 | 3300005543 | Bacteria | 1103 |
| 300 | Ga0070672_100728972 | 3300005543 | Bacteria | 869 |
| 301 | Ga0070686_100005374 | 3300005544 | Bacteria | 7086 |
| 302 | Ga0070686_100006315 | 3300005544 | Bacteria | 6582 |
| 303 | Ga0070686_100038764 | 3300005544 | Bacteria | 2964 |
| 304 | Ga0070686_100418755 | 3300005544 | Bacteria | 1023 |
| 305 | Ga0070686_100444268 | 3300005544 | Bacteria | 995 |
| 306 | Ga0070695_100048751 | 3300005545 | Bacteria | 2709 |
| 307 | Ga0070695_100058121 | 3300005545 | Bacteria | 2500 |
| 308 | Ga0070695_100176070 | 3300005545 | Bacteria | 1512 |
| 309 | Ga0070696_100084241 | 3300005546 | Bacteria | 2255 |
| 310 | Ga0070696_100099287 | 3300005546 | Bacteria | 2083 |
| 311 | Ga0070696_100149510 | 3300005546 | Bacteria | 1713 |
| 312 | Ga0070696_100156776 | 3300005546 | Bacteria | 1675 |
| 313 | Ga0070696_100216148 | 3300005546 | Bacteria | 1436 |
| 314 | Ga0070696_100510550 | 3300005546 | Bacteria | 958 |
| 315 | Ga0070696_100949167 | 3300005546 | Bacteria | 716 |
| 316 | Ga0070696_101264139 | 3300005546 | Bacteria | 625 |
| 317 | Ga0070693_100051208 | 3300005547 | Bacteria | 2364 |
| 318 | Ga0070693_100052511 | 3300005547 | Bacteria | 2337 |
| 319 | Ga0070693_100096064 | 3300005547 | Bacteria | 1796 |
| 320 | Ga0070693_100148217 | 3300005547 | Bacteria | 1483 |
| 321 | Ga0070693_100296266 | 3300005547 | Bacteria | 1089 |
| 322 | Ga0070693_100414919 | 3300005547 | Bacteria | 937 |
| 323 | Ga0070665_100001666 | 3300005548 | Bacteria | 25601 |
| 324 | Ga0070665_100064057 | 3300005548 | Bacteria | 3686 |
| 325 | Ga0070665_100069966 | 3300005548 | Bacteria | 3516 |
| 326 | Ga0070665_100078425 | 3300005548 | Bacteria | 3309 |
| 327 | Ga0070665_100140532 | 3300005548 | Bacteria | 2418 |
| 328 | Ga0070665_100148543 | 3300005548 | Bacteria | 2346 |
| 329 | Ga0070665_100251134 | 3300005548 | Bacteria | 1769 |
| 330 | Ga0070665_100296120 | 3300005548 | Bacteria | 1620 |
| 331 | Ga0070665_100372487 | 3300005548 | Bacteria | 1435 |
| 332 | Ga0070665_100395612 | 3300005548 | Bacteria | 1389 |
| 333 | Ga0070665_100819901 | 3300005548 | Bacteria | 943 |
| 334 | Ga0070665_101008890 | 3300005548 | Bacteria | 844 |
| 335 | Ga0070665_101173653 | 3300005548 | Bacteria | 779 |
| 336 | Ga0070665_101269534 | 3300005548 | Bacteria | 747 |
| 337 | Ga0070704_100006508 | 3300005549 | Bacteria | 6885 |
| 338 | Ga0070704_100067471 | 3300005549 | Bacteria | 2583 |
| 339 | Ga0068855_100008197 | 3300005563 | Bacteria | 12629 |
| 340 | Ga0068855_100012377 | 3300005563 | Bacteria | 10304 |
| 341 | Ga0068855_100044569 | 3300005563 | Bacteria | 5249 |
| 342 | Ga0068855_100086777 | 3300005563 | Bacteria | 3618 |
| 343 | Ga0068855_100199544 | 3300005563 | Bacteria | 2253 |
| 344 | Ga0068855_100206748 | 3300005563 | Bacteria | 2208 |
| 345 | Ga0068855_100257719 | 3300005563 | Bacteria | 1944 |
| 346 | Ga0068855_100495253 | 3300005563 | Bacteria | 1329 |
| 347 | Ga0068855_100582375 | 3300005563 | Bacteria | 1208 |
| 348 | Ga0068855_100848900 | 3300005563 | Bacteria | 968 |
| 349 | Ga0068855_100953411 | 3300005563 | Bacteria | 904 |
| 350 | Ga0068855_101020036 | 3300005563 | Bacteria | 868 |
| 351 | Ga0070664_100016247 | 3300005564 | Bacteria | 6102 |
| 352 | Ga0070664_100106987 | 3300005564 | Bacteria | 2438 |
| 353 | Ga0070664_100161050 | 3300005564 | Bacteria | 1985 |
| 354 | Ga0070664_100279846 | 3300005564 | Bacteria | 1504 |
| 355 | Ga0070664_100857165 | 3300005564 | Bacteria | 851 |
| 356 | Ga0068857_100007028 | 3300005577 | Bacteria | 9689 |
| 357 | Ga0068857_100088413 | 3300005577 | Bacteria | 2772 |
| 358 | Ga0068857_100139258 | 3300005577 | Bacteria | 2193 |
| 359 | Ga0068857_100250095 | 3300005577 | Bacteria | 1625 |
| 360 | Ga0068857_100537011 | 3300005577 | Bacteria | 1100 |
| 361 | Ga0068857_100569377 | 3300005577 | Bacteria | 1068 |
| 362 | Ga0068854_100003980 | 3300005578 | Bacteria | 9266 |
| 363 | Ga0068854_100142780 | 3300005578 | Bacteria | 1839 |
| 364 | Ga0068854_100430946 | 3300005578 | Bacteria | 1097 |
| 365 | Ga0068854_100594912 | 3300005578 | Bacteria | 944 |
| 366 | Ga0068856_100000406 | 3300005614 | Bacteria | 47326 |
| 367 | Ga0068856_100181218 | 3300005614 | Bacteria | 2119 |
| 368 | Ga0068856_100199039 | 3300005614 | Bacteria | 2018 |
| 369 | Ga0068856_100408200 | 3300005614 | Bacteria | 1378 |
| 370 | Ga0068856_100917226 | 3300005614 | Bacteria | 895 |
| 371 | Ga0068856_100958480 | 3300005614 | Bacteria | 874 |
| 372 | Ga0068856_101079300 | 3300005614 | Bacteria | 820 |
| 373 | Ga0070702_100000099 | 3300005615 | Bacteria | 25765 |
| 374 | Ga0070702_100008907 | 3300005615 | Bacteria | 4884 |
| 375 | Ga0070702_100343183 | 3300005615 | Bacteria | 1049 |
| 376 | Ga0070702_100358263 | 3300005615 | Bacteria | 1030 |
| 377 | Ga0068852_100015801 | 3300005616 | Bacteria | 5868 |
| 378 | Ga0068852_100026623 | 3300005616 | Bacteria | 4704 |
| 379 | Ga0068852_100057377 | 3300005616 | Bacteria | 3369 |
| 380 | Ga0068852_100173312 | 3300005616 | Bacteria | 2024 |
| 381 | Ga0068852_100297706 | 3300005616 | Bacteria | 1560 |
| 382 | Ga0068852_100389575 | 3300005616 | Bacteria | 1368 |
| 383 | Ga0068852_100495730 | 3300005616 | Bacteria | 1216 |
| 384 | Ga0068859_100002395 | 3300005617 | Bacteria | 19092 |
| 385 | Ga0068859_100072467 | 3300005617 | Bacteria | 3481 |
| 386 | Ga0068859_100094856 | 3300005617 | Bacteria | 3036 |
| 387 | Ga0068859_100124644 | 3300005617 | Bacteria | 2644 |
| 388 | Ga0068859_100617819 | 3300005617 | Bacteria | 1176 |
| 389 | Ga0068859_101096576 | 3300005617 | Bacteria | 876 |
| 390 | Ga0068864_100001957 | 3300005618 | Bacteria | 16937 |
| 391 | Ga0068864_100021360 | 3300005618 | Bacteria | 5423 |
| 392 | Ga0068864_100075862 | 3300005618 | Bacteria | 2936 |
| 393 | Ga0068864_100467562 | 3300005618 | Bacteria | 1208 |
| 394 | Ga0068864_101158573 | 3300005618 | Bacteria | 771 |
| 395 | Ga0068864_101858767 | 3300005618 | Bacteria | 608 |
| 396 | Ga0068866_10001585 | 3300005718 | Bacteria | 9648 |
| 397 | Ga0068866_10008946 | 3300005718 | Bacteria | 4239 |
| 398 | Ga0068866_10039117 | 3300005718 | Bacteria | 2340 |
| 399 | Ga0068866_10141830 | 3300005718 | Bacteria | 1380 |
| 400 | Ga0068866_10219924 | 3300005718 | Bacteria | 1145 |
| 401 | Ga0068866_10778945 | 3300005718 | Bacteria | 663 |
| 402 | Ga0068861_100000354 | 3300005719 | Bacteria | 26182 |
| 403 | Ga0068861_100021977 | 3300005719 | Bacteria | 4590 |
| 404 | Ga0068861_100061718 | 3300005719 | Bacteria | 2877 |
| 405 | Ga0068861_100345957 | 3300005719 | Bacteria | 1302 |
| 406 | Ga0068861_100727202 | 3300005719 | Bacteria | 925 |
| 407 | Ga0068861_101316366 | 3300005719 | Bacteria | 703 |
| 408 | Ga0068851_10105288 | 3300005834 | Bacteria | 1501 |
| 409 | Ga0068851_10565114 | 3300005834 | Bacteria | 689 |
| 410 | Ga0068851_10651429 | 3300005834 | Bacteria | 645 |
| 411 | Ga0068870_10000165 | 3300005840 | Bacteria | 23495 |
| 412 | Ga0068870_10049113 | 3300005840 | Bacteria | 2224 |
| 413 | Ga0068870_10170947 | 3300005840 | Bacteria | 1297 |
| 414 | Ga0068870_10241834 | 3300005840 | Bacteria | 1115 |
| 415 | Ga0068863_100001449 | 3300005841 | Bacteria | 23543 |
| 416 | Ga0068863_100016627 | 3300005841 | Bacteria | 7059 |
| 417 | Ga0068863_100385215 | 3300005841 | Bacteria | 1369 |
| 418 | Ga0068863_102342338 | 3300005841 | Bacteria | 544 |
| 419 | Ga0068858_100018513 | 3300005842 | Bacteria | 6520 |
| 420 | Ga0068858_100045467 | 3300005842 | Bacteria | 4069 |
| 421 | Ga0068858_100052996 | 3300005842 | Bacteria | 3754 |
| 422 | Ga0068858_100360279 | 3300005842 | Bacteria | 1394 |
| 423 | Ga0068858_100390938 | 3300005842 | Bacteria | 1335 |
| 424 | Ga0068858_100411830 | 3300005842 | Bacteria | 1299 |
| 425 | Ga0068858_100710224 | 3300005842 | Bacteria | 978 |
| 426 | Ga0068858_100936687 | 3300005842 | Bacteria | 848 |
| 427 | Ga0068860_100001477 | 3300005843 | Bacteria | 25388 |
| 428 | Ga0068860_100015564 | 3300005843 | Bacteria | 7429 |
| 429 | Ga0068860_100105189 | 3300005843 | Bacteria | 2695 |
| 430 | Ga0068860_100472835 | 3300005843 | Bacteria | 1248 |
| 431 | Ga0068862_100014775 | 3300005844 | Bacteria | 6485 |
| 432 | Ga0068862_100062072 | 3300005844 | Bacteria | 3213 |
| 433 | Ga0068862_100082075 | 3300005844 | Bacteria | 2797 |
| 434 | Ga0068862_100327025 | 3300005844 | Bacteria | 1416 |
| 435 | Ga0081455_10000327 | 3300005937 | Bacteria | 62253 |
| 436 | Ga0081455_10001293 | 3300005937 | Bacteria | 31137 |
| 437 | Ga0081455_10615716 | 3300005937 | Bacteria | 705 |
| 438 | Ga0081538_10014654 | 3300005981 | Bacteria | 6126 |
| 439 | Ga0081540_1000108 | 3300005983 | Bacteria | 88825 |
| 440 | Ga0081540_1019974 | 3300005983 | Bacteria | 4047 |
| 441 | Ga0081540_1055343 | 3300005983 | Bacteria | 1933 |
| 442 | Ga0081540_1096624 | 3300005983 | Bacteria | 1285 |
| 443 | Ga0081540_1110301 | 3300005983 | Bacteria | 1165 |
| 444 | Ga0081539_10209184 | 3300005985 | Bacteria | 895 |
| 445 | Ga0081539_10232325 | 3300005985 | Bacteria | 832 |
| 446 | Ga0070717_10001121 | 3300006028 | Bacteria | 18099 |
| 447 | Ga0070717_10038847 | 3300006028 | Bacteria | 3870 |
| 448 | Ga0070717_10160743 | 3300006028 | Bacteria | 1948 |
| 449 | Ga0070717_10447794 | 3300006028 | Bacteria | 1163 |
| 450 | Ga0075365_10000253 | 3300006038 | Bacteria | 18331 |
| 451 | Ga0075365_10006417 | 3300006038 | Bacteria | 6470 |
| 452 | Ga0075365_10182519 | 3300006038 | Bacteria | 1467 |
| 453 | Ga0075365_10244030 | 3300006038 | Bacteria | 1261 |
| 454 | Ga0075365_10254072 | 3300006038 | Bacteria | 1235 |
| 455 | Ga0075365_10480691 | 3300006038 | Bacteria | 878 |
| 456 | Ga0075368_10019183 | 3300006042 | Bacteria | 2580 |
| 457 | Ga0075368_10162350 | 3300006042 | Bacteria | 936 |
| 458 | Ga0075368_10291057 | 3300006042 | Bacteria | 703 |
| 459 | Ga0075363_100111876 | 3300006048 | Bacteria | 1518 |
| 460 | Ga0075363_100401880 | 3300006048 | Bacteria | 805 |
| 461 | Ga0075363_100522274 | 3300006048 | Bacteria | 706 |
| 462 | Ga0075363_100528928 | 3300006048 | Bacteria | 702 |
| 463 | Ga0075363_100688219 | 3300006048 | Bacteria | 617 |
| 464 | Ga0075364_10374816 | 3300006051 | Bacteria | 971 |
| 465 | Ga0075432_10047301 | 3300006058 | Bacteria | 1512 |
| 466 | Ga0070715_10026313 | 3300006163 | Bacteria | 2314 |
| 467 | Ga0070715_10084938 | 3300006163 | Bacteria | 1445 |
| 468 | Ga0070715_10459969 | 3300006163 | Bacteria | 720 |
| 469 | Ga0070715_10780685 | 3300006163 | Bacteria | 578 |
| 470 | Ga0070716_100001226 | 3300006173 | Bacteria | 11292 |
| 471 | Ga0070716_100014276 | 3300006173 | Bacteria | 4066 |
| 472 | Ga0070716_100161095 | 3300006173 | Bacteria | 1454 |
| 473 | Ga0070716_100203854 | 3300006173 | Bacteria | 1317 |
| 474 | Ga0070716_100345556 | 3300006173 | Bacteria | 1051 |
| 475 | Ga0070716_100655030 | 3300006173 | Bacteria | 797 |
| 476 | Ga0070712_100000244 | 3300006175 | Bacteria | 30649 |
| 477 | Ga0070712_100000983 | 3300006175 | Bacteria | 17123 |
| 478 | Ga0070712_100021619 | 3300006175 | Bacteria | 4228 |
| 479 | Ga0070712_100052038 | 3300006175 | Bacteria | 2854 |
| 480 | Ga0070712_100109751 | 3300006175 | Bacteria | 2057 |
| 481 | Ga0070712_100165502 | 3300006175 | Bacteria | 1711 |
| 482 | Ga0070712_100240294 | 3300006175 | Bacteria | 1442 |
| 483 | Ga0070712_100444422 | 3300006175 | Bacteria | 1078 |
| 484 | Ga0070712_100502869 | 3300006175 | Bacteria | 1016 |
| 485 | Ga0075362_10035265 | 3300006177 | Bacteria | 2183 |
| 486 | Ga0075362_10059826 | 3300006177 | Bacteria | 1721 |
| 487 | Ga0075362_10064177 | 3300006177 | Bacteria | 1666 |
| 488 | Ga0075362_10212101 | 3300006177 | Bacteria | 945 |
| 489 | Ga0075362_10238835 | 3300006177 | Bacteria | 892 |
| 490 | Ga0075367_10002242 | 3300006178 | Bacteria | 8739 |
| 491 | Ga0075367_10008688 | 3300006178 | Bacteria | 5274 |
| 492 | Ga0075367_10315627 | 3300006178 | Bacteria | 985 |
| 493 | Ga0075369_10004804 | 3300006186 | Bacteria | 5025 |
| 494 | Ga0075369_10034041 | 3300006186 | Bacteria | 2161 |
| 495 | Ga0075369_10101868 | 3300006186 | Bacteria | 1289 |
| 496 | Ga0075369_10134756 | 3300006186 | Bacteria | 1124 |
| 497 | Ga0075366_10002628 | 3300006195 | Bacteria | 9242 |
| 498 | Ga0075366_10032261 | 3300006195 | Bacteria | 3084 |
| 499 | Ga0075366_10150985 | 3300006195 | Bacteria | 1407 |
| 500 | Ga0075366_10430188 | 3300006195 | Bacteria | 814 |
| 501 | Ga0075366_10467746 | 3300006195 | Bacteria | 778 |
| 502 | Ga0075366_10519606 | 3300006195 | Bacteria | 736 |
| 503 | Ga0075366_10539806 | 3300006195 | Bacteria | 722 |
| 504 | Ga0097621_100000841 | 3300006237 | Bacteria | 21627 |
| 505 | Ga0097621_100001124 | 3300006237 | Bacteria | 18635 |
| 506 | Ga0097621_100012671 | 3300006237 | Bacteria | 6261 |
| 507 | Ga0097621_100021911 | 3300006237 | Bacteria | 4951 |
| 508 | Ga0097621_100058357 | 3300006237 | Bacteria | 3158 |
| 509 | Ga0097621_100170557 | 3300006237 | Bacteria | 1875 |
| 510 | Ga0097621_100274064 | 3300006237 | Bacteria | 1483 |
| 511 | Ga0097621_100423828 | 3300006237 | Bacteria | 1195 |
| 512 | Ga0075370_10080473 | 3300006353 | Bacteria | 1872 |
| 513 | Ga0075370_10316348 | 3300006353 | Bacteria | 929 |
| 514 | Ga0075370_10316890 | 3300006353 | Bacteria | 929 |
| 515 | Ga0075370_10544435 | 3300006353 | Bacteria | 702 |
| 516 | Ga0068871_100000243 | 3300006358 | Bacteria | 37961 |
| 517 | Ga0068871_100001352 | 3300006358 | Bacteria | 16421 |
| 518 | Ga0068871_100052112 | 3300006358 | Bacteria | 3313 |
| 519 | Ga0068871_100168956 | 3300006358 | Bacteria | 1873 |
| 520 | Ga0068871_100181937 | 3300006358 | Bacteria | 1807 |
| 521 | Ga0068871_100249544 | 3300006358 | Bacteria | 1545 |
| 522 | Ga0068871_100274060 | 3300006358 | Bacteria | 1474 |
| 523 | Ga0068871_100464386 | 3300006358 | Bacteria | 1136 |
| 524 | Ga0068871_101372948 | 3300006358 | Bacteria | 666 |
| 525 | Ga0075428_100048667 | 3300006844 | Bacteria | 4653 |
| 526 | Ga0075428_100441727 | 3300006844 | Bacteria | 1393 |
| 527 | Ga0075428_100924867 | 3300006844 | Bacteria | 924 |
| 528 | Ga0075428_101120323 | 3300006844 | Bacteria | 831 |
| 529 | Ga0075430_100000370 | 3300006846 | Bacteria | 32941 |
| 530 | Ga0075430_100018050 | 3300006846 | Bacteria | 6005 |
| 531 | Ga0075431_100111850 | 3300006847 | Bacteria | 2818 |
| 532 | Ga0075431_100337906 | 3300006847 | Bacteria | 1516 |
| 533 | Ga0075431_100658515 | 3300006847 | Bacteria | 1027 |
| 534 | Ga0075433_10010812 | 3300006852 | Bacteria | 7341 |
| 535 | Ga0075433_10137753 | 3300006852 | Bacteria | 2169 |
| 536 | Ga0075433_10195773 | 3300006852 | Bacteria | 1798 |
| 537 | Ga0075434_100029863 | 3300006871 | Bacteria | 5366 |
| 538 | Ga0075434_100041047 | 3300006871 | Bacteria | 4582 |
| 539 | Ga0075434_100287613 | 3300006871 | Bacteria | 1664 |
| 540 | Ga0075434_101223636 | 3300006871 | Bacteria | 763 |
| 541 | Ga0075434_102073236 | 3300006871 | Bacteria | 573 |
| 542 | Ga0075434_102092829 | 3300006871 | Bacteria | 571 |
| 543 | Ga0075429_100580959 | 3300006880 | Bacteria | 982 |
| 544 | Ga0075429_101058960 | 3300006880 | Bacteria | 709 |
| 545 | Ga0075429_101625113 | 3300006880 | Bacteria | 562 |
| 546 | Ga0068865_100002923 | 3300006881 | Bacteria | 10190 |
| 547 | Ga0068865_100005706 | 3300006881 | Bacteria | 7564 |
| 548 | Ga0068865_100035796 | 3300006881 | Bacteria | 3342 |
| 549 | Ga0068865_100224391 | 3300006881 | Bacteria | 1470 |
| 550 | Ga0068865_100473200 | 3300006881 | Bacteria | 1040 |
| 551 | Ga0075436_100000154 | 3300006914 | Bacteria | 42705 |
| 552 | Ga0075436_100137482 | 3300006914 | Bacteria | 1716 |
| 553 | Ga0075436_100194953 | 3300006914 | Bacteria | 1434 |
| 554 | Ga0075436_100482059 | 3300006914 | Bacteria | 906 |
| 555 | Ga0097620_100002395 | 3300006931 | Bacteria | 19092 |
| 556 | Ga0097620_100072465 | 3300006931 | Bacteria | 3481 |
| 557 | Ga0097620_100094848 | 3300006931 | Bacteria | 3036 |
| 558 | Ga0097620_100124645 | 3300006931 | Bacteria | 2644 |
| 559 | Ga0097620_100554409 | 3300006931 | Bacteria | 1244 |
| 560 | Ga0097620_100617827 | 3300006931 | Bacteria | 1176 |
| 561 | Ga0097620_101096581 | 3300006931 | Bacteria | 876 |
| 562 | Ga0099826_10007363 | 3300006948 | Bacteria | 8121 |
| 563 | Ga0075435_100067160 | 3300007076 | Bacteria | 2919 |
| 564 | Ga0075435_100069794 | 3300007076 | Bacteria | 2866 |
| 565 | Ga0075435_100545496 | 3300007076 | Bacteria | 1004 |
| 566 | Ga0075435_101245873 | 3300007076 | Bacteria | 651 |
| 567 | Ga0075435_101287641 | 3300007076 | Bacteria | 640 |
| 568 | Ga0099795_10210522 | 3300007788 | Bacteria | 824 |
| 569 | Ga0105251_10132490 | 3300009011 | Bacteria | 1129 |
| 570 | Ga0105244_10047531 | 3300009036 | Bacteria | 2200 |
| 571 | Ga0105250_10069439 | 3300009092 | Bacteria | 1423 |
| 572 | Ga0105240_10000091 | 3300009093 | Bacteria | 182507 |
| 573 | Ga0105240_10170039 | 3300009093 | Bacteria | 2582 |
| 574 | Ga0105240_10173356 | 3300009093 | Bacteria | 2552 |
| 575 | Ga0105240_10320690 | 3300009093 | Bacteria | 1766 |
| 576 | Ga0105240_10481483 | 3300009093 | Bacteria | 1383 |
| 577 | Ga0105240_10579113 | 3300009093 | Bacteria | 1238 |
| 578 | Ga0105240_10748525 | 3300009093 | Bacteria | 1063 |
| 579 | Ga0105240_10788767 | 3300009093 | Bacteria | 1030 |
| 580 | Ga0105240_11013378 | 3300009093 | Bacteria | 887 |
| 581 | Ga0105240_11287149 | 3300009093 | Bacteria | 771 |
| 582 | Ga0111539_10025567 | 3300009094 | Bacteria | 7237 |
| 583 | Ga0111539_10055658 | 3300009094 | Bacteria | 4703 |
| 584 | Ga0111539_10190643 | 3300009094 | Bacteria | 2392 |
| 585 | Ga0111539_10658795 | 3300009094 | Bacteria | 1219 |
| 586 | Ga0105245_10004161 | 3300009098 | Bacteria | 12852 |
| 587 | Ga0105245_10194373 | 3300009098 | Bacteria | 1945 |
| 588 | Ga0105245_10202644 | 3300009098 | Bacteria | 1906 |
| 589 | Ga0105245_10402780 | 3300009098 | Bacteria | 1368 |
| 590 | Ga0105245_11039365 | 3300009098 | Bacteria | 864 |
| 591 | Ga0105245_12557584 | 3300009098 | Bacteria | 564 |
| 592 | Ga0105247_10005197 | 3300009101 | Bacteria | 8229 |
| 593 | Ga0105247_10040176 | 3300009101 | Bacteria | 2859 |
| 594 | Ga0105247_10049429 | 3300009101 | Bacteria | 2586 |
| 595 | Ga0105247_10107846 | 3300009101 | Bacteria | 1788 |
| 596 | Ga0105247_10311757 | 3300009101 | Bacteria | 1095 |
| 597 | Ga0105247_10636072 | 3300009101 | Bacteria | 795 |
| 598 | Ga0105247_10647205 | 3300009101 | Bacteria | 789 |
| 599 | Ga0114129_10109918 | 3300009147 | Bacteria | 3805 |
| 600 | Ga0114129_10135209 | 3300009147 | Bacteria | 3383 |
| 601 | Ga0114129_10237149 | 3300009147 | Bacteria | 2454 |
| 602 | Ga0114129_11501824 | 3300009147 | Bacteria | 828 |
| 603 | Ga0114129_11503238 | 3300009147 | Bacteria | 827 |
| 604 | Ga0114129_11561835 | 3300009147 | Bacteria | 809 |
| 605 | Ga0114129_12891134 | 3300009147 | Bacteria | 568 |
| 606 | Ga0105243_10010549 | 3300009148 | Bacteria | 7016 |
| 607 | Ga0105243_10015650 | 3300009148 | Bacteria | 5734 |
| 608 | Ga0105243_10135945 | 3300009148 | Bacteria | 2091 |
| 609 | Ga0105243_10170071 | 3300009148 | Bacteria | 1886 |
| 610 | Ga0105243_10304173 | 3300009148 | Bacteria | 1446 |
| 611 | Ga0105243_10351342 | 3300009148 | Bacteria | 1354 |
| 612 | Ga0105243_10531602 | 3300009148 | Bacteria | 1120 |
| 613 | Ga0105243_10947932 | 3300009148 | Bacteria | 859 |
| 614 | Ga0105243_12256637 | 3300009148 | Bacteria | 581 |
| 615 | Ga0105241_10002326 | 3300009174 | Bacteria | 14273 |
| 616 | Ga0105241_10011311 | 3300009174 | Bacteria | 6543 |
| 617 | Ga0105241_10168721 | 3300009174 | Bacteria | 1806 |
| 618 | Ga0105241_10261128 | 3300009174 | Bacteria | 1472 |
| 619 | Ga0105241_10336954 | 3300009174 | Bacteria | 1306 |
| 620 | Ga0105241_10415320 | 3300009174 | Bacteria | 1183 |
| 621 | Ga0105242_10000036 | 3300009176 | Bacteria | 91470 |
| 622 | Ga0105242_10014436 | 3300009176 | Bacteria | 6120 |
| 623 | Ga0105242_10050007 | 3300009176 | Bacteria | 3402 |
| 624 | Ga0105242_10121938 | 3300009176 | Bacteria | 2238 |
| 625 | Ga0105242_10197178 | 3300009176 | Bacteria | 1786 |
| 626 | Ga0105242_10556096 | 3300009176 | Bacteria | 1101 |
| 627 | Ga0105242_11162946 | 3300009176 | Bacteria | 789 |
| 628 | Ga0105242_11344786 | 3300009176 | Bacteria | 740 |
| 629 | Ga0105248_10012352 | 3300009177 | Bacteria | 9424 |
| 630 | Ga0105248_10065276 | 3300009177 | Bacteria | 4087 |
| 631 | Ga0105248_10067514 | 3300009177 | Bacteria | 4015 |
| 632 | Ga0105248_10398023 | 3300009177 | Bacteria | 1551 |
| 633 | Ga0105248_11070150 | 3300009177 | Bacteria | 911 |
| 634 | Ga0105237_10022578 | 3300009545 | Bacteria | 6454 |
| 635 | Ga0105237_10244885 | 3300009545 | Bacteria | 1794 |
| 636 | Ga0105237_10329906 | 3300009545 | Bacteria | 1530 |
| 637 | Ga0105237_10390996 | 3300009545 | Bacteria | 1395 |
| 638 | Ga0105237_10414189 | 3300009545 | Bacteria | 1353 |
| 639 | Ga0105237_10521250 | 3300009545 | Bacteria | 1195 |
| 640 | Ga0105237_10579072 | 3300009545 | Bacteria | 1129 |
| 641 | Ga0105237_10610602 | 3300009545 | Bacteria | 1098 |
| 642 | Ga0105237_10636774 | 3300009545 | Bacteria | 1073 |
| 643 | Ga0105237_11116579 | 3300009545 | Bacteria | 795 |
| 644 | Ga0105238_10013730 | 3300009551 | Bacteria | 8184 |
| 645 | Ga0105238_10052375 | 3300009551 | Bacteria | 4103 |
| 646 | Ga0105238_10164597 | 3300009551 | Bacteria | 2193 |
| 647 | Ga0105238_10198474 | 3300009551 | Bacteria | 1982 |
| 648 | Ga0105238_10210749 | 3300009551 | Bacteria | 1919 |
| 649 | Ga0105238_10435178 | 3300009551 | Bacteria | 1307 |
| 650 | Ga0105238_10519077 | 3300009551 | Bacteria | 1194 |
| 651 | Ga0105238_10723284 | 3300009551 | Bacteria | 1008 |
| 652 | Ga0105238_10755623 | 3300009551 | Bacteria | 986 |
| 653 | Ga0105238_10845925 | 3300009551 | Bacteria | 932 |
| 654 | Ga0105238_10916218 | 3300009551 | Bacteria | 895 |
| 655 | Ga0105238_10971212 | 3300009551 | Bacteria | 870 |
| 656 | Ga0105238_11322479 | 3300009551 | Bacteria | 747 |
| 657 | Ga0105238_11822837 | 3300009551 | Bacteria | 641 |
| 658 | Ga0105249_10012949 | 3300009553 | Bacteria | 7360 |
| 659 | Ga0105249_10071587 | 3300009553 | Bacteria | 3203 |
| 660 | Ga0105249_10132524 | 3300009553 | Bacteria | 2381 |
| 661 | Ga0105249_10409755 | 3300009553 | Bacteria | 1387 |
| 662 | Ga0105249_11318830 | 3300009553 | Bacteria | 793 |
| 663 | Ga0099796_10031323 | 3300010159 | Bacteria | 1734 |
| 664 | Ga0099796_10095703 | 3300010159 | Bacteria | 1110 |
| 665 | Ga0105239_10001368 | 3300010375 | Bacteria | 32749 |
| 666 | Ga0105239_10010593 | 3300010375 | Bacteria | 10310 |
| 667 | Ga0105239_10044590 | 3300010375 | Bacteria | 4861 |
| 668 | Ga0105239_10180022 | 3300010375 | Bacteria | 2365 |
| 669 | Ga0105239_10299664 | 3300010375 | Bacteria | 1810 |
| 670 | Ga0105239_10330928 | 3300010375 | Bacteria | 1718 |
| 671 | Ga0105239_10365864 | 3300010375 | Bacteria | 1629 |
| 672 | Ga0105239_10369618 | 3300010375 | Bacteria | 1620 |
| 673 | Ga0105239_10504509 | 3300010375 | Bacteria | 1376 |
| 674 | Ga0105239_10932036 | 3300010375 | Bacteria | 997 |
| 675 | Ga0105239_10977177 | 3300010375 | Bacteria | 973 |
| 676 | Ga0105239_11490681 | 3300010375 | Bacteria | 782 |
| 677 | Ga0105246_10000666 | 3300011119 | Bacteria | 19263 |
| 678 | Ga0105246_10027737 | 3300011119 | Bacteria | 3714 |
| 679 | Ga0105246_10052929 | 3300011119 | Bacteria | 2792 |
| 680 | Ga0105246_10199853 | 3300011119 | Bacteria | 1553 |
| 681 | Ga0105246_10377047 | 3300011119 | Bacteria | 1171 |
| 682 | Ga0105246_10672648 | 3300011119 | Bacteria | 904 |
| 683 | Ga0105246_11398775 | 3300011119 | Bacteria | 653 |
| 684 | Ga0105246_12119292 | 3300011119 | Bacteria | 545 |
| 685 | Ga0157321_1002565 | 3300012487 | Bacteria | 1021 |
| 686 | Ga0157329_1010456 | 3300012491 | Bacteria | 728 |
| 687 | Ga0157341_1005141 | 3300012494 | Bacteria | 972 |
| 688 | Ga0157345_1004704 | 3300012498 | Bacteria | 1032 |
| 689 | Ga0157314_1002125 | 3300012500 | Bacteria | 1371 |
| 690 | Ga0157347_1003490 | 3300012502 | Bacteria | 1413 |
| 691 | Ga0157313_1004446 | 3300012503 | Bacteria | 964 |
| 692 | Ga0157315_1000717 | 3300012508 | Bacteria | 1616 |
| 693 | Ga0157373_10058615 | 3300013100 | Bacteria | 2730 |
| 694 | Ga0157373_10179986 | 3300013100 | Bacteria | 1488 |
| 695 | Ga0157373_10200916 | 3300013100 | Bacteria | 1405 |
| 696 | Ga0157373_10220314 | 3300013100 | Bacteria | 1339 |
| 697 | Ga0157371_10005746 | 3300013102 | Bacteria | 10391 |
| 698 | Ga0157371_10581906 | 3300013102 | Bacteria | 832 |
| 699 | Ga0157370_10044538 | 3300013104 | Bacteria | 4263 |
| 700 | Ga0157370_10250286 | 3300013104 | Bacteria | 1639 |
| 701 | Ga0157370_10329113 | 3300013104 | Bacteria | 1409 |
| 702 | Ga0157369_10003501 | 3300013105 | Bacteria | 18649 |
| 703 | Ga0157369_10141190 | 3300013105 | Bacteria | 2549 |
| 704 | Ga0157369_10443076 | 3300013105 | Bacteria | 1345 |
| 705 | Ga0157369_10451625 | 3300013105 | Bacteria | 1331 |
| 706 | Ga0157369_10756014 | 3300013105 | Bacteria | 1000 |
| 707 | Ga0157369_10982849 | 3300013105 | Bacteria | 864 |
| 708 | Ga0157369_11055180 | 3300013105 | Bacteria | 831 |
| 709 | Ga0157369_11128870 | 3300013105 | Bacteria | 801 |
| 710 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 711 | Ga0157374_10005236 | 3300013296 | Bacteria | 10879 |
| 712 | Ga0157374_10176078 | 3300013296 | Bacteria | 2088 |
| 713 | Ga0157374_10293868 | 3300013296 | Bacteria | 1606 |
| 714 | Ga0157374_10339671 | 3300013296 | Bacteria | 1491 |
| 715 | Ga0157374_10891600 | 3300013296 | Bacteria | 907 |
| 716 | Ga0157374_11448412 | 3300013296 | Bacteria | 710 |
| 717 | Ga0157378_10000462 | 3300013297 | Bacteria | 38648 |
| 718 | Ga0157378_10025132 | 3300013297 | Bacteria | 5248 |
| 719 | Ga0157378_10050491 | 3300013297 | Bacteria | 3701 |
| 720 | Ga0157378_10342232 | 3300013297 | Bacteria | 1459 |
| 721 | Ga0157378_10636662 | 3300013297 | Bacteria | 1081 |
| 722 | Ga0157378_10861997 | 3300013297 | Bacteria | 934 |
| 723 | Ga0163162_10010706 | 3300013306 | Bacteria | 8921 |
| 724 | Ga0163162_10062995 | 3300013306 | Bacteria | 3750 |
| 725 | Ga0163162_10097014 | 3300013306 | Bacteria | 3036 |
| 726 | Ga0163162_10370999 | 3300013306 | Bacteria | 1564 |
| 727 | Ga0163162_10475748 | 3300013306 | Bacteria | 1380 |
| 728 | Ga0163162_10640948 | 3300013306 | Bacteria | 1187 |
| 729 | Ga0163162_10801590 | 3300013306 | Bacteria | 1059 |
| 730 | Ga0157372_10444747 | 3300013307 | Bacteria | 1511 |
| 731 | Ga0157372_11197676 | 3300013307 | Bacteria | 878 |
| 732 | Ga0157372_11591447 | 3300013307 | Bacteria | 752 |
| 733 | Ga0157375_10003826 | 3300013308 | Bacteria | 13052 |
| 734 | Ga0157375_10014386 | 3300013308 | Bacteria | 7057 |
| 735 | Ga0157375_10029710 | 3300013308 | Bacteria | 5144 |
| 736 | Ga0157375_10046446 | 3300013308 | Bacteria | 4234 |
| 737 | Ga0157375_10095419 | 3300013308 | Bacteria | 3045 |
| 738 | Ga0157375_10834559 | 3300013308 | Bacteria | 1069 |
| 739 | Ga0163163_10000002 | 3300014325 | Bacteria | 609846 |
| 740 | Ga0163163_10006875 | 3300014325 | Bacteria | 9986 |
| 741 | Ga0163163_10016380 | 3300014325 | Bacteria | 6886 |
| 742 | Ga0163163_10106629 | 3300014325 | Bacteria | 2828 |
| 743 | Ga0163163_10109840 | 3300014325 | Bacteria | 2785 |
| 744 | Ga0157380_10000274 | 3300014326 | Bacteria | 30965 |
| 745 | Ga0157380_10036448 | 3300014326 | Bacteria | 3805 |
| 746 | Ga0157380_12239955 | 3300014326 | Bacteria | 610 |
| 747 | Ga0157377_10007030 | 3300014745 | Bacteria | 5405 |
| 748 | Ga0157377_10008998 | 3300014745 | Bacteria | 4889 |
| 749 | Ga0157377_10220668 | 3300014745 | Bacteria | 1213 |
| 750 | Ga0157377_10247728 | 3300014745 | Bacteria | 1153 |
| 751 | Ga0157377_10712668 | 3300014745 | Bacteria | 730 |
| 752 | Ga0157379_10002580 | 3300014968 | Bacteria | 15213 |
| 753 | Ga0157379_10002641 | 3300014968 | Bacteria | 15074 |
| 754 | Ga0157379_10028886 | 3300014968 | Bacteria | 4932 |
| 755 | Ga0157379_10037035 | 3300014968 | Bacteria | 4349 |
| 756 | Ga0157379_10144901 | 3300014968 | Bacteria | 2142 |
| 757 | Ga0157379_10295511 | 3300014968 | Bacteria | 1476 |
| 758 | Ga0157379_10399245 | 3300014968 | Bacteria | 1264 |
| 759 | Ga0157379_10889691 | 3300014968 | Bacteria | 844 |
| 760 | Ga0157379_11108840 | 3300014968 | Bacteria | 758 |
| 761 | Ga0157376_10001158 | 3300014969 | Bacteria | 17347 |
| 762 | Ga0157376_10023691 | 3300014969 | Bacteria | 4809 |
| 763 | Ga0157376_10480581 | 3300014969 | Bacteria | 1217 |
| 764 | Ga0157376_10502217 | 3300014969 | Bacteria | 1192 |
| 765 | Ga0157376_10619608 | 3300014969 | Bacteria | 1079 |
| 766 | Ga0157376_11482769 | 3300014969 | Bacteria | 711 |
| 767 | Ga0157376_11671690 | 3300014969 | Bacteria | 672 |
| 768 | Ga0157376_12475529 | 3300014969 | Bacteria | 559 |
| 769 | Ga0183363_1082 | 3300015690 | Bacteria | 28896 |
| 770 | Ga0163161_10001021 | 3300017792 | Bacteria | 21333 |
| 771 | Ga0163161_10077117 | 3300017792 | Bacteria | 2447 |
| 772 | Ga0163161_10108639 | 3300017792 | Bacteria | 2071 |
| 773 | Ga0163161_10117035 | 3300017792 | Bacteria | 1998 |
| 774 | Ga0163161_10213653 | 3300017792 | Bacteria | 1491 |
| 775 | Ga0163161_10372707 | 3300017792 | Bacteria | 1139 |
| 776 | Ga0163161_10691513 | 3300017792 | Bacteria | 848 |
| 777 | Ga0206354_10832954 | 3300020081 | Bacteria | 739 |
| 778 | Ga0206353_10469384 | 3300020082 | Bacteria | 708 |
| 779 | Ga0214542_1000006 | 3300021321 | Bacteria | 345164 |
| 780 | Ga0214543_1000014 | 3300021327 | Bacteria | 324986 |
| 781 | Ga0213876_10203602 | 3300021384 | Bacteria | 1052 |
| 782 | Ga0209563_107071 | 3300025230 | Bacteria | 1873 |
| 783 | Ga0209233_1000015 | 3300025261 | Bacteria | 980563 |
| 784 | Ga0209233_1020178 | 3300025261 | Bacteria | 1753 |
| 785 | Ga0207666_1001232 | 3300025271 | Bacteria | 3011 |
| 786 | Ga0207666_1001599 | 3300025271 | Bacteria | 2678 |
| 787 | Ga0207673_1000144 | 3300025290 | Bacteria | 6906 |
| 788 | Ga0209564_1000023 | 3300025295 | Bacteria | 555102 |
| 789 | Ga0209758_1000013 | 3300025297 | Bacteria | 873003 |
| 790 | Ga0209256_1000215 | 3300025299 | Bacteria | 106454 |
| 791 | Ga0207697_10016806 | 3300025315 | Bacteria | 3011 |
| 792 | Ga0207697_10020928 | 3300025315 | Bacteria | 2678 |
| 793 | Ga0207697_10069735 | 3300025315 | Bacteria | 1472 |
| 794 | Ga0207656_10087008 | 3300025321 | Bacteria | 1413 |
| 795 | Ga0207656_10142756 | 3300025321 | Bacteria | 1129 |
| 796 | Ga0207656_10389120 | 3300025321 | Bacteria | 700 |
| 797 | Ga0207655_1043901 | 3300025728 | Bacteria | 1884 |
| 798 | Ga0207653_10014097 | 3300025885 | Bacteria | 2506 |
| 799 | Ga0207682_10000399 | 3300025893 | Bacteria | 19986 |
| 800 | Ga0207692_10013438 | 3300025898 | Bacteria | 3552 |
| 801 | Ga0207692_10060724 | 3300025898 | Bacteria | 1956 |
| 802 | Ga0207642_10000073 | 3300025899 | Bacteria | 27837 |
| 803 | Ga0207642_10014044 | 3300025899 | Bacteria | 2942 |
| 804 | Ga0207642_10232406 | 3300025899 | Bacteria | 1037 |
| 805 | Ga0207642_10437580 | 3300025899 | Bacteria | 790 |
| 806 | Ga0207710_10005066 | 3300025900 | Bacteria | 5706 |
| 807 | Ga0207710_10009984 | 3300025900 | Bacteria | 3993 |
| 808 | Ga0207710_10014743 | 3300025900 | Bacteria | 3300 |
| 809 | Ga0207710_10130165 | 3300025900 | Bacteria | 1208 |
| 810 | Ga0207688_10003955 | 3300025901 | Bacteria | 8083 |
| 811 | Ga0207688_10005485 | 3300025901 | Bacteria | 6897 |
| 812 | Ga0207688_10153228 | 3300025901 | Bacteria | 1362 |
| 813 | Ga0207680_10043923 | 3300025903 | Bacteria | 2624 |
| 814 | Ga0207680_10053309 | 3300025903 | Bacteria | 2428 |
| 815 | Ga0207680_10054255 | 3300025903 | Bacteria | 2410 |
| 816 | Ga0207680_10102398 | 3300025903 | Bacteria | 1842 |
| 817 | Ga0207680_10151730 | 3300025903 | Bacteria | 1545 |
| 818 | Ga0207680_10652022 | 3300025903 | Bacteria | 754 |
| 819 | Ga0207647_10016554 | 3300025904 | Bacteria | 5029 |
| 820 | Ga0207647_10038761 | 3300025904 | Bacteria | 3011 |
| 821 | Ga0207647_10078124 | 3300025904 | Bacteria | 1988 |
| 822 | Ga0207685_10085879 | 3300025905 | Bacteria | 1314 |
| 823 | Ga0207685_10150833 | 3300025905 | Bacteria | 1052 |
| 824 | Ga0207685_10280116 | 3300025905 | Bacteria | 818 |
| 825 | Ga0207699_10132348 | 3300025906 | Bacteria | 1628 |
| 826 | Ga0207699_10155697 | 3300025906 | Bacteria | 1516 |
| 827 | Ga0207699_10418372 | 3300025906 | Bacteria | 957 |
| 828 | Ga0207699_11006821 | 3300025906 | Bacteria | 616 |
| 829 | Ga0207699_11028687 | 3300025906 | Bacteria | 609 |
| 830 | Ga0207645_10000457 | 3300025907 | Bacteria | 33747 |
| 831 | Ga0207645_10029158 | 3300025907 | Bacteria | 3558 |
| 832 | Ga0207645_10036551 | 3300025907 | Bacteria | 3153 |
| 833 | Ga0207645_10098702 | 3300025907 | Bacteria | 1883 |
| 834 | Ga0207645_10654728 | 3300025907 | Bacteria | 714 |
| 835 | Ga0207643_10000571 | 3300025908 | Bacteria | 23315 |
| 836 | Ga0207643_10002630 | 3300025908 | Bacteria | 9724 |
| 837 | Ga0207643_10098989 | 3300025908 | Bacteria | 1708 |
| 838 | Ga0207705_10048589 | 3300025909 | Bacteria | 3052 |
| 839 | Ga0207705_10705432 | 3300025909 | Bacteria | 784 |
| 840 | Ga0207654_10003110 | 3300025911 | Bacteria | 8405 |
| 841 | Ga0207654_10009634 | 3300025911 | Bacteria | 4911 |
| 842 | Ga0207654_10065176 | 3300025911 | Bacteria | 2144 |
| 843 | Ga0207654_10074488 | 3300025911 | Bacteria | 2026 |
| 844 | Ga0207654_10138718 | 3300025911 | Bacteria | 1548 |
| 845 | Ga0207654_10310641 | 3300025911 | Bacteria | 1075 |
| 846 | Ga0207654_10412874 | 3300025911 | Bacteria | 941 |
| 847 | Ga0207707_10015257 | 3300025912 | Bacteria | 6690 |
| 848 | Ga0207707_10086200 | 3300025912 | Bacteria | 2744 |
| 849 | Ga0207707_10274287 | 3300025912 | Bacteria | 1461 |
| 850 | Ga0207707_10440360 | 3300025912 | Bacteria | 1116 |
| 851 | Ga0207707_10486076 | 3300025912 | Bacteria | 1054 |
| 852 | Ga0207695_10000018 | 3300025913 | Bacteria | 766611 |
| 853 | Ga0207695_10008517 | 3300025913 | Bacteria | 12823 |
| 854 | Ga0207695_10048036 | 3300025913 | Bacteria | 4510 |
| 855 | Ga0207695_10089023 | 3300025913 | Bacteria | 3105 |
| 856 | Ga0207695_10197922 | 3300025913 | Bacteria | 1925 |
| 857 | Ga0207695_10313989 | 3300025913 | Bacteria | 1457 |
| 858 | Ga0207695_10431413 | 3300025913 | Bacteria | 1202 |
| 859 | Ga0207695_10481448 | 3300025913 | Bacteria | 1123 |
| 860 | Ga0207671_10024799 | 3300025914 | Bacteria | 4506 |
| 861 | Ga0207671_10048973 | 3300025914 | Bacteria | 3127 |
| 862 | Ga0207671_10135543 | 3300025914 | Bacteria | 1893 |
| 863 | Ga0207671_10206408 | 3300025914 | Bacteria | 1536 |
| 864 | Ga0207671_10730776 | 3300025914 | Bacteria | 787 |
| 865 | Ga0207693_10005098 | 3300025915 | Bacteria | 11009 |
| 866 | Ga0207693_10005593 | 3300025915 | Bacteria | 10447 |
| 867 | Ga0207693_10009660 | 3300025915 | Bacteria | 7855 |
| 868 | Ga0207693_10014290 | 3300025915 | Bacteria | 6388 |
| 869 | Ga0207693_10019432 | 3300025915 | Bacteria | 5403 |
| 870 | Ga0207693_10043855 | 3300025915 | Bacteria | 3516 |
| 871 | Ga0207693_10092320 | 3300025915 | Bacteria | 2373 |
| 872 | Ga0207693_10220803 | 3300025915 | Bacteria | 1489 |
| 873 | Ga0207693_10273873 | 3300025915 | Bacteria | 1323 |
| 874 | Ga0207693_10508504 | 3300025915 | Bacteria | 940 |
| 875 | Ga0207693_10847395 | 3300025915 | Bacteria | 703 |
| 876 | Ga0207693_10879762 | 3300025915 | Bacteria | 688 |
| 877 | Ga0207663_10004209 | 3300025916 | Bacteria | 7133 |
| 878 | Ga0207663_10062301 | 3300025916 | Bacteria | 2370 |
| 879 | Ga0207663_10077839 | 3300025916 | Bacteria | 2160 |
| 880 | Ga0207663_10104850 | 3300025916 | Bacteria | 1907 |
| 881 | Ga0207663_10287762 | 3300025916 | Bacteria | 1223 |
| 882 | Ga0207663_10348782 | 3300025916 | Bacteria | 1120 |
| 883 | Ga0207663_10404805 | 3300025916 | Bacteria | 1044 |
| 884 | Ga0207663_10515822 | 3300025916 | Bacteria | 930 |
| 885 | Ga0207663_10607554 | 3300025916 | Bacteria | 860 |
| 886 | Ga0207663_11145540 | 3300025916 | Bacteria | 626 |
| 887 | Ga0207663_11240168 | 3300025916 | Bacteria | 600 |
| 888 | Ga0207660_10055466 | 3300025917 | Bacteria | 2832 |
| 889 | Ga0207660_10191967 | 3300025917 | Bacteria | 1591 |
| 890 | Ga0207660_10270394 | 3300025917 | Bacteria | 1346 |
| 891 | Ga0207660_10291351 | 3300025917 | Bacteria | 1298 |
| 892 | Ga0207660_10369830 | 3300025917 | Bacteria | 1151 |
| 893 | Ga0207660_10492157 | 3300025917 | Bacteria | 994 |
| 894 | Ga0207660_10504012 | 3300025917 | Bacteria | 982 |
| 895 | Ga0207662_10014634 | 3300025918 | Bacteria | 4405 |
| 896 | Ga0207662_10042209 | 3300025918 | Bacteria | 2688 |
| 897 | Ga0207662_10148603 | 3300025918 | Bacteria | 1489 |
| 898 | Ga0207662_10203785 | 3300025918 | Bacteria | 1282 |
| 899 | Ga0207657_10011285 | 3300025919 | Bacteria | 8873 |
| 900 | Ga0207657_10048362 | 3300025919 | Bacteria | 3714 |
| 901 | Ga0207657_10075993 | 3300025919 | Bacteria | 2834 |
| 902 | Ga0207657_10545993 | 3300025919 | Bacteria | 906 |
| 903 | Ga0207657_10679486 | 3300025919 | Bacteria | 800 |
| 904 | Ga0207657_10940354 | 3300025919 | Bacteria | 665 |
| 905 | Ga0207657_11031480 | 3300025919 | Bacteria | 630 |
| 906 | Ga0207657_11182985 | 3300025919 | Bacteria | 582 |
| 907 | Ga0207649_10000382 | 3300025920 | Bacteria | 33119 |
| 908 | Ga0207649_10000473 | 3300025920 | Bacteria | 28708 |
| 909 | Ga0207649_10042350 | 3300025920 | Bacteria | 2777 |
| 910 | Ga0207649_10092203 | 3300025920 | Bacteria | 1986 |
| 911 | Ga0207649_10445485 | 3300025920 | Bacteria | 976 |
| 912 | Ga0207649_11019040 | 3300025920 | Bacteria | 652 |
| 913 | Ga0207652_10000764 | 3300025921 | Bacteria | 30807 |
| 914 | Ga0207652_10074576 | 3300025921 | Bacteria | 2954 |
| 915 | Ga0207652_10084337 | 3300025921 | Bacteria | 2783 |
| 916 | Ga0207652_10273321 | 3300025921 | Bacteria | 1524 |
| 917 | Ga0207652_10719074 | 3300025921 | Bacteria | 890 |
| 918 | Ga0207652_10810748 | 3300025921 | Bacteria | 831 |
| 919 | Ga0207652_10891499 | 3300025921 | Bacteria | 786 |
| 920 | Ga0207646_10183787 | 3300025922 | Bacteria | 1888 |
| 921 | Ga0207646_10542508 | 3300025922 | Bacteria | 1046 |
| 922 | Ga0207681_10000065 | 3300025923 | Bacteria | 98832 |
| 923 | Ga0207681_10097091 | 3300025923 | Bacteria | 2117 |
| 924 | Ga0207681_10145468 | 3300025923 | Bacteria | 1770 |
| 925 | Ga0207681_10368702 | 3300025923 | Bacteria | 1153 |
| 926 | Ga0207681_11456687 | 3300025923 | Bacteria | 574 |
| 927 | Ga0207694_10000018 | 3300025924 | Bacteria | 331281 |
| 928 | Ga0207694_10050126 | 3300025924 | Bacteria | 3232 |
| 929 | Ga0207694_10071161 | 3300025924 | Bacteria | 2717 |
| 930 | Ga0207694_10152383 | 3300025924 | Bacteria | 1863 |
| 931 | Ga0207694_10249149 | 3300025924 | Bacteria | 1453 |
| 932 | Ga0207694_10315055 | 3300025924 | Bacteria | 1290 |
| 933 | Ga0207694_10527923 | 3300025924 | Bacteria | 989 |
| 934 | Ga0207694_10552850 | 3300025924 | Bacteria | 966 |
| 935 | Ga0207694_10803911 | 3300025924 | Bacteria | 794 |
| 936 | Ga0207694_10828139 | 3300025924 | Bacteria | 782 |
| 937 | Ga0207650_10031294 | 3300025925 | Bacteria | 3841 |
| 938 | Ga0207650_10154835 | 3300025925 | Bacteria | 1812 |
| 939 | Ga0207659_10000142 | 3300025926 | Bacteria | 42302 |
| 940 | Ga0207659_11245042 | 3300025926 | Bacteria | 639 |
| 941 | Ga0207659_11256605 | 3300025926 | Bacteria | 636 |
| 942 | Ga0207687_10000125 | 3300025927 | Bacteria | 51567 |
| 943 | Ga0207687_10031496 | 3300025927 | Bacteria | 3585 |
| 944 | Ga0207687_10060565 | 3300025927 | Bacteria | 2670 |
| 945 | Ga0207687_10093905 | 3300025927 | Bacteria | 2194 |
| 946 | Ga0207687_10187599 | 3300025927 | Bacteria | 1607 |
| 947 | Ga0207700_10000017 | 3300025928 | Bacteria | 195983 |
| 948 | Ga0207700_10000747 | 3300025928 | Bacteria | 18702 |
| 949 | Ga0207700_10073961 | 3300025928 | Bacteria | 2634 |
| 950 | Ga0207700_10079991 | 3300025928 | Bacteria | 2547 |
| 951 | Ga0207700_10298008 | 3300025928 | Bacteria | 1391 |
| 952 | Ga0207700_10305525 | 3300025928 | Bacteria | 1375 |
| 953 | Ga0207700_10411772 | 3300025928 | Bacteria | 1186 |
| 954 | Ga0207664_10067421 | 3300025929 | Bacteria | 2872 |
| 955 | Ga0207664_10068459 | 3300025929 | Bacteria | 2851 |
| 956 | Ga0207664_10255318 | 3300025929 | Bacteria | 1531 |
| 957 | Ga0207664_10391397 | 3300025929 | Bacteria | 1235 |
| 958 | Ga0207664_11266876 | 3300025929 | Bacteria | 656 |
| 959 | Ga0207644_10002374 | 3300025931 | Bacteria | 12154 |
| 960 | Ga0207644_10037849 | 3300025931 | Bacteria | 3395 |
| 961 | Ga0207644_10102001 | 3300025931 | Bacteria | 2157 |
| 962 | Ga0207644_10198856 | 3300025931 | Bacteria | 1580 |
| 963 | Ga0207644_10491362 | 3300025931 | Bacteria | 1012 |
| 964 | Ga0207644_10998833 | 3300025931 | Bacteria | 702 |
| 965 | Ga0207644_11076415 | 3300025931 | Bacteria | 675 |
| 966 | Ga0207690_10000900 | 3300025932 | Bacteria | 18977 |
| 967 | Ga0207690_10036628 | 3300025932 | Bacteria | 3178 |
| 968 | Ga0207690_10410684 | 3300025932 | Bacteria | 1081 |
| 969 | Ga0207690_11265078 | 3300025932 | Bacteria | 616 |
| 970 | Ga0207706_10005077 | 3300025933 | Bacteria | 12296 |
| 971 | Ga0207706_10008604 | 3300025933 | Bacteria | 9403 |
| 972 | Ga0207706_10024616 | 3300025933 | Bacteria | 5396 |
| 973 | Ga0207706_10425950 | 3300025933 | Bacteria | 1149 |
| 974 | Ga0207706_10502538 | 3300025933 | Bacteria | 1046 |
| 975 | Ga0207706_10915503 | 3300025933 | Bacteria | 740 |
| 976 | Ga0207686_10000344 | 3300025934 | Bacteria | 33461 |
| 977 | Ga0207686_10031417 | 3300025934 | Bacteria | 3153 |
| 978 | Ga0207686_10157483 | 3300025934 | Bacteria | 1588 |
| 979 | Ga0207686_10848597 | 3300025934 | Bacteria | 735 |
| 980 | Ga0207709_10001385 | 3300025935 | Bacteria | 16967 |
| 981 | Ga0207709_10080067 | 3300025935 | Bacteria | 2102 |
| 982 | Ga0207709_10233337 | 3300025935 | Bacteria | 1334 |
| 983 | Ga0207709_10308234 | 3300025935 | Bacteria | 1180 |
| 984 | Ga0207709_10311163 | 3300025935 | Bacteria | 1175 |
| 985 | Ga0207670_10000288 | 3300025936 | Bacteria | 30769 |
| 986 | Ga0207670_10683832 | 3300025936 | Bacteria | 848 |
| 987 | Ga0207669_10002658 | 3300025937 | Bacteria | 7649 |
| 988 | Ga0207669_10518945 | 3300025937 | Bacteria | 956 |
| 989 | Ga0207704_10000121 | 3300025938 | Bacteria | 42395 |
| 990 | Ga0207704_10007421 | 3300025938 | Bacteria | 5179 |
| 991 | Ga0207704_10039546 | 3300025938 | Bacteria | 2747 |
| 992 | Ga0207704_10872266 | 3300025938 | Bacteria | 755 |
| 993 | Ga0207704_11075309 | 3300025938 | Bacteria | 683 |
| 994 | Ga0207704_11191832 | 3300025938 | Bacteria | 649 |
| 995 | Ga0207665_10001147 | 3300025939 | Bacteria | 17826 |
| 996 | Ga0207665_10002353 | 3300025939 | Bacteria | 12764 |
| 997 | Ga0207665_10052377 | 3300025939 | Bacteria | 2749 |
| 998 | Ga0207665_10176043 | 3300025939 | Bacteria | 1547 |
| 999 | Ga0207665_10506305 | 3300025939 | Bacteria | 933 |
| 1000 | Ga0207665_10611188 | 3300025939 | Bacteria | 852 |
| 1001 | Ga0207665_11291053 | 3300025939 | Bacteria | 582 |
| 1002 | Ga0207691_10005469 | 3300025940 | Bacteria | 12263 |
| 1003 | Ga0207691_10059048 | 3300025940 | Bacteria | 3489 |
| 1004 | Ga0207691_10258670 | 3300025940 | Bacteria | 1501 |
| 1005 | Ga0207691_10680548 | 3300025940 | Bacteria | 868 |
| 1006 | Ga0207691_10695801 | 3300025940 | Bacteria | 857 |
| 1007 | Ga0207711_10004828 | 3300025941 | Bacteria | 11454 |
| 1008 | Ga0207711_10011260 | 3300025941 | Bacteria | 7433 |
| 1009 | Ga0207711_10097260 | 3300025941 | Bacteria | 2599 |
| 1010 | Ga0207711_10260277 | 3300025941 | Bacteria | 1594 |
| 1011 | Ga0207711_10719565 | 3300025941 | Bacteria | 931 |
| 1012 | Ga0207689_10000696 | 3300025942 | Bacteria | 32214 |
| 1013 | Ga0207689_10028922 | 3300025942 | Bacteria | 4633 |
| 1014 | Ga0207689_10109494 | 3300025942 | Bacteria | 2270 |
| 1015 | Ga0207689_10263483 | 3300025942 | Bacteria | 1426 |
| 1016 | Ga0207689_10614714 | 3300025942 | Bacteria | 915 |
| 1017 | Ga0207689_10811817 | 3300025942 | Bacteria | 790 |
| 1018 | Ga0207689_10873315 | 3300025942 | Bacteria | 759 |
| 1019 | Ga0207661_10290662 | 3300025944 | Bacteria | 1463 |
| 1020 | Ga0207661_10294799 | 3300025944 | Bacteria | 1452 |
| 1021 | Ga0207661_10689357 | 3300025944 | Bacteria | 939 |
| 1022 | Ga0207661_10728358 | 3300025944 | Bacteria | 912 |
| 1023 | Ga0207661_11136803 | 3300025944 | Bacteria | 719 |
| 1024 | Ga0207661_11169900 | 3300025944 | Bacteria | 708 |
| 1025 | Ga0207661_12002364 | 3300025944 | Bacteria | 525 |
| 1026 | Ga0207679_10000064 | 3300025945 | Bacteria | 98118 |
| 1027 | Ga0207679_10153156 | 3300025945 | Bacteria | 1879 |
| 1028 | Ga0207679_10325676 | 3300025945 | Bacteria | 1332 |
| 1029 | Ga0207679_10431484 | 3300025945 | Bacteria | 1165 |
| 1030 | Ga0207679_11509539 | 3300025945 | Bacteria | 616 |
| 1031 | Ga0207667_10000052 | 3300025949 | Bacteria | 232415 |
| 1032 | Ga0207667_10032084 | 3300025949 | Bacteria | 5662 |
| 1033 | Ga0207667_10101281 | 3300025949 | Bacteria | 2971 |
| 1034 | Ga0207667_10638609 | 3300025949 | Bacteria | 1071 |
| 1035 | Ga0207667_10668500 | 3300025949 | Bacteria | 1043 |
| 1036 | Ga0207667_10725487 | 3300025949 | Bacteria | 995 |
| 1037 | Ga0207667_10733516 | 3300025949 | Bacteria | 988 |
| 1038 | Ga0207667_10764371 | 3300025949 | Bacteria | 965 |
| 1039 | Ga0207667_11482663 | 3300025949 | Bacteria | 650 |
| 1040 | Ga0207667_11647654 | 3300025949 | Bacteria | 609 |
| 1041 | Ga0207651_10000338 | 3300025960 | Bacteria | 19898 |
| 1042 | Ga0207651_10035164 | 3300025960 | Bacteria | 3254 |
| 1043 | Ga0207651_10573507 | 3300025960 | Bacteria | 984 |
| 1044 | Ga0207651_11070946 | 3300025960 | Bacteria | 722 |
| 1045 | Ga0207651_11288289 | 3300025960 | Bacteria | 657 |
| 1046 | Ga0207651_11604014 | 3300025960 | Bacteria | 586 |
| 1047 | Ga0207712_10000944 | 3300025961 | Bacteria | 20980 |
| 1048 | Ga0207712_10059836 | 3300025961 | Bacteria | 2698 |
| 1049 | Ga0207712_10300964 | 3300025961 | Bacteria | 1316 |
| 1050 | Ga0207712_10621121 | 3300025961 | Bacteria | 937 |
| 1051 | Ga0207712_10922498 | 3300025961 | Bacteria | 773 |
| 1052 | Ga0207668_10000503 | 3300025972 | Bacteria | 24507 |
| 1053 | Ga0207668_10051908 | 3300025972 | Bacteria | 2835 |
| 1054 | Ga0207668_10069526 | 3300025972 | Bacteria | 2507 |
| 1055 | Ga0207668_10111894 | 3300025972 | Bacteria | 2050 |
| 1056 | Ga0207668_10357542 | 3300025972 | Bacteria | 1223 |
| 1057 | Ga0207668_10766473 | 3300025972 | Bacteria | 852 |
| 1058 | Ga0207640_10000320 | 3300025981 | Bacteria | 32131 |
| 1059 | Ga0207640_10412873 | 3300025981 | Bacteria | 1102 |
| 1060 | Ga0207640_10429227 | 3300025981 | Bacteria | 1084 |
| 1061 | Ga0207640_11006824 | 3300025981 | Bacteria | 733 |
| 1062 | Ga0207658_10033265 | 3300025986 | Bacteria | 3676 |
| 1063 | Ga0207658_10093915 | 3300025986 | Bacteria | 2333 |
| 1064 | Ga0207658_10226324 | 3300025986 | Bacteria | 1576 |
| 1065 | Ga0207658_10334802 | 3300025986 | Bacteria | 1314 |
| 1066 | Ga0207658_10340798 | 3300025986 | Bacteria | 1303 |
| 1067 | Ga0207658_10497179 | 3300025986 | Bacteria | 1086 |
| 1068 | Ga0207658_10519645 | 3300025986 | Bacteria | 1062 |
| 1069 | Ga0207658_10622047 | 3300025986 | Bacteria | 971 |
| 1070 | Ga0207677_10002365 | 3300026023 | Bacteria | 9887 |
| 1071 | Ga0207677_10043233 | 3300026023 | Bacteria | 2994 |
| 1072 | Ga0207677_10059931 | 3300026023 | Bacteria | 2628 |
| 1073 | Ga0207677_10193770 | 3300026023 | Bacteria | 1609 |
| 1074 | Ga0207703_10001400 | 3300026035 | Bacteria | 21963 |
| 1075 | Ga0207703_10116527 | 3300026035 | Bacteria | 2287 |
| 1076 | Ga0207703_10347161 | 3300026035 | Bacteria | 1365 |
| 1077 | Ga0207703_10607109 | 3300026035 | Bacteria | 1035 |
| 1078 | Ga0207703_10682504 | 3300026035 | Bacteria | 976 |
| 1079 | Ga0207703_11831890 | 3300026035 | Bacteria | 583 |
| 1080 | Ga0207639_10016982 | 3300026041 | Bacteria | 5157 |
| 1081 | Ga0207639_10036966 | 3300026041 | Bacteria | 3623 |
| 1082 | Ga0207639_10152705 | 3300026041 | Bacteria | 1936 |
| 1083 | Ga0207639_10289311 | 3300026041 | Bacteria | 1444 |
| 1084 | Ga0207639_10342408 | 3300026041 | Bacteria | 1333 |
| 1085 | Ga0207678_10002811 | 3300026067 | Bacteria | 15790 |
| 1086 | Ga0207678_10007889 | 3300026067 | Bacteria | 9392 |
| 1087 | Ga0207678_10012694 | 3300026067 | Bacteria | 7399 |
| 1088 | Ga0207678_10636038 | 3300026067 | Bacteria | 937 |
| 1089 | Ga0207678_10696169 | 3300026067 | Bacteria | 894 |
| 1090 | Ga0207708_10004148 | 3300026075 | Bacteria | 10659 |
| 1091 | Ga0207708_10055846 | 3300026075 | Bacteria | 3011 |
| 1092 | Ga0207708_10070399 | 3300026075 | Bacteria | 2678 |
| 1093 | Ga0207702_10001217 | 3300026078 | Bacteria | 26109 |
| 1094 | Ga0207702_10224763 | 3300026078 | Bacteria | 1751 |
| 1095 | Ga0207702_10265280 | 3300026078 | Bacteria | 1618 |
| 1096 | Ga0207702_10461937 | 3300026078 | Bacteria | 1233 |
| 1097 | Ga0207702_10550579 | 3300026078 | Bacteria | 1128 |
| 1098 | Ga0207702_10554544 | 3300026078 | Bacteria | 1124 |
| 1099 | Ga0207702_10571020 | 3300026078 | Bacteria | 1108 |
| 1100 | Ga0207702_11083492 | 3300026078 | Bacteria | 795 |
| 1101 | Ga0207641_10006750 | 3300026088 | Bacteria | 9617 |
| 1102 | Ga0207641_10029971 | 3300026088 | Bacteria | 4502 |
| 1103 | Ga0207641_10034969 | 3300026088 | Bacteria | 4182 |
| 1104 | Ga0207641_10339544 | 3300026088 | Bacteria | 1429 |
| 1105 | Ga0207641_10392344 | 3300026088 | Bacteria | 1331 |
| 1106 | Ga0207641_11228628 | 3300026088 | Bacteria | 749 |
| 1107 | Ga0207641_11256465 | 3300026088 | Bacteria | 741 |
| 1108 | Ga0207648_10013636 | 3300026089 | Bacteria | 7545 |
| 1109 | Ga0207648_10023005 | 3300026089 | Bacteria | 5588 |
| 1110 | Ga0207648_10032835 | 3300026089 | Bacteria | 4580 |
| 1111 | Ga0207648_10080154 | 3300026089 | Bacteria | 2848 |
| 1112 | Ga0207648_10510992 | 3300026089 | Bacteria | 1100 |
| 1113 | Ga0207676_10000079 | 3300026095 | Bacteria | 94811 |
| 1114 | Ga0207676_10012315 | 3300026095 | Bacteria | 6124 |
| 1115 | Ga0207676_10147763 | 3300026095 | Bacteria | 2020 |
| 1116 | Ga0207676_10373573 | 3300026095 | Bacteria | 1325 |
| 1117 | Ga0207676_10658726 | 3300026095 | Bacteria | 1011 |
| 1118 | Ga0207676_11633136 | 3300026095 | Bacteria | 642 |
| 1119 | Ga0207674_10032977 | 3300026116 | Bacteria | 5427 |
| 1120 | Ga0207674_10058304 | 3300026116 | Bacteria | 3912 |
| 1121 | Ga0207674_10109763 | 3300026116 | Bacteria | 2734 |
| 1122 | Ga0207674_10154052 | 3300026116 | Bacteria | 2254 |
| 1123 | Ga0207674_10579849 | 3300026116 | Bacteria | 1083 |
| 1124 | Ga0207674_10607276 | 3300026116 | Bacteria | 1057 |
| 1125 | Ga0207674_11227253 | 3300026116 | Bacteria | 719 |
| 1126 | Ga0207675_100003030 | 3300026118 | Bacteria | 16479 |
| 1127 | Ga0207675_100009836 | 3300026118 | Bacteria | 8947 |
| 1128 | Ga0207675_100038364 | 3300026118 | Bacteria | 4470 |
| 1129 | Ga0207675_100371496 | 3300026118 | Bacteria | 1405 |
| 1130 | Ga0207675_100662765 | 3300026118 | Bacteria | 1050 |
| 1131 | Ga0207675_101514243 | 3300026118 | Bacteria | 691 |
| 1132 | Ga0207683_10000037 | 3300026121 | Bacteria | 100920 |
| 1133 | Ga0207683_10011813 | 3300026121 | Bacteria | 7450 |
| 1134 | Ga0207683_10019746 | 3300026121 | Bacteria | 5757 |
| 1135 | Ga0207683_10153884 | 3300026121 | Bacteria | 2076 |
| 1136 | Ga0207683_10178740 | 3300026121 | Bacteria | 1924 |
| 1137 | Ga0207698_10002906 | 3300026142 | Bacteria | 10245 |
| 1138 | Ga0207698_10213954 | 3300026142 | Bacteria | 1736 |
| 1139 | Ga0207698_10547741 | 3300026142 | Bacteria | 1133 |
| 1140 | Ga0207698_10736152 | 3300026142 | Bacteria | 984 |
| 1141 | Ga0207698_12179949 | 3300026142 | Bacteria | 567 |
| 1142 | Ga0209973_1049671 | 3300027252 | Bacteria | 630 |
| 1143 | Ga0210002_1008968 | 3300027617 | Bacteria | 1526 |
| 1144 | Ga0209983_1012323 | 3300027665 | Bacteria | 1755 |
| 1145 | Ga0209282_1006157 | 3300027666 | Bacteria | 7430 |
| 1146 | Ga0209282_1039336 | 3300027666 | Bacteria | 2822 |
| 1147 | Ga0209971_1007881 | 3300027682 | Bacteria | 2526 |
| 1148 | Ga0209966_1001939 | 3300027695 | Bacteria | 3470 |
| 1149 | Ga0209966_1081754 | 3300027695 | Bacteria | 717 |
| 1150 | Ga0209998_10004140 | 3300027717 | Bacteria | 3095 |
| 1151 | Ga0209998_10008721 | 3300027717 | Bacteria | 2101 |
| 1152 | Ga0209998_10010527 | 3300027717 | Bacteria | 1915 |
| 1153 | Ga0209813_10010127 | 3300027866 | Bacteria | 2430 |
| 1154 | Ga0209813_10104459 | 3300027866 | Bacteria | 968 |
| 1155 | Ga0209813_10174229 | 3300027866 | Bacteria | 783 |
| 1156 | Ga0209974_10013409 | 3300027876 | Bacteria | 2729 |
| 1157 | Ga0209974_10115603 | 3300027876 | Bacteria | 947 |
| 1158 | Ga0209974_10278017 | 3300027876 | Bacteria | 636 |
| 1159 | Ga0207428_10000064 | 3300027907 | Bacteria | 151185 |
| 1160 | Ga0207428_10014192 | 3300027907 | Bacteria | 6934 |
| 1161 | Ga0207428_10024254 | 3300027907 | Bacteria | 5095 |
| 1162 | Ga0207428_10598387 | 3300027907 | Bacteria | 795 |
| 1163 | Ga0268266_10001539 | 3300028379 | Bacteria | 26986 |
| 1164 | Ga0268266_10006859 | 3300028379 | Bacteria | 10367 |
| 1165 | Ga0268266_10017082 | 3300028379 | Bacteria | 6196 |
| 1166 | Ga0268266_10028988 | 3300028379 | Bacteria | 4704 |
| 1167 | Ga0268266_10039850 | 3300028379 | Bacteria | 4002 |
| 1168 | Ga0268266_10068757 | 3300028379 | Bacteria | 3067 |
| 1169 | Ga0268266_10071989 | 3300028379 | Bacteria | 2996 |
| 1170 | Ga0268266_10122755 | 3300028379 | Bacteria | 2313 |
| 1171 | Ga0268266_10243948 | 3300028379 | Bacteria | 1659 |
| 1172 | Ga0268266_10691767 | 3300028379 | Bacteria | 982 |
| 1173 | Ga0268266_10703261 | 3300028379 | Bacteria | 974 |
| 1174 | Ga0268266_11773268 | 3300028379 | Bacteria | 592 |
| 1175 | Ga0268265_10019014 | 3300028380 | Bacteria | 4769 |
| 1176 | Ga0268265_10103099 | 3300028380 | Bacteria | 2309 |
| 1177 | Ga0268265_10111508 | 3300028380 | Bacteria | 2234 |
| 1178 | Ga0268265_10247208 | 3300028380 | Bacteria | 1578 |
| 1179 | Ga0268265_10324600 | 3300028380 | Bacteria | 1396 |
| 1180 | Ga0268264_10000022 | 3300028381 | Bacteria | 476624 |
| 1181 | Ga0268264_10000805 | 3300028381 | Bacteria | 33825 |
| 1182 | Ga0268264_10017880 | 3300028381 | Bacteria | 5801 |
| 1183 | Ga0268264_10155682 | 3300028381 | Bacteria | 2053 |
| 1184 | Ga0268264_10651541 | 3300028381 | Bacteria | 1042 |
| 1185 | Ga0268264_11727751 | 3300028381 | Bacteria | 636 |
| 1186 | Ga0265334_10027907 | 3300028573 | Bacteria | 2271 |
| 1187 | Ga0265318_10046767 | 3300028577 | Bacteria | 1633 |
| 1188 | Ga0307517_10198111 | 3300028786 | Bacteria | 1261 |
| 1189 | Ga0265338_10000100 | 3300028800 | Bacteria | 159619 |
| 1190 | Ga0265338_10005075 | 3300028800 | Bacteria | 17376 |
| 1191 | Ga0265338_10391674 | 3300028800 | Bacteria | 992 |
| 1192 | Ga0265338_11035473 | 3300028800 | Bacteria | 555 |
| 1193 | Ga0307511_10235350 | 3300030521 | Bacteria | 900 |
| 1194 | Ga0316181_1235153 | 3300030744 | Bacteria | 2507 |
| 1195 | Ga0265762_1045705 | 3300030760 | Bacteria | 867 |
| 1196 | Ga0265760_10040801 | 3300031090 | Bacteria | 1383 |
| 1197 | Ga0265760_10086139 | 3300031090 | Bacteria | 978 |
| 1198 | Ga0265330_10025049 | 3300031235 | Bacteria | 2706 |
| 1199 | Ga0265330_10131468 | 3300031235 | Bacteria | 1065 |
| 1200 | Ga0265332_10019940 | 3300031238 | Bacteria | 2961 |
| 1201 | Ga0265328_10000006 | 3300031239 | Bacteria | 227698 |
| 1202 | Ga0265328_10199454 | 3300031239 | Bacteria | 759 |
| 1203 | Ga0265320_10030229 | 3300031240 | Bacteria | 2795 |
| 1204 | Ga0265320_10231140 | 3300031240 | Bacteria | 822 |
| 1205 | Ga0265325_10000014 | 3300031241 | Bacteria | 131579 |
| 1206 | Ga0265325_10001421 | 3300031241 | Bacteria | 16859 |
| 1207 | Ga0265325_10002235 | 3300031241 | Bacteria | 13138 |
| 1208 | Ga0265325_10068420 | 3300031241 | Bacteria | 1787 |
| 1209 | Ga0265325_10121365 | 3300031241 | Bacteria | 1259 |
| 1210 | Ga0265325_10175390 | 3300031241 | Bacteria | 1001 |
| 1211 | Ga0265325_10227582 | 3300031241 | Bacteria | 851 |
| 1212 | Ga0265325_10244737 | 3300031241 | Bacteria | 814 |
| 1213 | Ga0265329_10024737 | 3300031242 | Bacteria | 1991 |
| 1214 | Ga0265329_10122316 | 3300031242 | Bacteria | 835 |
| 1215 | Ga0265340_10001571 | 3300031247 | Bacteria | 13097 |
| 1216 | Ga0265340_10068201 | 3300031247 | Bacteria | 1689 |
| 1217 | Ga0265340_10069214 | 3300031247 | Bacteria | 1675 |
| 1218 | Ga0265340_10096216 | 3300031247 | Bacteria | 1379 |
| 1219 | Ga0265340_10104206 | 3300031247 | Bacteria | 1316 |
| 1220 | Ga0265340_10108961 | 3300031247 | Bacteria | 1281 |
| 1221 | Ga0265340_10119645 | 3300031247 | Bacteria | 1212 |
| 1222 | Ga0265339_10003369 | 3300031249 | Bacteria | 11184 |
| 1223 | Ga0265339_10023668 | 3300031249 | Bacteria | 3549 |
| 1224 | Ga0265339_10033703 | 3300031249 | Bacteria | 2881 |
| 1225 | Ga0265339_10147201 | 3300031249 | Bacteria | 1194 |
| 1226 | Ga0265339_10363500 | 3300031249 | Bacteria | 680 |
| 1227 | Ga0265339_10443082 | 3300031249 | Bacteria | 603 |
| 1228 | Ga0265331_10000113 | 3300031250 | Bacteria | 105472 |
| 1229 | Ga0265331_10002319 | 3300031250 | Bacteria | 12973 |
| 1230 | Ga0265331_10008036 | 3300031250 | Bacteria | 6032 |
| 1231 | Ga0265331_10034635 | 3300031250 | Bacteria | 2489 |
| 1232 | Ga0265331_10041860 | 3300031250 | Bacteria | 2224 |
| 1233 | Ga0265331_10078310 | 3300031250 | Bacteria | 1539 |
| 1234 | Ga0265331_10131853 | 3300031250 | Bacteria | 1140 |
| 1235 | Ga0265327_10000124 | 3300031251 | Bacteria | 169233 |
| 1236 | Ga0265327_10020547 | 3300031251 | Bacteria | 4018 |
| 1237 | Ga0265327_10244006 | 3300031251 | Bacteria | 802 |
| 1238 | Ga0265316_10000333 | 3300031344 | Bacteria | 52789 |
| 1239 | Ga0265316_10061583 | 3300031344 | Bacteria | 2914 |
| 1240 | Ga0265316_10111693 | 3300031344 | Bacteria | 2069 |
| 1241 | Ga0265316_10141249 | 3300031344 | Bacteria | 1808 |
| 1242 | Ga0307509_10144098 | 3300031507 | Bacteria | 2311 |
| 1243 | Ga0307509_10224553 | 3300031507 | Bacteria | 1687 |
| 1244 | Ga0307408_101200854 | 3300031548 | Bacteria | 707 |
| 1245 | Ga0265313_10001667 | 3300031595 | Bacteria | 20546 |
| 1246 | Ga0265313_10008310 | 3300031595 | Bacteria | 6919 |
| 1247 | Ga0265313_10020687 | 3300031595 | Bacteria | 3622 |
| 1248 | Ga0265313_10123304 | 3300031595 | Bacteria | 1128 |
| 1249 | Ga0265313_10131512 | 3300031595 | Bacteria | 1084 |
| 1250 | Ga0307508_10259527 | 3300031616 | Bacteria | 1332 |
| 1251 | Ga0316575_10060235 | 3300031665 | Bacteria | 1516 |
| 1252 | Ga0265314_10025240 | 3300031711 | Bacteria | 4489 |
| 1253 | Ga0265314_10025603 | 3300031711 | Bacteria | 4447 |
| 1254 | Ga0265314_10028930 | 3300031711 | Bacteria | 4124 |
| 1255 | Ga0265314_10138567 | 3300031711 | Bacteria | 1507 |
| 1256 | Ga0265314_10170464 | 3300031711 | Bacteria | 1314 |
| 1257 | Ga0265342_10018213 | 3300031712 | Bacteria | 4555 |
| 1258 | Ga0265342_10257285 | 3300031712 | Bacteria | 930 |
| 1259 | Ga0265342_10276896 | 3300031712 | Bacteria | 889 |
| 1260 | Ga0265342_10286059 | 3300031712 | Bacteria | 872 |
| 1261 | Ga0265342_10515928 | 3300031712 | Bacteria | 609 |
| 1262 | Ga0307516_10021961 | 3300031730 | Bacteria | 6557 |
| 1263 | Ga0307516_10325126 | 3300031730 | Bacteria | 1208 |
| 1264 | Ga0307516_10458714 | 3300031730 | Bacteria | 930 |
| 1265 | Ga0307406_10627668 | 3300031901 | Bacteria | 889 |
| 1266 | Ga0307412_11269709 | 3300031911 | Bacteria | 662 |
| 1267 | Ga0307409_100222329 | 3300031995 | Bacteria | 1705 |
| 1268 | Ga0307414_10156200 | 3300032004 | Bacteria | 1806 |
| 1269 | Ga0307411_10096960 | 3300032005 | Bacteria | 2074 |
| 1270 | Ga0307415_101203249 | 3300032126 | Bacteria | 714 |
| 1271 | Ga0316583_10000123 | 3300032133 | Bacteria | 17891 |
| 1272 | Ga0307507_10006782 | 3300033179 | Bacteria | 17185 |
| 1273 | Ga0307507_10230487 | 3300033179 | Bacteria | 1229 |
| 1274 | Ga0307510_10151214 | 3300033180 | Bacteria | 1940 |
| 1275 | Ga0373930_0000972 | 3300034816 | Bacteria | 4110 |
| 1276 | Ga0373930_0136284 | 3300034816 | Bacteria | 607 |
| 1277 | Ga0373948_0000169 | 3300034817 | Bacteria | 7326 |
| 1278 | Ga0373948_0007214 | 3300034817 | Bacteria | 1862 |
| 1279 | Ga0373948_0020187 | 3300034817 | Bacteria | 1266 |
| 1280 | Ga0373950_0000253 | 3300034818 | Bacteria | 6788 |
| 1281 | Ga0373950_0001897 | 3300034818 | Bacteria | 2810 |
| 1282 | Ga0373958_0003084 | 3300034819 | Bacteria | 2382 |
| 1283 | Ga0373958_0008410 | 3300034819 | Bacteria | 1670 |
| 1284 | Ga0373958_0180879 | 3300034819 | Bacteria | 543 |
| 1285 | Ga0373959_0004517 | 3300034820 | Bacteria | 2247 |
| 1286 | Ga0373938_0000142 | 3300034957 | Bacteria | 10404 |
| 1287 | Ga0373938_0009131 | 3300034957 | Bacteria | 1788 |
| 1288 | Ga0373926_0004179 | 3300035083 | Bacteria | 4710 |
| 1289 | Ga0373926_0012751 | 3300035083 | Bacteria | 2845 |
| 1290 | Ga0373926_0055880 | 3300035083 | Bacteria | 1431 |
| 1291 | Ga0373928_0000634 | 3300035084 | Bacteria | 6910 |
| 1292 | Ga0373928_0001826 | 3300035084 | Bacteria | 4148 |
| 1293 | Ga0373928_0159033 | 3300035084 | Bacteria | 630 |
| 1294 | Ga0373929_0001528 | 3300035085 | Bacteria | 4395 |
| 1295 | Ga0373929_0017852 | 3300035085 | Bacteria | 1405 |
| 1296 | Ga0373929_0059575 | 3300035085 | Bacteria | 891 |
| 1297 | Ga0373929_0095483 | 3300035085 | Bacteria | 743 |
| 1298 | Ga0373934_0017218 | 3300035086 | Bacteria | 2756 |
| 1299 | Ga0373934_0028536 | 3300035086 | Bacteria | 2176 |
| 1300 | Ga0373940_0002260 | 3300035088 | Bacteria | 3709 |
| 1301 | Ga0373940_0126892 | 3300035088 | Bacteria | 796 |
| 1302 | Ga0373940_0155809 | 3300035088 | Bacteria | 730 |
| 1303 | Ga0373944_0033583 | 3300035089 | Bacteria | 1555 |
| 1304 | Ga0373944_0056645 | 3300035089 | Bacteria | 1248 |
| 1305 | Ga0373944_0062132 | 3300035089 | Bacteria | 1200 |
| 1306 | Ga0373949_0001704 | 3300035090 | Bacteria | 6098 |
| 1307 | Ga0373949_0011869 | 3300035090 | Bacteria | 1923 |
| 1308 | Ga0373951_0004113 | 3300035091 | Bacteria | 3479 |
| 1309 | Ga0373951_0021701 | 3300035091 | Bacteria | 1475 |
| 1310 | Ga0373951_0108142 | 3300035091 | Bacteria | 746 |
| 1311 | Ga0373952_0000469 | 3300035092 | Bacteria | 7042 |
| 1312 | Ga0373952_0010817 | 3300035092 | Bacteria | 1769 |
| 1313 | Ga0373952_0216138 | 3300035092 | Bacteria | 567 |
| 1314 | Ga0373923_0039986 | 3300035111 | Bacteria | 1928 |
| 1315 | Ga0373923_0048739 | 3300035111 | Bacteria | 1769 |
| 1316 | Ga0373923_0275965 | 3300035111 | Bacteria | 791 |
| 1317 | Ga0373932_0001947 | 3300035112 | Bacteria | 5467 |
| 1318 | Ga0373932_0026515 | 3300035112 | Bacteria | 1577 |
| 1319 | Ga0373932_0299378 | 3300035112 | Bacteria | 600 |
| 1320 | Ga0373936_0032209 | 3300035113 | Bacteria | 2072 |
| 1321 | Ga0373936_0045202 | 3300035113 | Bacteria | 1773 |
| 1322 | Ga0373936_0130971 | 3300035113 | Bacteria | 1078 |
| 1323 | Ga0373939_0000711 | 3300035114 | Bacteria | 8243 |
| 1324 | Ga0373939_0001236 | 3300035114 | Bacteria | 6246 |
| 1325 | Ga0373939_0003388 | 3300035114 | Bacteria | 3737 |
| 1326 | Ga0373939_0040228 | 3300035114 | Bacteria | 1403 |
| 1327 | Ga0373941_0000186 | 3300035115 | Bacteria | 11728 |
| 1328 | Ga0373941_0000584 | 3300035115 | Bacteria | 7361 |
| 1329 | Ga0373941_0134427 | 3300035115 | Bacteria | 894 |
| 1330 | Ga0373945_0000073 | 3300035116 | Bacteria | 22978 |
| 1331 | Ga0373945_0016156 | 3300035116 | Bacteria | 2514 |
| 1332 | Ga0373945_0029055 | 3300035116 | Bacteria | 1940 |
| 1333 | Ga0373953_0018005 | 3300035117 | Bacteria | 2606 |
| 1334 | Ga0373953_0190111 | 3300035117 | Bacteria | 887 |
| 1335 | Ga0373954_0016841 | 3300035118 | Bacteria | 3278 |
| 1336 | Ga0373954_0032391 | 3300035118 | Bacteria | 2416 |
| 1337 | Ga0373954_0115093 | 3300035118 | Bacteria | 1303 |
| 1338 | Ga0373954_0367224 | 3300035118 | Bacteria | 711 |
| 1339 | Ga0373956_0006007 | 3300035119 | Bacteria | 4860 |
| 1340 | Ga0373956_0145837 | 3300035119 | Bacteria | 1113 |
| 1341 | Ga0373957_0001780 | 3300035120 | Bacteria | 5942 |
| 1342 | Ga0373957_0074433 | 3300035120 | Bacteria | 1333 |
| 1343 | Ga0373960_0004138 | 3300035121 | Bacteria | 3314 |
| 1344 | Ga0373960_0004588 | 3300035121 | Bacteria | 3169 |
| 1345 | Ga0373960_0136153 | 3300035121 | Bacteria | 828 |
| 1346 | Ga0373960_0177632 | 3300035121 | Bacteria | 742 |
| 1347 | Ga0373943_0004682 | 3300035170 | Bacteria | 6189 |
| 1348 | Ga0373943_0007039 | 3300035170 | Bacteria | 5046 |
| 1349 | Ga0373943_0197375 | 3300035170 | Bacteria | 1112 |
| 1350 | Ga0373943_0590573 | 3300035170 | Bacteria | 653 |
| 1351 | Ga0373946_0000371 | 3300035171 | Bacteria | 14535 |
| 1352 | Ga0373946_0033119 | 3300035171 | Bacteria | 2078 |
| 1353 | Ga0373955_0004122 | 3300035172 | Bacteria | 6414 |
| 1354 | Ga0373955_0008798 | 3300035172 | Bacteria | 4704 |
| 1355 | Ga0373955_0480211 | 3300035172 | Bacteria | 758 |
| 1356 | Ga0373942_0000298 | 3300035207 | Bacteria | 13554 |
| 1357 | Ga0373942_0043844 | 3300035207 | Bacteria | 1230 |
| 1358 | Ga0373961_0002218 | 3300035241 | Bacteria | 5133 |
| 1359 | Ga0373961_0003878 | 3300035241 | Bacteria | 3648 |
| 1360 | Ga0373961_0008934 | 3300035241 | Bacteria | 2444 |
| 1361 | Ga0373961_0105092 | 3300035241 | Bacteria | 919 |
| 1362 | Ga0373962_0000374 | 3300035242 | Bacteria | 9797 |
| 1363 | Ga0373962_0000988 | 3300035242 | Bacteria | 6569 |
| 1364 | Ga0373962_0244872 | 3300035242 | Bacteria | 621 |
| 1365 | Ga0373924_0125940 | 3300035410 | Bacteria | 1113 |
| 1366 | Ga0373924_0203294 | 3300035410 | Bacteria | 874 |
| 1367 | Ga0373924_0412048 | 3300035410 | Bacteria | 604 |
| 1368 | Ga0373931_0000823 | 3300035691 | Bacteria | 13016 |
| 1369 | Ga0373931_0004447 | 3300035691 | Bacteria | 6404 |
| 1370 | Ga0373931_0023006 | 3300035691 | Bacteria | 3142 |
| 1371 | Ga0373931_0279364 | 3300035691 | Bacteria | 1025 |
| 1372 | Ga0373931_0495182 | 3300035691 | Bacteria | 787 |
| 1373 | Ga0373935_0002812 | 3300035692 | Bacteria | 10017 |
| 1374 | Ga0373935_0021250 | 3300035692 | Bacteria | 3973 |
| 1375 | Ga0373935_0040171 | 3300035692 | Bacteria | 2935 |
| 1376 | Ga0373935_0119875 | 3300035692 | Bacteria | 1756 |
| 1377 | Ga0373935_0570055 | 3300035692 | Bacteria | 826 |
| 1378 | Ga0373935_0651173 | 3300035692 | Bacteria | 773 |
| 1379 | Ga0373927_0008749 | 3300035695 | Bacteria | 6800 |
| 1380 | Ga0373927_0024429 | 3300035695 | Bacteria | 3954 |
| 1381 | Ga0373927_0034147 | 3300035695 | Bacteria | 3309 |
| 1382 | Ga0373927_0046748 | 3300035695 | Bacteria | 2799 |
| 1383 | Ga0373927_0157489 | 3300035695 | Bacteria | 1488 |
| 1384 | Ga0373927_0354026 | 3300035695 | Bacteria | 968 |
| 1385 | Ga0373927_0429267 | 3300035695 | Bacteria | 872 |
| 1386 | Ga0373927_0723049 | 3300035695 | Bacteria | 658 |
| 1387 | Ga0373933_0010116 | 3300035724 | Bacteria | 5163 |
| 1388 | Ga0373933_0054991 | 3300035724 | Bacteria | 2386 |
| 1389 | Ga0373933_0275336 | 3300035724 | Bacteria | 1087 |
| 1390 | Ga0373933_0324897 | 3300035724 | Bacteria | 998 |
| 1391 | Ga0373933_0494312 | 3300035724 | Bacteria | 801 |
| 1392 | Ga0373947_0002721 | 3300035725 | Bacteria | 10615 |
| 1393 | Ga0373947_0027881 | 3300035725 | Bacteria | 3307 |
| 1394 | Ga0373947_0046588 | 3300035725 | Bacteria | 2597 |
| 1395 | Ga0373947_0065071 | 3300035725 | Bacteria | 2223 |
| 1396 | Ga0373947_0099201 | 3300035725 | Bacteria | 1828 |
| 1397 | Ga0373947_0178733 | 3300035725 | Bacteria | 1380 |
| 1398 | Ga0373947_0897924 | 3300035725 | Bacteria | 605 |
| 1399 | Ga0373937_0000998 | 3300036401 | Bacteria | 23980 |
| 1400 | Ga0373937_0002122 | 3300036401 | Bacteria | 16578 |
| 1401 | Ga0373937_0138612 | 3300036401 | Bacteria | 2275 |
| 1402 | Ga0373937_0408434 | 3300036401 | Bacteria | 1288 |
| 1403 | Ga0373937_0431780 | 3300036401 | Bacteria | 1250 |
| 1404 | Ga0373937_0806671 | 3300036401 | Bacteria | 887 |
| 1405 | Ga0373925_0001693 | 3300037068 | Bacteria | 18543 |
| 1406 | Ga0373925_0018327 | 3300037068 | Bacteria | 5088 |
| 1407 | Ga0373925_0052406 | 3300037068 | Bacteria | 3048 |
| 1408 | Ga0373925_0092836 | 3300037068 | Bacteria | 2309 |
| 1409 | Ga0373925_0157095 | 3300037068 | Bacteria | 1789 |
| 1410 | Ga0373925_0184517 | 3300037068 | Bacteria | 1653 |
| 1411 | Ga0373925_0457823 | 3300037068 | Bacteria | 1045 |
| 1412 | Ga0373925_0497421 | 3300037068 | Bacteria | 1001 |
| 1413 | Ga0373925_0684594 | 3300037068 | Bacteria | 845 |
| 1414 | Ga0373925_1041493 | 3300037068 | Bacteria | 674 |
| 1415 | Ga0395900_0689921 | 3300037418 | Bacteria | 955 |
| 1416 | Ga0395900_1659714 | 3300037418 | Bacteria | 550 |
| 1417 | Ga0395898_0041641 | 3300037466 | Bacteria | 4536 |
| 1418 | Ga0395898_0186242 | 3300037466 | Bacteria | 1983 |
| 1419 | Ga0395898_0323733 | 3300037466 | Bacteria | 1470 |
| 1420 | Ga0395898_0929445 | 3300037466 | Bacteria | 807 |
| 1421 | Ga0395905_0013091 | 3300037471 | Bacteria | 7964 |
| 1422 | Ga0436364_0825876 | 3300037853 | Bacteria | 806 |
| 1423 | Ga0436364_0871904 | 3300037853 | Bacteria | 2904 |
| 1424 | Ga0395901_0038182 | 3300038443 | Bacteria | 4968 |
| 1425 | Ga0395901_0216910 | 3300038443 | Bacteria | 2001 |
| 1426 | Ga0395901_0335515 | 3300038443 | Bacteria | 1562 |
| 1427 | Ga0395901_0636587 | 3300038443 | Bacteria | 1071 |
| 1428 | Ga0395901_1466114 | 3300038443 | Bacteria | 639 |
| 1429 | Ga0242420_027537 | 3300038996 | Bacteria | 1042 |
| 1430 | Ga0436365_0256272 | 3300039437 | Bacteria | 1330 |
| 1431 | Ga0436365_0306351 | 3300039437 | Bacteria | 2598 |
| 1432 | Ga0436365_0309386 | 3300039437 | Bacteria | 599 |
| 1433 | Ga0436365_0333374 | 3300039437 | Bacteria | 2196 |
| 1434 | Ga0436365_1152734 | 3300039437 | Bacteria | 2798 |
| 1435 | Ga0436360_0027830 | 3300039438 | Bacteria | 1292 |
| 1436 | Ga0436360_0485954 | 3300039438 | Bacteria | 760 |
| 1437 | Ga0436360_0500281 | 3300039438 | Bacteria | 1138 |
| 1438 | Ga0436360_0503632 | 3300039438 | Bacteria | 1009 |
| 1439 | Ga0436360_0853818 | 3300039438 | Bacteria | 1684 |
| 1440 | Ga0436360_1207847 | 3300039438 | Bacteria | 1248 |
| 1441 | Ga0436360_1263043 | 3300039438 | Bacteria | 833 |
| 1442 | Ga0436361_0067895 | 3300039447 | Bacteria | 839 |
| 1443 | Ga0436361_0704126 | 3300039447 | Bacteria | 805 |
| 1444 | Ga0436363_0481699 | 3300039450 | Bacteria | 814 |
| 1445 | Ga0436362_0162245 | 3300039453 | Bacteria | 614 |
| 1446 | Ga0436362_0910219 | 3300039453 | Bacteria | 924 |
| 1447 | Ga0436362_0939360 | 3300039453 | Bacteria | 692 |
| 1448 | Ga0439466_0152580 | 3300041411 | Bacteria | 707 |
| 1449 | Ga0451793_1361258 | 3300041452 | Bacteria | 1922 |
| 1450 | Ga0451797_0545593 | 3300041453 | Bacteria | 1627 |
| 1451 | Ga0451798_0980934 | 3300041458 | Bacteria | 1128 |
| 1452 | Ga0451800_0001266 | 3300041459 | Bacteria | 577 |
| 1453 | Ga0451802_0105263 | 3300041460 | Bacteria | 667 |
| 1454 | Ga0451804_0971913 | 3300041463 | Bacteria | 729 |
| 1455 | Ga0451807_1645706 | 3300041486 | Bacteria | 679 |
| 1456 | Ga0451807_2770020 | 3300041486 | Bacteria | 671 |
| 1457 | Ga0451833_1211953 | 3300041491 | Bacteria | 616 |
| 1458 | Ga0451847_0188795 | 3300041503 | Bacteria | 781 |
| 1459 | Ga0451851_1057867 | 3300041507 | Bacteria | 2330 |
| 1460 | Ga0439449_0191478 | 3300042007 | Bacteria | 765 |
| 1461 | Ga0439450_040119 | 3300042008 | Bacteria | 1084 |
| 1462 | Ga0439455_0193604 | 3300042012 | Bacteria | 587 |
| 1463 | Ga0439463_006824 | 3300042016 | Bacteria | 2820 |
| 1464 | Ga0450923_083758 | 3300042125 | Bacteria | 720 |
| 1465 | Ga0450908_027224 | 3300042184 | Bacteria | 997 |
| 1466 | Ga0439459_0017909 | 3300042438 | Bacteria | 1326 |
| 1467 | Ga0451577_0054974 | 3300042876 | Bacteria | 3554 |
| 1468 | Ga0466969_0407110 | 3300044656 | Bacteria | 618 |
| 1469 | Ga0466972_0082820 | 3300044658 | Bacteria | 1527 |
| 1470 | Ga0466965_0550848 | 3300044683 | Bacteria | 651 |
| 1471 | Ga0466966_0374420 | 3300044684 | Bacteria | 855 |
| 1472 | Ga0466961_0312723 | 3300044693 | Bacteria | 958 |
| 1473 | Ga0466963_0188785 | 3300044694 | Bacteria | 1440 |
| 1474 | Ga0466963_0372580 | 3300044694 | Bacteria | 1006 |
| 1475 | Ga0466963_0858346 | 3300044694 | Bacteria | 640 |
| 1476 | Ga0453684_0244131 | 3300044712 | Bacteria | 2066 |
| 1477 | Ga0453684_0629404 | 3300044712 | Bacteria | 1173 |
| 1478 | Ga0466968_0082045 | 3300044735 | Bacteria | 1418 |
| 1479 | Ga0466970_0211324 | 3300044765 | Bacteria | 1081 |
| 1480 | Ga0466957_0195572 | 3300044842 | Bacteria | 1326 |
| 1481 | Ga0466957_0552410 | 3300044842 | Bacteria | 803 |
| 1482 | Ga0466960_0107277 | 3300044901 | Bacteria | 1446 |
| 1483 | Ga0466959_0028187 | 3300045049 | Bacteria | 4164 |
| 1484 | Ga0451576_0025688 | 3300045051 | Bacteria | 6344 |
| 1485 | Ga0466958_0387133 | 3300045836 | Bacteria | 902 |
| 1486 | Ga0495627_039646 | 3300046453 | Bacteria | 1453 |
| 1487 | Ga0495592_0007338 | 3300046454 | Bacteria | 8245 |
| 1488 | Ga0495592_0009724 | 3300046454 | Bacteria | 7239 |
| 1489 | Ga0495592_0240363 | 3300046454 | Bacteria | 1202 |
| 1490 | Ga0495592_0281699 | 3300046454 | Bacteria | 1087 |
| 1491 | Ga0495603_0010082 | 3300046455 | Bacteria | 5717 |
| 1492 | Ga0495603_0043405 | 3300046455 | Bacteria | 2685 |
| 1493 | Ga0495603_0072095 | 3300046455 | Bacteria | 2029 |
| 1494 | Ga0495603_0080224 | 3300046455 | Bacteria | 1912 |
| 1495 | Ga0495629_0002415 | 3300046459 | Bacteria | 14376 |
| 1496 | Ga0495629_0008648 | 3300046459 | Bacteria | 7498 |
| 1497 | Ga0495629_0196068 | 3300046459 | Bacteria | 1397 |
| 1498 | Ga0495629_0311662 | 3300046459 | Bacteria | 1076 |
| 1499 | Ga0495629_0643281 | 3300046459 | Bacteria | 707 |
| 1500 | Ga0495629_0690006 | 3300046459 | Bacteria | 678 |
| 1501 | Ga0495638_0045067 | 3300046460 | Bacteria | 2776 |
| 1502 | Ga0495638_0062547 | 3300046460 | Bacteria | 2297 |
| 1503 | Ga0495641_0007056 | 3300046461 | Bacteria | 7119 |
| 1504 | Ga0495641_0028225 | 3300046461 | Bacteria | 2718 |
| 1505 | Ga0495651_0038171 | 3300046462 | Bacteria | 3740 |
| 1506 | Ga0495651_0127351 | 3300046462 | Bacteria | 1863 |
| 1507 | Ga0495653_0001564 | 3300046463 | Bacteria | 17908 |
| 1508 | Ga0495653_0037648 | 3300046463 | Bacteria | 3798 |
| 1509 | Ga0495580_0104325 | 3300046472 | Bacteria | 1970 |
| 1510 | Ga0495580_0145000 | 3300046472 | Bacteria | 1645 |
| 1511 | Ga0495580_0297767 | 3300046472 | Bacteria | 1099 |
| 1512 | Ga0495580_0418642 | 3300046472 | Bacteria | 901 |
| 1513 | Ga0495580_0721769 | 3300046472 | Bacteria | 651 |
| 1514 | Ga0495582_0194853 | 3300046473 | Bacteria | 1156 |
| 1515 | Ga0495605_0103108 | 3300046474 | Bacteria | 1309 |
| 1516 | Ga0495639_0001235 | 3300046475 | Bacteria | 11524 |
| 1517 | Ga0495639_0014386 | 3300046475 | Bacteria | 3426 |
| 1518 | Ga0495639_0033442 | 3300046475 | Bacteria | 2296 |
| 1519 | Ga0495662_0005171 | 3300046476 | Bacteria | 6540 |
| 1520 | Ga0495662_0031740 | 3300046476 | Bacteria | 2552 |
| 1521 | Ga0495662_0171713 | 3300046476 | Bacteria | 1068 |
| 1522 | Ga0495664_0001468 | 3300046477 | Bacteria | 12483 |
| 1523 | Ga0495664_0004629 | 3300046477 | Bacteria | 7524 |
| 1524 | Ga0495664_0104250 | 3300046477 | Bacteria | 1709 |
| 1525 | Ga0495664_0497989 | 3300046477 | Bacteria | 728 |
| 1526 | Ga0495584_0006069 | 3300046491 | Bacteria | 6360 |
| 1527 | Ga0495584_0033197 | 3300046491 | Bacteria | 2611 |
| 1528 | Ga0495584_0106761 | 3300046491 | Bacteria | 1416 |
| 1529 | Ga0495585_0023251 | 3300046492 | Bacteria | 3557 |
| 1530 | Ga0495585_0256071 | 3300046492 | Bacteria | 872 |
| 1531 | Ga0495594_0000885 | 3300046499 | Bacteria | 15447 |
| 1532 | Ga0495594_0047293 | 3300046499 | Bacteria | 2362 |
| 1533 | Ga0495594_0137014 | 3300046499 | Bacteria | 1388 |
| 1534 | Ga0495596_0016289 | 3300046500 | Bacteria | 3091 |
| 1535 | Ga0495596_0318019 | 3300046500 | Bacteria | 605 |
| 1536 | Ga0495607_0146650 | 3300046501 | Bacteria | 1212 |
| 1537 | Ga0495583_0134087 | 3300046506 | Bacteria | 1035 |
| 1538 | Ga0495606_0147045 | 3300046507 | Bacteria | 1386 |
| 1539 | Ga0495606_0270425 | 3300046507 | Bacteria | 934 |
| 1540 | Ga0495606_0318004 | 3300046507 | Bacteria | 837 |
| 1541 | Ga0495606_0414019 | 3300046507 | Bacteria | 699 |
| 1542 | Ga0495608_0004913 | 3300046511 | Bacteria | 9575 |
| 1543 | Ga0495608_0011240 | 3300046511 | Bacteria | 6232 |
| 1544 | Ga0495616_0139249 | 3300046513 | Bacteria | 1106 |
| 1545 | Ga0495618_0007887 | 3300046514 | Bacteria | 6443 |
| 1546 | Ga0495618_0048797 | 3300046514 | Bacteria | 2673 |
| 1547 | Ga0495618_0224550 | 3300046514 | Bacteria | 1184 |
| 1548 | Ga0495628_0121770 | 3300046516 | Bacteria | 2000 |
| 1549 | Ga0495628_0200556 | 3300046516 | Bacteria | 1503 |
| 1550 | Ga0495630_0023958 | 3300046517 | Bacteria | 4513 |
| 1551 | Ga0495630_0449427 | 3300046517 | Bacteria | 987 |
| 1552 | Ga0495630_0556283 | 3300046517 | Bacteria | 880 |
| 1553 | Ga0495630_0568859 | 3300046517 | Bacteria | 869 |
| 1554 | Ga0495631_0071504 | 3300046518 | Bacteria | 1499 |
| 1555 | Ga0495637_0035852 | 3300046520 | Bacteria | 2165 |
| 1556 | Ga0495637_0139854 | 3300046520 | Bacteria | 919 |
| 1557 | Ga0495644_0061992 | 3300046523 | Bacteria | 1405 |
| 1558 | Ga0495644_0126491 | 3300046523 | Bacteria | 973 |
| 1559 | Ga0495666_0008960 | 3300046526 | Bacteria | 5007 |
| 1560 | Ga0495666_0243431 | 3300046526 | Bacteria | 820 |
| 1561 | Ga0495666_0356301 | 3300046526 | Bacteria | 659 |
| 1562 | Ga0495652_0006569 | 3300046529 | Bacteria | 10804 |
| 1563 | Ga0495652_0112959 | 3300046529 | Bacteria | 2181 |
| 1564 | Ga0495652_0244946 | 3300046529 | Bacteria | 1332 |
| 1565 | Ga0495665_0010456 | 3300046531 | Bacteria | 5021 |
| 1566 | Ga0495665_0066400 | 3300046531 | Bacteria | 1904 |
| 1567 | Ga0495665_0238104 | 3300046531 | Bacteria | 939 |
| 1568 | Ga0495665_0454537 | 3300046531 | Bacteria | 647 |
| 1569 | Ga0495640_0097308 | 3300046533 | Bacteria | 1935 |
| 1570 | Ga0495640_0119515 | 3300046533 | Bacteria | 1714 |
| 1571 | Ga0495640_0616370 | 3300046533 | Bacteria | 655 |
| 1572 | Ga0495586_0006626 | 3300046535 | Bacteria | 6185 |
| 1573 | Ga0495586_0108693 | 3300046535 | Bacteria | 1542 |
| 1574 | Ga0495586_0385101 | 3300046535 | Bacteria | 807 |
| 1575 | Ga0495587_0009864 | 3300046536 | Bacteria | 6097 |
| 1576 | Ga0495587_0021655 | 3300046536 | Bacteria | 3966 |
| 1577 | Ga0495587_0097944 | 3300046536 | Bacteria | 1691 |
| 1578 | Ga0495598_0013282 | 3300046537 | Bacteria | 2038 |
| 1579 | Ga0495609_0158595 | 3300046538 | Bacteria | 960 |
| 1580 | Ga0495621_0092527 | 3300046539 | Bacteria | 1141 |
| 1581 | Ga0495645_0005648 | 3300046543 | Bacteria | 8612 |
| 1582 | Ga0495645_0162120 | 3300046543 | Bacteria | 1545 |
| 1583 | Ga0495645_0688952 | 3300046543 | Bacteria | 621 |
| 1584 | Ga0495622_0018025 | 3300046557 | Bacteria | 3287 |
| 1585 | Ga0495622_0096837 | 3300046557 | Bacteria | 1354 |
| 1586 | Ga0495622_0097993 | 3300046557 | Bacteria | 1345 |
| 1587 | Ga0495667_0002438 | 3300046559 | Bacteria | 12418 |
| 1588 | Ga0495667_0071062 | 3300046559 | Bacteria | 2270 |
| 1589 | Ga0495667_0679497 | 3300046559 | Bacteria | 639 |
| 1590 | Ga0495656_0017072 | 3300046615 | Bacteria | 2764 |
| 1591 | Ga0495656_0047340 | 3300046615 | Bacteria | 1823 |
| 1592 | Ga0495634_0051519 | 3300046642 | Bacteria | 2762 |
| 1593 | Ga0495634_0064532 | 3300046642 | Bacteria | 2427 |
| 1594 | Ga0495634_0113159 | 3300046642 | Bacteria | 1743 |
| 1595 | Ga0495634_0850820 | 3300046642 | Bacteria | 518 |
| 1596 | Ga0495611_0087587 | 3300046648 | Bacteria | 1437 |
| 1597 | Ga0495625_0651455 | 3300046660 | Bacteria | 627 |
| 1598 | Ga0495635_0001320 | 3300046663 | Bacteria | 16508 |
| 1599 | Ga0495635_0237066 | 3300046663 | Bacteria | 1231 |
| 1600 | Ga0495659_0047341 | 3300046664 | Bacteria | 1555 |
| 1601 | Ga0495659_0063621 | 3300046664 | Bacteria | 1368 |
| 1602 | Ga0495661_0150947 | 3300046665 | Bacteria | 1255 |
| 1603 | Ga0495661_0241783 | 3300046665 | Bacteria | 926 |
| 1604 | Ga0495588_0088582 | 3300046674 | Bacteria | 1620 |
| 1605 | Ga0495657_0004369 | 3300046675 | Bacteria | 11284 |
| 1606 | Ga0495657_0201003 | 3300046675 | Bacteria | 1215 |
| 1607 | Ga0495657_0504188 | 3300046675 | Bacteria | 706 |
| 1608 | Ga0495599_0014982 | 3300046678 | Bacteria | 4805 |
| 1609 | Ga0495599_0032053 | 3300046678 | Bacteria | 3298 |
| 1610 | Ga0495623_0005523 | 3300046679 | Bacteria | 8259 |
| 1611 | Ga0495646_0001863 | 3300046680 | Bacteria | 12680 |
| 1612 | Ga0495646_0002260 | 3300046680 | Bacteria | 11775 |
| 1613 | Ga0495647_0000406 | 3300046681 | Bacteria | 12338 |
| 1614 | Ga0495647_0005548 | 3300046681 | Bacteria | 4140 |
| 1615 | Ga0495647_0014711 | 3300046681 | Bacteria | 2730 |
| 1616 | Ga0495647_0116523 | 3300046681 | Bacteria | 1120 |
| 1617 | Ga0495658_0000992 | 3300046683 | Bacteria | 15035 |
| 1618 | Ga0495658_0003451 | 3300046683 | Bacteria | 7814 |
| 1619 | Ga0495658_0044958 | 3300046683 | Bacteria | 2476 |
| 1620 | Ga0495658_0437053 | 3300046683 | Bacteria | 835 |
| 1621 | Ga0495658_0573697 | 3300046683 | Bacteria | 723 |
| 1622 | Ga0495669_0025391 | 3300046684 | Bacteria | 2584 |
| 1623 | Ga0495669_0209154 | 3300046684 | Bacteria | 934 |
| 1624 | Ga0495613_0008131 | 3300046689 | Bacteria | 7802 |
| 1625 | Ga0495613_0082724 | 3300046689 | Bacteria | 2331 |
| 1626 | Ga0495613_0115123 | 3300046689 | Bacteria | 1935 |
| 1627 | Ga0495624_0003021 | 3300046690 | Bacteria | 12596 |
| 1628 | Ga0495624_0095937 | 3300046690 | Bacteria | 1827 |
| 1629 | Ga0495624_0164681 | 3300046690 | Bacteria | 1353 |
| 1630 | Ga0495624_0182713 | 3300046690 | Bacteria | 1277 |
| 1631 | Ga0495624_0204350 | 3300046690 | Bacteria | 1199 |
| 1632 | Ga0495624_0254278 | 3300046690 | Bacteria | 1062 |
| 1633 | Ga0495671_0028600 | 3300046692 | Bacteria | 2870 |
| 1634 | Ga0495671_0264196 | 3300046692 | Bacteria | 830 |
| 1635 | Ga0495649_0361839 | 3300046694 | Bacteria | 732 |
| 1636 | Ga0495649_0378185 | 3300046694 | Bacteria | 713 |
| 1637 | Ga0495589_0231183 | 3300046794 | Bacteria | 867 |
| 1638 | Ga0495600_0004026 | 3300046809 | Bacteria | 8734 |
| 1639 | Ga0495600_0025145 | 3300046809 | Bacteria | 3837 |
| 1640 | Ga0495660_0106434 | 3300046810 | Bacteria | 1437 |
| 1641 | Ga0495581_0004714 | 3300047315 | Bacteria | 7872 |
| 1642 | Ga0495581_0025832 | 3300047315 | Bacteria | 3406 |
| 1643 | Ga0495581_0175629 | 3300047315 | Bacteria | 1252 |
| 1644 | Ga0495581_0369917 | 3300047315 | Bacteria | 837 |
| 1645 | Ga0495581_0464850 | 3300047315 | Bacteria | 736 |
| 1646 | Ga0495604_0004371 | 3300047317 | Bacteria | 11195 |
| 1647 | Ga0495604_0014285 | 3300047317 | Bacteria | 6330 |
| 1648 | Ga0495636_0195845 | 3300047318 | Bacteria | 921 |
| 1649 | Ga0495674_0050447 | 3300047319 | Bacteria | 3671 |
| 1650 | Ga0495674_0063241 | 3300047319 | Bacteria | 3219 |
| 1651 | Ga0495674_0065328 | 3300047319 | Bacteria | 3161 |
| 1652 | Ga0495674_0080891 | 3300047319 | Bacteria | 2787 |
| 1653 | Ga0495674_0158381 | 3300047319 | Bacteria | 1896 |
| 1654 | Ga0495674_0683556 | 3300047319 | Bacteria | 807 |
| 1655 | Ga0495672_0174321 | 3300047320 | Bacteria | 1094 |
| 1656 | Ga0495672_0215502 | 3300047320 | Bacteria | 951 |
| 1657 | Ga0495676_0086776 | 3300047321 | Bacteria | 2353 |
| 1658 | Ga0495676_0206580 | 3300047321 | Bacteria | 1361 |
| 1659 | Ga0495676_0271913 | 3300047321 | Bacteria | 1149 |
| 1660 | Ga0495676_0358073 | 3300047321 | Bacteria | 974 |
| 1661 | Ga0495676_0398758 | 3300047321 | Bacteria | 913 |
| 1662 | Ga0495676_0535528 | 3300047321 | Bacteria | 766 |
| 1663 | Ga0495680_0004581 | 3300047322 | Bacteria | 13185 |
| 1664 | Ga0495680_0021543 | 3300047322 | Bacteria | 5394 |
| 1665 | Ga0495680_0068859 | 3300047322 | Bacteria | 2702 |
| 1666 | Ga0495680_0131854 | 3300047322 | Bacteria | 1836 |
| 1667 | Ga0495680_0376506 | 3300047322 | Bacteria | 984 |
| 1668 | Ga0495680_0680692 | 3300047322 | Bacteria | 681 |
| 1669 | Ga0495675_0058076 | 3300047444 | Bacteria | 2453 |
| 1670 | Ga0495675_0294671 | 3300047444 | Bacteria | 965 |
| 1671 | Ga0495677_0020410 | 3300047445 | Bacteria | 2402 |
| 1672 | Ga0495677_0140963 | 3300047445 | Bacteria | 926 |
| 1673 | Ga0495679_075892 | 3300047446 | Bacteria | 961 |
| 1674 | Ga0495685_073476 | 3300047447 | Bacteria | 1144 |
| 1675 | Ga0495673_0125246 | 3300047469 | Bacteria | 1014 |
| 1676 | Ga0495684_0000665 | 3300047471 | Bacteria | 27695 |
| 1677 | Ga0495684_0049452 | 3300047471 | Bacteria | 3212 |
| 1678 | Ga0495684_0157389 | 3300047471 | Bacteria | 1696 |
| 1679 | Ga0495684_0586580 | 3300047471 | Bacteria | 754 |
| 1680 | Ga0495686_0208209 | 3300047472 | Bacteria | 1119 |
| 1681 | Ga0495593_0002227 | 3300047673 | Bacteria | 11631 |
| 1682 | Ga0495593_0026621 | 3300047673 | Bacteria | 3191 |
| 1683 | Ga0495602_0003946 | 3300048088 | Bacteria | 15466 |
| 1684 | Ga0495602_0078824 | 3300048088 | Bacteria | 2781 |
| 1685 | Ga0495602_0177367 | 3300048088 | Bacteria | 1647 |
| 1686 | Ga0495602_0399205 | 3300048088 | Bacteria | 981 |
| 1687 | Ga0495602_0935539 | 3300048088 | Bacteria | 575 |
| 1688 | Ga0495614_0013298 | 3300048089 | Bacteria | 3610 |
| 1689 | Ga0495614_0073117 | 3300048089 | Bacteria | 1480 |
| 1690 | Ga0495615_0036334 | 3300048090 | Bacteria | 1208 |
| 1691 | Ga0496100_0003652 | 3300048903 | Bacteria | 8047 |
| 1692 | Ga0496100_0013089 | 3300048903 | Bacteria | 4775 |
| 1693 | Ga0496100_0025032 | 3300048903 | Bacteria | 3646 |
| 1694 | Ga0496100_0107162 | 3300048903 | Bacteria | 1935 |
| 1695 | Ga0496100_0121395 | 3300048903 | Bacteria | 1828 |
| 1696 | Ga0496100_0151296 | 3300048903 | Bacteria | 1655 |
| 1697 | Ga0496100_0190031 | 3300048903 | Bacteria | 1490 |
| 1698 | Ga0496100_0220313 | 3300048903 | Bacteria | 1392 |
| 1699 | Ga0496100_0421157 | 3300048903 | Bacteria | 1020 |
| 1700 | Ga0496101_0000964 | 3300048904 | Bacteria | 16964 |
| 1701 | Ga0496101_0001534 | 3300048904 | Bacteria | 13845 |
| 1702 | Ga0496101_0022529 | 3300048904 | Bacteria | 4337 |
| 1703 | Ga0496101_0263881 | 3300048904 | Bacteria | 1343 |
| 1704 | Ga0496101_0408679 | 3300048904 | Bacteria | 1069 |
| 1705 | Ga0496101_0594301 | 3300048904 | Bacteria | 875 |
| 1706 | Ga0496101_0910390 | 3300048904 | Bacteria | 692 |
| 1707 | Ga0496102_0018417 | 3300048905 | Bacteria | 6137 |
| 1708 | Ga0496102_0041498 | 3300048905 | Bacteria | 4166 |
| 1709 | Ga0496102_0081943 | 3300048905 | Bacteria | 2975 |
| 1710 | Ga0496102_0134424 | 3300048905 | Bacteria | 2317 |
| 1711 | Ga0496102_0202829 | 3300048905 | Bacteria | 1869 |
| 1712 | Ga0496102_0277278 | 3300048905 | Bacteria | 1580 |
| 1713 | Ga0496102_0415258 | 3300048905 | Bacteria | 1264 |
| 1714 | Ga0496102_0954277 | 3300048905 | Bacteria | 778 |
| 1715 | Ga0496102_1002107 | 3300048905 | Bacteria | 756 |
| 1716 | Ga0496103_0002627 | 3300048906 | Bacteria | 11256 |
| 1717 | Ga0496103_0060798 | 3300048906 | Bacteria | 2348 |
| 1718 | Ga0496103_0077179 | 3300048906 | Bacteria | 2091 |
| 1719 | Ga0496103_0133772 | 3300048906 | Bacteria | 1584 |
| 1720 | Ga0496103_0140554 | 3300048906 | Bacteria | 1544 |
| 1721 | Ga0496103_0240986 | 3300048906 | Bacteria | 1163 |
| 1722 | Ga0496103_0433272 | 3300048906 | Bacteria | 844 |
| 1723 | Ga0496103_0540409 | 3300048906 | Bacteria | 744 |
| 1724 | Ga0496104_0000062 | 3300048907 | Bacteria | 117255 |
| 1725 | Ga0496104_0003859 | 3300048907 | Bacteria | 12970 |
| 1726 | Ga0496104_0005449 | 3300048907 | Bacteria | 11138 |
| 1727 | Ga0496104_0006088 | 3300048907 | Bacteria | 10586 |
| 1728 | Ga0496104_0012447 | 3300048907 | Bacteria | 7650 |
| 1729 | Ga0496104_0019562 | 3300048907 | Bacteria | 6198 |
| 1730 | Ga0496104_0328086 | 3300048907 | Bacteria | 1443 |
| 1731 | Ga0496104_0351141 | 3300048907 | Bacteria | 1387 |
| 1732 | Ga0496104_0369650 | 3300048907 | Bacteria | 1346 |
| 1733 | Ga0496104_0869670 | 3300048907 | Bacteria | 807 |
| 1734 | Ga0496104_1839788 | 3300048907 | Bacteria | 507 |
| 1735 | Ga0496105_0000069 | 3300048908 | Bacteria | 80917 |
| 1736 | Ga0496105_0002521 | 3300048908 | Bacteria | 13283 |
| 1737 | Ga0496105_0005334 | 3300048908 | Bacteria | 9741 |
| 1738 | Ga0496105_0012965 | 3300048908 | Bacteria | 6605 |
| 1739 | Ga0496105_0013368 | 3300048908 | Bacteria | 6514 |
| 1740 | Ga0496105_0020223 | 3300048908 | Bacteria | 5378 |
| 1741 | Ga0496106_0005548 | 3300048909 | Bacteria | 9340 |
| 1742 | Ga0496106_0010045 | 3300048909 | Bacteria | 6992 |
| 1743 | Ga0496106_0014992 | 3300048909 | Bacteria | 5735 |
| 1744 | Ga0496106_0021945 | 3300048909 | Bacteria | 4743 |
| 1745 | Ga0496106_0282868 | 3300048909 | Bacteria | 1329 |
| 1746 | Ga0496106_0730589 | 3300048909 | Bacteria | 788 |
| 1747 | Ga0496106_1394956 | 3300048909 | Bacteria | 541 |
| 1748 | Ga0496107_0009919 | 3300048910 | Bacteria | 6609 |
| 1749 | Ga0496107_0030691 | 3300048910 | Bacteria | 3831 |
| 1750 | Ga0496107_0033427 | 3300048910 | Bacteria | 3679 |
| 1751 | Ga0496107_0036189 | 3300048910 | Bacteria | 3540 |
| 1752 | Ga0496107_0065471 | 3300048910 | Bacteria | 2634 |
| 1753 | Ga0496107_0161334 | 3300048910 | Bacteria | 1661 |
| 1754 | Ga0496107_0258524 | 3300048910 | Bacteria | 1296 |
| 1755 | Ga0496108_0005674 | 3300048911 | Bacteria | 10103 |
| 1756 | Ga0496108_0014484 | 3300048911 | Bacteria | 6438 |
| 1757 | Ga0496108_0016715 | 3300048911 | Bacteria | 5993 |
| 1758 | Ga0496108_0048390 | 3300048911 | Bacteria | 3555 |
| 1759 | Ga0496108_0076490 | 3300048911 | Bacteria | 2829 |
| 1760 | Ga0496108_0105509 | 3300048911 | Bacteria | 2406 |
| 1761 | Ga0496108_0113341 | 3300048911 | Bacteria | 2320 |
| 1762 | Ga0496108_0196494 | 3300048911 | Bacteria | 1749 |
| 1763 | Ga0496108_0378916 | 3300048911 | Bacteria | 1235 |
| 1764 | Ga0496109_0001018 | 3300048912 | Bacteria | 23151 |
| 1765 | Ga0496109_0003269 | 3300048912 | Bacteria | 13520 |
| 1766 | Ga0496109_0006704 | 3300048912 | Bacteria | 9692 |
| 1767 | Ga0496109_0018236 | 3300048912 | Bacteria | 6164 |
| 1768 | Ga0496109_0036180 | 3300048912 | Bacteria | 4456 |
| 1769 | Ga0496109_0043990 | 3300048912 | Bacteria | 4049 |
| 1770 | Ga0496109_0123518 | 3300048912 | Bacteria | 2413 |
| 1771 | Ga0496109_0326010 | 3300048912 | Bacteria | 1449 |
| 1772 | Ga0496109_0526720 | 3300048912 | Bacteria | 1115 |
| 1773 | Ga0496109_0566068 | 3300048912 | Bacteria | 1072 |
| 1774 | Ga0496110_0003889 | 3300048913 | Bacteria | 11494 |
| 1775 | Ga0496110_0004123 | 3300048913 | Bacteria | 11228 |
| 1776 | Ga0496110_0008786 | 3300048913 | Bacteria | 8140 |
| 1777 | Ga0496110_0010013 | 3300048913 | Bacteria | 7693 |
| 1778 | Ga0496110_0017504 | 3300048913 | Bacteria | 5996 |
| 1779 | Ga0496110_0088669 | 3300048913 | Bacteria | 2763 |
| 1780 | Ga0496110_0139440 | 3300048913 | Bacteria | 2192 |
| 1781 | Ga0496110_0186049 | 3300048913 | Bacteria | 1886 |
| 1782 | Ga0496110_0226468 | 3300048913 | Bacteria | 1700 |
| 1783 | Ga0496110_0303999 | 3300048913 | Bacteria | 1453 |
| 1784 | Ga0496110_1545798 | 3300048913 | Bacteria | 573 |
| 1785 | Ga0496111_0009604 | 3300048914 | Bacteria | 6461 |
| 1786 | Ga0496111_0020260 | 3300048914 | Bacteria | 4627 |
| 1787 | Ga0496111_0026058 | 3300048914 | Bacteria | 4127 |
| 1788 | Ga0496111_0252017 | 3300048914 | Bacteria | 1310 |
| 1789 | Ga0496112_0000079 | 3300048915 | Bacteria | 64101 |
| 1790 | Ga0496112_0014236 | 3300048915 | Bacteria | 7371 |
| 1791 | Ga0496112_0025757 | 3300048915 | Bacteria | 5649 |
| 1792 | Ga0496112_0067442 | 3300048915 | Bacteria | 3532 |
| 1793 | Ga0496112_0104117 | 3300048915 | Bacteria | 2808 |
| 1794 | Ga0496112_0188627 | 3300048915 | Bacteria | 2024 |
| 1795 | Ga0496112_0228031 | 3300048915 | Bacteria | 1818 |
| 1796 | Ga0496112_0306080 | 3300048915 | Bacteria | 1534 |
| 1797 | Ga0496112_0486692 | 3300048915 | Bacteria | 1170 |
| 1798 | Ga0496112_0582312 | 3300048915 | Bacteria | 1052 |
| 1799 | Ga0496113_0001952 | 3300048916 | Bacteria | 11807 |
| 1800 | Ga0496113_0002550 | 3300048916 | Bacteria | 10630 |
| 1801 | Ga0496113_0038672 | 3300048916 | Bacteria | 3508 |
| 1802 | Ga0496113_0049794 | 3300048916 | Bacteria | 3121 |
| 1803 | Ga0496113_0109928 | 3300048916 | Bacteria | 2144 |
| 1804 | Ga0496113_0131767 | 3300048916 | Bacteria | 1962 |
| 1805 | Ga0496113_0324454 | 3300048916 | Bacteria | 1234 |
| 1806 | Ga0496114_0005552 | 3300048917 | Bacteria | 9884 |
| 1807 | Ga0496114_0052754 | 3300048917 | Bacteria | 3388 |
| 1808 | Ga0496114_0130190 | 3300048917 | Bacteria | 2172 |
| 1809 | Ga0496114_0133737 | 3300048917 | Bacteria | 2143 |
| 1810 | Ga0496114_0296768 | 3300048917 | Bacteria | 1426 |
| 1811 | Ga0496114_0301128 | 3300048917 | Bacteria | 1416 |
| 1812 | Ga0496114_0544100 | 3300048917 | Bacteria | 1026 |
| 1813 | Ga0496115_0009587 | 3300048918 | Bacteria | 7198 |
| 1814 | Ga0496115_0038830 | 3300048918 | Bacteria | 3780 |
| 1815 | Ga0496115_0045916 | 3300048918 | Bacteria | 3488 |
| 1816 | Ga0496115_0065973 | 3300048918 | Bacteria | 2925 |
| 1817 | Ga0496115_0134504 | 3300048918 | Bacteria | 2038 |
| 1818 | Ga0496115_0361080 | 3300048918 | Bacteria | 1183 |
| 1819 | Ga0496115_0380730 | 3300048918 | Bacteria | 1147 |
| 1820 | Ga0496115_0470906 | 3300048918 | Bacteria | 1012 |
| 1821 | Ga0496115_0759519 | 3300048918 | Bacteria | 757 |
| 1822 | Ga0496115_0829709 | 3300048918 | Bacteria | 717 |
| 1823 | Ga0496116_0032483 | 3300048919 | Bacteria | 3719 |
| 1824 | Ga0496116_0235587 | 3300048919 | Bacteria | 924 |
| 1825 | Ga0496117_0018894 | 3300048920 | Bacteria | 5686 |
| 1826 | Ga0496118_0003967 | 3300048921 | Bacteria | 18059 |
| 1827 | Ga0496119_0008884 | 3300048922 | Bacteria | 8740 |
| 1828 | Ga0496119_0021564 | 3300048922 | Bacteria | 4650 |
| 1829 | Ga0496119_0347648 | 3300048922 | Bacteria | 719 |
| 1830 | Ga0496120_0172926 | 3300048923 | Bacteria | 1067 |
| 1831 | Ga0496121_0000576 | 3300048924 | Bacteria | 69005 |
| 1832 | Ga0496121_0001526 | 3300048924 | Bacteria | 38831 |
| 1833 | Ga0496121_0466583 | 3300048924 | Bacteria | 810 |
| 1834 | Ga0496122_0000160 | 3300048925 | Bacteria | 159236 |
| 1835 | Ga0496122_0503000 | 3300048925 | Bacteria | 588 |
| 1836 | Ga0496123_0000034 | 3300048926 | Bacteria | 274836 |
| 1837 | Ga0496123_0242564 | 3300048926 | Bacteria | 894 |
| 1838 | Ga0496124_0055299 | 3300048927 | Bacteria | 3354 |
| 1839 | Ga0496124_0366719 | 3300048927 | Bacteria | 1013 |
| 1840 | Ga0496125_0034194 | 3300048928 | Bacteria | 4484 |
| 1841 | Ga0496125_0357155 | 3300048928 | Bacteria | 870 |
| 1842 | Ga0496125_0497614 | 3300048928 | Bacteria | 687 |
| 1843 | Ga0496126_0008516 | 3300048929 | Bacteria | 11055 |
| 1844 | Ga0496126_0300824 | 3300048929 | Bacteria | 1323 |
| 1845 | Ga0496126_0346193 | 3300048929 | Bacteria | 1216 |
| 1846 | Ga0496126_0465985 | 3300048929 | Bacteria | 1015 |
| 1847 | Ga0501306_011394 | 3300049127 | Bacteria | 1133 |
| 1848 | Ga0501306_022221 | 3300049127 | Bacteria | 894 |
| 1849 | Ga0501306_074175 | 3300049127 | Bacteria | 578 |
| 1850 | Ga0501308_027067 | 3300049128 | Bacteria | 751 |
| 1851 | Ga0501309_084324 | 3300049129 | Bacteria | 536 |
| 1852 | Ga0501345_03992 | 3300049134 | Bacteria | 651 |
| 1853 | Ga0501304_007279 | 3300049160 | Bacteria | 910 |
| 1854 | Ga0501305_032249 | 3300049161 | Bacteria | 822 |
| 1855 | Ga0501305_033893 | 3300049161 | Bacteria | 808 |
| 1856 | Ga0501305_108060 | 3300049161 | Bacteria | 524 |
| 1857 | Ga0501307_014408 | 3300049162 | Bacteria | 966 |
| 1858 | Ga0501307_019821 | 3300049162 | Bacteria | 865 |
| 1859 | Ga0495682_0001739 | 3300049460 | Bacteria | 11047 |
| 1860 | Ga0495682_0069478 | 3300049460 | Bacteria | 1268 |
| 1861 | Ga0501311_013856 | 3300049527 | Bacteria | 1023 |
| 1862 | Ga0501311_056326 | 3300049527 | Bacteria | 626 |
| 1863 | Ga0501312_087642 | 3300049528 | Bacteria | 571 |
| 1864 | Ga0501313_033449 | 3300049529 | Bacteria | 673 |
| 1865 | Ga0501313_051383 | 3300049529 | Bacteria | 570 |
| 1866 | Ga0501314_006563 | 3300049530 | Bacteria | 1016 |
| 1867 | Ga0501315_017382 | 3300049531 | Bacteria | 940 |
| 1868 | Ga0501316_035020 | 3300049532 | Bacteria | 684 |
| 1869 | Ga0501316_052286 | 3300049532 | Bacteria | 590 |
| 1870 | Ga0501316_066641 | 3300049532 | Bacteria | 540 |
| 1871 | Ga0501317_054853 | 3300049533 | Bacteria | 642 |
| 1872 | Ga0501318_052024 | 3300049534 | Bacteria | 611 |
| 1873 | Ga0501319_004718 | 3300049535 | Bacteria | 956 |
| 1874 | Ga0501319_030601 | 3300049535 | Bacteria | 517 |
| 1875 | Ga0501320_016699 | 3300049536 | Bacteria | 814 |
| 1876 | Ga0501320_044408 | 3300049536 | Bacteria | 590 |
| 1877 | Ga0501321_030603 | 3300049537 | Bacteria | 717 |
| 1878 | Ga0501321_031387 | 3300049537 | Bacteria | 711 |
| 1879 | Ga0501321_063682 | 3300049537 | Bacteria | 562 |
| 1880 | Ga0501322_008464 | 3300049538 | Bacteria | 764 |
| 1881 | Ga0501323_013727 | 3300049539 | Bacteria | 1005 |
| 1882 | Ga0501323_029143 | 3300049539 | Bacteria | 768 |
| 1883 | Ga0501324_009375 | 3300049540 | Bacteria | 877 |
| 1884 | Ga0501325_008441 | 3300049541 | Bacteria | 894 |
| 1885 | Ga0501325_010379 | 3300049541 | Bacteria | 843 |
| 1886 | Ga0501325_017743 | 3300049541 | Bacteria | 723 |
| 1887 | Ga0501325_040955 | 3300049541 | Bacteria | 564 |
| 1888 | Ga0501325_041014 | 3300049541 | Bacteria | 563 |
| 1889 | Ga0501327_08600 | 3300049543 | Bacteria | 652 |
| 1890 | Ga0501328_10531 | 3300049544 | Bacteria | 524 |
| 1891 | Ga0501329_09609 | 3300049545 | Bacteria | 596 |
| 1892 | Ga0501329_10195 | 3300049545 | Bacteria | 585 |
| 1893 | Ga0501330_008594 | 3300049546 | Bacteria | 702 |
| 1894 | Ga0501331_15584 | 3300049547 | Bacteria | 504 |
| 1895 | Ga0501335_029033 | 3300049551 | Bacteria | 619 |
| 1896 | Ga0501336_021297 | 3300049552 | Bacteria | 591 |
| 1897 | Ga0501031_0585608 | 3300049568 | Bacteria | 718 |
| 1898 | Ga0501031_0715726 | 3300049568 | Bacteria | 643 |
| 1899 | Ga0501031_0955429 | 3300049568 | Bacteria | 548 |
| 1900 | Ga0501032_0057878 | 3300049569 | Bacteria | 2603 |
| 1901 | Ga0501032_0078899 | 3300049569 | Bacteria | 2192 |
| 1902 | Ga0501032_0138096 | 3300049569 | Bacteria | 1606 |
| 1903 | Ga0501032_0283490 | 3300049569 | Bacteria | 1072 |
| 1904 | Ga0501033_0000763 | 3300049570 | Bacteria | 29600 |
| 1905 | Ga0501033_0013758 | 3300049570 | Bacteria | 6155 |
| 1906 | Ga0501033_0041417 | 3300049570 | Bacteria | 3437 |
| 1907 | Ga0501033_0068350 | 3300049570 | Bacteria | 2612 |
| 1908 | Ga0501033_0105075 | 3300049570 | Bacteria | 2058 |
| 1909 | Ga0501033_0187357 | 3300049570 | Bacteria | 1482 |
| 1910 | Ga0501033_0211894 | 3300049570 | Bacteria | 1381 |
| 1911 | Ga0501033_0267769 | 3300049570 | Bacteria | 1208 |
| 1912 | Ga0501033_0303176 | 3300049570 | Bacteria | 1124 |
| 1913 | Ga0501033_0860020 | 3300049570 | Bacteria | 611 |
| 1914 | Ga0501034_0109420 | 3300049571 | Bacteria | 2754 |
| 1915 | Ga0501034_0206828 | 3300049571 | Bacteria | 1919 |
| 1916 | Ga0501034_0220111 | 3300049571 | Bacteria | 1851 |
| 1917 | Ga0501034_0262996 | 3300049571 | Bacteria | 1668 |
| 1918 | Ga0501034_0351742 | 3300049571 | Bacteria | 1401 |
| 1919 | Ga0501034_0502154 | 3300049571 | Bacteria | 1127 |
| 1920 | Ga0501034_1018463 | 3300049571 | Bacteria | 711 |
| 1921 | Ga0501034_1249833 | 3300049571 | Bacteria | 620 |
| 1922 | Ga0501034_1529601 | 3300049571 | Bacteria | 541 |
| 1923 | Ga0501036_0023988 | 3300049572 | Bacteria | 5142 |
| 1924 | Ga0501036_0059405 | 3300049572 | Bacteria | 3240 |
| 1925 | Ga0501036_0276944 | 3300049572 | Bacteria | 1404 |
| 1926 | Ga0501036_0404901 | 3300049572 | Bacteria | 1138 |
| 1927 | Ga0501036_1057402 | 3300049572 | Bacteria | 664 |
| 1928 | Ga0501037_0061556 | 3300049573 | Bacteria | 2737 |
| 1929 | Ga0501037_0077620 | 3300049573 | Bacteria | 2410 |
| 1930 | Ga0501037_0092344 | 3300049573 | Bacteria | 2189 |
| 1931 | Ga0501037_0096455 | 3300049573 | Bacteria | 2137 |
| 1932 | Ga0501037_0166391 | 3300049573 | Bacteria | 1570 |
| 1933 | Ga0501037_0823041 | 3300049573 | Bacteria | 612 |
| 1934 | Ga0501038_0064087 | 3300049574 | Bacteria | 3135 |
| 1935 | Ga0501038_0096710 | 3300049574 | Bacteria | 2464 |
| 1936 | Ga0501038_0126590 | 3300049574 | Bacteria | 2102 |
| 1937 | Ga0501038_0187470 | 3300049574 | Bacteria | 1666 |
| 1938 | Ga0501038_0215822 | 3300049574 | Bacteria | 1533 |
| 1939 | Ga0501038_0428605 | 3300049574 | Bacteria | 1019 |
| 1940 | Ga0501038_0928801 | 3300049574 | Bacteria | 641 |
| 1941 | Ga0501038_0982752 | 3300049574 | Bacteria | 620 |
| 1942 | Ga0501038_1067581 | 3300049574 | Bacteria | 591 |
| 1943 | Ga0501039_0420782 | 3300049575 | Bacteria | 1049 |
| 1944 | Ga0501039_0668118 | 3300049575 | Bacteria | 813 |
| 1945 | Ga0501039_0843268 | 3300049575 | Bacteria | 714 |
| 1946 | Ga0501040_0347397 | 3300049576 | Bacteria | 1062 |
| 1947 | Ga0501041_0150747 | 3300049577 | Bacteria | 1452 |
| 1948 | Ga0501042_0151831 | 3300049578 | Bacteria | 1670 |
| 1949 | Ga0501042_0272239 | 3300049578 | Bacteria | 1223 |
| 1950 | Ga0501042_0357926 | 3300049578 | Bacteria | 1056 |
| 1951 | Ga0501042_0358368 | 3300049578 | Bacteria | 1055 |
| 1952 | Ga0501042_0650562 | 3300049578 | Bacteria | 766 |
| 1953 | Ga0501043_0028008 | 3300049579 | Bacteria | 4422 |
| 1954 | Ga0501043_0065904 | 3300049579 | Bacteria | 2844 |
| 1955 | Ga0501043_0146293 | 3300049579 | Bacteria | 1850 |
| 1956 | Ga0501043_0182295 | 3300049579 | Bacteria | 1636 |
| 1957 | Ga0501043_0247472 | 3300049579 | Bacteria | 1374 |
| 1958 | Ga0501043_0297076 | 3300049579 | Bacteria | 1235 |
| 1959 | Ga0501043_0512099 | 3300049579 | Bacteria | 895 |
| 1960 | Ga0501046_0024970 | 3300049580 | Bacteria | 4896 |
| 1961 | Ga0501046_0338508 | 3300049580 | Bacteria | 1094 |
| 1962 | Ga0501046_0409153 | 3300049580 | Bacteria | 979 |
| 1963 | Ga0501046_0606871 | 3300049580 | Bacteria | 776 |
| 1964 | Ga0501046_0776205 | 3300049580 | Bacteria | 672 |
| 1965 | Ga0501047_0009361 | 3300049581 | Bacteria | 9252 |
| 1966 | Ga0501047_0027159 | 3300049581 | Bacteria | 5514 |
| 1967 | Ga0501047_0042561 | 3300049581 | Bacteria | 4389 |
| 1968 | Ga0501047_0055535 | 3300049581 | Bacteria | 3829 |
| 1969 | Ga0501047_0079894 | 3300049581 | Bacteria | 3144 |
| 1970 | Ga0501047_0105031 | 3300049581 | Bacteria | 2705 |
| 1971 | Ga0501047_0138409 | 3300049581 | Bacteria | 2314 |
| 1972 | Ga0501047_0299684 | 3300049581 | Bacteria | 1450 |
| 1973 | Ga0501047_0441750 | 3300049581 | Bacteria | 1131 |
| 1974 | Ga0501047_0705864 | 3300049581 | Bacteria | 826 |
| 1975 | Ga0501047_1071807 | 3300049581 | Bacteria | 619 |
| 1976 | Ga0501048_0368864 | 3300049582 | Bacteria | 1025 |
| 1977 | Ga0501067_0003431 | 3300049583 | Bacteria | 8721 |
| 1978 | Ga0501067_0062663 | 3300049583 | Bacteria | 2059 |
| 1979 | Ga0501068_0191040 | 3300049584 | Bacteria | 1297 |
| 1980 | Ga0501068_0402926 | 3300049584 | Bacteria | 882 |
| 1981 | Ga0501069_0464584 | 3300049585 | Bacteria | 753 |
| 1982 | Ga0501070_0013211 | 3300049586 | Bacteria | 6961 |
| 1983 | Ga0501070_0060200 | 3300049586 | Bacteria | 3148 |
| 1984 | Ga0501070_0065603 | 3300049586 | Bacteria | 3006 |
| 1985 | Ga0501070_0084233 | 3300049586 | Bacteria | 2632 |
| 1986 | Ga0501070_0106670 | 3300049586 | Bacteria | 2315 |
| 1987 | Ga0501070_0240323 | 3300049586 | Bacteria | 1482 |
| 1988 | Ga0501071_0261423 | 3300049587 | Bacteria | 1307 |
| 1989 | Ga0501071_0293848 | 3300049587 | Bacteria | 1231 |
| 1990 | Ga0501072_0006469 | 3300049588 | Bacteria | 8920 |
| 1991 | Ga0501072_0007497 | 3300049588 | Bacteria | 8280 |
| 1992 | Ga0501072_0298024 | 3300049588 | Bacteria | 1282 |
| 1993 | Ga0501072_0693278 | 3300049588 | Bacteria | 801 |
| 1994 | Ga0501073_0030301 | 3300049589 | Bacteria | 3863 |
| 1995 | Ga0501073_0111058 | 3300049589 | Bacteria | 1902 |
| 1996 | Ga0501073_0202041 | 3300049589 | Bacteria | 1374 |
| 1997 | Ga0501073_0217534 | 3300049589 | Bacteria | 1320 |
| 1998 | Ga0501073_0438839 | 3300049589 | Bacteria | 902 |
| 1999 | Ga0501073_0507685 | 3300049589 | Bacteria | 833 |
| 2000 | Ga0501073_0513554 | 3300049589 | Bacteria | 828 |
| 2001 | Ga0501073_0669927 | 3300049589 | Bacteria | 716 |
| 2002 | Ga0501074_0279253 | 3300049590 | Bacteria | 1187 |
| 2003 | Ga0501074_0399881 | 3300049590 | Bacteria | 974 |
| 2004 | Ga0501074_0750382 | 3300049590 | Bacteria | 688 |
| 2005 | Ga0501075_0091594 | 3300049591 | Bacteria | 2307 |
| 2006 | Ga0501075_0298241 | 3300049591 | Bacteria | 1228 |
| 2007 | Ga0501075_0584864 | 3300049591 | Bacteria | 852 |
| 2008 | Ga0501076_0019729 | 3300049592 | Bacteria | 5156 |
| 2009 | Ga0501076_0111236 | 3300049592 | Bacteria | 2214 |
| 2010 | Ga0501076_0124026 | 3300049592 | Bacteria | 2092 |
| 2011 | Ga0501076_0264061 | 3300049592 | Bacteria | 1410 |
| 2012 | Ga0501077_0135215 | 3300049593 | Bacteria | 1564 |
| 2013 | Ga0501243_055495 | 3300049675 | Bacteria | 724 |
| 2014 | Ga0501253_131304 | 3300049683 | Bacteria | 616 |
| 2015 | Ga0501259_142044 | 3300049688 | Bacteria | 588 |
| 2016 | Ga0501079_0019839 | 3300049741 | Bacteria | 5136 |
| 2017 | Ga0501079_0101613 | 3300049741 | Bacteria | 2230 |
| 2018 | Ga0501079_0339646 | 3300049741 | Bacteria | 1176 |
| 2019 | Ga0501079_0659442 | 3300049741 | Bacteria | 824 |
| 2020 | Ga0501079_0754810 | 3300049741 | Bacteria | 766 |
| 2021 | Ga0501079_0863338 | 3300049741 | Bacteria | 713 |
| 2022 | Ga0501080_0027939 | 3300049742 | Bacteria | 5246 |
| 2023 | Ga0501080_0032171 | 3300049742 | Bacteria | 4890 |
| 2024 | Ga0501080_0079896 | 3300049742 | Bacteria | 3040 |
| 2025 | Ga0501080_0097738 | 3300049742 | Bacteria | 2726 |
| 2026 | Ga0501080_0151156 | 3300049742 | Bacteria | 2146 |
| 2027 | Ga0501080_0330730 | 3300049742 | Bacteria | 1378 |
| 2028 | Ga0501081_0004665 | 3300049743 | Bacteria | 8811 |
| 2029 | Ga0501081_0066924 | 3300049743 | Bacteria | 2499 |
| 2030 | Ga0501081_0122167 | 3300049743 | Bacteria | 1856 |
| 2031 | Ga0501083_0005990 | 3300049744 | Bacteria | 8611 |
| 2032 | Ga0501083_0042949 | 3300049744 | Bacteria | 3063 |
| 2033 | Ga0501083_0083005 | 3300049744 | Bacteria | 2122 |
| 2034 | Ga0501083_0270798 | 3300049744 | Bacteria | 1105 |
| 2035 | Ga0501083_0399139 | 3300049744 | Bacteria | 895 |
| 2036 | Ga0501083_0697781 | 3300049744 | Bacteria | 660 |
| 2037 | Ga0501268_023113 | 3300049765 | Bacteria | 1078 |
| 2038 | Ga0501280_075591 | 3300049776 | Bacteria | 611 |
| 2039 | Ga0501035_0055995 | 3300049822 | Bacteria | 3520 |
| 2040 | Ga0501035_0073162 | 3300049822 | Bacteria | 3032 |
| 2041 | Ga0501035_0090103 | 3300049822 | Bacteria | 2700 |
| 2042 | Ga0501035_0120821 | 3300049822 | Bacteria | 2290 |
| 2043 | Ga0501035_0126146 | 3300049822 | Bacteria | 2234 |
| 2044 | Ga0501035_0229518 | 3300049822 | Bacteria | 1582 |
| 2045 | Ga0501035_0321314 | 3300049822 | Bacteria | 1300 |
| 2046 | Ga0501035_0493632 | 3300049822 | Bacteria | 1008 |
| 2047 | Ga0501044_0007994 | 3300049823 | Bacteria | 11621 |
| 2048 | Ga0501044_0009855 | 3300049823 | Bacteria | 10385 |
| 2049 | Ga0501044_0076782 | 3300049823 | Bacteria | 3389 |
| 2050 | Ga0501044_0083877 | 3300049823 | Bacteria | 3221 |
| 2051 | Ga0501044_0093477 | 3300049823 | Bacteria | 3032 |
| 2052 | Ga0501044_0154315 | 3300049823 | Bacteria | 2276 |
| 2053 | Ga0501044_0154552 | 3300049823 | Bacteria | 2274 |
| 2054 | Ga0501044_0161764 | 3300049823 | Bacteria | 2215 |
| 2055 | Ga0501044_0191698 | 3300049823 | Bacteria | 2006 |
| 2056 | Ga0501044_0368466 | 3300049823 | Bacteria | 1353 |
| 2057 | Ga0501044_0384559 | 3300049823 | Bacteria | 1318 |
| 2058 | Ga0501044_0463960 | 3300049823 | Bacteria | 1171 |
| 2059 | Ga0501044_0471468 | 3300049823 | Bacteria | 1159 |
| 2060 | Ga0501044_0574218 | 3300049823 | Bacteria | 1023 |
| 2061 | Ga0501044_0722177 | 3300049823 | Bacteria | 880 |
| 2062 | Ga0501044_1096889 | 3300049823 | Bacteria | 665 |
| 2063 | nmdc:mga03683_192237_c1 | 3300050489 | Bacteria | 934 |
| 2064 | nmdc:mga03683_33053_c1 | 3300050489 | Bacteria | 2084 |
| 2065 | nmdc:mga03683_97080_c1 | 3300050489 | Bacteria | 1291 |
| 2066 | nmdc:mga03n38_636598_c1 | 3300050490 | Bacteria | 610 |
| 2067 | nmdc:mga03n38_699629_c1 | 3300050490 | Bacteria | 584 |
| 2068 | nmdc:mga00v17_179599_c1 | 3300050491 | Bacteria | 1366 |
| 2069 | nmdc:mga00v17_254254_c1 | 3300050491 | Bacteria | 1139 |
| 2070 | nmdc:mga00v17_850766_c1 | 3300050491 | Bacteria | 579 |
| 2071 | nmdc:mga0yw44_197226_c1 | 3300050492 | Bacteria | 1329 |
| 2072 | nmdc:mga0yw44_24684_c1 | 3300050492 | Bacteria | 3406 |
| 2073 | nmdc:mga0yw44_320641_c1 | 3300050492 | Bacteria | 1040 |
| 2074 | nmdc:mga0yw44_5178_c1 | 3300050492 | Bacteria | 6110 |
| 2075 | nmdc:mga0yw44_72129_c1 | 3300050492 | Bacteria | 2146 |
| 2076 | nmdc:mga0k408_176885_c1 | 3300050493 | Bacteria | 1272 |
| 2077 | nmdc:mga0k408_43959_c1 | 3300050493 | Bacteria | 2575 |
| 2078 | nmdc:mga06z11_105625_c1 | 3300050494 | Bacteria | 1552 |
| 2079 | nmdc:mga06z11_206429_c1 | 3300050494 | Bacteria | 1143 |
| 2080 | nmdc:mga06z11_28022_c1 | 3300050494 | Bacteria | 2699 |
| 2081 | nmdc:mga06z11_403118_c1 | 3300050494 | Bacteria | 823 |
| 2082 | nmdc:mga06z11_413932_c1 | 3300050494 | Bacteria | 812 |
| 2083 | nmdc:mga06z11_455955_c1 | 3300050494 | Bacteria | 773 |
| 2084 | nmdc:mga06z11_5834_c1 | 3300050494 | Bacteria | 4970 |
| 2085 | nmdc:mga04h51_28279_c1 | 3300050495 | Bacteria | 1748 |
| 2086 | nmdc:mga04h51_303378_c1 | 3300050495 | Bacteria | 651 |
| 2087 | nmdc:mga07m45_325211_c1 | 3300050496 | Bacteria | 894 |
| 2088 | nmdc:mga07m45_514818_c1 | 3300050496 | Bacteria | 693 |
| 2089 | nmdc:mga05p37_1103959_c1 | 3300050507 | Bacteria | 830 |
| 2090 | nmdc:mga05p37_1402269_c1 | 3300050507 | Bacteria | 703 |
| 2091 | nmdc:mga05p37_203667_c1 | 3300050507 | Bacteria | 2395 |
| 2092 | nmdc:mga05p37_295714_c1 | 3300050507 | Bacteria | 1926 |
| 2093 | nmdc:mga05p37_346454_c1 | 3300050507 | Bacteria | 1750 |
| 2094 | nmdc:mga05p37_427886_c1 | 3300050507 | Bacteria | 1539 |
| 2095 | nmdc:mga05p37_478293_c1 | 3300050507 | Bacteria | 1435 |
| 2096 | nmdc:mga05p37_843418_c1 | 3300050507 | Bacteria | 996 |
| 2097 | nmdc:mga09592_110127_c1 | 3300050508 | Bacteria | 2362 |
| 2098 | nmdc:mga09592_572805_c1 | 3300050508 | Bacteria | 969 |
| 2099 | nmdc:mga09592_583050_c1 | 3300050508 | Bacteria | 959 |
| 2100 | nmdc:mga0qj67_110_c1 | 3300050509 | Bacteria | 54139 |
| 2101 | nmdc:mga0qj67_192888_c1 | 3300050509 | Bacteria | 1655 |
| 2102 | nmdc:mga0qj67_210707_c1 | 3300050509 | Bacteria | 1578 |
| 2103 | nmdc:mga0qj67_45773_c1 | 3300050509 | Bacteria | 3452 |
| 2104 | nmdc:mga0qj67_895066_c1 | 3300050509 | Bacteria | 699 |
| 2105 | nmdc:mga06r32_140579_c1 | 3300050510 | Bacteria | 2390 |
| 2106 | nmdc:mga06r32_240550_c1 | 3300050510 | Bacteria | 1798 |
| 2107 | nmdc:mga06r32_357616_c1 | 3300050510 | Bacteria | 1444 |
| 2108 | nmdc:mga06r32_69907_c1 | 3300050510 | Bacteria | 3394 |
| 2109 | nmdc:mga08y16_1040336_c1 | 3300050511 | Bacteria | 797 |
| 2110 | nmdc:mga08y16_105316_c1 | 3300050511 | Bacteria | 2936 |
| 2111 | nmdc:mga08y16_112073_c1 | 3300050511 | Bacteria | 2840 |
| 2112 | nmdc:mga08y16_1179181_c1 | 3300050511 | Bacteria | 737 |
| 2113 | nmdc:mga08y16_16917_c1 | 3300050511 | Bacteria | 7680 |
| 2114 | nmdc:mga08y16_20977_c1 | 3300050511 | Bacteria | 6897 |
| 2115 | nmdc:mga08y16_311778_c1 | 3300050511 | Bacteria | 1620 |
| 2116 | nmdc:mga0n895_1204055_c1 | 3300050512 | Bacteria | 731 |
| 2117 | nmdc:mga0n895_30484_c1 | 3300050512 | Bacteria | 5155 |
| 2118 | nmdc:mga0n895_313048_c1 | 3300050512 | Bacteria | 1591 |
| 2119 | nmdc:mga0n895_32647_c1 | 3300050512 | Bacteria | 4998 |
| 2120 | nmdc:mga0n895_43218_c1 | 3300050512 | Bacteria | 4390 |
| 2121 | nmdc:mga0n895_821186_c1 | 3300050512 | Bacteria | 616 |
| 2122 | nmdc:mga0n895_848429_c1 | 3300050512 | Bacteria | 901 |
| 2123 | nmdc:mga0rr50_106113_c1 | 3300050513 | Bacteria | 2216 |
| 2124 | nmdc:mga0rr50_1154146_c1 | 3300050513 | Bacteria | 658 |
| 2125 | nmdc:mga0rr50_295143_c1 | 3300050513 | Bacteria | 1355 |
| 2126 | nmdc:mga0rr50_304657_c1 | 3300050513 | Bacteria | 1333 |
| 2127 | nmdc:mga0rr50_509303_c1 | 3300050513 | Bacteria | 1024 |
| 2128 | nmdc:mga08x19_197103_c1 | 3300050514 | Bacteria | 1379 |
| 2129 | nmdc:mga08x19_348162_c1 | 3300050514 | Bacteria | 1034 |
| 2130 | nmdc:mga08x19_62131_c1 | 3300050514 | Bacteria | 2421 |
| 2131 | nmdc:mga08x19_7671_c1 | 3300050514 | Bacteria | 6406 |
| 2132 | nmdc:mga08x19_96968_c1 | 3300050514 | Bacteria | 1952 |
| 2133 | nmdc:mga0a205_199291_c1 | 3300050515 | Bacteria | 1893 |
| 2134 | nmdc:mga0a205_485_c2 | 3300050515 | Bacteria | 14949 |
| 2135 | nmdc:mga0a205_80824_c1 | 3300050515 | Bacteria | 3140 |
| 2136 | nmdc:mga0a205_815016_c1 | 3300050515 | Bacteria | 781 |
| 2137 | nmdc:mga0sz30_39284_c1 | 3300050516 | Bacteria | 1985 |
| 2138 | Ga0495601_0001249 | 3300053077 | Bacteria | 13944 |
| 2139 | Ga0495601_0005437 | 3300053077 | Bacteria | 7418 |
| 2140 | Ga0495601_0020790 | 3300053077 | Bacteria | 4011 |
| 2141 | Ga0495601_0029740 | 3300053077 | Bacteria | 3390 |
| 2142 | Ga0495601_0165209 | 3300053077 | Bacteria | 1447 |
| 2143 | Ga0495612_0001253 | 3300053078 | Bacteria | 10465 |
| 2144 | Ga0495612_0008705 | 3300053078 | Bacteria | 4115 |
| 2145 | Ga0495612_0130839 | 3300053078 | Bacteria | 1084 |
| 2146 | Ga0495612_0198168 | 3300053078 | Bacteria | 885 |
| 2147 | Ga0500635_0015409 | 3300053080 | Bacteria | 2258 |
| 2148 | Ga0495655_0012906 | 3300053083 | Bacteria | 1714 |
| 2149 | Ga0495595_0000908 | 3300053084 | Bacteria | 11418 |
| 2150 | Ga0495595_0002372 | 3300053084 | Bacteria | 7341 |
| 2151 | Ga0495595_0169026 | 3300053084 | Bacteria | 1082 |
| 2152 | Ga0495619_0003156 | 3300053085 | Bacteria | 10692 |
| 2153 | Ga0495619_0005876 | 3300053085 | Bacteria | 7774 |
| 2154 | Ga0495619_0040506 | 3300053085 | Bacteria | 3045 |
| 2155 | Ga0495619_0060676 | 3300053085 | Bacteria | 2514 |
| 2156 | Ga0495619_0061545 | 3300053085 | Bacteria | 2498 |
| 2157 | Ga0500643_000003 | 3300053087 | Bacteria | 876659 |
| 2158 | Ga0500647_0278844 | 3300053091 | Bacteria | 723 |
| 2159 | Ga0500566_0103446 | 3300053094 | Bacteria | 1558 |
| 2160 | Ga0500566_0430688 | 3300053094 | Bacteria | 582 |
| 2161 | Ga0500641_0080812 | 3300053096 | Bacteria | 1379 |
| 2162 | Ga0500648_199276 | 3300053097 | Bacteria | 1008 |
| 2163 | Ga0500558_143487 | 3300053106 | Bacteria | 896 |
| 2164 | Ga0500592_040571 | 3300053116 | Bacteria | 753 |
| 2165 | Ga0500595_000096 | 3300053119 | Bacteria | 61002 |
| 2166 | Ga0500595_036587 | 3300053119 | Bacteria | 1607 |
| 2167 | Ga0500595_041856 | 3300053119 | Bacteria | 1470 |
| 2168 | Ga0500595_088417 | 3300053119 | Bacteria | 899 |
| 2169 | Ga0500618_003035 | 3300053125 | Bacteria | 5964 |
| 2170 | Ga0500628_152685 | 3300053129 | Bacteria | 647 |
| 2171 | Ga0500642_0147330 | 3300053130 | Bacteria | 1105 |
| 2172 | Ga0500559_0167038 | 3300053136 | Bacteria | 1034 |
| 2173 | Ga0500564_235778 | 3300053138 | Bacteria | 733 |
| 2174 | Ga0500568_0009896 | 3300053139 | Bacteria | 4504 |
| 2175 | Ga0500573_0000002 | 3300053140 | Bacteria | 407088 |
| 2176 | Ga0500573_0013140 | 3300053140 | Bacteria | 4660 |
| 2177 | Ga0500603_058966 | 3300053150 | Bacteria | 1069 |
| 2178 | Ga0500616_0002365 | 3300053153 | Bacteria | 15857 |
| 2179 | Ga0500616_0259111 | 3300053153 | Bacteria | 739 |
| 2180 | Ga0500619_147881 | 3300053154 | Bacteria | 800 |
| 2181 | Ga0500638_149454 | 3300053162 | Bacteria | 1040 |
| 2182 | Ga0500639_135040 | 3300053163 | Bacteria | 1163 |
| 2183 | Ga0500636_0000044 | 3300053177 | Bacteria | 66762 |
| 2184 | Ga0500636_0087924 | 3300053177 | Bacteria | 1782 |
| 2185 | Ga0500636_0253672 | 3300053177 | Bacteria | 895 |
| 2186 | Ga0500645_034726 | 3300053730 | Bacteria | 1506 |
| 2187 | Ga0500645_078168 | 3300053730 | Bacteria | 945 |
| 2188 | Ga0500596_019464 | 3300053735 | Bacteria | 1020 |
| 2189 | Ga0501084_0000049 | 3300054114 | Bacteria | 94947 |
| 2190 | Ga0501084_0006919 | 3300054114 | Bacteria | 9335 |
| 2191 | Ga0501084_0014455 | 3300054114 | Bacteria | 6542 |
| 2192 | Ga0501084_0071047 | 3300054114 | Bacteria | 2914 |
| 2193 | Ga0501084_0093223 | 3300054114 | Bacteria | 2528 |
| 2194 | Ga0501084_0143212 | 3300054114 | Bacteria | 2013 |
| 2195 | Ga0501084_0176012 | 3300054114 | Bacteria | 1806 |
| 2196 | Ga0501084_0482857 | 3300054114 | Bacteria | 1047 |
| 2197 | Ga0501084_0554901 | 3300054114 | Bacteria | 971 |
| 2198 | Ga0501084_0953143 | 3300054114 | Bacteria | 721 |
| 2199 | Ga0501084_1160584 | 3300054114 | Bacteria | 648 |
| 2200 | Ga0501084_1386455 | 3300054114 | Bacteria | 589 |
| 2201 | Ga0587084_013044 | 3300059477 | Bacteria | 1136 |
| 2202 | Ga0587066_020471 | 3300059490 | Bacteria | 1087 |
| 2203 | Ga0587070_022744 | 3300059491 | Bacteria | 1070 |
| 2204 | Ga0587073_0060983 | 3300059492 | Bacteria | 884 |
| 2205 | Ga0587077_018926 | 3300059493 | Bacteria | 1192 |
| 2206 | Ga0587077_081476 | 3300059493 | Bacteria | 744 |
| 2207 | Ga0587080_025810 | 3300059503 | Bacteria | 994 |
| 2208 | Ga0587080_026354 | 3300059503 | Bacteria | 987 |
| 2209 | Ga0587083_0035659 | 3300059505 | Bacteria | 1015 |
| 2210 | Ga0587085_019087 | 3300059506 | Bacteria | 1024 |
| 2211 | Ga0587088_026948 | 3300059508 | Bacteria | 1001 |
| 2212 | Ga0587089_042684 | 3300059509 | Bacteria | 706 |
| 2213 | Ga0587089_050426 | 3300059509 | Bacteria | 667 |
| 2214 | Ga0587090_018670 | 3300059510 | Bacteria | 1062 |
| 2215 | Ga0587091_018613 | 3300059511 | Bacteria | 1184 |
| 2216 | Ga0587101_008409 | 3300059623 | Bacteria | 1246 |
| 2217 | Ga0587109_013812 | 3300059624 | Bacteria | 1346 |
| 2218 | Ga0587115_013681 | 3300059626 | Bacteria | 1053 |
| 2219 | Ga0587128_019433 | 3300059630 | Bacteria | 1029 |
| 2220 | Ga0587062_014590 | 3300059639 | Bacteria | 1039 |
| 2221 | Ga0587067_013983 | 3300059640 | Bacteria | 1280 |
| 2222 | Ga0587072_020857 | 3300059643 | Bacteria | 1158 |
| 2223 | Ga0587075_017541 | 3300059644 | Bacteria | 1031 |
| 2224 | Ga0587076_023815 | 3300059645 | Bacteria | 1034 |
| 2225 | Ga0587076_132310 | 3300059645 | Bacteria | 589 |
| 2226 | Ga0587078_010640 | 3300059646 | Bacteria | 1059 |
| 2227 | Ga0587079_070651 | 3300059647 | Bacteria | 778 |
| 2228 | Ga0587105_001741 | 3300059651 | Bacteria | 1168 |
| 2229 | Ga0587107_013776 | 3300059652 | Bacteria | 1031 |
| 2230 | Ga0587110_038127 | 3300059654 | Bacteria | 609 |
| 2231 | Ga0587111_0036701 | 3300060346 | Bacteria | 1027 |
| 2232 | Ga0501082_0031765 | 3300060353 | Bacteria | 4554 |
| 2233 | Ga0501082_0053384 | 3300060353 | Bacteria | 3484 |
| 2234 | Ga0501082_0406412 | 3300060353 | Bacteria | 1188 |
| 2235 | Ga0501082_0409845 | 3300060353 | Bacteria | 1183 |
| 2236 | Ga0501082_0566261 | 3300060353 | Bacteria | 994 |
| 2237 | Ga0501082_0823041 | 3300060353 | Bacteria | 812 |
| 2238 | Ga0501082_1549695 | 3300060353 | Bacteria | 579 |
| 2239 | Ga0530510_0081435 | 3300061734 | Bacteria | 2357 |
| 2240 | Ga0530510_0468780 | 3300061734 | Bacteria | 953 |
| 2241 | Ga0530510_0494603 | 3300061734 | Bacteria | 927 |
| 2242 | 2600201226 | 2599185354 | Bacteria | 4398675 |
| 2243 | 2842695820 | 2842694124 | Bacteria | 4063419 |
| 2244 | Ga0373944_0001645 | |||
| 2245 | 2214761875 | |||
| 2246 | ARcpr5oldR_c000005 | |||
| 2247 | ARSoilYngRDRAFT_c00135 | |||
| 2248 | ARcpr5yngRDRAFT_c000073 | |||
| 2249 | ARSoilOldRDRAFT_c000012 | |||
| 2250 | ARCol0oldRDRAFT_c02295 | |||
| 2251 | ARCol0yngRDRAFT_1000066 | |||
| 2252 | JGI24032J14994_100207 | |||
| 2253 | JGI24736J21556_1007134 | |||
| 2254 | JGI24736J21556_1079992 | |||
| 2255 | JGI24752J21851_1002466 | |||
| 2256 | JGI24746J21847_1002567 | |||
| 2257 | JGI24747J21853_1000229 | |||
| 2258 | JGI24740J21852_10024312 | |||
| 2259 | JGI24739J22299_10000451 | |||
| 2260 | JGI24739J22299_10006960 | |||
| 2261 | JGI24739J22299_10207394 | |||
| 2262 | JGI24737J22298_10003545 | |||
| 2263 | JGI24737J22298_10013316 | |||
| 2264 | JGI24737J22298_10044531 | |||
| 2265 | JGI24737J22298_10089320 | |||
| 2266 | JGI24743J22301_10045512 | |||
| 2267 | JGI24750J21931_1000063 | |||
| 2268 | JGI24750J21931_1017352 | |||
| 2269 | JGI24745J21846_1000659 | |||
| 2270 | JGI24738J21930_10000026 | |||
| 2271 | JGI24749J21850_1001547 | |||
| 2272 | JGI24744J21845_10007253 | |||
| 2273 | JGI24744J21845_10009430 | |||
| 2274 | JGI24744J21845_10029022 | |||
| 2275 | JGI24035J26624_1000384 | |||
| 2276 | JGI24034J26672_10000450 | |||
| 2277 | JGI24742J22300_10000100 | |||
| 2278 | JGI24751J29686_10008012 | |||
| 2279 | JGI25151J46595_10000047 | |||
| 2280 | JGI25151J46595_10000086 | |||
| 2281 | JGI25165J46597_1000003 | |||
| 2282 | JGI25153J46596_10016624 | |||
| 2283 | Ga0007417J51691_1068927 | |||
| 2284 | Ga0055526_1000102 | |||
| 2285 | Ga0055524_1000352 | |||
| 2286 | Ga0055534_1064744 | |||
| 2287 | Ga0055531_10008796 | |||
| 2288 | JGI25405J52794_10005629 | |||
| 2289 | JGI25405J52794_10040755 | |||
| 2290 | JGI25405J52794_10064746 | |||
| 2291 | Ga0065165_1003966 | |||
| 2292 | Ga0065714_10210453 | |||
| 2293 | Ga0065704_10078881 | |||
| 2294 | Ga0065704_10226081 | |||
| 2295 | Ga0065712_10000705 | |||
| 2296 | Ga0065712_10085237 | |||
| 2297 | Ga0065712_10125464 | |||
| 2298 | Ga0065715_10003686 | |||
| 2299 | Ga0065715_10090522 | |||
| 2300 | Ga0065715_10170204 | |||
| 2301 | Ga0065707_10257648 | |||
| 2302 | Ga0070658_10026441 | |||
| 2303 | Ga0070658_10027112 | |||
| 2304 | Ga0070658_10038663 | |||
| 2305 | Ga0070676_10001250 | |||
| 2306 | Ga0070676_10040362 | |||
| 2307 | Ga0070676_10137593 | |||
| 2308 | Ga0070676_10175776 | |||
| 2309 | Ga0070676_10353966 | |||
| 2310 | Ga0070683_100148475 | |||
| 2311 | Ga0070683_100164558 | |||
| 2312 | Ga0070683_100187663 | |||
| 2313 | Ga0070683_100199397 | |||
| 2314 | Ga0070683_100598761 | |||
| 2315 | Ga0070683_101034666 | |||
| 2316 | Ga0070683_101545633 | |||
| 2317 | Ga0070690_100008879 | |||
| 2318 | Ga0070690_100029592 | |||
| 2319 | Ga0070690_100119144 | |||
| 2320 | Ga0070690_100125557 | |||
| 2321 | Ga0070690_100270483 | |||
| 2322 | Ga0070690_100313837 | |||
| 2323 | Ga0070670_100011383 | |||
| 2324 | Ga0070670_100032043 | |||
| 2325 | Ga0070670_100414291 | |||
| 2326 | Ga0070670_100615852 | |||
| 2327 | Ga0070677_10000055 | |||
| 2328 | Ga0070677_10305642 | |||
| 2329 | Ga0068869_100001739 | |||
| 2330 | Ga0068869_100005143 | |||
| 2331 | Ga0068869_100035364 | |||
| 2332 | Ga0068869_100625513 | |||
| 2333 | Ga0068869_100934871 | |||
| 2334 | Ga0070666_10030353 | |||
| 2335 | Ga0070666_10041771 | |||
| 2336 | Ga0070666_10044519 | |||
| 2337 | Ga0070666_10053330 | |||
| 2338 | Ga0070666_10187419 | |||
| 2339 | Ga0070666_10255372 | |||
| 2340 | Ga0070666_10710186 | |||
| 2341 | Ga0070666_10810409 | |||
| 2342 | Ga0070680_100051886 | |||
| 2343 | Ga0070680_100053620 | |||
| 2344 | Ga0070680_100097846 | |||
| 2345 | Ga0070680_100249054 | |||
| 2346 | Ga0070680_100256283 | |||
| 2347 | Ga0070680_100345980 | |||
| 2348 | Ga0070680_100703492 | |||
| 2349 | Ga0070682_100008777 | |||
| 2350 | Ga0070682_100060665 | |||
| 2351 | Ga0070682_100286001 | |||
| 2352 | Ga0070682_100398109 | |||
| 2353 | Ga0070682_100544002 | |||
| 2354 | Ga0068868_100002440 | |||
| 2355 | Ga0068868_100188069 | |||
| 2356 | Ga0068868_100275076 | |||
| 2357 | Ga0068868_100570421 | |||
| 2358 | Ga0068868_101084750 | |||
| 2359 | Ga0068868_101217280 | |||
| 2360 | Ga0070660_100009251 | |||
| 2361 | Ga0070660_100056274 | |||
| 2362 | Ga0070660_100500742 | |||
| 2363 | Ga0070660_100880426 | |||
| 2364 | Ga0070660_100885150 | |||
| 2365 | Ga0070689_100003427 | |||
| 2366 | Ga0070689_100042064 | |||
| 2367 | Ga0070689_100056550 | |||
| 2368 | Ga0070689_100382832 | |||
| 2369 | Ga0070689_100725162 | |||
| 2370 | Ga0070691_10018238 | |||
| 2371 | Ga0070691_10022689 | |||
| 2372 | Ga0070691_10246927 | |||
| 2373 | Ga0070691_10730788 | |||
| 2374 | Ga0070687_100001219 | |||
| 2375 | Ga0070687_100120563 | |||
| 2376 | Ga0070687_100143043 | |||
| 2377 | Ga0070687_100291039 | |||
| 2378 | Ga0070661_100000019 | |||
| 2379 | Ga0070661_100005369 | |||
| 2380 | Ga0070661_100140071 | |||
| 2381 | Ga0070661_100164493 | |||
| 2382 | Ga0070661_100279043 | |||
| 2383 | Ga0070661_100362815 | |||
| 2384 | Ga0070692_10002445 | |||
| 2385 | Ga0070692_10029257 | |||
| 2386 | Ga0070668_100010381 | |||
| 2387 | Ga0070668_100018336 | |||
| 2388 | Ga0070668_100090379 | |||
| 2389 | Ga0070668_100191925 | |||
| 2390 | Ga0070668_100514223 | |||
| 2391 | Ga0070669_100003432 | |||
| 2392 | Ga0070669_100037713 | |||
| 2393 | Ga0070669_100097844 | |||
| 2394 | Ga0070669_100115265 | |||
| 2395 | Ga0070669_100586699 | |||
| 2396 | Ga0070669_100680143 | |||
| 2397 | Ga0070669_101579383 | |||
| 2398 | Ga0070675_100009751 | |||
| 2399 | Ga0070675_100013224 | |||
| 2400 | Ga0070675_100063934 | |||
| 2401 | Ga0070675_100249883 | |||
| 2402 | Ga0070671_100000344 | |||
| 2403 | Ga0070671_100023576 | |||
| 2404 | Ga0070671_100043720 | |||
| 2405 | Ga0070671_100075836 | |||
| 2406 | Ga0070671_100880547 | |||
| 2407 | Ga0070674_100000250 | |||
| 2408 | Ga0070674_100165387 | |||
| 2409 | Ga0070674_100443704 | |||
| 2410 | Ga0070673_100001701 | |||
| 2411 | Ga0070673_100198620 | |||
| 2412 | Ga0070673_100199611 | |||
| 2413 | Ga0070673_100216864 | |||
| 2414 | Ga0070673_100328174 | |||
| 2415 | Ga0070673_101077394 | |||
| 2416 | Ga0070688_100005899 | |||
| 2417 | Ga0070688_100011287 | |||
| 2418 | Ga0070688_100069914 | |||
| 2419 | Ga0070659_100015535 | |||
| 2420 | Ga0070659_100066094 | |||
| 2421 | Ga0070659_100072266 | |||
| 2422 | Ga0070659_100274884 | |||
| 2423 | Ga0070659_100345762 | |||
| 2424 | Ga0070659_100369380 | |||
| 2425 | Ga0070667_100009616 | |||
| 2426 | Ga0070667_100010027 | |||
| 2427 | Ga0070667_100015965 | |||
| 2428 | Ga0070667_100170241 | |||
| 2429 | Ga0070667_100383742 | |||
| 2430 | Ga0070703_10003768 | |||
| 2431 | Ga0070709_10002940 | |||
| 2432 | Ga0070709_10058623 | |||
| 2433 | Ga0070709_10075450 | |||
| 2434 | Ga0070709_10080351 | |||
| 2435 | Ga0070714_100038980 | |||
| 2436 | Ga0070714_100044928 | |||
| 2437 | Ga0070714_100064144 | |||
| 2438 | Ga0070714_100167380 | |||
| 2439 | Ga0070714_100978931 | |||
| 2440 | Ga0070714_101342156 | |||
| 2441 | Ga0070713_100005484 | |||
| 2442 | Ga0070713_100100286 | |||
| 2443 | Ga0070713_100100653 | |||
| 2444 | Ga0070713_100457250 | |||
| 2445 | Ga0070713_100630439 | |||
| 2446 | Ga0070713_101097523 | |||
| 2447 | Ga0070710_10008043 | |||
| 2448 | Ga0070710_10093518 | |||
| 2449 | Ga0070701_10002806 | |||
| 2450 | Ga0070701_10193715 | |||
| 2451 | Ga0070711_100002519 | |||
| 2452 | Ga0070711_100079918 | |||
| 2453 | Ga0070711_100239710 | |||
| 2454 | Ga0070711_100451133 | |||
| 2455 | Ga0070711_100648831 | |||
| 2456 | Ga0070711_101384736 | |||
| 2457 | Ga0070705_100014699 | |||
| 2458 | Ga0070705_100042721 | |||
| 2459 | Ga0070705_100077733 | |||
| 2460 | Ga0070700_100045586 | |||
| 2461 | Ga0070700_100141319 | |||
| 2462 | Ga0070700_100283134 | |||
| 2463 | Ga0070700_100380964 | |||
| 2464 | Ga0070694_100021143 | |||
| 2465 | Ga0070694_100113915 | |||
| 2466 | Ga0070694_100533491 | |||
| 2467 | Ga0070694_100613062 | |||
| 2468 | Ga0070694_100635640 | |||
| 2469 | Ga0070708_100032307 | |||
| 2470 | Ga0070708_100062532 | |||
| 2471 | Ga0070708_100998906 | |||
| 2472 | Ga0070663_100029594 | |||
| 2473 | Ga0070663_100063184 | |||
| 2474 | Ga0070663_100114973 | |||
| 2475 | Ga0070663_100539499 | |||
| 2476 | Ga0070663_100898540 | |||
| 2477 | Ga0070678_100000784 | |||
| 2478 | Ga0070678_100149910 | |||
| 2479 | Ga0070678_100330483 | |||
| 2480 | Ga0070678_100344505 | |||
| 2481 | Ga0070678_100432434 | |||
| 2482 | Ga0070662_100050231 | |||
| 2483 | Ga0070662_100062081 | |||
| 2484 | Ga0070662_100078824 | |||
| 2485 | Ga0070681_10021719 | |||
| 2486 | Ga0070681_10053171 | |||
| 2487 | Ga0070681_10156394 | |||
| 2488 | Ga0070681_10165291 | |||
| 2489 | Ga0070681_10226633 | |||
| 2490 | Ga0070681_10469003 | |||
| 2491 | Ga0068867_100002792 | |||
| 2492 | Ga0068867_100005970 | |||
| 2493 | Ga0068867_100021169 | |||
| 2494 | Ga0068867_100032862 | |||
| 2495 | Ga0068867_100406759 | |||
| 2496 | Ga0068867_100981517 | |||
| 2497 | Ga0070685_10001307 | |||
| 2498 | Ga0070685_10004363 | |||
| 2499 | Ga0070685_10023513 | |||
| 2500 | Ga0070685_10261202 | |||
| 2501 | Ga0070707_100065762 | |||
| 2502 | Ga0070707_101006386 | |||
| 2503 | Ga0070698_100045789 | |||
| 2504 | Ga0070698_100291936 | |||
| 2505 | Ga0074259_10113202 | |||
| 2506 | Ga0070699_100089245 | |||
| 2507 | Ga0070679_100019810 | |||
| 2508 | Ga0070679_100029886 | |||
| 2509 | Ga0070679_100065568 | |||
| 2510 | Ga0070679_100075069 | |||
| 2511 | Ga0070679_100125965 | |||
| 2512 | Ga0070679_100130785 | |||
| 2513 | Ga0070679_100138507 | |||
| 2514 | Ga0070679_100255315 | |||
| 2515 | Ga0070679_100310154 | |||
| 2516 | Ga0070679_100478903 | |||
| 2517 | Ga0070679_101207180 | |||
| 2518 | Ga0070684_100003800 | |||
| 2519 | Ga0070684_100074354 | |||
| 2520 | Ga0070684_100097748 | |||
| 2521 | Ga0070684_100138507 | |||
| 2522 | Ga0070684_100170317 | |||
| 2523 | Ga0070684_100698657 | |||
| 2524 | Ga0070697_100461969 | |||
| 2525 | Ga0070697_101029753 | |||
| 2526 | Ga0068853_100011082 | |||
| 2527 | Ga0068853_100024870 | |||
| 2528 | Ga0068853_100037962 | |||
| 2529 | Ga0068853_100066989 | |||
| 2530 | Ga0068853_100195671 | |||
| 2531 | Ga0068853_100236915 | |||
| 2532 | Ga0068853_100237056 | |||
| 2533 | Ga0068853_100243596 | |||
| 2534 | Ga0068853_100527773 | |||
| 2535 | Ga0068853_100652430 | |||
| 2536 | Ga0068853_100744453 | |||
| 2537 | Ga0068853_101170748 | |||
| 2538 | Ga0070672_100002659 | |||
| 2539 | Ga0070672_100019800 | |||
| 2540 | Ga0070672_100079029 | |||
| 2541 | Ga0070672_100368657 | |||
| 2542 | Ga0070672_100454588 | |||
| 2543 | Ga0070672_100728972 | |||
| 2544 | Ga0070686_100005374 | |||
| 2545 | Ga0070686_100006315 | |||
| 2546 | Ga0070686_100038764 | |||
| 2547 | Ga0070686_100418755 | |||
| 2548 | Ga0070686_100444268 | |||
| 2549 | Ga0070695_100048751 | |||
| 2550 | Ga0070695_100058121 | |||
| 2551 | Ga0070695_100176070 | |||
| 2552 | Ga0070696_100084241 | |||
| 2553 | Ga0070696_100099287 | |||
| 2554 | Ga0070696_100149510 | |||
| 2555 | Ga0070696_100156776 | |||
| 2556 | Ga0070696_100216148 | |||
| 2557 | Ga0070696_100510550 | |||
| 2558 | Ga0070696_100949167 | |||
| 2559 | Ga0070696_101264139 | |||
| 2560 | Ga0070693_100051208 | |||
| 2561 | Ga0070693_100052511 | |||
| 2562 | Ga0070693_100096064 | |||
| 2563 | Ga0070693_100148217 | |||
| 2564 | Ga0070693_100296266 | |||
| 2565 | Ga0070693_100414919 | |||
| 2566 | Ga0070665_100001666 | |||
| 2567 | Ga0070665_100064057 | |||
| 2568 | Ga0070665_100069966 | |||
| 2569 | Ga0070665_100078425 | |||
| 2570 | Ga0070665_100140532 | |||
| 2571 | Ga0070665_100148543 | |||
| 2572 | Ga0070665_100251134 | |||
| 2573 | Ga0070665_100296120 | |||
| 2574 | Ga0070665_100372487 | |||
| 2575 | Ga0070665_100395612 | |||
| 2576 | Ga0070665_100819901 | |||
| 2577 | Ga0070665_101008890 | |||
| 2578 | Ga0070665_101173653 | |||
| 2579 | Ga0070665_101269534 | |||
| 2580 | Ga0070704_100006508 | |||
| 2581 | Ga0070704_100067471 | |||
| 2582 | Ga0068855_100008197 | |||
| 2583 | Ga0068855_100012377 | |||
| 2584 | Ga0068855_100044569 | |||
| 2585 | Ga0068855_100086777 | |||
| 2586 | Ga0068855_100199544 | |||
| 2587 | Ga0068855_100206748 | |||
| 2588 | Ga0068855_100257719 | |||
| 2589 | Ga0068855_100495253 | |||
| 2590 | Ga0068855_100582375 | |||
| 2591 | Ga0068855_100848900 | |||
| 2592 | Ga0068855_100953411 | |||
| 2593 | Ga0068855_101020036 | |||
| 2594 | Ga0070664_100016247 | |||
| 2595 | Ga0070664_100106987 | |||
| 2596 | Ga0070664_100161050 | |||
| 2597 | Ga0070664_100279846 | |||
| 2598 | Ga0070664_100857165 | |||
| 2599 | Ga0068857_100007028 | |||
| 2600 | Ga0068857_100088413 | |||
| 2601 | Ga0068857_100139258 | |||
| 2602 | Ga0068857_100250095 | |||
| 2603 | Ga0068857_100537011 | |||
| 2604 | Ga0068857_100569377 | |||
| 2605 | Ga0068854_100003980 | |||
| 2606 | Ga0068854_100142780 | |||
| 2607 | Ga0068854_100430946 | |||
| 2608 | Ga0068854_100594912 | |||
| 2609 | Ga0068856_100000406 | |||
| 2610 | Ga0068856_100181218 | |||
| 2611 | Ga0068856_100199039 | |||
| 2612 | Ga0068856_100408200 | |||
| 2613 | Ga0068856_100917226 | |||
| 2614 | Ga0068856_100958480 | |||
| 2615 | Ga0068856_101079300 | |||
| 2616 | Ga0070702_100000099 | |||
| 2617 | Ga0070702_100008907 | |||
| 2618 | Ga0070702_100343183 | |||
| 2619 | Ga0070702_100358263 | |||
| 2620 | Ga0068852_100015801 | |||
| 2621 | Ga0068852_100026623 | |||
| 2622 | Ga0068852_100057377 | |||
| 2623 | Ga0068852_100173312 | |||
| 2624 | Ga0068852_100297706 | |||
| 2625 | Ga0068852_100389575 | |||
| 2626 | Ga0068852_100495730 | |||
| 2627 | Ga0068859_100002395 | |||
| 2628 | Ga0068859_100072467 | |||
| 2629 | Ga0068859_100094856 | |||
| 2630 | Ga0068859_100124644 | |||
| 2631 | Ga0068859_100617819 | |||
| 2632 | Ga0068859_101096576 | |||
| 2633 | Ga0068864_100001957 | |||
| 2634 | Ga0068864_100021360 | |||
| 2635 | Ga0068864_100075862 | |||
| 2636 | Ga0068864_100467562 | |||
| 2637 | Ga0068864_101158573 | |||
| 2638 | Ga0068864_101858767 | |||
| 2639 | Ga0068866_10001585 | |||
| 2640 | Ga0068866_10008946 | |||
| 2641 | Ga0068866_10039117 | |||
| 2642 | Ga0068866_10141830 | |||
| 2643 | Ga0068866_10219924 | |||
| 2644 | Ga0068866_10778945 | |||
| 2645 | Ga0068861_100000354 | |||
| 2646 | Ga0068861_100021977 | |||
| 2647 | Ga0068861_100061718 | |||
| 2648 | Ga0068861_100345957 | |||
| 2649 | Ga0068861_100727202 | |||
| 2650 | Ga0068861_101316366 | |||
| 2651 | Ga0068851_10105288 | |||
| 2652 | Ga0068851_10565114 | |||
| 2653 | Ga0068851_10651429 | |||
| 2654 | Ga0068870_10000165 | |||
| 2655 | Ga0068870_10049113 | |||
| 2656 | Ga0068870_10170947 | |||
| 2657 | Ga0068870_10241834 | |||
| 2658 | Ga0068863_100001449 | |||
| 2659 | Ga0068863_100016627 | |||
| 2660 | Ga0068863_100385215 | |||
| 2661 | Ga0068863_102342338 | |||
| 2662 | Ga0068858_100018513 | |||
| 2663 | Ga0068858_100045467 | |||
| 2664 | Ga0068858_100052996 | |||
| 2665 | Ga0068858_100360279 | |||
| 2666 | Ga0068858_100390938 | |||
| 2667 | Ga0068858_100411830 | |||
| 2668 | Ga0068858_100710224 | |||
| 2669 | Ga0068858_100936687 | |||
| 2670 | Ga0068860_100001477 | |||
| 2671 | Ga0068860_100015564 | |||
| 2672 | Ga0068860_100105189 | |||
| 2673 | Ga0068860_100472835 | |||
| 2674 | Ga0068862_100014775 | |||
| 2675 | Ga0068862_100062072 | |||
| 2676 | Ga0068862_100082075 | |||
| 2677 | Ga0068862_100327025 | |||
| 2678 | Ga0081455_10000327 | |||
| 2679 | Ga0081455_10001293 | |||
| 2680 | Ga0081455_10615716 | |||
| 2681 | Ga0081538_10014654 | |||
| 2682 | Ga0081540_1000108 | |||
| 2683 | Ga0081540_1019974 | |||
| 2684 | Ga0081540_1055343 | |||
| 2685 | Ga0081540_1096624 | |||
| 2686 | Ga0081540_1110301 | |||
| 2687 | Ga0081539_10209184 | |||
| 2688 | Ga0081539_10232325 | |||
| 2689 | Ga0070717_10001121 | |||
| 2690 | Ga0070717_10038847 | |||
| 2691 | Ga0070717_10160743 | |||
| 2692 | Ga0070717_10447794 | |||
| 2693 | Ga0075365_10000253 | |||
| 2694 | Ga0075365_10006417 | |||
| 2695 | Ga0075365_10182519 | |||
| 2696 | Ga0075365_10244030 | |||
| 2697 | Ga0075365_10254072 | |||
| 2698 | Ga0075365_10480691 | |||
| 2699 | Ga0075368_10019183 | |||
| 2700 | Ga0075368_10162350 | |||
| 2701 | Ga0075368_10291057 | |||
| 2702 | Ga0075363_100111876 | |||
| 2703 | Ga0075363_100401880 | |||
| 2704 | Ga0075363_100522274 | |||
| 2705 | Ga0075363_100528928 | |||
| 2706 | Ga0075363_100688219 | |||
| 2707 | Ga0075364_10374816 | |||
| 2708 | Ga0075432_10047301 | |||
| 2709 | Ga0070715_10026313 | |||
| 2710 | Ga0070715_10084938 | |||
| 2711 | Ga0070715_10459969 | |||
| 2712 | Ga0070715_10780685 | |||
| 2713 | Ga0070716_100001226 | |||
| 2714 | Ga0070716_100014276 | |||
| 2715 | Ga0070716_100161095 | |||
| 2716 | Ga0070716_100203854 | |||
| 2717 | Ga0070716_100345556 | |||
| 2718 | Ga0070716_100655030 | |||
| 2719 | Ga0070712_100000244 | |||
| 2720 | Ga0070712_100000983 | |||
| 2721 | Ga0070712_100021619 | |||
| 2722 | Ga0070712_100052038 | |||
| 2723 | Ga0070712_100109751 | |||
| 2724 | Ga0070712_100165502 | |||
| 2725 | Ga0070712_100240294 | |||
| 2726 | Ga0070712_100444422 | |||
| 2727 | Ga0070712_100502869 | |||
| 2728 | Ga0075362_10035265 | |||
| 2729 | Ga0075362_10059826 | |||
| 2730 | Ga0075362_10064177 | |||
| 2731 | Ga0075362_10212101 | |||
| 2732 | Ga0075362_10238835 | |||
| 2733 | Ga0075367_10002242 | |||
| 2734 | Ga0075367_10008688 | |||
| 2735 | Ga0075367_10315627 | |||
| 2736 | Ga0075369_10004804 | |||
| 2737 | Ga0075369_10034041 | |||
| 2738 | Ga0075369_10101868 | |||
| 2739 | Ga0075369_10134756 | |||
| 2740 | Ga0075366_10002628 | |||
| 2741 | Ga0075366_10032261 | |||
| 2742 | Ga0075366_10150985 | |||
| 2743 | Ga0075366_10430188 | |||
| 2744 | Ga0075366_10467746 | |||
| 2745 | Ga0075366_10519606 | |||
| 2746 | Ga0075366_10539806 | |||
| 2747 | Ga0097621_100000841 | |||
| 2748 | Ga0097621_100001124 | |||
| 2749 | Ga0097621_100012671 | |||
| 2750 | Ga0097621_100021911 | |||
| 2751 | Ga0097621_100058357 | |||
| 2752 | Ga0097621_100170557 | |||
| 2753 | Ga0097621_100274064 | |||
| 2754 | Ga0097621_100423828 | |||
| 2755 | Ga0075370_10080473 | |||
| 2756 | Ga0075370_10316348 | |||
| 2757 | Ga0075370_10316890 | |||
| 2758 | Ga0075370_10544435 | |||
| 2759 | Ga0068871_100000243 | |||
| 2760 | Ga0068871_100001352 | |||
| 2761 | Ga0068871_100052112 | |||
| 2762 | Ga0068871_100168956 | |||
| 2763 | Ga0068871_100181937 | |||
| 2764 | Ga0068871_100249544 | |||
| 2765 | Ga0068871_100274060 | |||
| 2766 | Ga0068871_100464386 | |||
| 2767 | Ga0068871_101372948 | |||
| 2768 | Ga0075428_100048667 | |||
| 2769 | Ga0075428_100441727 | |||
| 2770 | Ga0075428_100924867 | |||
| 2771 | Ga0075428_101120323 | |||
| 2772 | Ga0075430_100000370 | |||
| 2773 | Ga0075430_100018050 | |||
| 2774 | Ga0075431_100111850 | |||
| 2775 | Ga0075431_100337906 | |||
| 2776 | Ga0075431_100658515 | |||
| 2777 | Ga0075433_10010812 | |||
| 2778 | Ga0075433_10137753 | |||
| 2779 | Ga0075433_10195773 | |||
| 2780 | Ga0075434_100029863 | |||
| 2781 | Ga0075434_100041047 | |||
| 2782 | Ga0075434_100287613 | |||
| 2783 | Ga0075434_101223636 | |||
| 2784 | Ga0075434_102073236 | |||
| 2785 | Ga0075434_102092829 | |||
| 2786 | Ga0075429_100580959 | |||
| 2787 | Ga0075429_101058960 | |||
| 2788 | Ga0075429_101625113 | |||
| 2789 | Ga0068865_100002923 | |||
| 2790 | Ga0068865_100005706 | |||
| 2791 | Ga0068865_100035796 | |||
| 2792 | Ga0068865_100224391 | |||
| 2793 | Ga0068865_100473200 | |||
| 2794 | Ga0075436_100000154 | |||
| 2795 | Ga0075436_100137482 | |||
| 2796 | Ga0075436_100194953 | |||
| 2797 | Ga0075436_100482059 | |||
| 2798 | Ga0097620_100002395 | |||
| 2799 | Ga0097620_100072465 | |||
| 2800 | Ga0097620_100094848 | |||
| 2801 | Ga0097620_100124645 | |||
| 2802 | Ga0097620_100554409 | |||
| 2803 | Ga0097620_100617827 | |||
| 2804 | Ga0097620_101096581 | |||
| 2805 | Ga0099826_10007363 | |||
| 2806 | Ga0075435_100067160 | |||
| 2807 | Ga0075435_100069794 | |||
| 2808 | Ga0075435_100545496 | |||
| 2809 | Ga0075435_101245873 | |||
| 2810 | Ga0075435_101287641 | |||
| 2811 | Ga0099795_10210522 | |||
| 2812 | Ga0105251_10132490 | |||
| 2813 | Ga0105244_10047531 | |||
| 2814 | Ga0105250_10069439 | |||
| 2815 | Ga0105240_10000091 | |||
| 2816 | Ga0105240_10170039 | |||
| 2817 | Ga0105240_10173356 | |||
| 2818 | Ga0105240_10320690 | |||
| 2819 | Ga0105240_10481483 | |||
| 2820 | Ga0105240_10579113 | |||
| 2821 | Ga0105240_10748525 | |||
| 2822 | Ga0105240_10788767 | |||
| 2823 | Ga0105240_11013378 | |||
| 2824 | Ga0105240_11287149 | |||
| 2825 | Ga0111539_10025567 | |||
| 2826 | Ga0111539_10055658 | |||
| 2827 | Ga0111539_10190643 | |||
| 2828 | Ga0111539_10658795 | |||
| 2829 | Ga0105245_10004161 | |||
| 2830 | Ga0105245_10194373 | |||
| 2831 | Ga0105245_10202644 | |||
| 2832 | Ga0105245_10402780 | |||
| 2833 | Ga0105245_11039365 | |||
| 2834 | Ga0105245_12557584 | |||
| 2835 | Ga0105247_10005197 | |||
| 2836 | Ga0105247_10040176 | |||
| 2837 | Ga0105247_10049429 | |||
| 2838 | Ga0105247_10107846 | |||
| 2839 | Ga0105247_10311757 | |||
| 2840 | Ga0105247_10636072 | |||
| 2841 | Ga0105247_10647205 | |||
| 2842 | Ga0114129_10109918 | |||
| 2843 | Ga0114129_10135209 | |||
| 2844 | Ga0114129_10237149 | |||
| 2845 | Ga0114129_11501824 | |||
| 2846 | Ga0114129_11503238 | |||
| 2847 | Ga0114129_11561835 | |||
| 2848 | Ga0114129_12891134 | |||
| 2849 | Ga0105243_10010549 | |||
| 2850 | Ga0105243_10015650 | |||
| 2851 | Ga0105243_10135945 | |||
| 2852 | Ga0105243_10170071 | |||
| 2853 | Ga0105243_10304173 | |||
| 2854 | Ga0105243_10351342 | |||
| 2855 | Ga0105243_10531602 | |||
| 2856 | Ga0105243_10947932 | |||
| 2857 | Ga0105243_12256637 | |||
| 2858 | Ga0105241_10002326 | |||
| 2859 | Ga0105241_10011311 | |||
| 2860 | Ga0105241_10168721 | |||
| 2861 | Ga0105241_10261128 | |||
| 2862 | Ga0105241_10336954 | |||
| 2863 | Ga0105241_10415320 | |||
| 2864 | Ga0105242_10000036 | |||
| 2865 | Ga0105242_10014436 | |||
| 2866 | Ga0105242_10050007 | |||
| 2867 | Ga0105242_10121938 | |||
| 2868 | Ga0105242_10197178 | |||
| 2869 | Ga0105242_10556096 | |||
| 2870 | Ga0105242_11162946 | |||
| 2871 | Ga0105242_11344786 | |||
| 2872 | Ga0105248_10012352 | |||
| 2873 | Ga0105248_10065276 | |||
| 2874 | Ga0105248_10067514 | |||
| 2875 | Ga0105248_10398023 | |||
| 2876 | Ga0105248_11070150 | |||
| 2877 | Ga0105237_10022578 | |||
| 2878 | Ga0105237_10244885 | |||
| 2879 | Ga0105237_10329906 | |||
| 2880 | Ga0105237_10390996 | |||
| 2881 | Ga0105237_10414189 | |||
| 2882 | Ga0105237_10521250 | |||
| 2883 | Ga0105237_10579072 | |||
| 2884 | Ga0105237_10610602 | |||
| 2885 | Ga0105237_10636774 | |||
| 2886 | Ga0105237_11116579 | |||
| 2887 | Ga0105238_10013730 | |||
| 2888 | Ga0105238_10052375 | |||
| 2889 | Ga0105238_10164597 | |||
| 2890 | Ga0105238_10198474 | |||
| 2891 | Ga0105238_10210749 | |||
| 2892 | Ga0105238_10435178 | |||
| 2893 | Ga0105238_10519077 | |||
| 2894 | Ga0105238_10723284 | |||
| 2895 | Ga0105238_10755623 | |||
| 2896 | Ga0105238_10845925 | |||
| 2897 | Ga0105238_10916218 | |||
| 2898 | Ga0105238_10971212 | |||
| 2899 | Ga0105238_11322479 | |||
| 2900 | Ga0105238_11822837 | |||
| 2901 | Ga0105249_10012949 | |||
| 2902 | Ga0105249_10071587 | |||
| 2903 | Ga0105249_10132524 | |||
| 2904 | Ga0105249_10409755 | |||
| 2905 | Ga0105249_11318830 | |||
| 2906 | Ga0099796_10031323 | |||
| 2907 | Ga0099796_10095703 | |||
| 2908 | Ga0105239_10001368 | |||
| 2909 | Ga0105239_10010593 | |||
| 2910 | Ga0105239_10044590 | |||
| 2911 | Ga0105239_10180022 | |||
| 2912 | Ga0105239_10299664 | |||
| 2913 | Ga0105239_10330928 | |||
| 2914 | Ga0105239_10365864 | |||
| 2915 | Ga0105239_10369618 | |||
| 2916 | Ga0105239_10504509 | |||
| 2917 | Ga0105239_10932036 | |||
| 2918 | Ga0105239_10977177 | |||
| 2919 | Ga0105239_11490681 | |||
| 2920 | Ga0105246_10000666 | |||
| 2921 | Ga0105246_10027737 | |||
| 2922 | Ga0105246_10052929 | |||
| 2923 | Ga0105246_10199853 | |||
| 2924 | Ga0105246_10377047 | |||
| 2925 | Ga0105246_10672648 | |||
| 2926 | Ga0105246_11398775 | |||
| 2927 | Ga0105246_12119292 | |||
| 2928 | Ga0157321_1002565 | |||
| 2929 | Ga0157329_1010456 | |||
| 2930 | Ga0157341_1005141 | |||
| 2931 | Ga0157345_1004704 | |||
| 2932 | Ga0157314_1002125 | |||
| 2933 | Ga0157347_1003490 | |||
| 2934 | Ga0157313_1004446 | |||
| 2935 | Ga0157315_1000717 | |||
| 2936 | Ga0157373_10058615 | |||
| 2937 | Ga0157373_10179986 | |||
| 2938 | Ga0157373_10200916 | |||
| 2939 | Ga0157373_10220314 | |||
| 2940 | Ga0157371_10005746 | |||
| 2941 | Ga0157371_10581906 | |||
| 2942 | Ga0157370_10044538 | |||
| 2943 | Ga0157370_10250286 | |||
| 2944 | Ga0157370_10329113 | |||
| 2945 | Ga0157369_10003501 | |||
| 2946 | Ga0157369_10141190 | |||
| 2947 | Ga0157369_10443076 | |||
| 2948 | Ga0157369_10451625 | |||
| 2949 | Ga0157369_10756014 | |||
| 2950 | Ga0157369_10982849 | |||
| 2951 | Ga0157369_11055180 | |||
| 2952 | Ga0157369_11128870 | |||
| 2953 | Ga0171463_1001 | |||
| 2954 | Ga0157374_10005236 | |||
| 2955 | Ga0157374_10176078 | |||
| 2956 | Ga0157374_10293868 | |||
| 2957 | Ga0157374_10339671 | |||
| 2958 | Ga0157374_10891600 | |||
| 2959 | Ga0157374_11448412 | |||
| 2960 | Ga0157378_10000462 | |||
| 2961 | Ga0157378_10025132 | |||
| 2962 | Ga0157378_10050491 | |||
| 2963 | Ga0157378_10342232 | |||
| 2964 | Ga0157378_10636662 | |||
| 2965 | Ga0157378_10861997 | |||
| 2966 | Ga0163162_10010706 | |||
| 2967 | Ga0163162_10062995 | |||
| 2968 | Ga0163162_10097014 | |||
| 2969 | Ga0163162_10370999 | |||
| 2970 | Ga0163162_10475748 | |||
| 2971 | Ga0163162_10640948 | |||
| 2972 | Ga0163162_10801590 | |||
| 2973 | Ga0157372_10444747 | |||
| 2974 | Ga0157372_11197676 | |||
| 2975 | Ga0157372_11591447 | |||
| 2976 | Ga0157375_10003826 | |||
| 2977 | Ga0157375_10014386 | |||
| 2978 | Ga0157375_10029710 | |||
| 2979 | Ga0157375_10046446 | |||
| 2980 | Ga0157375_10095419 | |||
| 2981 | Ga0157375_10834559 | |||
| 2982 | Ga0163163_10000002 | |||
| 2983 | Ga0163163_10006875 | |||
| 2984 | Ga0163163_10016380 | |||
| 2985 | Ga0163163_10106629 | |||
| 2986 | Ga0163163_10109840 | |||
| 2987 | Ga0157380_10000274 | |||
| 2988 | Ga0157380_10036448 | |||
| 2989 | Ga0157380_12239955 | |||
| 2990 | Ga0157377_10007030 | |||
| 2991 | Ga0157377_10008998 | |||
| 2992 | Ga0157377_10220668 | |||
| 2993 | Ga0157377_10247728 | |||
| 2994 | Ga0157377_10712668 | |||
| 2995 | Ga0157379_10002580 | |||
| 2996 | Ga0157379_10002641 | |||
| 2997 | Ga0157379_10028886 | |||
| 2998 | Ga0157379_10037035 | |||
| 2999 | Ga0157379_10144901 | |||
| 3000 | Ga0157379_10295511 | |||
| 3001 | Ga0157379_10399245 | |||
| 3002 | Ga0157379_10889691 | |||
| 3003 | Ga0157379_11108840 | |||
| 3004 | Ga0157376_10001158 | |||
| 3005 | Ga0157376_10023691 | |||
| 3006 | Ga0157376_10480581 | |||
| 3007 | Ga0157376_10502217 | |||
| 3008 | Ga0157376_10619608 | |||
| 3009 | Ga0157376_11482769 | |||
| 3010 | Ga0157376_11671690 | |||
| 3011 | Ga0157376_12475529 | |||
| 3012 | Ga0183363_1082 | |||
| 3013 | Ga0163161_10001021 | |||
| 3014 | Ga0163161_10077117 | |||
| 3015 | Ga0163161_10108639 | |||
| 3016 | Ga0163161_10117035 | |||
| 3017 | Ga0163161_10213653 | |||
| 3018 | Ga0163161_10372707 | |||
| 3019 | Ga0163161_10691513 | |||
| 3020 | Ga0206354_10832954 | |||
| 3021 | Ga0206353_10469384 | |||
| 3022 | Ga0214542_1000006 | |||
| 3023 | Ga0214543_1000014 | |||
| 3024 | Ga0213876_10203602 | |||
| 3025 | Ga0209563_107071 | |||
| 3026 | Ga0209233_1000015 | |||
| 3027 | Ga0209233_1020178 | |||
| 3028 | Ga0207666_1001232 | |||
| 3029 | Ga0207666_1001599 | |||
| 3030 | Ga0207673_1000144 | |||
| 3031 | Ga0209564_1000023 | |||
| 3032 | Ga0209758_1000013 | |||
| 3033 | Ga0209256_1000215 | |||
| 3034 | Ga0207697_10016806 | |||
| 3035 | Ga0207697_10020928 | |||
| 3036 | Ga0207697_10069735 | |||
| 3037 | Ga0207656_10087008 | |||
| 3038 | Ga0207656_10142756 | |||
| 3039 | Ga0207656_10389120 | |||
| 3040 | Ga0207655_1043901 | |||
| 3041 | Ga0207653_10014097 | |||
| 3042 | Ga0207682_10000399 | |||
| 3043 | Ga0207692_10013438 | |||
| 3044 | Ga0207692_10060724 | |||
| 3045 | Ga0207642_10000073 | |||
| 3046 | Ga0207642_10014044 | |||
| 3047 | Ga0207642_10232406 | |||
| 3048 | Ga0207642_10437580 | |||
| 3049 | Ga0207710_10005066 | |||
| 3050 | Ga0207710_10009984 | |||
| 3051 | Ga0207710_10014743 | |||
| 3052 | Ga0207710_10130165 | |||
| 3053 | Ga0207688_10003955 | |||
| 3054 | Ga0207688_10005485 | |||
| 3055 | Ga0207688_10153228 | |||
| 3056 | Ga0207680_10043923 | |||
| 3057 | Ga0207680_10053309 | |||
| 3058 | Ga0207680_10054255 | |||
| 3059 | Ga0207680_10102398 | |||
| 3060 | Ga0207680_10151730 | |||
| 3061 | Ga0207680_10652022 | |||
| 3062 | Ga0207647_10016554 | |||
| 3063 | Ga0207647_10038761 | |||
| 3064 | Ga0207647_10078124 | |||
| 3065 | Ga0207685_10085879 | |||
| 3066 | Ga0207685_10150833 | |||
| 3067 | Ga0207685_10280116 | |||
| 3068 | Ga0207699_10132348 | |||
| 3069 | Ga0207699_10155697 | |||
| 3070 | Ga0207699_10418372 | |||
| 3071 | Ga0207699_11006821 | |||
| 3072 | Ga0207699_11028687 | |||
| 3073 | Ga0207645_10000457 | |||
| 3074 | Ga0207645_10029158 | |||
| 3075 | Ga0207645_10036551 | |||
| 3076 | Ga0207645_10098702 | |||
| 3077 | Ga0207645_10654728 | |||
| 3078 | Ga0207643_10000571 | |||
| 3079 | Ga0207643_10002630 | |||
| 3080 | Ga0207643_10098989 | |||
| 3081 | Ga0207705_10048589 | |||
| 3082 | Ga0207705_10705432 | |||
| 3083 | Ga0207654_10003110 | |||
| 3084 | Ga0207654_10009634 | |||
| 3085 | Ga0207654_10065176 | |||
| 3086 | Ga0207654_10074488 | |||
| 3087 | Ga0207654_10138718 | |||
| 3088 | Ga0207654_10310641 | |||
| 3089 | Ga0207654_10412874 | |||
| 3090 | Ga0207707_10015257 | |||
| 3091 | Ga0207707_10086200 | |||
| 3092 | Ga0207707_10274287 | |||
| 3093 | Ga0207707_10440360 | |||
| 3094 | Ga0207707_10486076 | |||
| 3095 | Ga0207695_10000018 | |||
| 3096 | Ga0207695_10008517 | |||
| 3097 | Ga0207695_10048036 | |||
| 3098 | Ga0207695_10089023 | |||
| 3099 | Ga0207695_10197922 | |||
| 3100 | Ga0207695_10313989 | |||
| 3101 | Ga0207695_10431413 | |||
| 3102 | Ga0207695_10481448 | |||
| 3103 | Ga0207671_10024799 | |||
| 3104 | Ga0207671_10048973 | |||
| 3105 | Ga0207671_10135543 | |||
| 3106 | Ga0207671_10206408 | |||
| 3107 | Ga0207671_10730776 | |||
| 3108 | Ga0207693_10005098 | |||
| 3109 | Ga0207693_10005593 | |||
| 3110 | Ga0207693_10009660 | |||
| 3111 | Ga0207693_10014290 | |||
| 3112 | Ga0207693_10019432 | |||
| 3113 | Ga0207693_10043855 | |||
| 3114 | Ga0207693_10092320 | |||
| 3115 | Ga0207693_10220803 | |||
| 3116 | Ga0207693_10273873 | |||
| 3117 | Ga0207693_10508504 | |||
| 3118 | Ga0207693_10847395 | |||
| 3119 | Ga0207693_10879762 | |||
| 3120 | Ga0207663_10004209 | |||
| 3121 | Ga0207663_10062301 | |||
| 3122 | Ga0207663_10077839 | |||
| 3123 | Ga0207663_10104850 | |||
| 3124 | Ga0207663_10287762 | |||
| 3125 | Ga0207663_10348782 | |||
| 3126 | Ga0207663_10404805 | |||
| 3127 | Ga0207663_10515822 | |||
| 3128 | Ga0207663_10607554 | |||
| 3129 | Ga0207663_11145540 | |||
| 3130 | Ga0207663_11240168 | |||
| 3131 | Ga0207660_10055466 | |||
| 3132 | Ga0207660_10191967 | |||
| 3133 | Ga0207660_10270394 | |||
| 3134 | Ga0207660_10291351 | |||
| 3135 | Ga0207660_10369830 | |||
| 3136 | Ga0207660_10492157 | |||
| 3137 | Ga0207660_10504012 | |||
| 3138 | Ga0207662_10014634 | |||
| 3139 | Ga0207662_10042209 | |||
| 3140 | Ga0207662_10148603 | |||
| 3141 | Ga0207662_10203785 | |||
| 3142 | Ga0207657_10011285 | |||
| 3143 | Ga0207657_10048362 | |||
| 3144 | Ga0207657_10075993 | |||
| 3145 | Ga0207657_10545993 | |||
| 3146 | Ga0207657_10679486 | |||
| 3147 | Ga0207657_10940354 | |||
| 3148 | Ga0207657_11031480 | |||
| 3149 | Ga0207657_11182985 | |||
| 3150 | Ga0207649_10000382 | |||
| 3151 | Ga0207649_10000473 | |||
| 3152 | Ga0207649_10042350 | |||
| 3153 | Ga0207649_10092203 | |||
| 3154 | Ga0207649_10445485 | |||
| 3155 | Ga0207649_11019040 | |||
| 3156 | Ga0207652_10000764 | |||
| 3157 | Ga0207652_10074576 | |||
| 3158 | Ga0207652_10084337 | |||
| 3159 | Ga0207652_10273321 | |||
| 3160 | Ga0207652_10719074 | |||
| 3161 | Ga0207652_10810748 | |||
| 3162 | Ga0207652_10891499 | |||
| 3163 | Ga0207646_10183787 | |||
| 3164 | Ga0207646_10542508 | |||
| 3165 | Ga0207681_10000065 | |||
| 3166 | Ga0207681_10097091 | |||
| 3167 | Ga0207681_10145468 | |||
| 3168 | Ga0207681_10368702 | |||
| 3169 | Ga0207681_11456687 | |||
| 3170 | Ga0207694_10000018 | |||
| 3171 | Ga0207694_10050126 | |||
| 3172 | Ga0207694_10071161 | |||
| 3173 | Ga0207694_10152383 | |||
| 3174 | Ga0207694_10249149 | |||
| 3175 | Ga0207694_10315055 | |||
| 3176 | Ga0207694_10527923 | |||
| 3177 | Ga0207694_10552850 | |||
| 3178 | Ga0207694_10803911 | |||
| 3179 | Ga0207694_10828139 | |||
| 3180 | Ga0207650_10031294 | |||
| 3181 | Ga0207650_10154835 | |||
| 3182 | Ga0207659_10000142 | |||
| 3183 | Ga0207659_11245042 | |||
| 3184 | Ga0207659_11256605 | |||
| 3185 | Ga0207687_10000125 | |||
| 3186 | Ga0207687_10031496 | |||
| 3187 | Ga0207687_10060565 | |||
| 3188 | Ga0207687_10093905 | |||
| 3189 | Ga0207687_10187599 | |||
| 3190 | Ga0207700_10000017 | |||
| 3191 | Ga0207700_10000747 | |||
| 3192 | Ga0207700_10073961 | |||
| 3193 | Ga0207700_10079991 | |||
| 3194 | Ga0207700_10298008 | |||
| 3195 | Ga0207700_10305525 | |||
| 3196 | Ga0207700_10411772 | |||
| 3197 | Ga0207664_10067421 | |||
| 3198 | Ga0207664_10068459 | |||
| 3199 | Ga0207664_10255318 | |||
| 3200 | Ga0207664_10391397 | |||
| 3201 | Ga0207664_11266876 | |||
| 3202 | Ga0207644_10002374 | |||
| 3203 | Ga0207644_10037849 | |||
| 3204 | Ga0207644_10102001 | |||
| 3205 | Ga0207644_10198856 | |||
| 3206 | Ga0207644_10491362 | |||
| 3207 | Ga0207644_10998833 | |||
| 3208 | Ga0207644_11076415 | |||
| 3209 | Ga0207690_10000900 | |||
| 3210 | Ga0207690_10036628 | |||
| 3211 | Ga0207690_10410684 | |||
| 3212 | Ga0207690_11265078 | |||
| 3213 | Ga0207706_10005077 | |||
| 3214 | Ga0207706_10008604 | |||
| 3215 | Ga0207706_10024616 | |||
| 3216 | Ga0207706_10425950 | |||
| 3217 | Ga0207706_10502538 | |||
| 3218 | Ga0207706_10915503 | |||
| 3219 | Ga0207686_10000344 | |||
| 3220 | Ga0207686_10031417 | |||
| 3221 | Ga0207686_10157483 | |||
| 3222 | Ga0207686_10848597 | |||
| 3223 | Ga0207709_10001385 | |||
| 3224 | Ga0207709_10080067 | |||
| 3225 | Ga0207709_10233337 | |||
| 3226 | Ga0207709_10308234 | |||
| 3227 | Ga0207709_10311163 | |||
| 3228 | Ga0207670_10000288 | |||
| 3229 | Ga0207670_10683832 | |||
| 3230 | Ga0207669_10002658 | |||
| 3231 | Ga0207669_10518945 | |||
| 3232 | Ga0207704_10000121 | |||
| 3233 | Ga0207704_10007421 | |||
| 3234 | Ga0207704_10039546 | |||
| 3235 | Ga0207704_10872266 | |||
| 3236 | Ga0207704_11075309 | |||
| 3237 | Ga0207704_11191832 | |||
| 3238 | Ga0207665_10001147 | |||
| 3239 | Ga0207665_10002353 | |||
| 3240 | Ga0207665_10052377 | |||
| 3241 | Ga0207665_10176043 | |||
| 3242 | Ga0207665_10506305 | |||
| 3243 | Ga0207665_10611188 | |||
| 3244 | Ga0207665_11291053 | |||
| 3245 | Ga0207691_10005469 | |||
| 3246 | Ga0207691_10059048 | |||
| 3247 | Ga0207691_10258670 | |||
| 3248 | Ga0207691_10680548 | |||
| 3249 | Ga0207691_10695801 | |||
| 3250 | Ga0207711_10004828 | |||
| 3251 | Ga0207711_10011260 | |||
| 3252 | Ga0207711_10097260 | |||
| 3253 | Ga0207711_10260277 | |||
| 3254 | Ga0207711_10719565 | |||
| 3255 | Ga0207689_10000696 | |||
| 3256 | Ga0207689_10028922 | |||
| 3257 | Ga0207689_10109494 | |||
| 3258 | Ga0207689_10263483 | |||
| 3259 | Ga0207689_10614714 | |||
| 3260 | Ga0207689_10811817 | |||
| 3261 | Ga0207689_10873315 | |||
| 3262 | Ga0207661_10290662 | |||
| 3263 | Ga0207661_10294799 | |||
| 3264 | Ga0207661_10689357 | |||
| 3265 | Ga0207661_10728358 | |||
| 3266 | Ga0207661_11136803 | |||
| 3267 | Ga0207661_11169900 | |||
| 3268 | Ga0207661_12002364 | |||
| 3269 | Ga0207679_10000064 | |||
| 3270 | Ga0207679_10153156 | |||
| 3271 | Ga0207679_10325676 | |||
| 3272 | Ga0207679_10431484 | |||
| 3273 | Ga0207679_11509539 | |||
| 3274 | Ga0207667_10000052 | |||
| 3275 | Ga0207667_10032084 | |||
| 3276 | Ga0207667_10101281 | |||
| 3277 | Ga0207667_10638609 | |||
| 3278 | Ga0207667_10668500 | |||
| 3279 | Ga0207667_10725487 | |||
| 3280 | Ga0207667_10733516 | |||
| 3281 | Ga0207667_10764371 | |||
| 3282 | Ga0207667_11482663 | |||
| 3283 | Ga0207667_11647654 | |||
| 3284 | Ga0207651_10000338 | |||
| 3285 | Ga0207651_10035164 | |||
| 3286 | Ga0207651_10573507 | |||
| 3287 | Ga0207651_11070946 | |||
| 3288 | Ga0207651_11288289 | |||
| 3289 | Ga0207651_11604014 | |||
| 3290 | Ga0207712_10000944 | |||
| 3291 | Ga0207712_10059836 | |||
| 3292 | Ga0207712_10300964 | |||
| 3293 | Ga0207712_10621121 | |||
| 3294 | Ga0207712_10922498 | |||
| 3295 | Ga0207668_10000503 | |||
| 3296 | Ga0207668_10051908 | |||
| 3297 | Ga0207668_10069526 | |||
| 3298 | Ga0207668_10111894 | |||
| 3299 | Ga0207668_10357542 | |||
| 3300 | Ga0207668_10766473 | |||
| 3301 | Ga0207640_10000320 | |||
| 3302 | Ga0207640_10412873 | |||
| 3303 | Ga0207640_10429227 | |||
| 3304 | Ga0207640_11006824 | |||
| 3305 | Ga0207658_10033265 | |||
| 3306 | Ga0207658_10093915 | |||
| 3307 | Ga0207658_10226324 | |||
| 3308 | Ga0207658_10334802 | |||
| 3309 | Ga0207658_10340798 | |||
| 3310 | Ga0207658_10497179 | |||
| 3311 | Ga0207658_10519645 | |||
| 3312 | Ga0207658_10622047 | |||
| 3313 | Ga0207677_10002365 | |||
| 3314 | Ga0207677_10043233 | |||
| 3315 | Ga0207677_10059931 | |||
| 3316 | Ga0207677_10193770 | |||
| 3317 | Ga0207703_10001400 | |||
| 3318 | Ga0207703_10116527 | |||
| 3319 | Ga0207703_10347161 | |||
| 3320 | Ga0207703_10607109 | |||
| 3321 | Ga0207703_10682504 | |||
| 3322 | Ga0207703_11831890 | |||
| 3323 | Ga0207639_10016982 | |||
| 3324 | Ga0207639_10036966 | |||
| 3325 | Ga0207639_10152705 | |||
| 3326 | Ga0207639_10289311 | |||
| 3327 | Ga0207639_10342408 | |||
| 3328 | Ga0207678_10002811 | |||
| 3329 | Ga0207678_10007889 | |||
| 3330 | Ga0207678_10012694 | |||
| 3331 | Ga0207678_10636038 | |||
| 3332 | Ga0207678_10696169 | |||
| 3333 | Ga0207708_10004148 | |||
| 3334 | Ga0207708_10055846 | |||
| 3335 | Ga0207708_10070399 | |||
| 3336 | Ga0207702_10001217 | |||
| 3337 | Ga0207702_10224763 | |||
| 3338 | Ga0207702_10265280 | |||
| 3339 | Ga0207702_10461937 | |||
| 3340 | Ga0207702_10550579 | |||
| 3341 | Ga0207702_10554544 | |||
| 3342 | Ga0207702_10571020 | |||
| 3343 | Ga0207702_11083492 | |||
| 3344 | Ga0207641_10006750 | |||
| 3345 | Ga0207641_10029971 | |||
| 3346 | Ga0207641_10034969 | |||
| 3347 | Ga0207641_10339544 | |||
| 3348 | Ga0207641_10392344 | |||
| 3349 | Ga0207641_11228628 | |||
| 3350 | Ga0207641_11256465 | |||
| 3351 | Ga0207648_10013636 | |||
| 3352 | Ga0207648_10023005 | |||
| 3353 | Ga0207648_10032835 | |||
| 3354 | Ga0207648_10080154 | |||
| 3355 | Ga0207648_10510992 | |||
| 3356 | Ga0207676_10000079 | |||
| 3357 | Ga0207676_10012315 | |||
| 3358 | Ga0207676_10147763 | |||
| 3359 | Ga0207676_10373573 | |||
| 3360 | Ga0207676_10658726 | |||
| 3361 | Ga0207676_11633136 | |||
| 3362 | Ga0207674_10032977 | |||
| 3363 | Ga0207674_10058304 | |||
| 3364 | Ga0207674_10109763 | |||
| 3365 | Ga0207674_10154052 | |||
| 3366 | Ga0207674_10579849 | |||
| 3367 | Ga0207674_10607276 | |||
| 3368 | Ga0207674_11227253 | |||
| 3369 | Ga0207675_100003030 | |||
| 3370 | Ga0207675_100009836 | |||
| 3371 | Ga0207675_100038364 | |||
| 3372 | Ga0207675_100371496 | |||
| 3373 | Ga0207675_100662765 | |||
| 3374 | Ga0207675_101514243 | |||
| 3375 | Ga0207683_10000037 | |||
| 3376 | Ga0207683_10011813 | |||
| 3377 | Ga0207683_10019746 | |||
| 3378 | Ga0207683_10153884 | |||
| 3379 | Ga0207683_10178740 | |||
| 3380 | Ga0207698_10002906 | |||
| 3381 | Ga0207698_10213954 | |||
| 3382 | Ga0207698_10547741 | |||
| 3383 | Ga0207698_10736152 | |||
| 3384 | Ga0207698_12179949 | |||
| 3385 | Ga0209973_1049671 | |||
| 3386 | Ga0210002_1008968 | |||
| 3387 | Ga0209983_1012323 | |||
| 3388 | Ga0209282_1006157 | |||
| 3389 | Ga0209282_1039336 | |||
| 3390 | Ga0209971_1007881 | |||
| 3391 | Ga0209966_1001939 | |||
| 3392 | Ga0209966_1081754 | |||
| 3393 | Ga0209998_10004140 | |||
| 3394 | Ga0209998_10008721 | |||
| 3395 | Ga0209998_10010527 | |||
| 3396 | Ga0209813_10010127 | |||
| 3397 | Ga0209813_10104459 | |||
| 3398 | Ga0209813_10174229 | |||
| 3399 | Ga0209974_10013409 | |||
| 3400 | Ga0209974_10115603 | |||
| 3401 | Ga0209974_10278017 | |||
| 3402 | Ga0207428_10000064 | |||
| 3403 | Ga0207428_10014192 | |||
| 3404 | Ga0207428_10024254 | |||
| 3405 | Ga0207428_10598387 | |||
| 3406 | Ga0268266_10001539 | |||
| 3407 | Ga0268266_10006859 | |||
| 3408 | Ga0268266_10017082 | |||
| 3409 | Ga0268266_10028988 | |||
| 3410 | Ga0268266_10039850 | |||
| 3411 | Ga0268266_10068757 | |||
| 3412 | Ga0268266_10071989 | |||
| 3413 | Ga0268266_10122755 | |||
| 3414 | Ga0268266_10243948 | |||
| 3415 | Ga0268266_10691767 | |||
| 3416 | Ga0268266_10703261 | |||
| 3417 | Ga0268266_11773268 | |||
| 3418 | Ga0268265_10019014 | |||
| 3419 | Ga0268265_10103099 | |||
| 3420 | Ga0268265_10111508 | |||
| 3421 | Ga0268265_10247208 | |||
| 3422 | Ga0268265_10324600 | |||
| 3423 | Ga0268264_10000022 | |||
| 3424 | Ga0268264_10000805 | |||
| 3425 | Ga0268264_10017880 | |||
| 3426 | Ga0268264_10155682 | |||
| 3427 | Ga0268264_10651541 | |||
| 3428 | Ga0268264_11727751 | |||
| 3429 | Ga0265334_10027907 | |||
| 3430 | Ga0265318_10046767 | |||
| 3431 | Ga0307517_10198111 | |||
| 3432 | Ga0265338_10000100 | |||
| 3433 | Ga0265338_10005075 | |||
| 3434 | Ga0265338_10391674 | |||
| 3435 | Ga0265338_11035473 | |||
| 3436 | Ga0307511_10235350 | |||
| 3437 | Ga0316181_1235153 | |||
| 3438 | Ga0265762_1045705 | |||
| 3439 | Ga0265760_10040801 | |||
| 3440 | Ga0265760_10086139 | |||
| 3441 | Ga0265330_10025049 | |||
| 3442 | Ga0265330_10131468 | |||
| 3443 | Ga0265332_10019940 | |||
| 3444 | Ga0265328_10000006 | |||
| 3445 | Ga0265328_10199454 | |||
| 3446 | Ga0265320_10030229 | |||
| 3447 | Ga0265320_10231140 | |||
| 3448 | Ga0265325_10000014 | |||
| 3449 | Ga0265325_10001421 | |||
| 3450 | Ga0265325_10002235 | |||
| 3451 | Ga0265325_10068420 | |||
| 3452 | Ga0265325_10121365 | |||
| 3453 | Ga0265325_10175390 | |||
| 3454 | Ga0265325_10227582 | |||
| 3455 | Ga0265325_10244737 | |||
| 3456 | Ga0265329_10024737 | |||
| 3457 | Ga0265329_10122316 | |||
| 3458 | Ga0265340_10001571 | |||
| 3459 | Ga0265340_10068201 | |||
| 3460 | Ga0265340_10069214 | |||
| 3461 | Ga0265340_10096216 | |||
| 3462 | Ga0265340_10104206 | |||
| 3463 | Ga0265340_10108961 | |||
| 3464 | Ga0265340_10119645 | |||
| 3465 | Ga0265339_10003369 | |||
| 3466 | Ga0265339_10023668 | |||
| 3467 | Ga0265339_10033703 | |||
| 3468 | Ga0265339_10147201 | |||
| 3469 | Ga0265339_10363500 | |||
| 3470 | Ga0265339_10443082 | |||
| 3471 | Ga0265331_10000113 | |||
| 3472 | Ga0265331_10002319 | |||
| 3473 | Ga0265331_10008036 | |||
| 3474 | Ga0265331_10034635 | |||
| 3475 | Ga0265331_10041860 | |||
| 3476 | Ga0265331_10078310 | |||
| 3477 | Ga0265331_10131853 | |||
| 3478 | Ga0265327_10000124 | |||
| 3479 | Ga0265327_10020547 | |||
| 3480 | Ga0265327_10244006 | |||
| 3481 | Ga0265316_10000333 | |||
| 3482 | Ga0265316_10061583 | |||
| 3483 | Ga0265316_10111693 | |||
| 3484 | Ga0265316_10141249 | |||
| 3485 | Ga0307509_10144098 | |||
| 3486 | Ga0307509_10224553 | |||
| 3487 | Ga0307408_101200854 | |||
| 3488 | Ga0265313_10001667 | |||
| 3489 | Ga0265313_10008310 | |||
| 3490 | Ga0265313_10020687 | |||
| 3491 | Ga0265313_10123304 | |||
| 3492 | Ga0265313_10131512 | |||
| 3493 | Ga0307508_10259527 | |||
| 3494 | Ga0316575_10060235 | |||
| 3495 | Ga0265314_10025240 | |||
| 3496 | Ga0265314_10025603 | |||
| 3497 | Ga0265314_10028930 | |||
| 3498 | Ga0265314_10138567 | |||
| 3499 | Ga0265314_10170464 | |||
| 3500 | Ga0265342_10018213 | |||
| 3501 | Ga0265342_10257285 | |||
| 3502 | Ga0265342_10276896 | |||
| 3503 | Ga0265342_10286059 | |||
| 3504 | Ga0265342_10515928 | |||
| 3505 | Ga0307516_10021961 | |||
| 3506 | Ga0307516_10325126 | |||
| 3507 | Ga0307516_10458714 | |||
| 3508 | Ga0307406_10627668 | |||
| 3509 | Ga0307412_11269709 | |||
| 3510 | Ga0307409_100222329 | |||
| 3511 | Ga0307414_10156200 | |||
| 3512 | Ga0307411_10096960 | |||
| 3513 | Ga0307415_101203249 | |||
| 3514 | Ga0316583_10000123 | |||
| 3515 | Ga0307507_10006782 | |||
| 3516 | Ga0307507_10230487 | |||
| 3517 | Ga0307510_10151214 | |||
| 3518 | Ga0373930_0000972 | |||
| 3519 | Ga0373930_0136284 | |||
| 3520 | Ga0373948_0000169 | |||
| 3521 | Ga0373948_0007214 | |||
| 3522 | Ga0373948_0020187 | |||
| 3523 | Ga0373950_0000253 | |||
| 3524 | Ga0373950_0001897 | |||
| 3525 | Ga0373958_0003084 | |||
| 3526 | Ga0373958_0008410 | |||
| 3527 | Ga0373958_0180879 | |||
| 3528 | Ga0373959_0004517 | |||
| 3529 | Ga0373938_0000142 | |||
| 3530 | Ga0373938_0009131 | |||
| 3531 | Ga0373926_0004179 | |||
| 3532 | Ga0373926_0012751 | |||
| 3533 | Ga0373926_0055880 | |||
| 3534 | Ga0373928_0000634 | |||
| 3535 | Ga0373928_0001826 | |||
| 3536 | Ga0373928_0159033 | |||
| 3537 | Ga0373929_0001528 | |||
| 3538 | Ga0373929_0017852 | |||
| 3539 | Ga0373929_0059575 | |||
| 3540 | Ga0373929_0095483 | |||
| 3541 | Ga0373934_0017218 | |||
| 3542 | Ga0373934_0028536 | |||
| 3543 | Ga0373940_0002260 | |||
| 3544 | Ga0373940_0126892 | |||
| 3545 | Ga0373940_0155809 | |||
| 3546 | Ga0373944_0033583 | |||
| 3547 | Ga0373944_0056645 | |||
| 3548 | Ga0373944_0062132 | |||
| 3549 | Ga0373949_0001704 | |||
| 3550 | Ga0373949_0011869 | |||
| 3551 | Ga0373951_0004113 | |||
| 3552 | Ga0373951_0021701 | |||
| 3553 | Ga0373951_0108142 | |||
| 3554 | Ga0373952_0000469 | |||
| 3555 | Ga0373952_0010817 | |||
| 3556 | Ga0373952_0216138 | |||
| 3557 | Ga0373923_0039986 | |||
| 3558 | Ga0373923_0048739 | |||
| 3559 | Ga0373923_0275965 | |||
| 3560 | Ga0373932_0001947 | |||
| 3561 | Ga0373932_0026515 | |||
| 3562 | Ga0373932_0299378 | |||
| 3563 | Ga0373936_0032209 | |||
| 3564 | Ga0373936_0045202 | |||
| 3565 | Ga0373936_0130971 | |||
| 3566 | Ga0373939_0000711 | |||
| 3567 | Ga0373939_0001236 | |||
| 3568 | Ga0373939_0003388 | |||
| 3569 | Ga0373939_0040228 | |||
| 3570 | Ga0373941_0000186 | |||
| 3571 | Ga0373941_0000584 | |||
| 3572 | Ga0373941_0134427 | |||
| 3573 | Ga0373945_0000073 | |||
| 3574 | Ga0373945_0016156 | |||
| 3575 | Ga0373945_0029055 | |||
| 3576 | Ga0373953_0018005 | |||
| 3577 | Ga0373953_0190111 | |||
| 3578 | Ga0373954_0016841 | |||
| 3579 | Ga0373954_0032391 | |||
| 3580 | Ga0373954_0115093 | |||
| 3581 | Ga0373954_0367224 | |||
| 3582 | Ga0373956_0006007 | |||
| 3583 | Ga0373956_0145837 | |||
| 3584 | Ga0373957_0001780 | |||
| 3585 | Ga0373957_0074433 | |||
| 3586 | Ga0373960_0004138 | |||
| 3587 | Ga0373960_0004588 | |||
| 3588 | Ga0373960_0136153 | |||
| 3589 | Ga0373960_0177632 | |||
| 3590 | Ga0373943_0004682 | |||
| 3591 | Ga0373943_0007039 | |||
| 3592 | Ga0373943_0197375 | |||
| 3593 | Ga0373943_0590573 | |||
| 3594 | Ga0373946_0000371 | |||
| 3595 | Ga0373946_0033119 | |||
| 3596 | Ga0373955_0004122 | |||
| 3597 | Ga0373955_0008798 | |||
| 3598 | Ga0373955_0480211 | |||
| 3599 | Ga0373942_0000298 | |||
| 3600 | Ga0373942_0043844 | |||
| 3601 | Ga0373961_0002218 | |||
| 3602 | Ga0373961_0003878 | |||
| 3603 | Ga0373961_0008934 | |||
| 3604 | Ga0373961_0105092 | |||
| 3605 | Ga0373962_0000374 | |||
| 3606 | Ga0373962_0000988 | |||
| 3607 | Ga0373962_0244872 | |||
| 3608 | Ga0373924_0125940 | |||
| 3609 | Ga0373924_0203294 | |||
| 3610 | Ga0373924_0412048 | |||
| 3611 | Ga0373931_0000823 | |||
| 3612 | Ga0373931_0004447 | |||
| 3613 | Ga0373931_0023006 | |||
| 3614 | Ga0373931_0279364 | |||
| 3615 | Ga0373931_0495182 | |||
| 3616 | Ga0373935_0002812 | |||
| 3617 | Ga0373935_0021250 | |||
| 3618 | Ga0373935_0040171 | |||
| 3619 | Ga0373935_0119875 | |||
| 3620 | Ga0373935_0570055 | |||
| 3621 | Ga0373935_0651173 | |||
| 3622 | Ga0373927_0008749 | |||
| 3623 | Ga0373927_0024429 | |||
| 3624 | Ga0373927_0034147 | |||
| 3625 | Ga0373927_0046748 | |||
| 3626 | Ga0373927_0157489 | |||
| 3627 | Ga0373927_0354026 | |||
| 3628 | Ga0373927_0429267 | |||
| 3629 | Ga0373927_0723049 | |||
| 3630 | Ga0373933_0010116 | |||
| 3631 | Ga0373933_0054991 | |||
| 3632 | Ga0373933_0275336 | |||
| 3633 | Ga0373933_0324897 | |||
| 3634 | Ga0373933_0494312 | |||
| 3635 | Ga0373947_0002721 | |||
| 3636 | Ga0373947_0027881 | |||
| 3637 | Ga0373947_0046588 | |||
| 3638 | Ga0373947_0065071 | |||
| 3639 | Ga0373947_0099201 | |||
| 3640 | Ga0373947_0178733 | |||
| 3641 | Ga0373947_0897924 | |||
| 3642 | Ga0373937_0000998 | |||
| 3643 | Ga0373937_0002122 | |||
| 3644 | Ga0373937_0138612 | |||
| 3645 | Ga0373937_0408434 | |||
| 3646 | Ga0373937_0431780 | |||
| 3647 | Ga0373937_0806671 | |||
| 3648 | Ga0373925_0001693 | |||
| 3649 | Ga0373925_0018327 | |||
| 3650 | Ga0373925_0052406 | |||
| 3651 | Ga0373925_0092836 | |||
| 3652 | Ga0373925_0157095 | |||
| 3653 | Ga0373925_0184517 | |||
| 3654 | Ga0373925_0457823 | |||
| 3655 | Ga0373925_0497421 | |||
| 3656 | Ga0373925_0684594 | |||
| 3657 | Ga0373925_1041493 | |||
| 3658 | Ga0395900_0689921 | |||
| 3659 | Ga0395900_1659714 | |||
| 3660 | Ga0395898_0041641 | |||
| 3661 | Ga0395898_0186242 | |||
| 3662 | Ga0395898_0323733 | |||
| 3663 | Ga0395898_0929445 | |||
| 3664 | Ga0395905_0013091 | |||
| 3665 | Ga0436364_0825876 | |||
| 3666 | Ga0436364_0871904 | |||
| 3667 | Ga0395901_0038182 | |||
| 3668 | Ga0395901_0216910 | |||
| 3669 | Ga0395901_0335515 | |||
| 3670 | Ga0395901_0636587 | |||
| 3671 | Ga0395901_1466114 | |||
| 3672 | Ga0242420_027537 | |||
| 3673 | Ga0436365_0256272 | |||
| 3674 | Ga0436365_0306351 | |||
| 3675 | Ga0436365_0309386 | |||
| 3676 | Ga0436365_0333374 | |||
| 3677 | Ga0436365_1152734 | |||
| 3678 | Ga0436360_0027830 | |||
| 3679 | Ga0436360_0485954 | |||
| 3680 | Ga0436360_0500281 | |||
| 3681 | Ga0436360_0503632 | |||
| 3682 | Ga0436360_0853818 | |||
| 3683 | Ga0436360_1207847 | |||
| 3684 | Ga0436360_1263043 | |||
| 3685 | Ga0436361_0067895 | |||
| 3686 | Ga0436361_0704126 | |||
| 3687 | Ga0436363_0481699 | |||
| 3688 | Ga0436362_0162245 | |||
| 3689 | Ga0436362_0910219 | |||
| 3690 | Ga0436362_0939360 | |||
| 3691 | Ga0439466_0152580 | |||
| 3692 | Ga0451793_1361258 | |||
| 3693 | Ga0451797_0545593 | |||
| 3694 | Ga0451798_0980934 | |||
| 3695 | Ga0451800_0001266 | |||
| 3696 | Ga0451802_0105263 | |||
| 3697 | Ga0451804_0971913 | |||
| 3698 | Ga0451807_1645706 | |||
| 3699 | Ga0451807_2770020 | |||
| 3700 | Ga0451833_1211953 | |||
| 3701 | Ga0451847_0188795 | |||
| 3702 | Ga0451851_1057867 | |||
| 3703 | Ga0439449_0191478 | |||
| 3704 | Ga0439450_040119 | |||
| 3705 | Ga0439455_0193604 | |||
| 3706 | Ga0439463_006824 | |||
| 3707 | Ga0450923_083758 | |||
| 3708 | Ga0450908_027224 | |||
| 3709 | Ga0439459_0017909 | |||
| 3710 | Ga0451577_0054974 | |||
| 3711 | Ga0466969_0407110 | |||
| 3712 | Ga0466972_0082820 | |||
| 3713 | Ga0466965_0550848 | |||
| 3714 | Ga0466966_0374420 | |||
| 3715 | Ga0466961_0312723 | |||
| 3716 | Ga0466963_0188785 | |||
| 3717 | Ga0466963_0372580 | |||
| 3718 | Ga0466963_0858346 | |||
| 3719 | Ga0453684_0244131 | |||
| 3720 | Ga0453684_0629404 | |||
| 3721 | Ga0466968_0082045 | |||
| 3722 | Ga0466970_0211324 | |||
| 3723 | Ga0466957_0195572 | |||
| 3724 | Ga0466957_0552410 | |||
| 3725 | Ga0466960_0107277 | |||
| 3726 | Ga0466959_0028187 | |||
| 3727 | Ga0451576_0025688 | |||
| 3728 | Ga0466958_0387133 | |||
| 3729 | Ga0495627_039646 | |||
| 3730 | Ga0495592_0007338 | |||
| 3731 | Ga0495592_0009724 | |||
| 3732 | Ga0495592_0240363 | |||
| 3733 | Ga0495592_0281699 | |||
| 3734 | Ga0495603_0010082 | |||
| 3735 | Ga0495603_0043405 | |||
| 3736 | Ga0495603_0072095 | |||
| 3737 | Ga0495603_0080224 | |||
| 3738 | Ga0495629_0002415 | |||
| 3739 | Ga0495629_0008648 | |||
| 3740 | Ga0495629_0196068 | |||
| 3741 | Ga0495629_0311662 | |||
| 3742 | Ga0495629_0643281 | |||
| 3743 | Ga0495629_0690006 | |||
| 3744 | Ga0495638_0045067 | |||
| 3745 | Ga0495638_0062547 | |||
| 3746 | Ga0495641_0007056 | |||
| 3747 | Ga0495641_0028225 | |||
| 3748 | Ga0495651_0038171 | |||
| 3749 | Ga0495651_0127351 | |||
| 3750 | Ga0495653_0001564 | |||
| 3751 | Ga0495653_0037648 | |||
| 3752 | Ga0495580_0104325 | |||
| 3753 | Ga0495580_0145000 | |||
| 3754 | Ga0495580_0297767 | |||
| 3755 | Ga0495580_0418642 | |||
| 3756 | Ga0495580_0721769 | |||
| 3757 | Ga0495582_0194853 | |||
| 3758 | Ga0495605_0103108 | |||
| 3759 | Ga0495639_0001235 | |||
| 3760 | Ga0495639_0014386 | |||
| 3761 | Ga0495639_0033442 | |||
| 3762 | Ga0495662_0005171 | |||
| 3763 | Ga0495662_0031740 | |||
| 3764 | Ga0495662_0171713 | |||
| 3765 | Ga0495664_0001468 | |||
| 3766 | Ga0495664_0004629 | |||
| 3767 | Ga0495664_0104250 | |||
| 3768 | Ga0495664_0497989 | |||
| 3769 | Ga0495584_0006069 | |||
| 3770 | Ga0495584_0033197 | |||
| 3771 | Ga0495584_0106761 | |||
| 3772 | Ga0495585_0023251 | |||
| 3773 | Ga0495585_0256071 | |||
| 3774 | Ga0495594_0000885 | |||
| 3775 | Ga0495594_0047293 | |||
| 3776 | Ga0495594_0137014 | |||
| 3777 | Ga0495596_0016289 | |||
| 3778 | Ga0495596_0318019 | |||
| 3779 | Ga0495607_0146650 | |||
| 3780 | Ga0495583_0134087 | |||
| 3781 | Ga0495606_0147045 | |||
| 3782 | Ga0495606_0270425 | |||
| 3783 | Ga0495606_0318004 | |||
| 3784 | Ga0495606_0414019 | |||
| 3785 | Ga0495608_0004913 | |||
| 3786 | Ga0495608_0011240 | |||
| 3787 | Ga0495616_0139249 | |||
| 3788 | Ga0495618_0007887 | |||
| 3789 | Ga0495618_0048797 | |||
| 3790 | Ga0495618_0224550 | |||
| 3791 | Ga0495628_0121770 | |||
| 3792 | Ga0495628_0200556 | |||
| 3793 | Ga0495630_0023958 | |||
| 3794 | Ga0495630_0449427 | |||
| 3795 | Ga0495630_0556283 | |||
| 3796 | Ga0495630_0568859 | |||
| 3797 | Ga0495631_0071504 | |||
| 3798 | Ga0495637_0035852 | |||
| 3799 | Ga0495637_0139854 | |||
| 3800 | Ga0495644_0061992 | |||
| 3801 | Ga0495644_0126491 | |||
| 3802 | Ga0495666_0008960 | |||
| 3803 | Ga0495666_0243431 | |||
| 3804 | Ga0495666_0356301 | |||
| 3805 | Ga0495652_0006569 | |||
| 3806 | Ga0495652_0112959 | |||
| 3807 | Ga0495652_0244946 | |||
| 3808 | Ga0495665_0010456 | |||
| 3809 | Ga0495665_0066400 | |||
| 3810 | Ga0495665_0238104 | |||
| 3811 | Ga0495665_0454537 | |||
| 3812 | Ga0495640_0097308 | |||
| 3813 | Ga0495640_0119515 | |||
| 3814 | Ga0495640_0616370 | |||
| 3815 | Ga0495586_0006626 | |||
| 3816 | Ga0495586_0108693 | |||
| 3817 | Ga0495586_0385101 | |||
| 3818 | Ga0495587_0009864 | |||
| 3819 | Ga0495587_0021655 | |||
| 3820 | Ga0495587_0097944 | |||
| 3821 | Ga0495598_0013282 | |||
| 3822 | Ga0495609_0158595 | |||
| 3823 | Ga0495621_0092527 | |||
| 3824 | Ga0495645_0005648 | |||
| 3825 | Ga0495645_0162120 | |||
| 3826 | Ga0495645_0688952 | |||
| 3827 | Ga0495622_0018025 | |||
| 3828 | Ga0495622_0096837 | |||
| 3829 | Ga0495622_0097993 | |||
| 3830 | Ga0495667_0002438 | |||
| 3831 | Ga0495667_0071062 | |||
| 3832 | Ga0495667_0679497 | |||
| 3833 | Ga0495656_0017072 | |||
| 3834 | Ga0495656_0047340 | |||
| 3835 | Ga0495634_0051519 | |||
| 3836 | Ga0495634_0064532 | |||
| 3837 | Ga0495634_0113159 | |||
| 3838 | Ga0495634_0850820 | |||
| 3839 | Ga0495611_0087587 | |||
| 3840 | Ga0495625_0651455 | |||
| 3841 | Ga0495635_0001320 | |||
| 3842 | Ga0495635_0237066 | |||
| 3843 | Ga0495659_0047341 | |||
| 3844 | Ga0495659_0063621 | |||
| 3845 | Ga0495661_0150947 | |||
| 3846 | Ga0495661_0241783 | |||
| 3847 | Ga0495588_0088582 | |||
| 3848 | Ga0495657_0004369 | |||
| 3849 | Ga0495657_0201003 | |||
| 3850 | Ga0495657_0504188 | |||
| 3851 | Ga0495599_0014982 | |||
| 3852 | Ga0495599_0032053 | |||
| 3853 | Ga0495623_0005523 | |||
| 3854 | Ga0495646_0001863 | |||
| 3855 | Ga0495646_0002260 | |||
| 3856 | Ga0495647_0000406 | |||
| 3857 | Ga0495647_0005548 | |||
| 3858 | Ga0495647_0014711 | |||
| 3859 | Ga0495647_0116523 | |||
| 3860 | Ga0495658_0000992 | |||
| 3861 | Ga0495658_0003451 | |||
| 3862 | Ga0495658_0044958 | |||
| 3863 | Ga0495658_0437053 | |||
| 3864 | Ga0495658_0573697 | |||
| 3865 | Ga0495669_0025391 | |||
| 3866 | Ga0495669_0209154 | |||
| 3867 | Ga0495613_0008131 | |||
| 3868 | Ga0495613_0082724 | |||
| 3869 | Ga0495613_0115123 | |||
| 3870 | Ga0495624_0003021 | |||
| 3871 | Ga0495624_0095937 | |||
| 3872 | Ga0495624_0164681 | |||
| 3873 | Ga0495624_0182713 | |||
| 3874 | Ga0495624_0204350 | |||
| 3875 | Ga0495624_0254278 | |||
| 3876 | Ga0495671_0028600 | |||
| 3877 | Ga0495671_0264196 | |||
| 3878 | Ga0495649_0361839 | |||
| 3879 | Ga0495649_0378185 | |||
| 3880 | Ga0495589_0231183 | |||
| 3881 | Ga0495600_0004026 | |||
| 3882 | Ga0495600_0025145 | |||
| 3883 | Ga0495660_0106434 | |||
| 3884 | Ga0495581_0004714 | |||
| 3885 | Ga0495581_0025832 | |||
| 3886 | Ga0495581_0175629 | |||
| 3887 | Ga0495581_0369917 | |||
| 3888 | Ga0495581_0464850 | |||
| 3889 | Ga0495604_0004371 | |||
| 3890 | Ga0495604_0014285 | |||
| 3891 | Ga0495636_0195845 | |||
| 3892 | Ga0495674_0050447 | |||
| 3893 | Ga0495674_0063241 | |||
| 3894 | Ga0495674_0065328 | |||
| 3895 | Ga0495674_0080891 | |||
| 3896 | Ga0495674_0158381 | |||
| 3897 | Ga0495674_0683556 | |||
| 3898 | Ga0495672_0174321 | |||
| 3899 | Ga0495672_0215502 | |||
| 3900 | Ga0495676_0086776 | |||
| 3901 | Ga0495676_0206580 | |||
| 3902 | Ga0495676_0271913 | |||
| 3903 | Ga0495676_0358073 | |||
| 3904 | Ga0495676_0398758 | |||
| 3905 | Ga0495676_0535528 | |||
| 3906 | Ga0495680_0004581 | |||
| 3907 | Ga0495680_0021543 | |||
| 3908 | Ga0495680_0068859 | |||
| 3909 | Ga0495680_0131854 | |||
| 3910 | Ga0495680_0376506 | |||
| 3911 | Ga0495680_0680692 | |||
| 3912 | Ga0495675_0058076 | |||
| 3913 | Ga0495675_0294671 | |||
| 3914 | Ga0495677_0020410 | |||
| 3915 | Ga0495677_0140963 | |||
| 3916 | Ga0495679_075892 | |||
| 3917 | Ga0495685_073476 | |||
| 3918 | Ga0495673_0125246 | |||
| 3919 | Ga0495684_0000665 | |||
| 3920 | Ga0495684_0049452 | |||
| 3921 | Ga0495684_0157389 | |||
| 3922 | Ga0495684_0586580 | |||
| 3923 | Ga0495686_0208209 | |||
| 3924 | Ga0495593_0002227 | |||
| 3925 | Ga0495593_0026621 | |||
| 3926 | Ga0495602_0003946 | |||
| 3927 | Ga0495602_0078824 | |||
| 3928 | Ga0495602_0177367 | |||
| 3929 | Ga0495602_0399205 | |||
| 3930 | Ga0495602_0935539 | |||
| 3931 | Ga0495614_0013298 | |||
| 3932 | Ga0495614_0073117 | |||
| 3933 | Ga0495615_0036334 | |||
| 3934 | Ga0496100_0003652 | |||
| 3935 | Ga0496100_0013089 | |||
| 3936 | Ga0496100_0025032 | |||
| 3937 | Ga0496100_0107162 | |||
| 3938 | Ga0496100_0121395 | |||
| 3939 | Ga0496100_0151296 | |||
| 3940 | Ga0496100_0190031 | |||
| 3941 | Ga0496100_0220313 | |||
| 3942 | Ga0496100_0421157 | |||
| 3943 | Ga0496101_0000964 | |||
| 3944 | Ga0496101_0001534 | |||
| 3945 | Ga0496101_0022529 | |||
| 3946 | Ga0496101_0263881 | |||
| 3947 | Ga0496101_0408679 | |||
| 3948 | Ga0496101_0594301 | |||
| 3949 | Ga0496101_0910390 | |||
| 3950 | Ga0496102_0018417 | |||
| 3951 | Ga0496102_0041498 | |||
| 3952 | Ga0496102_0081943 | |||
| 3953 | Ga0496102_0134424 | |||
| 3954 | Ga0496102_0202829 | |||
| 3955 | Ga0496102_0277278 | |||
| 3956 | Ga0496102_0415258 | |||
| 3957 | Ga0496102_0954277 | |||
| 3958 | Ga0496102_1002107 | |||
| 3959 | Ga0496103_0002627 | |||
| 3960 | Ga0496103_0060798 | |||
| 3961 | Ga0496103_0077179 | |||
| 3962 | Ga0496103_0133772 | |||
| 3963 | Ga0496103_0140554 | |||
| 3964 | Ga0496103_0240986 | |||
| 3965 | Ga0496103_0433272 | |||
| 3966 | Ga0496103_0540409 | |||
| 3967 | Ga0496104_0000062 | |||
| 3968 | Ga0496104_0003859 | |||
| 3969 | Ga0496104_0005449 | |||
| 3970 | Ga0496104_0006088 | |||
| 3971 | Ga0496104_0012447 | |||
| 3972 | Ga0496104_0019562 | |||
| 3973 | Ga0496104_0328086 | |||
| 3974 | Ga0496104_0351141 | |||
| 3975 | Ga0496104_0369650 | |||
| 3976 | Ga0496104_0869670 | |||
| 3977 | Ga0496104_1839788 | |||
| 3978 | Ga0496105_0000069 | |||
| 3979 | Ga0496105_0002521 | |||
| 3980 | Ga0496105_0005334 | |||
| 3981 | Ga0496105_0012965 | |||
| 3982 | Ga0496105_0013368 | |||
| 3983 | Ga0496105_0020223 | |||
| 3984 | Ga0496106_0005548 | |||
| 3985 | Ga0496106_0010045 | |||
| 3986 | Ga0496106_0014992 | |||
| 3987 | Ga0496106_0021945 | |||
| 3988 | Ga0496106_0282868 | |||
| 3989 | Ga0496106_0730589 | |||
| 3990 | Ga0496106_1394956 | |||
| 3991 | Ga0496107_0009919 | |||
| 3992 | Ga0496107_0030691 | |||
| 3993 | Ga0496107_0033427 | |||
| 3994 | Ga0496107_0036189 | |||
| 3995 | Ga0496107_0065471 | |||
| 3996 | Ga0496107_0161334 | |||
| 3997 | Ga0496107_0258524 | |||
| 3998 | Ga0496108_0005674 | |||
| 3999 | Ga0496108_0014484 | |||
| 4000 | Ga0496108_0016715 | |||
| 4001 | Ga0496108_0048390 | |||
| 4002 | Ga0496108_0076490 | |||
| 4003 | Ga0496108_0105509 | |||
| 4004 | Ga0496108_0113341 | |||
| 4005 | Ga0496108_0196494 | |||
| 4006 | Ga0496108_0378916 | |||
| 4007 | Ga0496109_0001018 | |||
| 4008 | Ga0496109_0003269 | |||
| 4009 | Ga0496109_0006704 | |||
| 4010 | Ga0496109_0018236 | |||
| 4011 | Ga0496109_0036180 | |||
| 4012 | Ga0496109_0043990 | |||
| 4013 | Ga0496109_0123518 | |||
| 4014 | Ga0496109_0326010 | |||
| 4015 | Ga0496109_0526720 | |||
| 4016 | Ga0496109_0566068 | |||
| 4017 | Ga0496110_0003889 | |||
| 4018 | Ga0496110_0004123 | |||
| 4019 | Ga0496110_0008786 | |||
| 4020 | Ga0496110_0010013 | |||
| 4021 | Ga0496110_0017504 | |||
| 4022 | Ga0496110_0088669 | |||
| 4023 | Ga0496110_0139440 | |||
| 4024 | Ga0496110_0186049 | |||
| 4025 | Ga0496110_0226468 | |||
| 4026 | Ga0496110_0303999 | |||
| 4027 | Ga0496110_1545798 | |||
| 4028 | Ga0496111_0009604 | |||
| 4029 | Ga0496111_0020260 | |||
| 4030 | Ga0496111_0026058 | |||
| 4031 | Ga0496111_0252017 | |||
| 4032 | Ga0496112_0000079 | |||
| 4033 | Ga0496112_0014236 | |||
| 4034 | Ga0496112_0025757 | |||
| 4035 | Ga0496112_0067442 | |||
| 4036 | Ga0496112_0104117 | |||
| 4037 | Ga0496112_0188627 | |||
| 4038 | Ga0496112_0228031 | |||
| 4039 | Ga0496112_0306080 | |||
| 4040 | Ga0496112_0486692 | |||
| 4041 | Ga0496112_0582312 | |||
| 4042 | Ga0496113_0001952 | |||
| 4043 | Ga0496113_0002550 | |||
| 4044 | Ga0496113_0038672 | |||
| 4045 | Ga0496113_0049794 | |||
| 4046 | Ga0496113_0109928 | |||
| 4047 | Ga0496113_0131767 | |||
| 4048 | Ga0496113_0324454 | |||
| 4049 | Ga0496114_0005552 | |||
| 4050 | Ga0496114_0052754 | |||
| 4051 | Ga0496114_0130190 | |||
| 4052 | Ga0496114_0133737 | |||
| 4053 | Ga0496114_0296768 | |||
| 4054 | Ga0496114_0301128 | |||
| 4055 | Ga0496114_0544100 | |||
| 4056 | Ga0496115_0009587 | |||
| 4057 | Ga0496115_0038830 | |||
| 4058 | Ga0496115_0045916 | |||
| 4059 | Ga0496115_0065973 | |||
| 4060 | Ga0496115_0134504 | |||
| 4061 | Ga0496115_0361080 | |||
| 4062 | Ga0496115_0380730 | |||
| 4063 | Ga0496115_0470906 | |||
| 4064 | Ga0496115_0759519 | |||
| 4065 | Ga0496115_0829709 | |||
| 4066 | Ga0496116_0032483 | |||
| 4067 | Ga0496116_0235587 | |||
| 4068 | Ga0496117_0018894 | |||
| 4069 | Ga0496118_0003967 | |||
| 4070 | Ga0496119_0008884 | |||
| 4071 | Ga0496119_0021564 | |||
| 4072 | Ga0496119_0347648 | |||
| 4073 | Ga0496120_0172926 | |||
| 4074 | Ga0496121_0000576 | |||
| 4075 | Ga0496121_0001526 | |||
| 4076 | Ga0496121_0466583 | |||
| 4077 | Ga0496122_0000160 | |||
| 4078 | Ga0496122_0503000 | |||
| 4079 | Ga0496123_0000034 | |||
| 4080 | Ga0496123_0242564 | |||
| 4081 | Ga0496124_0055299 | |||
| 4082 | Ga0496124_0366719 | |||
| 4083 | Ga0496125_0034194 | |||
| 4084 | Ga0496125_0357155 | |||
| 4085 | Ga0496125_0497614 | |||
| 4086 | Ga0496126_0008516 | |||
| 4087 | Ga0496126_0300824 | |||
| 4088 | Ga0496126_0346193 | |||
| 4089 | Ga0496126_0465985 | |||
| 4090 | Ga0501306_011394 | |||
| 4091 | Ga0501306_022221 | |||
| 4092 | Ga0501306_074175 | |||
| 4093 | Ga0501308_027067 | |||
| 4094 | Ga0501309_084324 | |||
| 4095 | Ga0501345_03992 | |||
| 4096 | Ga0501304_007279 | |||
| 4097 | Ga0501305_032249 | |||
| 4098 | Ga0501305_033893 | |||
| 4099 | Ga0501305_108060 | |||
| 4100 | Ga0501307_014408 | |||
| 4101 | Ga0501307_019821 | |||
| 4102 | Ga0495682_0001739 | |||
| 4103 | Ga0495682_0069478 | |||
| 4104 | Ga0501311_013856 | |||
| 4105 | Ga0501311_056326 | |||
| 4106 | Ga0501312_087642 | |||
| 4107 | Ga0501313_033449 | |||
| 4108 | Ga0501313_051383 | |||
| 4109 | Ga0501314_006563 | |||
| 4110 | Ga0501315_017382 | |||
| 4111 | Ga0501316_035020 | |||
| 4112 | Ga0501316_052286 | |||
| 4113 | Ga0501316_066641 | |||
| 4114 | Ga0501317_054853 | |||
| 4115 | Ga0501318_052024 | |||
| 4116 | Ga0501319_004718 | |||
| 4117 | Ga0501319_030601 | |||
| 4118 | Ga0501320_016699 | |||
| 4119 | Ga0501320_044408 | |||
| 4120 | Ga0501321_030603 | |||
| 4121 | Ga0501321_031387 | |||
| 4122 | Ga0501321_063682 | |||
| 4123 | Ga0501322_008464 | |||
| 4124 | Ga0501323_013727 | |||
| 4125 | Ga0501323_029143 | |||
| 4126 | Ga0501324_009375 | |||
| 4127 | Ga0501325_008441 | |||
| 4128 | Ga0501325_010379 | |||
| 4129 | Ga0501325_017743 | |||
| 4130 | Ga0501325_040955 | |||
| 4131 | Ga0501325_041014 | |||
| 4132 | Ga0501327_08600 | |||
| 4133 | Ga0501328_10531 | |||
| 4134 | Ga0501329_09609 | |||
| 4135 | Ga0501329_10195 | |||
| 4136 | Ga0501330_008594 | |||
| 4137 | Ga0501331_15584 | |||
| 4138 | Ga0501335_029033 | |||
| 4139 | Ga0501336_021297 | |||
| 4140 | Ga0501031_0585608 | |||
| 4141 | Ga0501031_0715726 | |||
| 4142 | Ga0501031_0955429 | |||
| 4143 | Ga0501032_0057878 | |||
| 4144 | Ga0501032_0078899 | |||
| 4145 | Ga0501032_0138096 | |||
| 4146 | Ga0501032_0283490 | |||
| 4147 | Ga0501033_0000763 | |||
| 4148 | Ga0501033_0013758 | |||
| 4149 | Ga0501033_0041417 | |||
| 4150 | Ga0501033_0068350 | |||
| 4151 | Ga0501033_0105075 | |||
| 4152 | Ga0501033_0187357 | |||
| 4153 | Ga0501033_0211894 | |||
| 4154 | Ga0501033_0267769 | |||
| 4155 | Ga0501033_0303176 | |||
| 4156 | Ga0501033_0860020 | |||
| 4157 | Ga0501034_0109420 | |||
| 4158 | Ga0501034_0206828 | |||
| 4159 | Ga0501034_0220111 | |||
| 4160 | Ga0501034_0262996 | |||
| 4161 | Ga0501034_0351742 | |||
| 4162 | Ga0501034_0502154 | |||
| 4163 | Ga0501034_1018463 | |||
| 4164 | Ga0501034_1249833 | |||
| 4165 | Ga0501034_1529601 | |||
| 4166 | Ga0501036_0023988 | |||
| 4167 | Ga0501036_0059405 | |||
| 4168 | Ga0501036_0276944 | |||
| 4169 | Ga0501036_0404901 | |||
| 4170 | Ga0501036_1057402 | |||
| 4171 | Ga0501037_0061556 | |||
| 4172 | Ga0501037_0077620 | |||
| 4173 | Ga0501037_0092344 | |||
| 4174 | Ga0501037_0096455 | |||
| 4175 | Ga0501037_0166391 | |||
| 4176 | Ga0501037_0823041 | |||
| 4177 | Ga0501038_0064087 | |||
| 4178 | Ga0501038_0096710 | |||
| 4179 | Ga0501038_0126590 | |||
| 4180 | Ga0501038_0187470 | |||
| 4181 | Ga0501038_0215822 | |||
| 4182 | Ga0501038_0428605 | |||
| 4183 | Ga0501038_0928801 | |||
| 4184 | Ga0501038_0982752 | |||
| 4185 | Ga0501038_1067581 | |||
| 4186 | Ga0501039_0420782 | |||
| 4187 | Ga0501039_0668118 | |||
| 4188 | Ga0501039_0843268 | |||
| 4189 | Ga0501040_0347397 | |||
| 4190 | Ga0501041_0150747 | |||
| 4191 | Ga0501042_0151831 | |||
| 4192 | Ga0501042_0272239 | |||
| 4193 | Ga0501042_0357926 | |||
| 4194 | Ga0501042_0358368 | |||
| 4195 | Ga0501042_0650562 | |||
| 4196 | Ga0501043_0028008 | |||
| 4197 | Ga0501043_0065904 | |||
| 4198 | Ga0501043_0146293 | |||
| 4199 | Ga0501043_0182295 | |||
| 4200 | Ga0501043_0247472 | |||
| 4201 | Ga0501043_0297076 | |||
| 4202 | Ga0501043_0512099 | |||
| 4203 | Ga0501046_0024970 | |||
| 4204 | Ga0501046_0338508 | |||
| 4205 | Ga0501046_0409153 | |||
| 4206 | Ga0501046_0606871 | |||
| 4207 | Ga0501046_0776205 | |||
| 4208 | Ga0501047_0009361 | |||
| 4209 | Ga0501047_0027159 | |||
| 4210 | Ga0501047_0042561 | |||
| 4211 | Ga0501047_0055535 | |||
| 4212 | Ga0501047_0079894 | |||
| 4213 | Ga0501047_0105031 | |||
| 4214 | Ga0501047_0138409 | |||
| 4215 | Ga0501047_0299684 | |||
| 4216 | Ga0501047_0441750 | |||
| 4217 | Ga0501047_0705864 | |||
| 4218 | Ga0501047_1071807 | |||
| 4219 | Ga0501048_0368864 | |||
| 4220 | Ga0501067_0003431 | |||
| 4221 | Ga0501067_0062663 | |||
| 4222 | Ga0501068_0191040 | |||
| 4223 | Ga0501068_0402926 | |||
| 4224 | Ga0501069_0464584 | |||
| 4225 | Ga0501070_0013211 | |||
| 4226 | Ga0501070_0060200 | |||
| 4227 | Ga0501070_0065603 | |||
| 4228 | Ga0501070_0084233 | |||
| 4229 | Ga0501070_0106670 | |||
| 4230 | Ga0501070_0240323 | |||
| 4231 | Ga0501071_0261423 | |||
| 4232 | Ga0501071_0293848 | |||
| 4233 | Ga0501072_0006469 | |||
| 4234 | Ga0501072_0007497 | |||
| 4235 | Ga0501072_0298024 | |||
| 4236 | Ga0501072_0693278 | |||
| 4237 | Ga0501073_0030301 | |||
| 4238 | Ga0501073_0111058 | |||
| 4239 | Ga0501073_0202041 | |||
| 4240 | Ga0501073_0217534 | |||
| 4241 | Ga0501073_0438839 | |||
| 4242 | Ga0501073_0507685 | |||
| 4243 | Ga0501073_0513554 | |||
| 4244 | Ga0501073_0669927 | |||
| 4245 | Ga0501074_0279253 | |||
| 4246 | Ga0501074_0399881 | |||
| 4247 | Ga0501074_0750382 | |||
| 4248 | Ga0501075_0091594 | |||
| 4249 | Ga0501075_0298241 | |||
| 4250 | Ga0501075_0584864 | |||
| 4251 | Ga0501076_0019729 | |||
| 4252 | Ga0501076_0111236 | |||
| 4253 | Ga0501076_0124026 | |||
| 4254 | Ga0501076_0264061 | |||
| 4255 | Ga0501077_0135215 | |||
| 4256 | Ga0501243_055495 | |||
| 4257 | Ga0501253_131304 | |||
| 4258 | Ga0501259_142044 | |||
| 4259 | Ga0501079_0019839 | |||
| 4260 | Ga0501079_0101613 | |||
| 4261 | Ga0501079_0339646 | |||
| 4262 | Ga0501079_0659442 | |||
| 4263 | Ga0501079_0754810 | |||
| 4264 | Ga0501079_0863338 | |||
| 4265 | Ga0501080_0027939 | |||
| 4266 | Ga0501080_0032171 | |||
| 4267 | Ga0501080_0079896 | |||
| 4268 | Ga0501080_0097738 | |||
| 4269 | Ga0501080_0151156 | |||
| 4270 | Ga0501080_0330730 | |||
| 4271 | Ga0501081_0004665 | |||
| 4272 | Ga0501081_0066924 | |||
| 4273 | Ga0501081_0122167 | |||
| 4274 | Ga0501083_0005990 | |||
| 4275 | Ga0501083_0042949 | |||
| 4276 | Ga0501083_0083005 | |||
| 4277 | Ga0501083_0270798 | |||
| 4278 | Ga0501083_0399139 | |||
| 4279 | Ga0501083_0697781 | |||
| 4280 | Ga0501268_023113 | |||
| 4281 | Ga0501280_075591 | |||
| 4282 | Ga0501035_0055995 | |||
| 4283 | Ga0501035_0073162 | |||
| 4284 | Ga0501035_0090103 | |||
| 4285 | Ga0501035_0120821 | |||
| 4286 | Ga0501035_0126146 | |||
| 4287 | Ga0501035_0229518 | |||
| 4288 | Ga0501035_0321314 | |||
| 4289 | Ga0501035_0493632 | |||
| 4290 | Ga0501044_0007994 | |||
| 4291 | Ga0501044_0009855 | |||
| 4292 | Ga0501044_0076782 | |||
| 4293 | Ga0501044_0083877 | |||
| 4294 | Ga0501044_0093477 | |||
| 4295 | Ga0501044_0154315 | |||
| 4296 | Ga0501044_0154552 | |||
| 4297 | Ga0501044_0161764 | |||
| 4298 | Ga0501044_0191698 | |||
| 4299 | Ga0501044_0368466 | |||
| 4300 | Ga0501044_0384559 | |||
| 4301 | Ga0501044_0463960 | |||
| 4302 | Ga0501044_0471468 | |||
| 4303 | Ga0501044_0574218 | |||
| 4304 | Ga0501044_0722177 | |||
| 4305 | Ga0501044_1096889 | |||
| 4306 | nmdc:mga03683_192237_c1 | |||
| 4307 | nmdc:mga03683_33053_c1 | |||
| 4308 | nmdc:mga03683_97080_c1 | |||
| 4309 | nmdc:mga03n38_636598_c1 | |||
| 4310 | nmdc:mga03n38_699629_c1 | |||
| 4311 | nmdc:mga00v17_179599_c1 | |||
| 4312 | nmdc:mga00v17_254254_c1 | |||
| 4313 | nmdc:mga00v17_850766_c1 | |||
| 4314 | nmdc:mga0yw44_197226_c1 | |||
| 4315 | nmdc:mga0yw44_24684_c1 | |||
| 4316 | nmdc:mga0yw44_320641_c1 | |||
| 4317 | nmdc:mga0yw44_5178_c1 | |||
| 4318 | nmdc:mga0yw44_72129_c1 | |||
| 4319 | nmdc:mga0k408_176885_c1 | |||
| 4320 | nmdc:mga0k408_43959_c1 | |||
| 4321 | nmdc:mga06z11_105625_c1 | |||
| 4322 | nmdc:mga06z11_206429_c1 | |||
| 4323 | nmdc:mga06z11_28022_c1 | |||
| 4324 | nmdc:mga06z11_403118_c1 | |||
| 4325 | nmdc:mga06z11_413932_c1 | |||
| 4326 | nmdc:mga06z11_455955_c1 | |||
| 4327 | nmdc:mga06z11_5834_c1 | |||
| 4328 | nmdc:mga04h51_28279_c1 | |||
| 4329 | nmdc:mga04h51_303378_c1 | |||
| 4330 | nmdc:mga07m45_325211_c1 | |||
| 4331 | nmdc:mga07m45_514818_c1 | |||
| 4332 | nmdc:mga05p37_1103959_c1 | |||
| 4333 | nmdc:mga05p37_1402269_c1 | |||
| 4334 | nmdc:mga05p37_203667_c1 | |||
| 4335 | nmdc:mga05p37_295714_c1 | |||
| 4336 | nmdc:mga05p37_346454_c1 | |||
| 4337 | nmdc:mga05p37_427886_c1 | |||
| 4338 | nmdc:mga05p37_478293_c1 | |||
| 4339 | nmdc:mga05p37_843418_c1 | |||
| 4340 | nmdc:mga09592_110127_c1 | |||
| 4341 | nmdc:mga09592_572805_c1 | |||
| 4342 | nmdc:mga09592_583050_c1 | |||
| 4343 | nmdc:mga0qj67_110_c1 | |||
| 4344 | nmdc:mga0qj67_192888_c1 | |||
| 4345 | nmdc:mga0qj67_210707_c1 | |||
| 4346 | nmdc:mga0qj67_45773_c1 | |||
| 4347 | nmdc:mga0qj67_895066_c1 | |||
| 4348 | nmdc:mga06r32_140579_c1 | |||
| 4349 | nmdc:mga06r32_240550_c1 | |||
| 4350 | nmdc:mga06r32_357616_c1 | |||
| 4351 | nmdc:mga06r32_69907_c1 | |||
| 4352 | nmdc:mga08y16_1040336_c1 | |||
| 4353 | nmdc:mga08y16_105316_c1 | |||
| 4354 | nmdc:mga08y16_112073_c1 | |||
| 4355 | nmdc:mga08y16_1179181_c1 | |||
| 4356 | nmdc:mga08y16_16917_c1 | |||
| 4357 | nmdc:mga08y16_20977_c1 | |||
| 4358 | nmdc:mga08y16_311778_c1 | |||
| 4359 | nmdc:mga0n895_1204055_c1 | |||
| 4360 | nmdc:mga0n895_30484_c1 | |||
| 4361 | nmdc:mga0n895_313048_c1 | |||
| 4362 | nmdc:mga0n895_32647_c1 | |||
| 4363 | nmdc:mga0n895_43218_c1 | |||
| 4364 | nmdc:mga0n895_821186_c1 | |||
| 4365 | nmdc:mga0n895_848429_c1 | |||
| 4366 | nmdc:mga0rr50_106113_c1 | |||
| 4367 | nmdc:mga0rr50_1154146_c1 | |||
| 4368 | nmdc:mga0rr50_295143_c1 | |||
| 4369 | nmdc:mga0rr50_304657_c1 | |||
| 4370 | nmdc:mga0rr50_509303_c1 | |||
| 4371 | nmdc:mga08x19_197103_c1 | |||
| 4372 | nmdc:mga08x19_348162_c1 | |||
| 4373 | nmdc:mga08x19_62131_c1 | |||
| 4374 | nmdc:mga08x19_7671_c1 | |||
| 4375 | nmdc:mga08x19_96968_c1 | |||
| 4376 | nmdc:mga0a205_199291_c1 | |||
| 4377 | nmdc:mga0a205_485_c2 | |||
| 4378 | nmdc:mga0a205_80824_c1 | |||
| 4379 | nmdc:mga0a205_815016_c1 | |||
| 4380 | nmdc:mga0sz30_39284_c1 | |||
| 4381 | Ga0495601_0001249 | |||
| 4382 | Ga0495601_0005437 | |||
| 4383 | Ga0495601_0020790 | |||
| 4384 | Ga0495601_0029740 | |||
| 4385 | Ga0495601_0165209 | |||
| 4386 | Ga0495612_0001253 | |||
| 4387 | Ga0495612_0008705 | |||
| 4388 | Ga0495612_0130839 | |||
| 4389 | Ga0495612_0198168 | |||
| 4390 | Ga0500635_0015409 | |||
| 4391 | Ga0495655_0012906 | |||
| 4392 | Ga0495595_0000908 | |||
| 4393 | Ga0495595_0002372 | |||
| 4394 | Ga0495595_0169026 | |||
| 4395 | Ga0495619_0003156 | |||
| 4396 | Ga0495619_0005876 | |||
| 4397 | Ga0495619_0040506 | |||
| 4398 | Ga0495619_0060676 | |||
| 4399 | Ga0495619_0061545 | |||
| 4400 | Ga0500643_000003 | |||
| 4401 | Ga0500647_0278844 | |||
| 4402 | Ga0500566_0103446 | |||
| 4403 | Ga0500566_0430688 | |||
| 4404 | Ga0500641_0080812 | |||
| 4405 | Ga0500648_199276 | |||
| 4406 | Ga0500558_143487 | |||
| 4407 | Ga0500592_040571 | |||
| 4408 | Ga0500595_000096 | |||
| 4409 | Ga0500595_036587 | |||
| 4410 | Ga0500595_041856 | |||
| 4411 | Ga0500595_088417 | |||
| 4412 | Ga0500618_003035 | |||
| 4413 | Ga0500628_152685 | |||
| 4414 | Ga0500642_0147330 | |||
| 4415 | Ga0500559_0167038 | |||
| 4416 | Ga0500564_235778 | |||
| 4417 | Ga0500568_0009896 | |||
| 4418 | Ga0500573_0000002 | |||
| 4419 | Ga0500573_0013140 | |||
| 4420 | Ga0500603_058966 | |||
| 4421 | Ga0500616_0002365 | |||
| 4422 | Ga0500616_0259111 | |||
| 4423 | Ga0500619_147881 | |||
| 4424 | Ga0500638_149454 | |||
| 4425 | Ga0500639_135040 | |||
| 4426 | Ga0500636_0000044 | |||
| 4427 | Ga0500636_0087924 | |||
| 4428 | Ga0500636_0253672 | |||
| 4429 | Ga0500645_034726 | |||
| 4430 | Ga0500645_078168 | |||
| 4431 | Ga0500596_019464 | |||
| 4432 | Ga0501084_0000049 | |||
| 4433 | Ga0501084_0006919 | |||
| 4434 | Ga0501084_0014455 | |||
| 4435 | Ga0501084_0071047 | |||
| 4436 | Ga0501084_0093223 | |||
| 4437 | Ga0501084_0143212 | |||
| 4438 | Ga0501084_0176012 | |||
| 4439 | Ga0501084_0482857 | |||
| 4440 | Ga0501084_0554901 | |||
| 4441 | Ga0501084_0953143 | |||
| 4442 | Ga0501084_1160584 | |||
| 4443 | Ga0501084_1386455 | |||
| 4444 | Ga0587084_013044 | |||
| 4445 | Ga0587066_020471 | |||
| 4446 | Ga0587070_022744 | |||
| 4447 | Ga0587073_0060983 | |||
| 4448 | Ga0587077_018926 | |||
| 4449 | Ga0587077_081476 | |||
| 4450 | Ga0587080_025810 | |||
| 4451 | Ga0587080_026354 | |||
| 4452 | Ga0587083_0035659 | |||
| 4453 | Ga0587085_019087 | |||
| 4454 | Ga0587088_026948 | |||
| 4455 | Ga0587089_042684 | |||
| 4456 | Ga0587089_050426 | |||
| 4457 | Ga0587090_018670 | |||
| 4458 | Ga0587091_018613 | |||
| 4459 | Ga0587101_008409 | |||
| 4460 | Ga0587109_013812 | |||
| 4461 | Ga0587115_013681 | |||
| 4462 | Ga0587128_019433 | |||
| 4463 | Ga0587062_014590 | |||
| 4464 | Ga0587067_013983 | |||
| 4465 | Ga0587072_020857 | |||
| 4466 | Ga0587075_017541 | |||
| 4467 | Ga0587076_023815 | |||
| 4468 | Ga0587076_132310 | |||
| 4469 | Ga0587078_010640 | |||
| 4470 | Ga0587079_070651 | |||
| 4471 | Ga0587105_001741 | |||
| 4472 | Ga0587107_013776 | |||
| 4473 | Ga0587110_038127 | |||
| 4474 | Ga0587111_0036701 | |||
| 4475 | Ga0501082_0031765 | |||
| 4476 | Ga0501082_0053384 | |||
| 4477 | Ga0501082_0406412 | |||
| 4478 | Ga0501082_0409845 | |||
| 4479 | Ga0501082_0566261 | |||
| 4480 | Ga0501082_0823041 | |||
| 4481 | Ga0501082_1549695 | |||
| 4482 | Ga0530510_0081435 | |||
| 4483 | Ga0530510_0468780 | |||
| 4484 | Ga0530510_0494603 | |||
| 4485 | 2600201226 | |||
| 4486 | 2842695820 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8c99-assembly1.cif.gz_J | cryo-em captures early ribosome assembly in action | 0.8694 | 1 | 143 |
| 8c99-assembly1.cif.gz_J | cryo-em captures early ribosome assembly in action | 0.8632 | 1 | 143 |
| 8c93-assembly1.cif.gz_J | cryo-em captures early ribosome assembly in action | 0.8377 | 1 | 143 |
| 8c93-assembly1.cif.gz_J | cryo-em captures early ribosome assembly in action | 0.832 | 1 | 143 |
| 8c91-assembly1.cif.gz_J | cryo-em captures early ribosome assembly in action | 0.8261 | 1 | 143 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4dhcN00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.8254 | 1 | 143 | 3.90.1180.10 |
| 4dhcN00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.8198 | 1 | 143 | 3.90.1180.10 |
| af_O96222_56_212_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.8004 | 9 | 141 | 3.90.1180.10 |
| af_Q4CZX3_36_177_3.90.1180.10 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.7921 | 13 | 141 | 3.90.1180.10 |
| 2v47N00 | Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L13p; Chain: A;;Ribosomal protein L13 | 0.7833 | 1 | 141 | 3.90.1180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C6XKJ9-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.8461 | 1 | 154 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-A0A8A8PMT4-F1-model_v4 | deleted | 0.8454 | 1 | 154 |
|
| AF-A0A0M3BQI7-F1-model_v4 | Large ribosomal subunit protein uL13 | 0.8447 | 1 | 154 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-Q8UFZ7-F1-model_v4 | Large ribosomal subunit protein uL13 (50S ribosomal protein L13) | 0.8446 | 1 | 154 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |
| AF-Q1MIP2-F1-model_v4 | Large ribosomal subunit protein uL13 (50S ribosomal protein L13) | 0.8442 | 1 | 154 |
GO:0003729
GO:0003735 GO:0006412 GO:0017148 GO:0022625 |