F496594

General Info

Members Datasets Scaffolds Average Seq Length
2245 783 4490 130

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10003054|Ga0075368_100030542
Length 145
Sequence MKLNTIKPAEGAKHAKRRGHKGQKSRAGGFHKVGFEGGQMPLQRRLPKRGFSSLTREFVAEVRLDELERLEATDITLDVLKAAGVVPVLTIRAKVILSGKLARKVALSAGVIATKGAKSAVEAAGGSVAEVVVKPVERKLKAKAK

Samples

Sample ID Description Type Environment
1 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
10 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
11 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
12 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
17 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
21 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
23 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
24 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
28 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
29 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
30 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
31 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
32 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
33 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
34 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
35 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
36 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
37 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
38 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
39 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
40 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
41 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
42 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
43 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
44 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
45 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
46 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
47 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
48 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
49 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
50 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
51 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
52 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
53 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
54 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
55 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
56 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
57 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
58 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
59 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
60 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
61 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
63 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
64 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
65 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
66 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
67 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
68 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
69 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
70 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
71 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
72 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
73 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
74 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
75 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
76 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
77 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
78 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
79 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
80 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
81 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
82 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
83 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
84 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
85 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
86 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
87 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
88 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
89 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
90 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
91 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
92 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
93 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
94 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
95 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
96 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
97 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
98 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
99 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
100 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
101 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
102 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
103 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
104 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
105 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
106 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
107 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
108 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
109 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
110 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
111 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
112 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
113 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
114 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
115 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
116 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
117 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
118 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
119 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
120 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
121 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
123 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
124 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
125 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
126 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
127 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
128 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
129 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
130 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
131 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
132 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
133 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
134 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
136 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
137 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
139 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
140 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
141 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
142 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
143 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
144 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
145 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
146 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
147 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
148 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
149 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
150 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
152 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
153 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
154 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
155 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
156 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
157 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
158 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
159 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
160 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
161 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
162 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
163 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
164 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
165 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
166 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
167 3300019179 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300019181 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
170 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
171 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
172 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
174 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
175 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
177 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
179 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
180 3300023560 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
181 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
182 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
189 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
190 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
192 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
193 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
196 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
197 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
198 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
199 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
201 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
202 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
203 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
204 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
205 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
206 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
208 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
209 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
261 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
263 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
264 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
266 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
269 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
270 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
271 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
272 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
273 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
274 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
275 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
276 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
277 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
278 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
279 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
280 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
281 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
282 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
288 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
289 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
290 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
291 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
292 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
293 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
294 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
295 3300031667 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
296 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
297 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
298 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
299 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
300 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
301 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
302 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
303 3300031814 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
305 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
306 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
307 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
308 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
309 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
310 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
311 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
312 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
313 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
314 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
316 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
317 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
320 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
321 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
322 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
323 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
324 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
325 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
326 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
327 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
328 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
329 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
330 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
331 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
332 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
333 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
334 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
335 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
336 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
337 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
338 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
339 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
340 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
341 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
342 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
343 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
344 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
345 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
346 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
347 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
348 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
349 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
350 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
351 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
352 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
353 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
354 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
355 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
356 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
357 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
358 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
359 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
360 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
361 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
362 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
363 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
364 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
365 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
366 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
367 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
368 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
369 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
370 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
371 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
372 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
373 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
374 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
375 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
376 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
377 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
378 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
379 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
380 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
381 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
382 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
383 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
384 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
385 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
386 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
387 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
388 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
389 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
390 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
391 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
392 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
393 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
394 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
395 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
396 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
397 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
398 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
399 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
400 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
401 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
402 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
403 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
404 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
405 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
406 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
407 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
408 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
409 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
410 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
411 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
412 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
413 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
414 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
415 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
416 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
417 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
418 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
419 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
420 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
421 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
422 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
423 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
424 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
425 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
426 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
427 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
428 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
429 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
430 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
431 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
432 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
433 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
434 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
435 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
436 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
437 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
438 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
439 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
440 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
441 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
442 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
443 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
444 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
445 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
446 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
447 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
448 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
449 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
450 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
451 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
452 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
453 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
454 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
455 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
456 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
457 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
458 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
459 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
460 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
461 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
462 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
463 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
464 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
465 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
466 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
467 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
468 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
469 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
470 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
471 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
472 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
473 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
474 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
475 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
476 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
477 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
478 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
479 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
480 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
481 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
482 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
483 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
484 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
485 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
486 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
487 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
488 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
489 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
490 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
491 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
492 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
493 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
494 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
495 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
496 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
497 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
498 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
499 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
500 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
501 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
502 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
503 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
504 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
505 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
506 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
507 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
508 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
509 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
510 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
511 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
512 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
513 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
514 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
515 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
516 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
517 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
518 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
519 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
520 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
521 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
522 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
523 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
524 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
525 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
526 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
527 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
528 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
529 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
530 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
531 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
532 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
533 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
534 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
535 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
536 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
537 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
538 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
540 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
541 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
542 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
543 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
544 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
545 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
546 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
547 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
548 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
549 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
550 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
551 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
552 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
553 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
554 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
555 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
556 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
557 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
558 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
559 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
560 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
561 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
562 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
563 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
564 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
565 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
566 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
567 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
568 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
569 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
570 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
571 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
572 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
573 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
574 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
575 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
576 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
577 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
578 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
579 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
580 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
581 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
582 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
583 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
584 3300049657 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought Metagenome Rhizosphere
585 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
586 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
587 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
588 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
589 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
590 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
591 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
592 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
593 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
594 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
595 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
596 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
597 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
598 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
599 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
600 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
601 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
602 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
603 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
604 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
605 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
606 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
607 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
608 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
609 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
610 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
611 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
612 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
613 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
614 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
615 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
616 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
617 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
618 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
619 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
620 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
621 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
622 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
623 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
624 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
625 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
626 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
627 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
628 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
629 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
630 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
631 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
632 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
633 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
634 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
635 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
636 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
637 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
638 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
639 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
640 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
641 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
642 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
643 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
644 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
645 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
646 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
647 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
648 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
649 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
650 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
651 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
652 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
653 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
654 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
655 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
656 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
657 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
658 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
659 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
660 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
661 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
662 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
663 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
664 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
665 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
666 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
667 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
668 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
669 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
670 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
671 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
672 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
673 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
674 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
675 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
676 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
677 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
678 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
679 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
680 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
681 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
682 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
683 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
684 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
685 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
686 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
687 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
688 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
689 2519103095 Burkholderia sp. KJ006 Isolate Nodule
690 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
691 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
692 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
693 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
694 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
695 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
696 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
697 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
698 2643221556 Massilia sp. Root1485 Isolate Unclassified
699 2643221621 Achromobacter sp. Root83 Isolate Unclassified
700 2643221638 Duganella sp. Root336D2 Isolate Unclassified
701 2643221645 Massilia sp. Root351 Isolate Unclassified
702 2643221664 Massilia sp. Root418 Isolate Unclassified
703 2643221684 Massilia sp. Root133 Isolate Unclassified
704 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
705 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
706 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
707 2738541280 Massilia sp. GV090 Isolate Unclassified
708 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
709 2738541297 Duganella sp. GV083 Isolate Unclassified
710 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
711 2738541300 Massilia sp. GV016 Isolate Unclassified
712 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
713 2738541357 Duganella sp. GV053 Isolate Unclassified
714 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
715 2738543003 Duganella sp. GV066 Isolate Unclassified
716 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
717 2738543018 Massilia sp. GV045 Isolate Unclassified
718 2738543026 Duganella sp. GV089 Isolate Unclassified
719 2738543029 Duganella sp. GV039 Isolate Unclassified
720 2738543030 Massilia sp. GV097 Isolate Unclassified
721 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
722 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
723 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
724 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
725 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
726 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
727 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
728 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
729 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
730 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
731 2818991450 Burkholderia sp. 604 Isolate Unclassified
732 2818991452 Burkholderia cepacia 561 Isolate Unclassified
733 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
734 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
735 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
736 2842711865 Duganella sp. R-73148 Isolate Unclassified
737 2855730933 Achromobacter sp. HZ28 Isolate Nodule
738 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
739 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
740 2857553236 Duganella sp. R-74557 Isolate Unclassified
741 2857558681 Duganella sp. R-74565 Isolate Unclassified
742 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
743 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
744 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
745 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
746 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
747 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
748 2904424332 Duganella sp. 1411 Isolate Rhizosphere
749 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
750 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
751 2904564687 Burkholderia sp. 571 Isolate Unclassified
752 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
753 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
754 2919476304 Duganella sp. 3397 Isolate Unclassified
755 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
756 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
757 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
758 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
759 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
760 2928163908 Burkholderia sp. 567 Isolate Unclassified
761 2928170801 Burkholderia sp. 572 Isolate Unclassified
762 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
763 2928536128 Burkholderia sola 565 Isolate Unclassified
764 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
765 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
766 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
767 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
768 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
769 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
770 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
771 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
772 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
773 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
774 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
775 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
776 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
777 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
778 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
779 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
780 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
781 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
782 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
783 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.63
Metatranscriptomes 12.38
Isolates 4.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.91
Nodule 1.2
Rhizoplane 4.14
Rhizosphere 77.15
Stem 0
Stem Tuber 0
Unclassified 0.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075368_10003054 3300006042 Bacteria 5542
2 JGI24736J21556_1000961 3300001904 Bacteria 5319
3 JGI24736J21556_1014262 3300001904 Bacteria 1278
4 JGI24741J21665_1000624 3300001915 Bacteria 10681
5 JGI24741J21665_1002145 3300001915 Bacteria 5249
6 JGI24740J21852_10008508 3300001979 Bacteria 4085
7 JGI24740J21852_10010715 3300001979 Bacteria 3517
8 JGI24740J21852_10022184 3300001979 Bacteria 2190
9 JGI24739J22299_10010870 3300001989 Bacteria 3368
10 JGI24739J22299_10015549 3300001989 Bacteria 2765
11 JGI24739J22299_10028555 3300001989 Bacteria 1945
12 JGI24739J22299_10040738 3300001989 Bacteria 1549
13 JGI24737J22298_10004674 3300001990 Bacteria 4762
14 JGI24737J22298_10008370 3300001990 Bacteria 3466
15 JGI24737J22298_10022836 3300001990 Bacteria 1987
16 JGI24737J22298_10027585 3300001990 Bacteria 1790
17 JGI24735J21928_10002193 3300002067 Bacteria 6859
18 JGI24735J21928_10011144 3300002067 Bacteria 2855
19 JGI24735J21928_10014430 3300002067 Bacteria 2475
20 JGI24735J21928_10019381 3300002067 Bacteria 2091
21 JGI24738J21930_10006803 3300002075 Bacteria 2657
22 JGI25155J39150_1007058 3300002704 Bacteria 522
23 JGI25156J39149_1006223 3300002705 Bacteria 3295
24 JGI25156J39149_1012871 3300002705 Bacteria 1811
25 JGI25156J39149_1014425 3300002705 Bacteria 1629
26 JGI25156J39149_1016459 3300002705 Bacteria 1437
27 JGI25156J39149_1020451 3300002705 Bacteria 1164
28 JGI25156J39149_1033188 3300002705 Bacteria 756
29 JGI25154J39366_1000303 3300002738 Bacteria 29179
30 JGI25154J39366_1001042 3300002738 Bacteria 11063
31 JGI25158J39367_1000542 3300002739 Bacteria 7614
32 JGI25152J39213_1013037 3300002773 Bacteria 1750
33 JGI25150J39212_1001923 3300002774 Bacteria 5456
34 JGI25150J39212_1003501 3300002774 Bacteria 3664
35 Ga0006763J43179_104166 3300002870 Bacteria 5040
36 JGI25159J45721_1005729 3300002987 Bacteria 3846
37 JGI25159J45721_1006200 3300002987 Bacteria 3618
38 Ga0006765J45826_105454 3300003161 Bacteria 4839
39 Ga0006765J45826_108890 3300003161 Bacteria 1165
40 Ga0006765J45826_116549 3300003161 Bacteria 533
41 Ga0006778J45830_1013714 3300003162 Bacteria 8778
42 Ga0006778J45830_1018992 3300003162 Bacteria 2451
43 Ga0006759J45824_1009839 3300003163 Bacteria 1691
44 Ga0006759J45824_1019440 3300003163 Bacteria 3635
45 Ga0006759J45824_1019946 3300003163 Bacteria 12757
46 Ga0006759J45824_1026311 3300003163 Bacteria 2275
47 JGI25151J46595_10000457 3300003187 Bacteria 39373
48 JGI25151J46595_10071766 3300003187 Bacteria 1044
49 JGI25151J46595_10077557 3300003187 Bacteria 976
50 JGI25406J46586_10002509 3300003203 Bacteria 8686
51 JGI25406J46586_10005813 3300003203 Bacteria 5709
52 JGI25165J46597_1001391 3300003214 Bacteria 13253
53 JGI25153J46596_10002258 3300003215 Bacteria 11225
54 Ga0006758J48902_1003546 3300003300 Bacteria 6400
55 Ga0006758J48902_1008911 3300003300 Bacteria 7674
56 Ga0006758J48902_1013469 3300003300 Bacteria 2905
57 Ga0006770J48903_1023756 3300003305 Bacteria 3863
58 Ga0006777J48905_1011571 3300003308 Bacteria 3265
59 Ga0006777J48905_1023402 3300003308 Bacteria 1830
60 JGI25160J50197_1001051 3300003354 Bacteria 14224
61 JGI25160J50197_1002367 3300003354 Bacteria 8808
62 JGI25161J50226_1003265 3300003374 Bacteria 3777
63 Ga0006556J51387_1013500 3300003479 Bacteria 15419
64 Ga0006556J51387_1016929 3300003479 Bacteria 14599
65 Ga0007417J51691_1002612 3300003544 Bacteria 14201
66 Ga0007417J51691_1012996 3300003544 Bacteria 3246
67 Ga0007417J51691_1036180 3300003544 Bacteria 1373
68 Ga0006558J51389_1019156 3300003558 Bacteria 14283
69 Ga0006558J51389_1029442 3300003558 Bacteria 4339
70 Ga0007427J51700_104412 3300003559 Bacteria 1776
71 Ga0007427J51700_116762 3300003559 Bacteria 1067
72 Ga0007427J51700_120270 3300003559 Bacteria 618
73 Ga0006560J51390_1011017 3300003565 Bacteria 19884
74 Ga0006560J51390_1020307 3300003565 Bacteria 14892
75 Ga0006554J51385_1017299 3300003567 Bacteria 14985
76 Ga0007410J51695_1004597 3300003574 Bacteria 14339
77 Ga0007410J51695_1005147 3300003574 Bacteria 1659
78 Ga0007410J51695_1012689 3300003574 Bacteria 12724
79 Ga0007410J51695_1015723 3300003574 Bacteria 3888
80 Ga0007409J51694_1002712 3300003575 Bacteria 865
81 Ga0007409J51694_1007029 3300003575 Bacteria 1871
82 Ga0007409J51694_1025202 3300003575 Bacteria 1643
83 Ga0007416J51690_1009369 3300003577 Bacteria 4951
84 Ga0007429J51699_1012288 3300003579 Bacteria 4157
85 Ga0007429J51699_1013730 3300003579 Bacteria 3438
86 Ga0007411J51799_103551 3300003611 Bacteria 13349
87 Ga0007411J51799_118133 3300003611 Bacteria 750
88 Ga0007415J51800_102854 3300003613 Bacteria 5009
89 Ga0032354_1003172 3300003693 Bacteria 6308
90 Ga0032354_1006520 3300003693 Bacteria 1872
91 Ga0032354_1013175 3300003693 Bacteria 5546
92 Ga0032354_1073470 3300003693 Bacteria 3279
93 Ga0032354_1175332 3300003693 Bacteria 524
94 Ga0006780_1003512 3300003735 Bacteria 4326
95 Ga0055539_1001132 3300003752 Bacteria 5509
96 Ga0055539_1005718 3300003752 Bacteria 1607
97 Ga0055533_1003286 3300003756 Bacteria 3303
98 Ga0055533_1003606 3300003756 Bacteria 3054
99 Ga0055533_1005127 3300003756 Bacteria 2180
100 Ga0055533_1006769 3300003756 Bacteria 1642
101 Ga0055532_1000066 3300003758 Bacteria 139987
102 Ga0055532_1000261 3300003758 Bacteria 35339
103 Ga0055532_1002406 3300003758 Bacteria 3918
104 Ga0055525_1000018 3300003759 Bacteria 393974
105 Ga0055527_1000035 3300003760 Bacteria 138481
106 Ga0055527_1000602 3300003760 Bacteria 11576
107 Ga0055535_1000046 3300003761 Bacteria 139987
108 Ga0055535_1000050 3300003761 Bacteria 138481
109 Ga0055542_1000512 3300003762 Bacteria 35339
110 Ga0055542_1001443 3300003762 Bacteria 11849
111 Ga0055542_1008179 3300003762 Bacteria 2062
112 Ga0055529_1000079 3300003763 Bacteria 149370
113 Ga0055529_1000087 3300003763 Bacteria 139975
114 Ga0055529_1000089 3300003763 Bacteria 138481
115 Ga0055529_1000804 3300003763 Bacteria 19180
116 Ga0055529_1019136 3300003763 Bacteria 856
117 Ga0055526_1008246 3300003771 Bacteria 5232
118 Ga0055526_1008253 3300003771 Bacteria 5230
119 Ga0055526_1012574 3300003771 Bacteria 3674
120 Ga0055526_1017962 3300003771 Bacteria 2668
121 Ga0055537_1000038 3300003773 Bacteria 92762
122 Ga0055537_1007557 3300003773 Bacteria 2609
123 Ga0055524_1000024 3300003775 Bacteria 217953
124 Ga0055524_1003212 3300003775 Bacteria 8017
125 Ga0055524_1038927 3300003775 Bacteria 1236
126 Ga0055534_1003773 3300003784 Bacteria 4660
127 Ga0055534_1005461 3300003784 Bacteria 3395
128 Ga0055528_1000489 3300003790 Bacteria 31350
129 Ga0055528_1012285 3300003790 Bacteria 3335
130 Ga0055528_1013311 3300003790 Bacteria 3124
131 Ga0055528_1029760 3300003790 Bacteria 1468
132 Ga0055530_10007831 3300003791 Bacteria 4408
133 Ga0055531_10006076 3300003794 Bacteria 6916
134 Ga0058692_1002213 3300003856 Bacteria 6626
135 Ga0055543_1004039 3300004625 Bacteria 4114
136 Ga0058860_10029302 3300004801 Bacteria 1277
137 Ga0058862_12800340 3300004803 Bacteria 1822
138 Ga0065165_1000504 3300005262 Bacteria 60378
139 Ga0065165_1000885 3300005262 Bacteria 38659
140 Ga0065165_1006561 3300005262 Bacteria 6061
141 Ga0065165_1043988 3300005262 Bacteria 1308
142 Ga0065714_10175573 3300005288 Bacteria 985
143 Ga0065714_10264494 3300005288 Bacteria 745
144 Ga0065712_10086127 3300005290 Bacteria 2651
145 Ga0065707_10200663 3300005295 Bacteria 1308
146 Ga0070658_10012014 3300005327 Bacteria 6954
147 Ga0070658_10028760 3300005327 Bacteria 4462
148 Ga0070658_10051816 3300005327 Bacteria 3326
149 Ga0070658_10197036 3300005327 Bacteria 1698
150 Ga0070658_10210675 3300005327 Bacteria 1642
151 Ga0070658_11224510 3300005327 Bacteria 652
152 Ga0070683_100130959 3300005329 Bacteria 2373
153 Ga0070690_100665097 3300005330 Bacteria 797
154 Ga0070670_100436011 3300005331 Bacteria 1160
155 Ga0070670_100588559 3300005331 Bacteria 995
156 Ga0070670_101020706 3300005331 Bacteria 753
157 Ga0068869_100000239 3300005334 Bacteria 28911
158 Ga0068869_100792341 3300005334 Bacteria 814
159 Ga0068869_100940796 3300005334 Bacteria 750
160 Ga0070666_10064761 3300005335 Bacteria 2479
161 Ga0070666_10851489 3300005335 Bacteria 673
162 Ga0070680_100028265 3300005336 Bacteria 4496
163 Ga0070682_100104638 3300005337 Bacteria 1875
164 Ga0070682_100335096 3300005337 Bacteria 1122
165 Ga0068868_100019350 3300005338 Bacteria 5101
166 Ga0068868_100470939 3300005338 Bacteria 1096
167 Ga0068868_100985634 3300005338 Bacteria 770
168 Ga0070660_100026003 3300005339 Bacteria 4356
169 Ga0070660_100034626 3300005339 Bacteria 3817
170 Ga0070689_101355443 3300005340 Bacteria 642
171 Ga0070691_10586771 3300005341 Bacteria 656
172 Ga0070687_100449060 3300005343 Bacteria 857
173 Ga0070661_100000276 3300005344 Bacteria 41562
174 Ga0070661_100425658 3300005344 Bacteria 1053
175 Ga0070661_100577942 3300005344 Bacteria 906
176 Ga0070661_100922623 3300005344 Bacteria 722
177 Ga0070669_100615595 3300005353 Bacteria 911
178 Ga0070669_100767176 3300005353 Bacteria 818
179 Ga0070675_100789602 3300005354 Bacteria 868
180 Ga0070671_100130518 3300005355 Bacteria 2116
181 Ga0070671_101474927 3300005355 Bacteria 602
182 Ga0070673_100420566 3300005364 Bacteria 1198
183 Ga0070688_100394510 3300005365 Bacteria 1023
184 Ga0070659_100000426 3300005366 Bacteria 31940
185 Ga0070659_100235446 3300005366 Bacteria 1514
186 Ga0070659_100755623 3300005366 Bacteria 843
187 Ga0070659_100766022 3300005366 Bacteria 838
188 Ga0070667_100263553 3300005367 Bacteria 1544
189 Ga0070694_100214288 3300005444 Bacteria 1442
190 Ga0070663_100001053 3300005455 Bacteria 15091
191 Ga0070663_100021946 3300005455 Bacteria 4257
192 Ga0070663_100434756 3300005455 Bacteria 1079
193 Ga0070663_100882448 3300005455 Bacteria 771
194 Ga0070663_101124597 3300005455 Bacteria 687
195 Ga0070678_100045788 3300005456 Bacteria 3132
196 Ga0070678_100253166 3300005456 Bacteria 1477
197 Ga0070678_100667905 3300005456 Bacteria 933
198 Ga0070662_100612492 3300005457 Bacteria 916
199 Ga0070681_10376443 3300005458 Bacteria 1330
200 Ga0070681_10446735 3300005458 Bacteria 1205
201 Ga0068867_101635410 3300005459 Bacteria 603
202 Ga0070685_11308658 3300005466 Bacteria 554
203 Ga0070706_100494586 3300005467 Bacteria 1138
204 Ga0070699_100041691 3300005518 Bacteria 3973
205 Ga0070699_100043286 3300005518 Bacteria 3897
206 Ga0070699_100085640 3300005518 Bacteria 2750
207 Ga0070679_100263732 3300005530 Bacteria 1678
208 Ga0070679_100272175 3300005530 Bacteria 1647
209 Ga0070684_100277906 3300005535 Bacteria 1534
210 Ga0068853_100029320 3300005539 Bacteria 4637
211 Ga0068853_101060371 3300005539 Bacteria 781
212 Ga0068853_101493106 3300005539 Unclassified 654
213 Ga0070672_100692733 3300005543 Bacteria 892
214 Ga0070665_100065427 3300005548 Bacteria 3647
215 Ga0070665_100442535 3300005548 Bacteria 1309
216 Ga0068855_100018349 3300005563 Bacteria 8405
217 Ga0068855_100077376 3300005563 Bacteria 3860
218 Ga0068855_100131783 3300005563 Bacteria 2854
219 Ga0068855_100257086 3300005563 Bacteria 1947
220 Ga0070664_100000018 3300005564 Bacteria 125281
221 Ga0070664_100010409 3300005564 Bacteria 7543
222 Ga0070664_100068369 3300005564 Bacteria 3037
223 Ga0070664_100142127 3300005564 Bacteria 2114
224 Ga0068857_100128424 3300005577 Bacteria 2285
225 Ga0068857_100178268 3300005577 Bacteria 1933
226 Ga0068857_100409644 3300005577 Bacteria 1262
227 Ga0068854_100000225 3300005578 Bacteria 38422
228 Ga0068854_100363057 3300005578 Bacteria 1189
229 Ga0068856_100000070 3300005614 Bacteria 95320
230 Ga0068856_100117908 3300005614 Bacteria 2655
231 Ga0068856_100155750 3300005614 Bacteria 2295
232 Ga0068852_100001513 3300005616 Bacteria 15722
233 Ga0068852_100022501 3300005616 Bacteria 5056
234 Ga0068852_100840357 3300005616 Bacteria 933
235 Ga0068864_101369740 3300005618 Bacteria 709
236 Ga0068864_102390113 3300005618 Bacteria 535
237 Ga0068866_10292215 3300005718 Bacteria 1014
238 Ga0068851_10115256 3300005834 Bacteria 1439
239 Ga0068863_100046276 3300005841 Bacteria 4129
240 Ga0068863_100532459 3300005841 Bacteria 1159
241 Ga0068858_100013226 3300005842 Bacteria 7776
242 Ga0068860_100019846 3300005843 Bacteria 6518
243 Ga0068862_100708291 3300005844 Bacteria 976
244 Ga0081539_10000142 3300005985 Bacteria 165444
245 Ga0081539_10000215 3300005985 Bacteria 135054
246 Ga0081539_10003297 3300005985 Bacteria 20197
247 Ga0075363_100000856 3300006048 Bacteria 10631
248 Ga0075363_100086667 3300006048 Bacteria 1719
249 Ga0075364_10015296 3300006051 Bacteria 4757
250 Ga0075364_10316984 3300006051 Bacteria 1062
251 Ga0075362_10000565 3300006177 Bacteria 10784
252 Ga0075362_10081459 3300006177 Bacteria 1492
253 Ga0075362_10527349 3300006177 Bacteria 606
254 Ga0075367_10001881 3300006178 Bacteria 9288
255 Ga0075369_10003827 3300006186 Bacteria 5518
256 Ga0075369_10490397 3300006186 Bacteria 583
257 Ga0075366_10064801 3300006195 Bacteria 2173
258 Ga0075366_10132503 3300006195 Bacteria 1504
259 Ga0075366_10267362 3300006195 Bacteria 1044
260 Ga0075366_10332276 3300006195 Bacteria 932
261 Ga0075366_10519688 3300006195 Bacteria 736
262 Ga0097621_100165035 3300006237 Bacteria 1906
263 Ga0097621_100233100 3300006237 Bacteria 1608
264 Ga0075370_10036206 3300006353 Bacteria 2772
265 Ga0075370_10136978 3300006353 Bacteria 1430
266 Ga0075370_10154017 3300006353 Bacteria 1347
267 Ga0075370_10521963 3300006353 Bacteria 717
268 Ga0068871_100003989 3300006358 Bacteria 10207
269 Ga0075433_10131861 3300006852 Bacteria 2220
270 Ga0075433_10263794 3300006852 Bacteria 1527
271 Ga0075434_100017973 3300006871 Bacteria 6823
272 Ga0068865_100052525 3300006881 Bacteria 2825
273 Ga0068865_101583434 3300006881 Bacteria 589
274 Ga0079104_1004078 3300006946 Bacteria 6424
275 Ga0099826_10000010 3300006948 Bacteria 314346
276 Ga0099826_10000024 3300006948 Bacteria 148974
277 Ga0075435_100031259 3300007076 Bacteria 4193
278 Ga0105251_10010131 3300009011 Bacteria 5495
279 Ga0105251_10027169 3300009011 Bacteria 2906
280 Ga0105251_10039647 3300009011 Bacteria 2300
281 Ga0105251_10053947 3300009011 Bacteria 1910
282 Ga0105244_10095626 3300009036 Bacteria 1457
283 Ga0105244_10129506 3300009036 Bacteria 1218
284 Ga0105250_10050101 3300009092 Bacteria 1675
285 Ga0105250_10051084 3300009092 Bacteria 1659
286 Ga0105250_10079808 3300009092 Bacteria 1326
287 Ga0105250_10493009 3300009092 Bacteria 555
288 Ga0105240_10063879 3300009093 Bacteria 4577
289 Ga0105240_10103920 3300009093 Bacteria 3450
290 Ga0105240_10108670 3300009093 Bacteria 3360
291 Ga0105240_10407148 3300009093 Bacteria 1531
292 Ga0105240_10456788 3300009093 Bacteria 1428
293 Ga0105240_10661229 3300009093 Bacteria 1144
294 Ga0111539_10009725 3300009094 Bacteria 12138
295 Ga0111539_10063652 3300009094 Bacteria 4364
296 Ga0105245_10323321 3300009098 Bacteria 1520
297 Ga0105245_11159602 3300009098 Bacteria 820
298 Ga0105247_10248107 3300009101 Bacteria 1216
299 Ga0114129_10905627 3300009147 Bacteria 1117
300 Ga0114129_11391926 3300009147 Bacteria 866
301 Ga0105243_10006860 3300009148 Bacteria 8779
302 Ga0105243_10168772 3300009148 Bacteria 1893
303 Ga0105243_10233819 3300009148 Bacteria 1632
304 Ga0105243_10413272 3300009148 Bacteria 1256
305 Ga0105241_10021276 3300009174 Bacteria 4793
306 Ga0105241_10177715 3300009174 Bacteria 1763
307 Ga0105241_10799341 3300009174 Bacteria 869
308 Ga0105241_12077056 3300009174 Bacteria 561
309 Ga0105242_10702387 3300009176 Bacteria 990
310 Ga0105248_10010314 3300009177 Bacteria 10284
311 Ga0105248_10015430 3300009177 Bacteria 8421
312 Ga0105248_10091471 3300009177 Bacteria 3427
313 Ga0105248_10393633 3300009177 Bacteria 1560
314 Ga0105248_10562764 3300009177 Bacteria 1286
315 Ga0105248_10930503 3300009177 Bacteria 982
316 Ga0105248_11153309 3300009177 Bacteria 876
317 Ga0105237_10056847 3300009545 Bacteria 3915
318 Ga0105237_10137397 3300009545 Bacteria 2438
319 Ga0105237_10145717 3300009545 Bacteria 2363
320 Ga0105237_11052499 3300009545 Bacteria 820
321 Ga0105238_10003065 3300009551 Bacteria 16659
322 Ga0105238_10478980 3300009551 Bacteria 1244
323 Ga0105238_10910308 3300009551 Bacteria 898
324 Ga0105238_11215312 3300009551 Bacteria 778
325 Ga0105239_10057421 3300010375 Bacteria 4269
326 Ga0105239_10143140 3300010375 Bacteria 2665
327 Ga0105239_10325011 3300010375 Bacteria 1735
328 Ga0105239_11049668 3300010375 Bacteria 937
329 Ga0105246_10193299 3300011119 Bacteria 1577
330 Ga0105246_10212712 3300011119 Bacteria 1510
331 Ga0105246_10681807 3300011119 Bacteria 898
332 Ga0157318_1017671 3300012482 Bacteria 604
333 Ga0157325_1002140 3300012485 Bacteria 980
334 Ga0157341_1023988 3300012494 Bacteria 620
335 Ga0157327_1046759 3300012512 Bacteria 602
336 Ga0154012_136784 3300013059 Bacteria 2113
337 Ga0157373_10015732 3300013100 Bacteria 5524
338 Ga0157371_10036577 3300013102 Bacteria 3515
339 Ga0157371_10054196 3300013102 Bacteria 2848
340 Ga0157371_10058062 3300013102 Bacteria 2745
341 Ga0157370_10062522 3300013104 Bacteria 3530
342 Ga0157370_10069903 3300013104 Bacteria 3316
343 Ga0157370_10872950 3300013104 Bacteria 817
344 Ga0157369_10078496 3300013105 Bacteria 3537
345 Ga0157369_10088073 3300013105 Bacteria 3314
346 Ga0157369_10088210 3300013105 Bacteria 3311
347 Ga0157369_10093282 3300013105 Bacteria 3214
348 Ga0157369_10188597 3300013105 Bacteria 2167
349 Ga0157369_10450338 3300013105 Bacteria 1333
350 Ga0157374_10000466 3300013296 Bacteria 36782
351 Ga0157374_10032559 3300013296 Bacteria 4748
352 Ga0157374_10069107 3300013296 Bacteria 3325
353 Ga0157374_10130817 3300013296 Bacteria 2429
354 Ga0157378_10027087 3300013297 Bacteria 5057
355 Ga0157378_10097687 3300013297 Bacteria 2677
356 Ga0157378_10140170 3300013297 Bacteria 2245
357 Ga0157378_12622117 3300013297 Bacteria 556
358 Ga0163162_10076123 3300013306 Bacteria 3417
359 Ga0163162_10086678 3300013306 Bacteria 3209
360 Ga0163162_11126646 3300013306 Bacteria 889
361 Ga0163162_11245599 3300013306 Bacteria 845
362 Ga0157372_10023322 3300013307 Bacteria 6707
363 Ga0157372_10381065 3300013307 Bacteria 1643
364 Ga0157372_11235545 3300013307 Bacteria 863
365 Ga0157375_10099540 3300013308 Bacteria 2987
366 Ga0157375_10411520 3300013308 Bacteria 1519
367 Ga0157375_10514513 3300013308 Bacteria 1360
368 Ga0157375_11027771 3300013308 Bacteria 963
369 Ga0157375_12256222 3300013308 Bacteria 649
370 Ga0163163_10694503 3300014325 Bacteria 1081
371 Ga0163163_10812622 3300014325 Bacteria 998
372 Ga0182008_10003186 3300014497 Bacteria 10028
373 Ga0182008_10079122 3300014497 Bacteria 1617
374 Ga0157376_10069893 3300014969 Bacteria 2979
375 Ga0157376_10493710 3300014969 Bacteria 1202
376 Ga0157376_11933336 3300014969 Bacteria 627
377 Ga0157376_12048211 3300014969 Bacteria 610
378 Ga0182006_1000240 3300015261 Bacteria 51334
379 Ga0182006_1009882 3300015261 Bacteria 4266
380 Ga0182006_1041809 3300015261 Bacteria 1798
381 Ga0182006_1235790 3300015261 Bacteria 602
382 Ga0182007_10012896 3300015262 Bacteria 3204
383 Ga0182007_10021036 3300015262 Bacteria 2322
384 Ga0182007_10039882 3300015262 Bacteria 1569
385 Ga0182005_1000016 3300015265 Bacteria 346889
386 Ga0183361_10015 3300016635 Bacteria 166772
387 Ga0184593_113785 3300019179 Bacteria 1316
388 Ga0184594_128061 3300019181 Bacteria 2351
389 Ga0197907_10133130 3300020069 Bacteria 3203
390 Ga0197907_11250558 3300020069 Bacteria 757
391 Ga0206356_10498037 3300020070 Bacteria 8711
392 Ga0206356_10847300 3300020070 Bacteria 1439
393 Ga0206355_1030836 3300020076 Bacteria 4092
394 Ga0206355_1157373 3300020076 Bacteria 1847
395 Ga0206355_1331117 3300020076 Bacteria 1480
396 Ga0206355_1594134 3300020076 Bacteria 852
397 Ga0206355_1647216 3300020076 Bacteria 1384
398 Ga0206351_10165518 3300020077 Bacteria 2290
399 Ga0206351_10211974 3300020077 Bacteria 1162
400 Ga0206352_11278378 3300020078 Bacteria 1040
401 Ga0206350_10425581 3300020080 Bacteria 3340
402 Ga0206350_10705675 3300020080 Bacteria 3953
403 Ga0206350_11246990 3300020080 Bacteria 2177
404 Ga0206354_10086599 3300020081 Bacteria 3665
405 Ga0206354_11361223 3300020081 Bacteria 3291
406 Ga0206354_11564442 3300020081 Bacteria 2672
407 Ga0206353_10280775 3300020082 Bacteria 2088
408 Ga0206353_10343767 3300020082 Bacteria 2679
409 Ga0206353_11104472 3300020082 Bacteria 2372
410 Ga0154015_1522148 3300020610 Bacteria 1971
411 Ga0154015_1692537 3300020610 Bacteria 4101
412 Ga0213872_10010693 3300021361 Bacteria 4359
413 Ga0213872_10047302 3300021361 Bacteria 1956
414 Ga0213872_10332396 3300021361 Bacteria 626
415 Ga0224712_10002193 3300022467 Bacteria 4763
416 Ga0224712_10060966 3300022467 Bacteria 1503
417 Ga0224712_10125668 3300022467 Bacteria 1115
418 Ga0247514_106419 3300023560 Bacteria 1381
419 Ga0209436_100401 3300025208 Bacteria 19545
420 Ga0209784_100052 3300025224 Bacteria 182783
421 Ga0209784_103737 3300025224 Bacteria 1213
422 Ga0209566_100068 3300025225 Bacteria 177484
423 Ga0209566_100801 3300025225 Bacteria 16448
424 Ga0209566_102355 3300025225 Bacteria 3595
425 Ga0209566_108979 3300025225 Bacteria 1059
426 Ga0209674_100087 3300025226 Bacteria 182783
427 Ga0209674_100153 3300025226 Bacteria 94333
428 Ga0209674_102800 3300025226 Bacteria 3515
429 Ga0209674_103913 3300025226 Bacteria 2577
430 Ga0209674_105404 3300025226 Bacteria 1893
431 Ga0209672_100073 3300025228 Bacteria 166621
432 Ga0209672_100276 3300025228 Bacteria 37317
433 Ga0209672_100383 3300025228 Bacteria 26965
434 Ga0209672_102256 3300025228 Bacteria 4964
435 Ga0209672_102285 3300025228 Bacteria 4911
436 Ga0209672_116278 3300025228 Bacteria 813
437 Ga0209147_100090 3300025229 Bacteria 176176
438 Ga0209147_100093 3300025229 Bacteria 167196
439 Ga0209147_102318 3300025229 Bacteria 4911
440 Ga0209563_100011 3300025230 Bacteria 1187808
441 Ga0209563_100373 3300025230 Bacteria 16406
442 Ga0209563_100470 3300025230 Bacteria 13814
443 Ga0209563_119837 3300025230 Bacteria 765
444 Ga0207427_100807 3300025231 Bacteria 14176
445 Ga0209437_103924 3300025233 Bacteria 2645
446 Ga0209258_100130 3300025242 Bacteria 176078
447 Ga0209258_100140 3300025242 Bacteria 167245
448 Ga0209258_102394 3300025242 Bacteria 4911
449 Ga0209258_103856 3300025242 Bacteria 3054
450 Ga0207425_1000021 3300025245 Bacteria 367537
451 Ga0207425_1000845 3300025245 Bacteria 15112
452 Ga0207425_1000932 3300025245 Bacteria 13905
453 Ga0209646_1000068 3300025246 Bacteria 233765
454 Ga0209646_1000119 3300025246 Bacteria 147427
455 Ga0209677_100043 3300025253 Bacteria 222331
456 Ga0209677_107281 3300025253 Bacteria 2389
457 Ga0209148_1000119 3300025254 Bacteria 188079
458 Ga0209148_1000140 3300025254 Bacteria 166819
459 Ga0209148_1000444 3300025254 Bacteria 45400
460 Ga0209148_1001671 3300025254 Bacteria 9966
461 Ga0209759_1001723 3300025256 Bacteria 11286
462 Ga0209759_1004738 3300025256 Bacteria 4974
463 Ga0209759_1008563 3300025256 Bacteria 3175
464 Ga0209759_1010191 3300025256 Bacteria 2773
465 Ga0209759_1012475 3300025256 Bacteria 2352
466 Ga0209759_1014574 3300025256 Bacteria 2071
467 Ga0209759_1014581 3300025256 Bacteria 2071
468 Ga0209759_1026805 3300025256 Bacteria 1201
469 Ga0209129_1000020 3300025258 Bacteria 457053
470 Ga0209233_1000173 3300025261 Bacteria 145995
471 Ga0209565_1000123 3300025263 Bacteria 111069
472 Ga0209565_1001042 3300025263 Bacteria 14043
473 Ga0209565_1003095 3300025263 Bacteria 5581
474 Ga0209455_1000070 3300025272 Bacteria 307867
475 Ga0209455_1000119 3300025272 Bacteria 174994
476 Ga0209455_1000125 3300025272 Bacteria 166819
477 Ga0209455_1000244 3300025272 Bacteria 67136
478 Ga0209455_1001216 3300025272 Bacteria 12270
479 Ga0209673_1000040 3300025273 Bacteria 312633
480 Ga0209673_1000098 3300025273 Bacteria 193352
481 Ga0209673_1004818 3300025273 Bacteria 7072
482 Ga0209673_1112596 3300025273 Bacteria 567
483 Ga0209130_1000290 3300025284 Bacteria 61271
484 Ga0209130_1002182 3300025284 Bacteria 10312
485 Ga0209675_1000117 3300025291 Bacteria 111087
486 Ga0209675_1002785 3300025291 Bacteria 8724
487 Ga0209025_1000039 3300025294 Bacteria 377396
488 Ga0209025_1011110 3300025294 Bacteria 5993
489 Ga0209564_1000027 3300025295 Bacteria 518458
490 Ga0209564_1000047 3300025295 Bacteria 368031
491 Ga0209564_1000121 3300025295 Bacteria 204081
492 Ga0209564_1002740 3300025295 Bacteria 13260
493 Ga0209564_1006738 3300025295 Bacteria 6100
494 Ga0209564_1032951 3300025295 Bacteria 1549
495 Ga0209564_1041569 3300025295 Bacteria 1231
496 Ga0209758_1000077 3300025297 Bacteria 268195
497 Ga0209758_1000322 3300025297 Bacteria 92458
498 Ga0209050_1000050 3300025298 Bacteria 362578
499 Ga0209050_1002922 3300025298 Bacteria 13390
500 Ga0209256_1000054 3300025299 Bacteria 298431
501 Ga0209256_1001933 3300025299 Bacteria 18898
502 Ga0209256_1002719 3300025299 Bacteria 13723
503 Ga0209256_1024911 3300025299 Bacteria 1753
504 Ga0209256_1058574 3300025299 Bacteria 905
505 Ga0207426_1000199 3300025302 Bacteria 145826
506 Ga0207426_1000802 3300025302 Bacteria 34010
507 Ga0207426_1010681 3300025302 Bacteria 3549
508 Ga0207426_1047907 3300025302 Bacteria 1287
509 Ga0209051_1052723 3300025303 Bacteria 1341
510 Ga0209051_1053753 3300025303 Bacteria 1320
511 Ga0209257_1000075 3300025304 Bacteria 324855
512 Ga0207656_10080640 3300025321 Bacteria 1462
513 Ga0207656_10187581 3300025321 Bacteria 995
514 Ga0207696_1020741 3300025711 Bacteria 2112
515 Ga0207696_1166247 3300025711 Bacteria 586
516 Ga0207696_1181955 3300025711 Bacteria 555
517 Ga0207655_1000499 3300025728 Bacteria 50341
518 Ga0207713_1004623 3300025735 Bacteria 8892
519 Ga0207713_1005407 3300025735 Bacteria 7998
520 Ga0207713_1023386 3300025735 Bacteria 2909
521 Ga0207710_10161546 3300025900 Bacteria 1092
522 Ga0207680_10163642 3300025903 Bacteria 1494
523 Ga0207680_10716637 3300025903 Bacteria 717
524 Ga0207647_10004870 3300025904 Bacteria 9917
525 Ga0207647_10007364 3300025904 Bacteria 7955
526 Ga0207647_10104384 3300025904 Bacteria 1680
527 Ga0207643_10273624 3300025908 Bacteria 1046
528 Ga0207705_10004265 3300025909 Bacteria 10829
529 Ga0207705_10011628 3300025909 Bacteria 6360
530 Ga0207705_10060061 3300025909 Bacteria 2745
531 Ga0207705_10103487 3300025909 Bacteria 2097
532 Ga0207705_10122104 3300025909 Bacteria 1934
533 Ga0207684_10223837 3300025910 Bacteria 1624
534 Ga0207684_10567778 3300025910 Bacteria 970
535 Ga0207654_10002111 3300025911 Bacteria 10175
536 Ga0207654_10090331 3300025911 Bacteria 1865
537 Ga0207654_10395591 3300025911 Bacteria 960
538 Ga0207654_10496717 3300025911 Bacteria 861
539 Ga0207695_10008376 3300025913 Bacteria 12952
540 Ga0207695_10027074 3300025913 Bacteria 6388
541 Ga0207695_10035527 3300025913 Bacteria 5403
542 Ga0207695_10227793 3300025913 Bacteria 1769
543 Ga0207695_10246637 3300025913 Bacteria 1686
544 Ga0207695_10269527 3300025913 Bacteria 1598
545 Ga0207695_11012665 3300025913 Bacteria 710
546 Ga0207695_11263733 3300025913 Bacteria 619
547 Ga0207671_10004456 3300025914 Bacteria 13379
548 Ga0207671_10201201 3300025914 Bacteria 1556
549 Ga0207671_10215175 3300025914 Bacteria 1504
550 Ga0207660_10011879 3300025917 Bacteria 5680
551 Ga0207662_10615472 3300025918 Bacteria 756
552 Ga0207657_10014049 3300025919 Bacteria 7833
553 Ga0207657_10030110 3300025919 Bacteria 4931
554 Ga0207657_10044711 3300025919 Bacteria 3891
555 Ga0207657_10377992 3300025919 Bacteria 1116
556 Ga0207649_10000490 3300025920 Bacteria 28067
557 Ga0207649_10023804 3300025920 Bacteria 3551
558 Ga0207652_10090095 3300025921 Bacteria 2694
559 Ga0207652_10434543 3300025921 Bacteria 1184
560 Ga0207646_10808223 3300025922 Bacteria 835
561 Ga0207694_10002733 3300025924 Bacteria 14269
562 Ga0207694_10045423 3300025924 Bacteria 3393
563 Ga0207694_10100374 3300025924 Bacteria 2293
564 Ga0207694_10108713 3300025924 Bacteria 2204
565 Ga0207650_10291854 3300025925 Bacteria 1330
566 Ga0207659_10648536 3300025926 Bacteria 902
567 Ga0207687_10187681 3300025927 Bacteria 1606
568 Ga0207687_10444164 3300025927 Bacteria 1075
569 Ga0207664_11036144 3300025929 Bacteria 735
570 Ga0207644_10095363 3300025931 Bacteria 2225
571 Ga0207644_10560838 3300025931 Bacteria 946
572 Ga0207690_10000040 3300025932 Bacteria 130300
573 Ga0207690_10048382 3300025932 Bacteria 2827
574 Ga0207690_10182111 3300025932 Bacteria 1583
575 Ga0207690_10375638 3300025932 Bacteria 1129
576 Ga0207690_10619049 3300025932 Bacteria 885
577 Ga0207690_10823820 3300025932 Bacteria 768
578 Ga0207706_10008025 3300025933 Bacteria 9741
579 Ga0207686_10724498 3300025934 Bacteria 792
580 Ga0207709_10001005 3300025935 Bacteria 20902
581 Ga0207709_10020009 3300025935 Bacteria 3772
582 Ga0207709_10115312 3300025935 Bacteria 1804
583 Ga0207704_10176248 3300025938 Bacteria 1540
584 Ga0207704_10836131 3300025938 Bacteria 771
585 Ga0207704_11259073 3300025938 Bacteria 632
586 Ga0207711_10057542 3300025941 Bacteria 3342
587 Ga0207711_10105192 3300025941 Bacteria 2502
588 Ga0207711_10582575 3300025941 Bacteria 1044
589 Ga0207711_10745958 3300025941 Bacteria 913
590 Ga0207689_10000370 3300025942 Bacteria 42422
591 Ga0207689_10056742 3300025942 Bacteria 3223
592 Ga0207689_10943752 3300025942 Bacteria 728
593 Ga0207689_10951974 3300025942 Bacteria 724
594 Ga0207679_10000032 3300025945 Bacteria 158845
595 Ga0207679_10108686 3300025945 Bacteria 2184
596 Ga0207679_10237693 3300025945 Bacteria 1542
597 Ga0207679_11677414 3300025945 Bacteria 582
598 Ga0207667_10006131 3300025949 Bacteria 14607
599 Ga0207667_10009212 3300025949 Bacteria 11656
600 Ga0207667_10015897 3300025949 Bacteria 8521
601 Ga0207667_10128204 3300025949 Bacteria 2613
602 Ga0207667_10384789 3300025949 Bacteria 1429
603 Ga0207651_10446093 3300025960 Bacteria 1109
604 Ga0207651_10469680 3300025960 Bacteria 1082
605 Ga0207651_10764166 3300025960 Bacteria 855
606 Ga0207668_11173430 3300025972 Bacteria 690
607 Ga0207640_10001991 3300025981 Bacteria 11019
608 Ga0207640_10022226 3300025981 Bacteria 3792
609 Ga0207658_10165595 3300025986 Bacteria 1816
610 Ga0207658_10257424 3300025986 Bacteria 1486
611 Ga0207658_11175935 3300025986 Bacteria 701
612 Ga0207677_10006249 3300026023 Bacteria 6514
613 Ga0207703_10041315 3300026035 Bacteria 3694
614 Ga0207678_10000024 3300026067 Bacteria 125239
615 Ga0207678_10003236 3300026067 Bacteria 14714
616 Ga0207678_10043906 3300026067 Bacteria 3867
617 Ga0207678_10238626 3300026067 Bacteria 1557
618 Ga0207678_10248922 3300026067 Bacteria 1522
619 Ga0207678_10381905 3300026067 Bacteria 1218
620 Ga0207702_10000973 3300026078 Bacteria 29351
621 Ga0207702_10185671 3300026078 Bacteria 1917
622 Ga0207641_10789388 3300026088 Bacteria 939
623 Ga0207648_10002176 3300026089 Bacteria 21281
624 Ga0207648_10873460 3300026089 Bacteria 839
625 Ga0207676_10231338 3300026095 Bacteria 1653
626 Ga0207676_10813761 3300026095 Bacteria 912
627 Ga0207676_11424445 3300026095 Bacteria 689
628 Ga0207674_10003250 3300026116 Bacteria 20001
629 Ga0207674_10033169 3300026116 Bacteria 5406
630 Ga0207674_10173522 3300026116 Bacteria 2109
631 Ga0207675_101338134 3300026118 Bacteria 737
632 Ga0207683_10065088 3300026121 Bacteria 3213
633 Ga0207683_10148309 3300026121 Bacteria 2116
634 Ga0207683_10228973 3300026121 Bacteria 1694
635 Ga0207683_10351656 3300026121 Bacteria 1352
636 Ga0207683_10505174 3300026121 Bacteria 1117
637 Ga0207698_10017410 3300026142 Bacteria 4874
638 Ga0207698_10023299 3300026142 Bacteria 4323
639 Ga0207698_10790935 3300026142 Bacteria 950
640 Ga0207698_11334281 3300026142 Bacteria 732
641 Ga0209281_1002282 3300027111 Bacteria 8082
642 Ga0209371_1000325 3300027312 Bacteria 52216
643 Ga0209371_1000766 3300027312 Bacteria 26728
644 Ga0209371_1003600 3300027312 Bacteria 7407
645 Ga0209282_1000032 3300027666 Bacteria 149218
646 Ga0209282_1000072 3300027666 Bacteria 81137
647 Ga0209813_10001024 3300027866 Bacteria 6287
648 Ga0209974_10092867 3300027876 Bacteria 1048
649 Ga0207428_10008382 3300027907 Bacteria 9335
650 Ga0268266_10117830 3300028379 Bacteria 2360
651 Ga0268265_10565558 3300028380 Bacteria 1081
652 Ga0268265_10897546 3300028380 Bacteria 870
653 Ga0265336_10000618 3300028666 Bacteria 19547
654 Ga0307515_10067022 3300028794 Bacteria 4959
655 Ga0307515_10084890 3300028794 Bacteria 4059
656 Ga0307515_10119204 3300028794 Bacteria 3004
657 Ga0307515_10276308 3300028794 Bacteria 1393
658 Ga0265338_10004608 3300028800 Bacteria 18530
659 Ga0265338_10005463 3300028800 Bacteria 16588
660 Ga0265324_10000002 3300029957 Bacteria 382754
661 Ga0265324_10000500 3300029957 Bacteria 27131
662 Ga0268256_1001275 3300030500 Bacteria 15647
663 Ga0268256_1002981 3300030500 Bacteria 8011
664 Ga0307512_10116329 3300030522 Bacteria 1738
665 Ga0316176_1210209 3300030732 Bacteria 1192
666 Ga0314311_1150818 3300030733 Bacteria 1473
667 Ga0316179_1017842 3300030734 Bacteria 1012
668 Ga0316178_1040944 3300030735 Bacteria 1141
669 Ga0316180_1026989 3300030736 Bacteria 4122
670 Ga0316183_1084783 3300030742 Bacteria 1538
671 Ga0316181_1091528 3300030744 Bacteria 717
672 Ga0316182_1108504 3300030745 Bacteria 3080
673 Ga0316182_1184435 3300030745 Bacteria 617
674 Ga0316182_1433823 3300030745 Bacteria 630
675 Ga0265767_100009 3300030836 Bacteria 6118
676 Ga0265766_1000099 3300030863 Bacteria 2843
677 Ga0265766_1000407 3300030863 Bacteria 1830
678 Ga0265766_1000435 3300030863 Bacteria 1791
679 Ga0265766_1000731 3300030863 Bacteria 1481
680 Ga0265766_1003268 3300030863 Bacteria 938
681 Ga0265769_100464 3300030888 Bacteria 1672
682 Ga0265769_100729 3300030888 Bacteria 1415
683 Ga0265769_102846 3300030888 Bacteria 932
684 Ga0265769_113786 3300030888 Bacteria 586
685 Ga0265768_100424 3300030963 Bacteria 1645
686 Ga0265773_1008002 3300031018 Bacteria 838
687 Ga0265328_10003595 3300031239 Bacteria 6839
688 Ga0265331_10000050 3300031250 Bacteria 181286
689 Ga0265331_10003466 3300031250 Bacteria 10177
690 Ga0265327_10000109 3300031251 Bacteria 181275
691 Ga0265327_10000161 3300031251 Bacteria 144768
692 Ga0265327_10000178 3300031251 Bacteria 135732
693 Ga0265327_10009306 3300031251 Bacteria 7110
694 Ga0265327_10028075 3300031251 Bacteria 3226
695 Ga0265327_10098857 3300031251 Bacteria 1411
696 Ga0265316_10067921 3300031344 Bacteria 2756
697 Ga0265316_10182264 3300031344 Bacteria 1563
698 Ga0265316_10503563 3300031344 Bacteria 865
699 Ga0307513_10011808 3300031456 Bacteria 10825
700 Ga0307513_10124367 3300031456 Bacteria 2539
701 Ga0307513_10769558 3300031456 Bacteria 668
702 Ga0307509_10109747 3300031507 Bacteria 2767
703 Ga0307509_10192810 3300031507 Bacteria 1886
704 Ga0307509_10286613 3300031507 Bacteria 1404
705 Ga0307408_100000089 3300031548 Bacteria 100712
706 Ga0307408_100001167 3300031548 Bacteria 19940
707 Ga0307408_100004683 3300031548 Bacteria 9240
708 Ga0307408_100292357 3300031548 Bacteria 1361
709 Ga0307408_100297420 3300031548 Bacteria 1350
710 Ga0307408_100477718 3300031548 Bacteria 1087
711 Ga0307408_100820655 3300031548 Bacteria 845
712 Ga0316575_10000771 3300031665 Bacteria 9685
713 Ga0316575_10038338 3300031665 Bacteria 1890
714 Ga0310111_101033 3300031667 Bacteria 2830
715 Ga0310111_122416 3300031667 Bacteria 763
716 Ga0316579_10026608 3300031691 Bacteria 2621
717 Ga0265314_10158374 3300031711 Bacteria 1381
718 Ga0316576_10029129 3300031727 Bacteria 3899
719 Ga0316578_10033675 3300031728 Bacteria 2937
720 Ga0307516_10583188 3300031730 Bacteria 772
721 Ga0307405_10052007 3300031731 Bacteria 2545
722 Ga0307405_10394290 3300031731 Bacteria 1082
723 Ga0307405_10964520 3300031731 Bacteria 725
724 Ga0316577_10146540 3300031733 Bacteria 1330
725 Ga0247548_101784 3300031814 Bacteria 896
726 Ga0247548_107337 3300031814 Bacteria 548
727 Ga0307518_10004256 3300031838 Bacteria 10276
728 Ga0307410_10632467 3300031852 Bacteria 896
729 Ga0307406_10400159 3300031901 Bacteria 1088
730 Ga0307406_10504504 3300031901 Bacteria 981
731 Ga0307407_10777831 3300031903 Bacteria 727
732 Ga0307412_10000056 3300031911 Bacteria 145861
733 Ga0307412_10011111 3300031911 Bacteria 5206
734 Ga0307412_10507816 3300031911 Bacteria 1005
735 Ga0307416_100002061 3300032002 Bacteria 11324
736 Ga0307416_100003624 3300032002 Bacteria 9121
737 Ga0307416_100006305 3300032002 Bacteria 7414
738 Ga0307416_100212411 3300032002 Bacteria 1847
739 Ga0307411_10233740 3300032005 Bacteria 1435
740 Ga0307411_10411105 3300032005 Bacteria 1121
741 Ga0307411_10487888 3300032005 Bacteria 1039
742 Ga0307411_10724848 3300032005 Bacteria 869
743 Ga0307411_10836349 3300032005 Bacteria 813
744 Ga0307411_11073839 3300032005 Bacteria 724
745 Ga0307415_101279947 3300032126 Bacteria 694
746 Ga0316583_10196422 3300032133 Bacteria 700
747 Ga0316580_10001102 3300032139 Bacteria 6814
748 Ga0316593_10000198 3300032168 Bacteria 9333
749 Ga0316593_10193303 3300032168 Bacteria 750
750 Ga0316593_10223821 3300032168 Bacteria 699
751 Ga0307507_10149043 3300033179 Bacteria 1767
752 Ga0307510_10228403 3300033180 Bacteria 1366
753 Ga0316592_1001786 3300033524 Bacteria 3582
754 Ga0316596_1000040 3300033541 Bacteria 13770
755 Ga0373950_0017579 3300034818 Bacteria 1233
756 Ga0373940_0012763 3300035088 Bacteria 2018
757 Ga0373940_0097521 3300035088 Bacteria 888
758 Ga0373932_0048427 3300035112 Bacteria 1252
759 Ga0373939_0000348 3300035114 Bacteria 11798
760 Ga0373960_0000482 3300035121 Bacteria 7922
761 Ga0373961_0059684 3300035241 Bacteria 1154
762 Ga0373962_0035579 3300035242 Bacteria 1383
763 Ga0316574_0003365 3300035398 Bacteria 8235
764 Ga0373931_0000535 3300035691 Bacteria 15604
765 Ga0373931_0008660 3300035691 Bacteria 4836
766 Ga0373931_0861160 3300035691 Bacteria 607
767 Ga0373947_0765701 3300035725 Bacteria 659
768 Ga0310112_026650 3300036458 Bacteria 799
769 Ga0310109_000061 3300036534 Bacteria 5065
770 Ga0310110_014822 3300036535 Bacteria 1120
771 Ga0395899_0000080 3300037312 Bacteria 171568
772 Ga0395899_0000218 3300037312 Bacteria 79718
773 Ga0395899_0005268 3300037312 Bacteria 10047
774 Ga0395899_0079277 3300037312 Bacteria 2391
775 Ga0395899_0462873 3300037312 Bacteria 828
776 Ga0395900_0000087 3300037418 Bacteria 171568
777 Ga0395900_0103484 3300037418 Bacteria 2924
778 Ga0395900_0104724 3300037418 Bacteria 2906
779 Ga0395900_0682800 3300037418 Bacteria 961
780 Ga0395900_0699378 3300037418 Bacteria 947
781 Ga0395900_1333168 3300037418 Bacteria 631
782 Ga0395900_1707164 3300037418 Bacteria 540
783 Ga0395898_0000448 3300037466 Bacteria 84953
784 Ga0395898_0004701 3300037466 Bacteria 14859
785 Ga0395898_0091559 3300037466 Bacteria 2925
786 Ga0395898_0139979 3300037466 Bacteria 2316
787 Ga0395898_1142440 3300037466 Bacteria 711
788 Ga0395898_1218083 3300037466 Bacteria 684
789 Ga0395905_0001371 3300037471 Bacteria 29596
790 Ga0395905_0002507 3300037471 Bacteria 20284
791 Ga0395905_0097862 3300037471 Bacteria 2755
792 Ga0395905_0173708 3300037471 Bacteria 2023
793 Ga0395905_0177460 3300037471 Bacteria 1999
794 Ga0395901_0000378 3300038443 Bacteria 53368
795 Ga0395901_0062325 3300038443 Bacteria 3880
796 Ga0395901_0207707 3300038443 Bacteria 2050
797 Ga0395901_0565724 3300038443 Bacteria 1150
798 Ga0395901_0798512 3300038443 Bacteria 933
799 Ga0395901_1105207 3300038443 Bacteria 763
800 Ga0395901_1341045 3300038443 Bacteria 676
801 Ga0400490_00437 3300038726 Bacteria 17578
802 Ga0400490_03371 3300038726 Bacteria 14955
803 Ga0400490_46672 3300038726 Bacteria 1597
804 Ga0400491_08907 3300038727 Bacteria 2331
805 Ga0400488_51157 3300038741 Bacteria 5303
806 Ga0400486_01341 3300038742 Bacteria 7086
807 Ga0400486_03874 3300038742 Bacteria 2575
808 Ga0400486_32640 3300038742 Bacteria 3848
809 Ga0400483_035353 3300039062 Bacteria 8181
810 Ga0400483_062435 3300039062 Bacteria 2108
811 Ga0400483_071897 3300039062 Bacteria 4924
812 Ga0400483_074535 3300039062 Bacteria 1920
813 Ga0400483_080413 3300039062 Bacteria 2696
814 Ga0400483_131418 3300039062 Bacteria 2090
815 Ga0400483_159229 3300039062 Bacteria 2986
816 Ga0400483_205660 3300039062 Bacteria 9867
817 Ga0400489_88546 3300039093 Bacteria 4330
818 Ga0436365_1248808 3300039437 Bacteria 996
819 Ga0436360_0476119 3300039438 Bacteria 2627
820 Ga0436361_0141197 3300039447 Bacteria 3173
821 Ga0436361_0378504 3300039447 Bacteria 3034
822 Ga0436361_0575526 3300039447 Bacteria 1312
823 Ga0436361_0830526 3300039447 Bacteria 3680
824 Ga0439436_0003093 3300041404 Bacteria 5043
825 Ga0439436_0101864 3300041404 Bacteria 801
826 Ga0439439_0027171 3300041406 Bacteria 1445
827 Ga0439439_0087288 3300041406 Bacteria 849
828 Ga0439439_0245793 3300041406 Bacteria 529
829 Ga0439447_063185 3300041407 Bacteria 868
830 Ga0439453_0009071 3300041408 Bacteria 1613
831 Ga0439466_0050203 3300041411 Bacteria 1368
832 Ga0439465_0010238 3300041413 Bacteria 2947
833 Ga0439465_0042679 3300041413 Bacteria 1470
834 Ga0439465_0098774 3300041413 Bacteria 1006
835 Ga0451791_0429238 3300041451 Bacteria 1115
836 Ga0451805_077998 3300041461 Bacteria 694
837 Ga0451805_100255 3300041461 Bacteria 1908
838 Ga0451835_1143204 3300041492 Bacteria 570
839 Ga0451841_0463776 3300041498 Bacteria 702
840 Ga0451850_01102 3300041506 Bacteria 709
841 Ga0451850_20986 3300041506 Bacteria 830
842 Ga0451853_0562209 3300041512 Bacteria 1045
843 Ga0452271_59633 3300041916 Bacteria 1191
844 Ga0439431_0002191 3300041997 Bacteria 4307
845 Ga0439433_0000255 3300041999 Bacteria 8970
846 Ga0439437_001479 3300042000 Bacteria 2468
847 Ga0439442_017115 3300042002 Bacteria 1496
848 Ga0439442_047946 3300042002 Bacteria 900
849 Ga0439445_0003892 3300042004 Bacteria 3360
850 Ga0439448_0000118 3300042005 Bacteria 14718
851 Ga0439448_0036301 3300042005 Bacteria 1581
852 Ga0439448_0044502 3300042005 Bacteria 1443
853 Ga0439448_0095964 3300042005 Bacteria 1004
854 Ga0439432_001484 3300042006 Bacteria 8802
855 Ga0439449_0008668 3300042007 Bacteria 3860
856 Ga0439449_0013168 3300042007 Bacteria 3111
857 Ga0439449_0098851 3300042007 Bacteria 1078
858 Ga0439452_030522 3300042010 Bacteria 1328
859 Ga0439452_091319 3300042010 Bacteria 658
860 Ga0439454_011850 3300042011 Bacteria 1172
861 Ga0439454_022677 3300042011 Bacteria 937
862 Ga0439455_0000425 3300042012 Bacteria 5666
863 Ga0439455_0026675 3300042012 Bacteria 1411
864 Ga0439455_0035150 3300042012 Bacteria 1263
865 Ga0439457_010422 3300042014 Bacteria 2137
866 Ga0450911_004506 3300042115 Bacteria 2277
867 Ga0450917_000001 3300042120 Bacteria 12228
868 Ga0450920_039592 3300042122 Bacteria 939
869 Ga0450923_056631 3300042125 Bacteria 850
870 Ga0450888_000936 3300042126 Bacteria 2776
871 Ga0450890_000549 3300042127 Bacteria 5493
872 Ga0450890_001085 3300042127 Bacteria 3967
873 Ga0450897_002592 3300042128 Bacteria 1373
874 Ga0450891_000655 3300042129 Bacteria 3612
875 Ga0450892_001248 3300042130 Bacteria 2585
876 Ga0450898_043606 3300042134 Bacteria 854
877 Ga0450902_024020 3300042137 Bacteria 1013
878 Ga0450904_002765 3300042139 Bacteria 2007
879 Ga0450904_008721 3300042139 Bacteria 1001
880 Ga0450889_000161 3300042144 Bacteria 6993
881 Ga0450907_011958 3300042146 Bacteria 1442
882 Ga0450910_017596 3300042147 Bacteria 1065
883 Ga0439446_0029603 3300042156 Bacteria 1580
884 Ga0439446_0048229 3300042156 Bacteria 1268
885 Ga0439446_0056828 3300042156 Bacteria 1176
886 Ga0439458_0009491 3300042157 Bacteria 2166
887 Ga0450909_012865 3300042185 Bacteria 1228
888 Ga0450916_001782 3300042530 Bacteria 2198
889 Ga0450893_0002428 3300042532 Bacteria 2901
890 Ga0450893_0016245 3300042532 Bacteria 1259
891 Ga0450901_013383 3300042533 Bacteria 859
892 Ga0451577_0000013 3300042876 Bacteria 550689
893 Ga0451577_0000191 3300042876 Bacteria 128991
894 Ga0451577_0056781 3300042876 Bacteria 3492
895 Ga0451577_0128321 3300042876 Bacteria 2274
896 Ga0451577_0218523 3300042876 Bacteria 1722
897 Ga0451577_0283539 3300042876 Bacteria 1501
898 Ga0451577_0286581 3300042876 Bacteria 1492
899 Ga0466969_0001722 3300044656 Bacteria 11695
900 Ga0466969_0004256 3300044656 Bacteria 7608
901 Ga0466969_0010770 3300044656 Bacteria 4844
902 Ga0466969_0011638 3300044656 Bacteria 4654
903 Ga0466969_0131244 3300044656 Bacteria 1161
904 Ga0466972_0060383 3300044658 Bacteria 1819
905 Ga0466972_0095863 3300044658 Bacteria 1405
906 Ga0466972_0154934 3300044658 Bacteria 1076
907 Ga0466972_0202782 3300044658 Bacteria 929
908 Ga0466973_0049331 3300044659 Bacteria 3901
909 Ga0466981_0147961 3300044669 Bacteria 1617
910 Ga0453683_0000059 3300044673 Bacteria 187158
911 Ga0466965_0001145 3300044683 Bacteria 10416
912 Ga0466965_0015818 3300044683 Bacteria 3584
913 Ga0466965_0063634 3300044683 Bacteria 1846
914 Ga0466965_0071942 3300044683 Bacteria 1740
915 Ga0466965_0221193 3300044683 Bacteria 1009
916 Ga0466965_0321709 3300044683 Bacteria 842
917 Ga0466965_0321710 3300044683 Bacteria 842
918 Ga0466966_0003725 3300044684 Bacteria 10048
919 Ga0466966_0059810 3300044684 Bacteria 2406
920 Ga0466966_0062883 3300044684 Bacteria 2339
921 Ga0466966_0062980 3300044684 Bacteria 2337
922 Ga0466966_0067908 3300044684 Bacteria 2238
923 Ga0466966_0093495 3300044684 Bacteria 1865
924 Ga0466961_0000296 3300044693 Bacteria 33082
925 Ga0466961_0000649 3300044693 Bacteria 21880
926 Ga0466961_0036745 3300044693 Bacteria 3143
927 Ga0466961_0053995 3300044693 Bacteria 2563
928 Ga0466961_0072863 3300044693 Bacteria 2178
929 Ga0466961_0117187 3300044693 Bacteria 1673
930 Ga0466961_0118072 3300044693 Bacteria 1666
931 Ga0466961_0335951 3300044693 Bacteria 920
932 Ga0466961_0391601 3300044693 Bacteria 843
933 Ga0466961_0800640 3300044693 Bacteria 562
934 Ga0466963_0047825 3300044694 Bacteria 2824
935 Ga0466963_0662781 3300044694 Bacteria 736
936 Ga0466964_0015332 3300044706 Bacteria 2915
937 Ga0466964_0020973 3300044706 Bacteria 2522
938 Ga0466964_0105381 3300044706 Bacteria 1249
939 Ga0453684_0000585 3300044712 Bacteria 135647
940 Ga0453684_0000590 3300044712 Bacteria 134718
941 Ga0453684_0000989 3300044712 Bacteria 92793
942 Ga0453684_0035225 3300044712 Bacteria 6924
943 Ga0453684_0065104 3300044712 Bacteria 4650
944 Ga0453684_0239607 3300044712 Bacteria 2089
945 Ga0453684_0317486 3300044712 Bacteria 1766
946 Ga0453684_0456100 3300044712 Bacteria 1422
947 Ga0453684_0860212 3300044712 Bacteria 974
948 Ga0453684_1755614 3300044712 Bacteria 632
949 Ga0466971_0000181 3300044719 Bacteria 23780
950 Ga0466971_0035698 3300044719 Bacteria 2229
951 Ga0466971_0136841 3300044719 Bacteria 1139
952 Ga0466968_0242976 3300044735 Bacteria 853
953 Ga0466968_0272311 3300044735 Bacteria 808
954 Ga0466968_0282713 3300044735 Bacteria 794
955 Ga0466970_0002988 3300044765 Bacteria 8198
956 Ga0466970_0015188 3300044765 Bacteria 3960
957 Ga0466970_0070556 3300044765 Bacteria 1878
958 Ga0466970_0178995 3300044765 Bacteria 1176
959 Ga0466957_0002562 3300044842 Bacteria 9780
960 Ga0466957_0014461 3300044842 Bacteria 4595
961 Ga0466957_0019611 3300044842 Bacteria 3978
962 Ga0466957_0027993 3300044842 Bacteria 3352
963 Ga0466957_0096700 3300044842 Bacteria 1856
964 Ga0466957_0197429 3300044842 Bacteria 1320
965 Ga0466957_0218243 3300044842 Bacteria 1258
966 Ga0466957_0379455 3300044842 Bacteria 964
967 Ga0466959_0000926 3300045049 Bacteria 17409
968 Ga0466959_0005512 3300045049 Bacteria 8680
969 Ga0466959_0007380 3300045049 Bacteria 7712
970 Ga0466959_0071231 3300045049 Bacteria 2517
971 Ga0466959_0265929 3300045049 Bacteria 1180
972 Ga0451576_0000013 3300045051 Bacteria 665120
973 Ga0451576_0000018 3300045051 Bacteria 550689
974 Ga0451576_0005877 3300045051 Bacteria 15243
975 Ga0451576_0010036 3300045051 Bacteria 10905
976 Ga0451576_0025038 3300045051 Bacteria 6436
977 Ga0451576_0100286 3300045051 Bacteria 3011
978 Ga0451576_0193652 3300045051 Bacteria 2123
979 Ga0451576_0280918 3300045051 Bacteria 1741
980 Ga0451576_0999273 3300045051 Bacteria 877
981 Ga0466958_0001887 3300045836 Bacteria 10239
982 Ga0466958_0019865 3300045836 Bacteria 3913
983 Ga0466958_0060303 3300045836 Bacteria 2309
984 Ga0466958_0065480 3300045836 Bacteria 2217
985 Ga0466958_0159333 3300045836 Bacteria 1425
986 Ga0466967_0187281 3300045976 Bacteria 1955
987 Ga0466967_0545245 3300045976 Bacteria 1141
988 Ga0466967_0746643 3300045976 Bacteria 970
989 Ga0495617_000397 3300046452 Bacteria 24142
990 Ga0495617_000636 3300046452 Bacteria 17611
991 Ga0495617_000830 3300046452 Bacteria 14706
992 Ga0495617_007711 3300046452 Bacteria 3722
993 Ga0495617_009077 3300046452 Bacteria 3418
994 Ga0495617_107059 3300046452 Bacteria 906
995 Ga0495627_004713 3300046453 Bacteria 5636
996 Ga0495627_008079 3300046453 Bacteria 3967
997 Ga0495592_0100631 3300046454 Bacteria 2060
998 Ga0495592_0205027 3300046454 Bacteria 1328
999 Ga0495603_0001612 3300046455 Bacteria 13252
1000 Ga0495603_0009392 3300046455 Bacteria 5909
1001 Ga0495603_0021343 3300046455 Bacteria 3921
1002 Ga0495603_0036844 3300046455 Bacteria 2935
1003 Ga0495603_0121153 3300046455 Bacteria 1524
1004 Ga0495603_0344095 3300046455 Bacteria 855
1005 Ga0495603_0365634 3300046455 Bacteria 828
1006 Ga0495590_0000020 3300046457 Bacteria 212352
1007 Ga0495590_0000632 3300046457 Bacteria 16341
1008 Ga0495590_0001551 3300046457 Bacteria 9865
1009 Ga0495590_0006208 3300046457 Bacteria 4677
1010 Ga0495590_0018240 3300046457 Bacteria 2513
1011 Ga0495590_0035656 3300046457 Bacteria 1736
1012 Ga0495590_0084356 3300046457 Bacteria 1120
1013 Ga0495590_0407092 3300046457 Bacteria 522
1014 Ga0495591_010774 3300046458 Bacteria 3514
1015 Ga0495629_0008019 3300046459 Bacteria 7771
1016 Ga0495629_0015926 3300046459 Bacteria 5401
1017 Ga0495629_0143741 3300046459 Bacteria 1659
1018 Ga0495629_0185132 3300046459 Bacteria 1442
1019 Ga0495629_0248372 3300046459 Bacteria 1224
1020 Ga0495629_0919744 3300046459 Bacteria 572
1021 Ga0495638_0000235 3300046460 Bacteria 75760
1022 Ga0495638_0010507 3300046460 Bacteria 6417
1023 Ga0495638_0016045 3300046460 Bacteria 5020
1024 Ga0495638_0058891 3300046460 Bacteria 2379
1025 Ga0495638_0066492 3300046460 Bacteria 2215
1026 Ga0495638_0127888 3300046460 Bacteria 1495
1027 Ga0495638_0138245 3300046460 Bacteria 1424
1028 Ga0495638_0143356 3300046460 Bacteria 1392
1029 Ga0495638_0175482 3300046460 Bacteria 1226
1030 Ga0495638_0192509 3300046460 Bacteria 1156
1031 Ga0495641_0049296 3300046461 Bacteria 1928
1032 Ga0495653_0000067 3300046463 Bacteria 90116
1033 Ga0495653_0004702 3300046463 Bacteria 11053
1034 Ga0495653_0030611 3300046463 Bacteria 4284
1035 Ga0495653_0071030 3300046463 Bacteria 2603
1036 Ga0495653_0091071 3300046463 Bacteria 2229
1037 Ga0495653_0300755 3300046463 Bacteria 1046
1038 Ga0495650_0000200 3300046471 Bacteria 130223
1039 Ga0495650_0000436 3300046471 Bacteria 67167
1040 Ga0495650_0001809 3300046471 Bacteria 19254
1041 Ga0495650_0007290 3300046471 Bacteria 6684
1042 Ga0495650_0017593 3300046471 Bacteria 3580
1043 Ga0495650_0020204 3300046471 Bacteria 3253
1044 Ga0495650_0023276 3300046471 Bacteria 2951
1045 Ga0495650_0025873 3300046471 Bacteria 2740
1046 Ga0495650_0028055 3300046471 Bacteria 2591
1047 Ga0495650_0046362 3300046471 Bacteria 1824
1048 Ga0495650_0086014 3300046471 Bacteria 1204
1049 Ga0495580_0006554 3300046472 Bacteria 9466
1050 Ga0495580_0016805 3300046472 Bacteria 5490
1051 Ga0495580_0020632 3300046472 Bacteria 4873
1052 Ga0495580_0130646 3300046472 Bacteria 1742
1053 Ga0495580_0295525 3300046472 Bacteria 1103
1054 Ga0495580_0716936 3300046472 Bacteria 653
1055 Ga0495582_0005108 3300046473 Bacteria 7350
1056 Ga0495582_0014415 3300046473 Bacteria 4345
1057 Ga0495582_0033837 3300046473 Bacteria 2810
1058 Ga0495582_0181417 3300046473 Bacteria 1199
1059 Ga0495582_0545605 3300046473 Bacteria 670
1060 Ga0495605_0000061 3300046474 Bacteria 145286
1061 Ga0495605_0001735 3300046474 Bacteria 13971
1062 Ga0495605_0005449 3300046474 Bacteria 7411
1063 Ga0495605_0009198 3300046474 Bacteria 5554
1064 Ga0495605_0010393 3300046474 Bacteria 5209
1065 Ga0495605_0012129 3300046474 Bacteria 4788
1066 Ga0495605_0013819 3300046474 Bacteria 4436
1067 Ga0495605_0014824 3300046474 Bacteria 4254
1068 Ga0495605_0017339 3300046474 Bacteria 3880
1069 Ga0495605_0066496 3300046474 Bacteria 1712
1070 Ga0495605_0085995 3300046474 Bacteria 1463
1071 Ga0495605_0125990 3300046474 Bacteria 1158
1072 Ga0495605_0272644 3300046474 Bacteria 720
1073 Ga0495639_0038910 3300046475 Bacteria 2137
1074 Ga0495639_0088103 3300046475 Bacteria 1453
1075 Ga0495639_0088932 3300046475 Bacteria 1446
1076 Ga0495639_0150524 3300046475 Bacteria 1122
1077 Ga0495662_0024098 3300046476 Bacteria 2936
1078 Ga0495662_0180757 3300046476 Bacteria 1039
1079 Ga0495664_0006673 3300046477 Bacteria 6381
1080 Ga0495664_0069337 3300046477 Bacteria 2105
1081 Ga0495664_0072529 3300046477 Bacteria 2057
1082 Ga0495664_0095229 3300046477 Bacteria 1792
1083 Ga0495664_0097358 3300046477 Bacteria 1771
1084 Ga0495664_0250066 3300046477 Bacteria 1072
1085 Ga0495584_0000636 3300046491 Bacteria 23364
1086 Ga0495584_0002002 3300046491 Bacteria 11717
1087 Ga0495584_0011799 3300046491 Bacteria 4468
1088 Ga0495584_0012155 3300046491 Bacteria 4399
1089 Ga0495584_0021670 3300046491 Bacteria 3262
1090 Ga0495584_0032055 3300046491 Bacteria 2660
1091 Ga0495584_0033893 3300046491 Bacteria 2583
1092 Ga0495584_0144920 3300046491 Bacteria 1206
1093 Ga0495584_0190186 3300046491 Bacteria 1043
1094 Ga0495584_0201597 3300046491 Bacteria 1011
1095 Ga0495585_0000497 3300046492 Bacteria 37109
1096 Ga0495585_0006666 3300046492 Bacteria 7134
1097 Ga0495585_0037607 3300046492 Bacteria 2725
1098 Ga0495585_0040726 3300046492 Bacteria 2607
1099 Ga0495585_0041550 3300046492 Bacteria 2578
1100 Ga0495585_0050808 3300046492 Bacteria 2298
1101 Ga0495585_0053985 3300046492 Bacteria 2222
1102 Ga0495585_0057251 3300046492 Bacteria 2151
1103 Ga0495585_0067131 3300046492 Bacteria 1962
1104 Ga0495594_0010435 3300046499 Bacteria 4818
1105 Ga0495594_0017612 3300046499 Bacteria 3776
1106 Ga0495594_0034748 3300046499 Bacteria 2743
1107 Ga0495594_0073377 3300046499 Bacteria 1904
1108 Ga0495594_0125027 3300046499 Bacteria 1455
1109 Ga0495594_0244040 3300046499 Bacteria 1023
1110 Ga0495596_0001745 3300046500 Bacteria 12192
1111 Ga0495596_0001963 3300046500 Bacteria 11349
1112 Ga0495596_0020643 3300046500 Bacteria 2694
1113 Ga0495596_0142796 3300046500 Bacteria 930
1114 Ga0495596_0165675 3300046500 Bacteria 859
1115 Ga0495596_0199960 3300046500 Bacteria 776
1116 Ga0495596_0254795 3300046500 Bacteria 681
1117 Ga0495607_0009755 3300046501 Bacteria 6481
1118 Ga0495607_0017761 3300046501 Bacteria 4554
1119 Ga0495607_0021914 3300046501 Bacteria 4018
1120 Ga0495607_0038368 3300046501 Bacteria 2869
1121 Ga0495607_0042397 3300046501 Bacteria 2697
1122 Ga0495607_0059953 3300046501 Bacteria 2167
1123 Ga0495607_0062866 3300046501 Bacteria 2102
1124 Ga0495607_0063124 3300046501 Bacteria 2097
1125 Ga0495607_0100890 3300046501 Bacteria 1546
1126 Ga0495607_0103502 3300046501 Bacteria 1521
1127 Ga0495607_0159222 3300046501 Bacteria 1148
1128 Ga0495607_0318419 3300046501 Bacteria 726
1129 Ga0495607_0319723 3300046501 Bacteria 724
1130 Ga0495583_0000317 3300046506 Bacteria 76193
1131 Ga0495583_0002046 3300046506 Bacteria 18350
1132 Ga0495583_0004594 3300046506 Bacteria 9786
1133 Ga0495583_0004815 3300046506 Bacteria 9459
1134 Ga0495583_0011949 3300046506 Bacteria 4952
1135 Ga0495583_0016574 3300046506 Bacteria 3954
1136 Ga0495583_0018545 3300046506 Bacteria 3659
1137 Ga0495583_0019465 3300046506 Bacteria 3542
1138 Ga0495583_0094359 3300046506 Bacteria 1284
1139 Ga0495606_0009877 3300046507 Bacteria 8000
1140 Ga0495606_0031882 3300046507 Bacteria 3658
1141 Ga0495606_0035311 3300046507 Bacteria 3418
1142 Ga0495606_0035595 3300046507 Bacteria 3401
1143 Ga0495606_0037967 3300046507 Bacteria 3264
1144 Ga0495606_0048233 3300046507 Bacteria 2802
1145 Ga0495606_0054164 3300046507 Bacteria 2598
1146 Ga0495606_0064595 3300046507 Bacteria 2328
1147 Ga0495606_0066613 3300046507 Bacteria 2283
1148 Ga0495606_0070973 3300046507 Bacteria 2194
1149 Ga0495606_0080050 3300046507 Bacteria 2033
1150 Ga0495606_0085615 3300046507 Bacteria 1949
1151 Ga0495606_0109571 3300046507 Bacteria 1667
1152 Ga0495606_0147485 3300046507 Bacteria 1383
1153 Ga0495608_0188850 3300046511 Bacteria 1301
1154 Ga0495608_0308495 3300046511 Bacteria 979
1155 Ga0495610_0000017 3300046512 Bacteria 365675
1156 Ga0495610_0065030 3300046512 Bacteria 1722
1157 Ga0495610_0125032 3300046512 Bacteria 1122
1158 Ga0495616_0003800 3300046513 Bacteria 9623
1159 Ga0495616_0011842 3300046513 Bacteria 4974
1160 Ga0495616_0034996 3300046513 Bacteria 2602
1161 Ga0495616_0072460 3300046513 Bacteria 1663
1162 Ga0495616_0086533 3300046513 Bacteria 1490
1163 Ga0495616_0102252 3300046513 Bacteria 1342
1164 Ga0495616_0111084 3300046513 Bacteria 1273
1165 Ga0495616_0117328 3300046513 Bacteria 1231
1166 Ga0495616_0119592 3300046513 Bacteria 1217
1167 Ga0495616_0163239 3300046513 Bacteria 1000
1168 Ga0495616_0390385 3300046513 Bacteria 573
1169 Ga0495618_0018095 3300046514 Bacteria 4325
1170 Ga0495618_0138514 3300046514 Bacteria 1556
1171 Ga0495618_0469722 3300046514 Bacteria 761
1172 Ga0495620_0001543 3300046515 Bacteria 13683
1173 Ga0495620_0014491 3300046515 Bacteria 4006
1174 Ga0495620_0053647 3300046515 Bacteria 1706
1175 Ga0495628_0006292 3300046516 Bacteria 10367
1176 Ga0495628_0069084 3300046516 Bacteria 2755
1177 Ga0495628_0075933 3300046516 Bacteria 2616
1178 Ga0495628_0079554 3300046516 Bacteria 2548
1179 Ga0495628_0109587 3300046516 Bacteria 2124
1180 Ga0495628_0205693 3300046516 Bacteria 1482
1181 Ga0495630_0038355 3300046517 Bacteria 3583
1182 Ga0495630_0100382 3300046517 Bacteria 2189
1183 Ga0495630_0109243 3300046517 Bacteria 2095
1184 Ga0495630_0134360 3300046517 Bacteria 1879
1185 Ga0495630_0207757 3300046517 Bacteria 1494
1186 Ga0495631_0011063 3300046518 Bacteria 4450
1187 Ga0495631_0011843 3300046518 Bacteria 4278
1188 Ga0495631_0019480 3300046518 Bacteria 3181
1189 Ga0495631_0030651 3300046518 Bacteria 2438
1190 Ga0495631_0161756 3300046518 Bacteria 960
1191 Ga0495632_0016465 3300046519 Bacteria 4111
1192 Ga0495632_0026864 3300046519 Bacteria 3022
1193 Ga0495632_0089406 3300046519 Bacteria 1462
1194 Ga0495632_0096913 3300046519 Bacteria 1392
1195 Ga0495632_0172654 3300046519 Bacteria 992
1196 Ga0495637_0000053 3300046520 Bacteria 99739
1197 Ga0495637_0002190 3300046520 Bacteria 10923
1198 Ga0495637_0011543 3300046520 Bacteria 4242
1199 Ga0495637_0012032 3300046520 Bacteria 4149
1200 Ga0495637_0056898 3300046520 Bacteria 1617
1201 Ga0495643_0012013 3300046522 Bacteria 5240
1202 Ga0495643_0014375 3300046522 Bacteria 4711
1203 Ga0495643_0019530 3300046522 Bacteria 3918
1204 Ga0495643_0026159 3300046522 Bacteria 3295
1205 Ga0495643_0040991 3300046522 Bacteria 2526
1206 Ga0495643_0044520 3300046522 Bacteria 2411
1207 Ga0495643_0048287 3300046522 Bacteria 2301
1208 Ga0495643_0054593 3300046522 Bacteria 2138
1209 Ga0495643_0104068 3300046522 Bacteria 1451
1210 Ga0495644_0003110 3300046523 Bacteria 6566
1211 Ga0495644_0013221 3300046523 Bacteria 3170
1212 Ga0495644_0019769 3300046523 Bacteria 2571
1213 Ga0495644_0053726 3300046523 Bacteria 1513
1214 Ga0495644_0075233 3300046523 Bacteria 1271
1215 Ga0495644_0218639 3300046523 Bacteria 736
1216 Ga0495648_0003167 3300046524 Bacteria 14648
1217 Ga0495648_0015922 3300046524 Bacteria 5434
1218 Ga0495648_0025782 3300046524 Bacteria 3971
1219 Ga0495648_0026850 3300046524 Bacteria 3867
1220 Ga0495648_0044310 3300046524 Bacteria 2778
1221 Ga0495648_0046480 3300046524 Bacteria 2690
1222 Ga0495648_0056197 3300046524 Bacteria 2368
1223 Ga0495648_0087678 3300046524 Bacteria 1751
1224 Ga0495648_0098552 3300046524 Bacteria 1618
1225 Ga0495648_0100591 3300046524 Bacteria 1596
1226 Ga0495648_0120126 3300046524 Bacteria 1414
1227 Ga0495648_0150736 3300046524 Bacteria 1213
1228 Ga0495648_0155108 3300046524 Bacteria 1190
1229 Ga0495648_0209849 3300046524 Bacteria 968
1230 Ga0495648_0320024 3300046524 Bacteria 719
1231 Ga0495663_0006063 3300046525 Bacteria 3344
1232 Ga0495663_0008461 3300046525 Bacteria 2849
1233 Ga0495663_0012604 3300046525 Bacteria 2357
1234 Ga0495663_0017530 3300046525 Bacteria 2033
1235 Ga0495663_0065824 3300046525 Bacteria 1146
1236 Ga0495663_0124763 3300046525 Bacteria 864
1237 Ga0495666_0002416 3300046526 Bacteria 9296
1238 Ga0495666_0040638 3300046526 Bacteria 2254
1239 Ga0495666_0049585 3300046526 Bacteria 2019
1240 Ga0495666_0098357 3300046526 Bacteria 1379
1241 Ga0495666_0105624 3300046526 Bacteria 1325
1242 Ga0495666_0115943 3300046526 Bacteria 1256
1243 Ga0495666_0162411 3300046526 Bacteria 1035
1244 Ga0495666_0287216 3300046526 Bacteria 745
1245 Ga0495666_0391822 3300046526 Bacteria 624
1246 Ga0495666_0446510 3300046526 Bacteria 579
1247 Ga0495642_0005824 3300046528 Bacteria 4726
1248 Ga0495642_0007577 3300046528 Bacteria 4159
1249 Ga0495642_0008349 3300046528 Bacteria 3963
1250 Ga0495642_0019574 3300046528 Bacteria 2654
1251 Ga0495642_0026738 3300046528 Bacteria 2293
1252 Ga0495642_0030583 3300046528 Bacteria 2154
1253 Ga0495642_0048741 3300046528 Bacteria 1738
1254 Ga0495642_0056434 3300046528 Bacteria 1622
1255 Ga0495642_0075423 3300046528 Bacteria 1414
1256 Ga0495642_0079432 3300046528 Bacteria 1379
1257 Ga0495642_0168073 3300046528 Bacteria 952
1258 Ga0495642_0213337 3300046528 Bacteria 842
1259 Ga0495642_0231611 3300046528 Bacteria 807
1260 Ga0495652_0035356 3300046529 Bacteria 4349
1261 Ga0495652_0115773 3300046529 Bacteria 2147
1262 Ga0495652_0146004 3300046529 Bacteria 1854
1263 Ga0495652_0151599 3300046529 Bacteria 1810
1264 Ga0495654_0000060 3300046530 Bacteria 134307
1265 Ga0495654_0030668 3300046530 Bacteria 2734
1266 Ga0495654_0109550 3300046530 Bacteria 1261
1267 Ga0495654_0176808 3300046530 Bacteria 927
1268 Ga0495654_0191212 3300046530 Bacteria 881
1269 Ga0495654_0247759 3300046530 Bacteria 743
1270 Ga0495665_0008466 3300046531 Bacteria 5581
1271 Ga0495665_0018585 3300046531 Bacteria 3734
1272 Ga0495665_0031045 3300046531 Bacteria 2859
1273 Ga0495665_0034628 3300046531 Bacteria 2700
1274 Ga0495665_0057876 3300046531 Bacteria 2046
1275 Ga0495665_0069907 3300046531 Bacteria 1850
1276 Ga0495665_0091889 3300046531 Bacteria 1595
1277 Ga0495665_0221276 3300046531 Bacteria 978
1278 Ga0495640_0041811 3300046533 Bacteria 3201
1279 Ga0495640_0475601 3300046533 Bacteria 761
1280 Ga0495586_0008133 3300046535 Bacteria 5590
1281 Ga0495586_0018161 3300046535 Bacteria 3741
1282 Ga0495586_0051587 3300046535 Bacteria 2226
1283 Ga0495586_0070537 3300046535 Bacteria 1908
1284 Ga0495586_0072077 3300046535 Bacteria 1888
1285 Ga0495586_0106892 3300046535 Bacteria 1556
1286 Ga0495587_0007790 3300046536 Bacteria 6919
1287 Ga0495587_0037993 3300046536 Bacteria 2888
1288 Ga0495587_0086906 3300046536 Bacteria 1809
1289 Ga0495587_0263774 3300046536 Bacteria 967
1290 Ga0495587_0427665 3300046536 Bacteria 735
1291 Ga0495598_0027767 3300046537 Bacteria 1564
1292 Ga0495609_0000007 3300046538 Bacteria 398812
1293 Ga0495609_0000666 3300046538 Bacteria 26632
1294 Ga0495609_0033507 3300046538 Bacteria 2332
1295 Ga0495609_0046714 3300046538 Bacteria 1938
1296 Ga0495609_0084127 3300046538 Bacteria 1388
1297 Ga0495609_0085504 3300046538 Bacteria 1375
1298 Ga0495609_0164311 3300046538 Bacteria 939
1299 Ga0495609_0211129 3300046538 Bacteria 808
1300 Ga0495621_0161107 3300046539 Bacteria 887
1301 Ga0495621_0161323 3300046539 Bacteria 887
1302 Ga0495621_0351269 3300046539 Bacteria 619
1303 Ga0495597_0007533 3300046542 Bacteria 5520
1304 Ga0495597_0007961 3300046542 Bacteria 5336
1305 Ga0495597_0014198 3300046542 Bacteria 3796
1306 Ga0495597_0022360 3300046542 Bacteria 2933
1307 Ga0495597_0023086 3300046542 Bacteria 2879
1308 Ga0495597_0073396 3300046542 Bacteria 1471
1309 Ga0495597_0073428 3300046542 Bacteria 1470
1310 Ga0495597_0079026 3300046542 Bacteria 1409
1311 Ga0495597_0125983 3300046542 Bacteria 1065
1312 Ga0495597_0185257 3300046542 Bacteria 839
1313 Ga0495597_0232401 3300046542 Bacteria 729
1314 Ga0495597_0323992 3300046542 Bacteria 594
1315 Ga0495645_0009368 3300046543 Bacteria 6846
1316 Ga0495645_0061503 3300046543 Bacteria 2720
1317 Ga0495645_0102644 3300046543 Bacteria 2032
1318 Ga0495645_0450145 3300046543 Bacteria 812
1319 Ga0495622_0002163 3300046557 Bacteria 9573
1320 Ga0495622_0012942 3300046557 Bacteria 3869
1321 Ga0495622_0014615 3300046557 Bacteria 3646
1322 Ga0495622_0031049 3300046557 Bacteria 2498
1323 Ga0495622_0031817 3300046557 Bacteria 2464
1324 Ga0495622_0035080 3300046557 Bacteria 2339
1325 Ga0495622_0041092 3300046557 Bacteria 2150
1326 Ga0495622_0110653 3300046557 Bacteria 1257
1327 Ga0495622_0192080 3300046557 Bacteria 912
1328 Ga0495622_0207613 3300046557 Bacteria 871
1329 Ga0495633_0006566 3300046558 Bacteria 6874
1330 Ga0495633_0023121 3300046558 Bacteria 3080
1331 Ga0495633_0025281 3300046558 Bacteria 2925
1332 Ga0495633_0036777 3300046558 Bacteria 2344
1333 Ga0495633_0062271 3300046558 Bacteria 1746
1334 Ga0495633_0068032 3300046558 Bacteria 1662
1335 Ga0495633_0097194 3300046558 Bacteria 1367
1336 Ga0495633_0160994 3300046558 Bacteria 1035
1337 Ga0495633_0171885 3300046558 Bacteria 998
1338 Ga0495633_0175653 3300046558 Bacteria 986
1339 Ga0495667_0043286 3300046559 Bacteria 2984
1340 Ga0495667_0151288 3300046559 Bacteria 1494
1341 Ga0495667_0555975 3300046559 Bacteria 717
1342 Ga0495656_0010416 3300046615 Bacteria 3380
1343 Ga0495656_0081304 3300046615 Bacteria 1462
1344 Ga0495656_0084934 3300046615 Bacteria 1436
1345 Ga0495656_0099696 3300046615 Bacteria 1341
1346 Ga0495656_0169174 3300046615 Bacteria 1067
1347 Ga0495656_0267756 3300046615 Bacteria 867
1348 Ga0495668_0002640 3300046616 Bacteria 14406
1349 Ga0495668_0005163 3300046616 Bacteria 8962
1350 Ga0495668_0008733 3300046616 Bacteria 6291
1351 Ga0495668_0011342 3300046616 Bacteria 5343
1352 Ga0495668_0011816 3300046616 Bacteria 5204
1353 Ga0495668_0018916 3300046616 Bacteria 3978
1354 Ga0495668_0029452 3300046616 Bacteria 3101
1355 Ga0495668_0051941 3300046616 Bacteria 2269
1356 Ga0495668_0103355 3300046616 Bacteria 1559
1357 Ga0495668_0120245 3300046616 Bacteria 1437
1358 Ga0495668_0162205 3300046616 Bacteria 1224
1359 Ga0495668_0311153 3300046616 Bacteria 864
1360 Ga0495668_0337344 3300046616 Bacteria 827
1361 Ga0495668_0395203 3300046616 Bacteria 759
1362 Ga0495634_0045859 3300046642 Bacteria 2952
1363 Ga0495634_0121713 3300046642 Bacteria 1670
1364 Ga0495634_0202784 3300046642 Bacteria 1231
1365 Ga0495634_0211208 3300046642 Bacteria 1201
1366 Ga0495611_0001662 3300046648 Bacteria 10778
1367 Ga0495611_0002069 3300046648 Bacteria 9442
1368 Ga0495611_0005909 3300046648 Bacteria 5219
1369 Ga0495611_0011874 3300046648 Bacteria 3697
1370 Ga0495611_0093136 3300046648 Bacteria 1393
1371 Ga0495611_0182449 3300046648 Bacteria 980
1372 Ga0495611_0248659 3300046648 Bacteria 824
1373 Ga0495625_0011213 3300046660 Bacteria 7328
1374 Ga0495625_0033151 3300046660 Bacteria 3822
1375 Ga0495625_0034116 3300046660 Bacteria 3757
1376 Ga0495625_0047734 3300046660 Bacteria 3086
1377 Ga0495625_0087655 3300046660 Bacteria 2157
1378 Ga0495625_0166164 3300046660 Bacteria 1475
1379 Ga0495625_0167010 3300046660 Bacteria 1471
1380 Ga0495625_0190370 3300046660 Bacteria 1359
1381 Ga0495625_0199527 3300046660 Bacteria 1321
1382 Ga0495625_0208462 3300046660 Bacteria 1285
1383 Ga0495625_0265594 3300046660 Bacteria 1109
1384 Ga0495635_0008977 3300046663 Bacteria 6978
1385 Ga0495635_0078555 3300046663 Bacteria 2259
1386 Ga0495635_0142420 3300046663 Bacteria 1632
1387 Ga0495635_0200952 3300046663 Bacteria 1352
1388 Ga0495659_0003686 3300046664 Bacteria 4871
1389 Ga0495659_0004277 3300046664 Bacteria 4502
1390 Ga0495659_0007839 3300046664 Bacteria 3385
1391 Ga0495659_0025538 3300046664 Bacteria 2023
1392 Ga0495659_0079281 3300046664 Bacteria 1244
1393 Ga0495659_0093802 3300046664 Bacteria 1155
1394 Ga0495659_0149661 3300046664 Bacteria 936
1395 Ga0495659_0558240 3300046664 Bacteria 505
1396 Ga0495661_0019060 3300046665 Bacteria 4500
1397 Ga0495661_0022315 3300046665 Bacteria 4118
1398 Ga0495661_0027641 3300046665 Bacteria 3639
1399 Ga0495661_0036532 3300046665 Bacteria 3075
1400 Ga0495661_0042541 3300046665 Bacteria 2799
1401 Ga0495661_0062587 3300046665 Bacteria 2203
1402 Ga0495661_0089042 3300046665 Bacteria 1760
1403 Ga0495661_0119891 3300046665 Bacteria 1454
1404 Ga0495661_0148229 3300046665 Bacteria 1269
1405 Ga0495661_0188840 3300046665 Bacteria 1086
1406 Ga0495661_0219532 3300046665 Bacteria 985
1407 Ga0495661_0293686 3300046665 Bacteria 815
1408 Ga0495661_0298181 3300046665 Bacteria 807
1409 Ga0495661_0421205 3300046665 Bacteria 646
1410 Ga0495588_0009027 3300046674 Bacteria 4594
1411 Ga0495588_0011149 3300046674 Bacteria 4209
1412 Ga0495588_0017870 3300046674 Bacteria 3451
1413 Ga0495588_0018679 3300046674 Bacteria 3384
1414 Ga0495588_0040525 3300046674 Bacteria 2375
1415 Ga0495588_0046528 3300046674 Bacteria 2225
1416 Ga0495588_0050054 3300046674 Bacteria 2149
1417 Ga0495588_0230874 3300046674 Bacteria 976
1418 Ga0495657_0727578 3300046675 Bacteria 569
1419 Ga0495657_0736393 3300046675 Bacteria 565
1420 Ga0495599_0052585 3300046678 Bacteria 2551
1421 Ga0495599_0060094 3300046678 Bacteria 2377
1422 Ga0495599_0204471 3300046678 Bacteria 1212
1423 Ga0495599_0222351 3300046678 Bacteria 1155
1424 Ga0495623_0031929 3300046679 Bacteria 3385
1425 Ga0495623_0100910 3300046679 Bacteria 1758
1426 Ga0495623_0118836 3300046679 Bacteria 1593
1427 Ga0495623_0154907 3300046679 Bacteria 1351
1428 Ga0495623_0164039 3300046679 Bacteria 1303
1429 Ga0495623_0164428 3300046679 Bacteria 1301
1430 Ga0495623_0175824 3300046679 Bacteria 1247
1431 Ga0495623_0178944 3300046679 Bacteria 1233
1432 Ga0495646_0038676 3300046680 Bacteria 2944
1433 Ga0495646_0043675 3300046680 Bacteria 2743
1434 Ga0495646_0054683 3300046680 Bacteria 2400
1435 Ga0495646_0076384 3300046680 Bacteria 1961
1436 Ga0495646_0154791 3300046680 Bacteria 1272
1437 Ga0495646_0158928 3300046680 Bacteria 1252
1438 Ga0495646_0405134 3300046680 Bacteria 708
1439 Ga0495658_0114704 3300046683 Bacteria 1624
1440 Ga0495658_0283936 3300046683 Bacteria 1045
1441 Ga0495658_0289894 3300046683 Bacteria 1034
1442 Ga0495658_0558190 3300046683 Bacteria 733
1443 Ga0495669_0001596 3300046684 Bacteria 9305
1444 Ga0495669_0002717 3300046684 Bacteria 7249
1445 Ga0495669_0031367 3300046684 Bacteria 2334
1446 Ga0495669_0041852 3300046684 Bacteria 2035
1447 Ga0495669_0086878 3300046684 Bacteria 1440
1448 Ga0495669_0116277 3300046684 Bacteria 1251
1449 Ga0495669_0350587 3300046684 Bacteria 713
1450 Ga0495613_0072609 3300046689 Bacteria 2508
1451 Ga0495613_0082016 3300046689 Bacteria 2342
1452 Ga0495613_0092389 3300046689 Bacteria 2191
1453 Ga0495613_0130385 3300046689 Bacteria 1800
1454 Ga0495613_0226145 3300046689 Bacteria 1312
1455 Ga0495613_0566434 3300046689 Bacteria 759
1456 Ga0495624_0020482 3300046690 Bacteria 4401
1457 Ga0495624_0039682 3300046690 Bacteria 3017
1458 Ga0495624_0053509 3300046690 Bacteria 2548
1459 Ga0495624_0069830 3300046690 Bacteria 2187
1460 Ga0495624_0097562 3300046690 Bacteria 1810
1461 Ga0495624_0149960 3300046690 Bacteria 1426
1462 Ga0495624_0499649 3300046690 Bacteria 727
1463 Ga0495624_0599869 3300046690 Bacteria 656
1464 Ga0495670_0009867 3300046691 Bacteria 4696
1465 Ga0495670_0028896 3300046691 Bacteria 2749
1466 Ga0495670_0035188 3300046691 Bacteria 2495
1467 Ga0495670_0067273 3300046691 Bacteria 1808
1468 Ga0495670_0102977 3300046691 Bacteria 1471
1469 Ga0495670_0119876 3300046691 Bacteria 1366
1470 Ga0495670_0150687 3300046691 Bacteria 1219
1471 Ga0495670_0166291 3300046691 Bacteria 1160
1472 Ga0495670_0320214 3300046691 Bacteria 832
1473 Ga0495671_0000037 3300046692 Bacteria 177605
1474 Ga0495671_0005005 3300046692 Bacteria 7807
1475 Ga0495671_0012352 3300046692 Bacteria 4668
1476 Ga0495671_0014262 3300046692 Bacteria 4282
1477 Ga0495671_0387612 3300046692 Bacteria 669
1478 Ga0495671_0457852 3300046692 Bacteria 609
1479 Ga0495649_0007567 3300046694 Bacteria 6610
1480 Ga0495649_0041099 3300046694 Bacteria 2529
1481 Ga0495649_0055982 3300046694 Bacteria 2130
1482 Ga0495649_0064779 3300046694 Bacteria 1962
1483 Ga0495649_0088148 3300046694 Bacteria 1655
1484 Ga0495649_0129516 3300046694 Bacteria 1331
1485 Ga0495649_0136805 3300046694 Bacteria 1291
1486 Ga0495649_0140298 3300046694 Bacteria 1272
1487 Ga0495649_0152737 3300046694 Bacteria 1212
1488 Ga0495649_0226406 3300046694 Bacteria 966
1489 Ga0495649_0246537 3300046694 Bacteria 918
1490 Ga0495589_0016595 3300046794 Bacteria 3783
1491 Ga0495589_0021019 3300046794 Bacteria 3335
1492 Ga0495589_0056788 3300046794 Bacteria 1926
1493 Ga0495589_0063428 3300046794 Bacteria 1812
1494 Ga0495589_0074703 3300046794 Bacteria 1653
1495 Ga0495589_0140971 3300046794 Bacteria 1154
1496 Ga0495589_0157145 3300046794 Bacteria 1084
1497 Ga0495589_0232418 3300046794 Bacteria 864
1498 Ga0495589_0312150 3300046794 Bacteria 727
1499 Ga0495600_0004009 3300046809 Bacteria 8753
1500 Ga0495600_0039828 3300046809 Bacteria 3060
1501 Ga0495600_0178346 3300046809 Bacteria 1369
1502 Ga0495600_0185571 3300046809 Bacteria 1339
1503 Ga0495600_0198806 3300046809 Bacteria 1288
1504 Ga0495600_0493571 3300046809 Bacteria 753
1505 Ga0495660_0010186 3300046810 Bacteria 5468
1506 Ga0495660_0011018 3300046810 Bacteria 5250
1507 Ga0495660_0012969 3300046810 Bacteria 4831
1508 Ga0495660_0015683 3300046810 Bacteria 4375
1509 Ga0495660_0034744 3300046810 Bacteria 2819
1510 Ga0495660_0048108 3300046810 Bacteria 2332
1511 Ga0495660_0051977 3300046810 Bacteria 2227
1512 Ga0495660_0065924 3300046810 Bacteria 1931
1513 Ga0495660_0084002 3300046810 Bacteria 1665
1514 Ga0495660_0116780 3300046810 Bacteria 1355
1515 Ga0495660_0119454 3300046810 Bacteria 1335
1516 Ga0495660_0174053 3300046810 Bacteria 1046
1517 Ga0495660_0208048 3300046810 Bacteria 930
1518 Ga0495660_0285985 3300046810 Bacteria 752
1519 Ga0495581_0003269 3300047315 Bacteria 9295
1520 Ga0495581_0011615 3300047315 Bacteria 5097
1521 Ga0495581_0027016 3300047315 Bacteria 3328
1522 Ga0495581_0040802 3300047315 Bacteria 2684
1523 Ga0495581_0078701 3300047315 Bacteria 1908
1524 Ga0495581_0157473 3300047315 Bacteria 1327
1525 Ga0495581_0176605 3300047315 Bacteria 1248
1526 Ga0495604_0003421 3300047317 Bacteria 12655
1527 Ga0495604_0010804 3300047317 Bacteria 7251
1528 Ga0495604_0048599 3300047317 Bacteria 3300
1529 Ga0495604_0096566 3300047317 Bacteria 2180
1530 Ga0495604_0126319 3300047317 Bacteria 1843
1531 Ga0495604_0290778 3300047317 Bacteria 1100
1532 Ga0495604_0433131 3300047317 Bacteria 861
1533 Ga0495636_0001434 3300047318 Bacteria 9014
1534 Ga0495636_0003890 3300047318 Bacteria 5826
1535 Ga0495636_0006133 3300047318 Bacteria 4722
1536 Ga0495636_0006316 3300047318 Bacteria 4654
1537 Ga0495636_0018170 3300047318 Bacteria 2820
1538 Ga0495636_0040864 3300047318 Bacteria 1923
1539 Ga0495636_0106143 3300047318 Bacteria 1232
1540 Ga0495636_0259312 3300047318 Bacteria 806
1541 Ga0495636_0337773 3300047318 Bacteria 709
1542 Ga0495674_0013576 3300047319 Bacteria 7652
1543 Ga0495674_0022526 3300047319 Bacteria 5810
1544 Ga0495674_0031660 3300047319 Bacteria 4803
1545 Ga0495674_0046418 3300047319 Bacteria 3855
1546 Ga0495674_0055008 3300047319 Bacteria 3491
1547 Ga0495674_0102840 3300047319 Bacteria 2429
1548 Ga0495674_0280785 3300047319 Bacteria 1364
1549 Ga0495672_0000013 3300047320 Bacteria 511827
1550 Ga0495672_0000157 3300047320 Bacteria 98544
1551 Ga0495672_0007686 3300047320 Bacteria 8079
1552 Ga0495672_0015499 3300047320 Bacteria 5172
1553 Ga0495672_0029479 3300047320 Bacteria 3455
1554 Ga0495672_0031965 3300047320 Bacteria 3280
1555 Ga0495672_0033248 3300047320 Bacteria 3196
1556 Ga0495672_0035691 3300047320 Bacteria 3060
1557 Ga0495672_0045766 3300047320 Bacteria 2615
1558 Ga0495672_0119798 3300047320 Bacteria 1400
1559 Ga0495672_0161124 3300047320 Bacteria 1153
1560 Ga0495672_0357737 3300047320 Bacteria 676
1561 Ga0495676_0010234 3300047321 Bacteria 8515
1562 Ga0495676_0024323 3300047321 Bacteria 5246
1563 Ga0495676_0026376 3300047321 Bacteria 5003
1564 Ga0495676_0067455 3300047321 Bacteria 2767
1565 Ga0495676_0077394 3300047321 Bacteria 2536
1566 Ga0495676_0098301 3300047321 Bacteria 2172
1567 Ga0495676_0113267 3300047321 Bacteria 1986
1568 Ga0495676_0120830 3300047321 Bacteria 1906
1569 Ga0495676_0275944 3300047321 Bacteria 1139
1570 Ga0495680_0007818 3300047322 Bacteria 9766
1571 Ga0495680_0074468 3300047322 Bacteria 2578
1572 Ga0495680_0100796 3300047322 Bacteria 2151
1573 Ga0495680_0134396 3300047322 Bacteria 1814
1574 Ga0495680_0186233 3300047322 Bacteria 1495
1575 Ga0495680_0232979 3300047322 Bacteria 1310
1576 Ga0495680_0250054 3300047322 Bacteria 1256
1577 Ga0495680_0404052 3300047322 Bacteria 942
1578 Ga0495680_1032052 3300047322 Bacteria 523
1579 Ga0495683_0001129 3300047323 Bacteria 18380
1580 Ga0495683_0017957 3300047323 Bacteria 3662
1581 Ga0495683_0022066 3300047323 Bacteria 3275
1582 Ga0495683_0023372 3300047323 Bacteria 3176
1583 Ga0495683_0032766 3300047323 Bacteria 2646
1584 Ga0495683_0033028 3300047323 Bacteria 2635
1585 Ga0495683_0044638 3300047323 Bacteria 2229
1586 Ga0495683_0049847 3300047323 Bacteria 2096
1587 Ga0495683_0059991 3300047323 Bacteria 1886
1588 Ga0495683_0070031 3300047323 Bacteria 1722
1589 Ga0495683_0093261 3300047323 Bacteria 1456
1590 Ga0495683_0188735 3300047323 Bacteria 936
1591 Ga0495683_0275552 3300047323 Bacteria 730
1592 Ga0495687_000216 3300047443 Bacteria 81734
1593 Ga0495687_000342 3300047443 Bacteria 59692
1594 Ga0495687_001562 3300047443 Bacteria 20787
1595 Ga0495687_002921 3300047443 Bacteria 12995
1596 Ga0495687_007470 3300047443 Bacteria 6428
1597 Ga0495687_013991 3300047443 Bacteria 4152
1598 Ga0495687_027846 3300047443 Bacteria 2638
1599 Ga0495687_062464 3300047443 Bacteria 1528
1600 Ga0495687_084824 3300047443 Bacteria 1229
1601 Ga0495687_095851 3300047443 Bacteria 1124
1602 Ga0495687_171650 3300047443 Bacteria 717
1603 Ga0495675_0013567 3300047444 Bacteria 5145
1604 Ga0495675_0021158 3300047444 Bacteria 4140
1605 Ga0495675_0053131 3300047444 Bacteria 2572
1606 Ga0495675_0072252 3300047444 Bacteria 2176
1607 Ga0495675_0098979 3300047444 Bacteria 1826
1608 Ga0495675_0191731 3300047444 Bacteria 1247
1609 Ga0495677_0001866 3300047445 Bacteria 8421
1610 Ga0495677_0005942 3300047445 Bacteria 4622
1611 Ga0495677_0008079 3300047445 Bacteria 3906
1612 Ga0495677_0009137 3300047445 Bacteria 3662
1613 Ga0495677_0015597 3300047445 Bacteria 2760
1614 Ga0495677_0044661 3300047445 Bacteria 1624
1615 Ga0495677_0109477 3300047445 Bacteria 1049
1616 Ga0495677_0176898 3300047445 Bacteria 826
1617 Ga0495677_0275635 3300047445 Bacteria 659
1618 Ga0495677_0289370 3300047445 Bacteria 643
1619 Ga0495679_008349 3300047446 Bacteria 4218
1620 Ga0495679_012257 3300047446 Bacteria 3270
1621 Ga0495679_017521 3300047446 Bacteria 2562
1622 Ga0495679_017686 3300047446 Bacteria 2546
1623 Ga0495679_023106 3300047446 Bacteria 2115
1624 Ga0495679_041737 3300047446 Bacteria 1418
1625 Ga0495685_000291 3300047447 Bacteria 16719
1626 Ga0495685_001965 3300047447 Bacteria 6380
1627 Ga0495685_014389 3300047447 Bacteria 2688
1628 Ga0495685_019727 3300047447 Bacteria 2316
1629 Ga0495685_034014 3300047447 Bacteria 1751
1630 Ga0495685_071378 3300047447 Bacteria 1162
1631 Ga0495685_079079 3300047447 Bacteria 1096
1632 Ga0495685_108989 3300047447 Bacteria 912
1633 Ga0495685_138553 3300047447 Bacteria 793
1634 Ga0495673_0000248 3300047469 Bacteria 75224
1635 Ga0495673_0019105 3300047469 Bacteria 3439
1636 Ga0495673_0030733 3300047469 Bacteria 2520
1637 Ga0495673_0067504 3300047469 Bacteria 1513
1638 Ga0495673_0078261 3300047469 Bacteria 1375
1639 Ga0495673_0132106 3300047469 Bacteria 980
1640 Ga0495673_0310455 3300047469 Bacteria 563
1641 Ga0495681_0009083 3300047470 Bacteria 6161
1642 Ga0495681_0010756 3300047470 Bacteria 5512
1643 Ga0495681_0011744 3300047470 Bacteria 5189
1644 Ga0495681_0021475 3300047470 Bacteria 3477
1645 Ga0495681_0043390 3300047470 Bacteria 2169
1646 Ga0495681_0046827 3300047470 Bacteria 2059
1647 Ga0495681_0086167 3300047470 Bacteria 1394
1648 Ga0495681_0126902 3300047470 Bacteria 1089
1649 Ga0495681_0249667 3300047470 Bacteria 701
1650 Ga0495681_0271015 3300047470 Bacteria 664
1651 Ga0495684_0068039 3300047471 Bacteria 2708
1652 Ga0495686_0000214 3300047472 Bacteria 106493
1653 Ga0495686_0000787 3300047472 Bacteria 41374
1654 Ga0495686_0001126 3300047472 Bacteria 31591
1655 Ga0495686_0007683 3300047472 Bacteria 8051
1656 Ga0495686_0010875 3300047472 Bacteria 6444
1657 Ga0495686_0057869 3300047472 Bacteria 2418
1658 Ga0495686_0189431 3300047472 Bacteria 1186
1659 Ga0495686_0290820 3300047472 Bacteria 905
1660 Ga0495686_0391768 3300047472 Bacteria 747
1661 Ga0495686_0458937 3300047472 Bacteria 676
1662 Ga0495686_0584168 3300047472 Bacteria 580
1663 Ga0495593_0002955 3300047673 Bacteria 10225
1664 Ga0495593_0015413 3300047673 Bacteria 4328
1665 Ga0495593_0018189 3300047673 Bacteria 3952
1666 Ga0495593_0036990 3300047673 Bacteria 2643
1667 Ga0495593_0185141 3300047673 Bacteria 1048
1668 Ga0495593_0466381 3300047673 Bacteria 632
1669 Ga0495602_0036361 3300048088 Bacteria 4584
1670 Ga0495602_0051607 3300048088 Bacteria 3661
1671 Ga0495602_0075551 3300048088 Bacteria 2859
1672 Ga0495602_0313649 3300048088 Bacteria 1143
1673 Ga0495602_0783218 3300048088 Bacteria 641
1674 Ga0495614_0048811 3300048089 Bacteria 1814
1675 Ga0495614_0048818 3300048089 Bacteria 1814
1676 Ga0495614_0056437 3300048089 Bacteria 1685
1677 Ga0495614_0320971 3300048089 Bacteria 718
1678 Ga0495615_0013648 3300048090 Bacteria 1701
1679 Ga0495615_0100569 3300048090 Bacteria 816
1680 Ga0495626_0000227 3300048091 Bacteria 66048
1681 Ga0495626_0010154 3300048091 Bacteria 5050
1682 Ga0495626_0021350 3300048091 Bacteria 3212
1683 Ga0495626_0022785 3300048091 Bacteria 3091
1684 Ga0495626_0040841 3300048091 Bacteria 2189
1685 Ga0495626_0044118 3300048091 Bacteria 2088
1686 Ga0495626_0055982 3300048091 Bacteria 1806
1687 Ga0495626_0060164 3300048091 Bacteria 1731
1688 Ga0495626_0073481 3300048091 Bacteria 1531
1689 Ga0495626_0073528 3300048091 Bacteria 1531
1690 Ga0495626_0083647 3300048091 Bacteria 1413
1691 Ga0495626_0084714 3300048091 Bacteria 1402
1692 Ga0495626_0096000 3300048091 Bacteria 1297
1693 Ga0495626_0097284 3300048091 Bacteria 1287
1694 Ga0495626_0126416 3300048091 Bacteria 1095
1695 Ga0495626_0202562 3300048091 Bacteria 813
1696 Ga0495626_0212790 3300048091 Bacteria 788
1697 Ga0495626_0290644 3300048091 Bacteria 647
1698 Ga0496100_0067106 3300048903 Bacteria 2381
1699 Ga0496100_0111532 3300048903 Bacteria 1901
1700 Ga0496100_0114800 3300048903 Bacteria 1876
1701 Ga0496100_0275250 3300048903 Bacteria 1253
1702 Ga0496100_0294264 3300048903 Bacteria 1213
1703 Ga0496100_0641645 3300048903 Bacteria 826
1704 Ga0496101_0009727 3300048904 Bacteria 6329
1705 Ga0496101_0046173 3300048904 Bacteria 3123
1706 Ga0496101_0211964 3300048904 Bacteria 1501
1707 Ga0496101_0560311 3300048904 Bacteria 903
1708 Ga0496101_0907796 3300048904 Bacteria 693
1709 Ga0496101_1140934 3300048904 Bacteria 611
1710 Ga0496102_0006537 3300048905 Bacteria 9950
1711 Ga0496102_0039654 3300048905 Bacteria 4256
1712 Ga0496102_0075112 3300048905 Bacteria 3106
1713 Ga0496102_0092053 3300048905 Bacteria 2807
1714 Ga0496102_0197397 3300048905 Bacteria 1896
1715 Ga0496102_0214439 3300048905 Bacteria 1814
1716 Ga0496102_0413289 3300048905 Bacteria 1267
1717 Ga0496102_1758156 3300048905 Bacteria 537
1718 Ga0496103_0003318 3300048906 Bacteria 9844
1719 Ga0496103_0017021 3300048906 Bacteria 4345
1720 Ga0496103_0032288 3300048906 Bacteria 3195
1721 Ga0496103_0038283 3300048906 Bacteria 2942
1722 Ga0496103_0155309 3300048906 Bacteria 1466
1723 Ga0496103_0210497 3300048906 Bacteria 1250
1724 Ga0496103_0343097 3300048906 Bacteria 960
1725 Ga0496103_0426401 3300048906 Bacteria 851
1726 Ga0496104_0018044 3300048907 Bacteria 6433
1727 Ga0496104_0336166 3300048907 Bacteria 1423
1728 Ga0496104_0505298 3300048907 Bacteria 1120
1729 Ga0496104_0651804 3300048907 Bacteria 962
1730 Ga0496104_0807072 3300048907 Bacteria 844
1731 Ga0496104_1163973 3300048907 Bacteria 674
1732 Ga0496105_0035800 3300048908 Bacteria 4087
1733 Ga0496105_0223701 3300048908 Bacteria 1531
1734 Ga0496105_0350800 3300048908 Bacteria 1178
1735 Ga0496106_0006711 3300048909 Bacteria 8526
1736 Ga0496106_0036102 3300048909 Bacteria 3697
1737 Ga0496106_0042023 3300048909 Bacteria 3427
1738 Ga0496106_0171980 3300048909 Bacteria 1717
1739 Ga0496106_0691124 3300048909 Bacteria 813
1740 Ga0496107_0069085 3300048910 Bacteria 2564
1741 Ga0496107_0088073 3300048910 Bacteria 2266
1742 Ga0496107_0160774 3300048910 Bacteria 1664
1743 Ga0496107_0222414 3300048910 Bacteria 1404
1744 Ga0496107_0848596 3300048910 Bacteria 667
1745 Ga0496108_0409678 3300048911 Bacteria 1184
1746 Ga0496108_1331530 3300048911 Bacteria 603
1747 Ga0496109_0042732 3300048912 Bacteria 4107
1748 Ga0496109_0548480 3300048912 Bacteria 1090
1749 Ga0496110_0032653 3300048913 Bacteria 4498
1750 Ga0496110_0294723 3300048913 Bacteria 1478
1751 Ga0496110_0456356 3300048913 Bacteria 1164
1752 Ga0496110_0457031 3300048913 Bacteria 1163
1753 Ga0496110_0794302 3300048913 Bacteria 851
1754 Ga0496110_1205357 3300048913 Bacteria 666
1755 Ga0496110_1261699 3300048913 Bacteria 648
1756 Ga0496111_0013924 3300048914 Bacteria 5484
1757 Ga0496111_0408873 3300048914 Bacteria 1003
1758 Ga0496111_0830563 3300048914 Bacteria 668
1759 Ga0496112_0014789 3300048915 Bacteria 7256
1760 Ga0496112_0196015 3300048915 Bacteria 1980
1761 Ga0496112_0529748 3300048915 Bacteria 1112
1762 Ga0496113_0023586 3300048916 Bacteria 4363
1763 Ga0496113_0027568 3300048916 Bacteria 4073
1764 Ga0496113_0173984 3300048916 Bacteria 1705
1765 Ga0496113_0274888 3300048916 Bacteria 1347
1766 Ga0496113_0476254 3300048916 Bacteria 1003
1767 Ga0496113_0757937 3300048916 Bacteria 772
1768 Ga0496114_0018505 3300048917 Bacteria 5633
1769 Ga0496114_0091484 3300048917 Bacteria 2584
1770 Ga0496114_0372797 3300048917 Bacteria 1263
1771 Ga0496114_0845291 3300048917 Bacteria 795
1772 Ga0496115_0040092 3300048918 Bacteria 3721
1773 Ga0496115_0062017 3300048918 Bacteria 3015
1774 Ga0496115_0131007 3300048918 Bacteria 2067
1775 Ga0496115_0131327 3300048918 Bacteria 2064
1776 Ga0496115_0254757 3300048918 Bacteria 1444
1777 Ga0496115_0376151 3300048918 Bacteria 1156
1778 Ga0496115_0379901 3300048918 Bacteria 1149
1779 Ga0496115_0431565 3300048918 Bacteria 1066
1780 Ga0496115_0532444 3300048918 Bacteria 941
1781 Ga0496115_0572610 3300048918 Bacteria 900
1782 Ga0496115_0608123 3300048918 Bacteria 868
1783 Ga0496116_0006663 3300048919 Bacteria 10425
1784 Ga0496116_0032654 3300048919 Bacteria 3706
1785 Ga0496116_0054709 3300048919 Bacteria 2626
1786 Ga0496116_0120515 3300048919 Bacteria 1519
1787 Ga0496116_0122217 3300048919 Bacteria 1504
1788 Ga0496116_0174618 3300048919 Bacteria 1159
1789 Ga0496116_0226636 3300048919 Bacteria 952
1790 Ga0496116_0393203 3300048919 Bacteria 617
1791 Ga0496117_0002850 3300048920 Bacteria 21031
1792 Ga0496117_0029031 3300048920 Bacteria 4270
1793 Ga0496117_0104585 3300048920 Bacteria 1781
1794 Ga0496118_0010366 3300048921 Bacteria 9235
1795 Ga0496118_0027422 3300048921 Bacteria 4820
1796 Ga0496118_0039741 3300048921 Bacteria 3750
1797 Ga0496118_0100694 3300048921 Bacteria 1953
1798 Ga0496118_0127248 3300048921 Bacteria 1644
1799 Ga0496118_0201720 3300048921 Bacteria 1177
1800 Ga0496118_0207405 3300048921 Bacteria 1153
1801 Ga0496119_0006975 3300048922 Bacteria 10299
1802 Ga0496119_0033005 3300048922 Bacteria 3441
1803 Ga0496119_0151658 3300048922 Bacteria 1241
1804 Ga0496119_0188727 3300048922 Bacteria 1075
1805 Ga0496120_0152393 3300048923 Bacteria 1160
1806 Ga0496120_0182412 3300048923 Bacteria 1029
1807 Ga0496120_0264386 3300048923 Bacteria 802
1808 Ga0496121_0002928 3300048924 Bacteria 24987
1809 Ga0496121_0015151 3300048924 Bacteria 8107
1810 Ga0496121_0023493 3300048924 Bacteria 5935
1811 Ga0496121_0031966 3300048924 Bacteria 4796
1812 Ga0496121_0040564 3300048924 Bacteria 4081
1813 Ga0496121_0060060 3300048924 Bacteria 3130
1814 Ga0496121_0064627 3300048924 Bacteria 2982
1815 Ga0496121_0233788 3300048924 Bacteria 1285
1816 Ga0496121_0672503 3300048924 Bacteria 627
1817 Ga0496122_0002652 3300048925 Bacteria 24985
1818 Ga0496122_0006384 3300048925 Bacteria 13553
1819 Ga0496122_0045238 3300048925 Bacteria 3423
1820 Ga0496122_0117785 3300048925 Bacteria 1723
1821 Ga0496122_0241896 3300048925 Bacteria 1017
1822 Ga0496123_0007601 3300048926 Bacteria 10151
1823 Ga0496123_0011446 3300048926 Bacteria 7687
1824 Ga0496123_0024316 3300048926 Bacteria 4607
1825 Ga0496123_0031548 3300048926 Bacteria 3853
1826 Ga0496123_0050572 3300048926 Bacteria 2775
1827 Ga0496124_0035888 3300048927 Bacteria 4332
1828 Ga0496124_0042938 3300048927 Bacteria 3889
1829 Ga0496124_0052609 3300048927 Bacteria 3458
1830 Ga0496124_0080875 3300048927 Bacteria 2672
1831 Ga0496124_0083920 3300048927 Bacteria 2613
1832 Ga0496124_0089738 3300048927 Bacteria 2509
1833 Ga0496124_0235447 3300048927 Bacteria 1365
1834 Ga0496124_0237303 3300048927 Bacteria 1358
1835 Ga0496124_0317340 3300048927 Bacteria 1117
1836 Ga0496124_0542713 3300048927 Bacteria 769
1837 Ga0496125_0001934 3300048928 Bacteria 28316
1838 Ga0496125_0005068 3300048928 Bacteria 14849
1839 Ga0496125_0134373 3300048928 Bacteria 1733
1840 Ga0496125_0164527 3300048928 Bacteria 1501
1841 Ga0496125_0177292 3300048928 Bacteria 1424
1842 Ga0496125_0253014 3300048928 Bacteria 1110
1843 Ga0496125_0412167 3300048928 Bacteria 786
1844 Ga0496126_0004622 3300048929 Bacteria 16312
1845 Ga0496126_0005787 3300048929 Bacteria 13974
1846 Ga0496126_0007973 3300048929 Bacteria 11505
1847 Ga0496126_0031015 3300048929 Bacteria 5056
1848 Ga0496126_0051319 3300048929 Bacteria 3755
1849 Ga0496126_0090828 3300048929 Bacteria 2686
1850 Ga0496126_0173352 3300048929 Bacteria 1836
1851 Ga0496126_0763102 3300048929 Bacteria 745
1852 Ga0501306_000005 3300049127 Bacteria 11576
1853 Ga0501306_000357 3300049127 Bacteria 3332
1854 Ga0501306_000359 3300049127 Bacteria 3323
1855 Ga0501306_002633 3300049127 Bacteria 1863
1856 Ga0501306_006022 3300049127 Bacteria 1409
1857 Ga0501306_051944 3300049127 Bacteria 659
1858 Ga0501306_104473 3300049127 Bacteria 509
1859 Ga0501308_000002 3300049128 Bacteria 13277
1860 Ga0501308_000101 3300049128 Bacteria 3987
1861 Ga0501308_001514 3300049128 Bacteria 1877
1862 Ga0501308_005869 3300049128 Bacteria 1240
1863 Ga0501309_000053 3300049129 Bacteria 5860
1864 Ga0501309_000994 3300049129 Bacteria 2589
1865 Ga0501309_008348 3300049129 Bacteria 1302
1866 Ga0501309_018310 3300049129 Bacteria 967
1867 Ga0501310_000065 3300049130 Bacteria 9861
1868 Ga0501310_000908 3300049130 Bacteria 2638
1869 Ga0501310_001119 3300049130 Bacteria 2408
1870 Ga0501310_001494 3300049130 Bacteria 2132
1871 Ga0501310_005775 3300049130 Bacteria 1278
1872 Ga0501310_006883 3300049130 Bacteria 1204
1873 Ga0501343_001045 3300049132 Bacteria 1805
1874 Ga0501343_003853 3300049132 Bacteria 1115
1875 Ga0501304_000001 3300049160 Bacteria 14569
1876 Ga0501304_000110 3300049160 Bacteria 3123
1877 Ga0501305_000138 3300049161 Bacteria 4738
1878 Ga0501305_001754 3300049161 Bacteria 2204
1879 Ga0501305_002625 3300049161 Bacteria 1958
1880 Ga0501307_000084 3300049162 Bacteria 4158
1881 Ga0501307_000295 3300049162 Bacteria 3069
1882 Ga0501307_000470 3300049162 Bacteria 2735
1883 Ga0501307_000643 3300049162 Bacteria 2526
1884 Ga0501307_008590 3300049162 Bacteria 1151
1885 Ga0501307_027472 3300049162 Bacteria 774
1886 Ga0495678_000010 3300049459 Bacteria 357896
1887 Ga0495678_006058 3300049459 Bacteria 6512
1888 Ga0495678_006909 3300049459 Bacteria 5955
1889 Ga0495678_008007 3300049459 Bacteria 5399
1890 Ga0495678_016621 3300049459 Bacteria 3359
1891 Ga0495678_016940 3300049459 Bacteria 3315
1892 Ga0495678_021632 3300049459 Bacteria 2828
1893 Ga0495678_031895 3300049459 Bacteria 2191
1894 Ga0495678_052645 3300049459 Bacteria 1566
1895 Ga0495678_058254 3300049459 Bacteria 1460
1896 Ga0495678_093588 3300049459 Bacteria 1053
1897 Ga0495678_172811 3300049459 Bacteria 682
1898 Ga0495678_187690 3300049459 Bacteria 644
1899 Ga0495682_0003087 3300049460 Bacteria 7552
1900 Ga0495682_0003914 3300049460 Bacteria 6501
1901 Ga0495682_0006686 3300049460 Bacteria 4656
1902 Ga0495682_0015613 3300049460 Bacteria 2877
1903 Ga0495682_0067593 3300049460 Bacteria 1287
1904 Ga0495682_0128104 3300049460 Bacteria 908
1905 Ga0501292_002630 3300049515 Bacteria 2332
1906 Ga0501298_064091 3300049521 Bacteria 783
1907 Ga0501303_013329 3300049526 Bacteria 802
1908 Ga0501311_000002 3300049527 Bacteria 12093
1909 Ga0501311_002478 3300049527 Bacteria 1773
1910 Ga0501311_024768 3300049527 Bacteria 837
1911 Ga0501312_000249 3300049528 Bacteria 3886
1912 Ga0501312_004300 3300049528 Bacteria 1670
1913 Ga0501312_006986 3300049528 Bacteria 1426
1914 Ga0501312_009302 3300049528 Bacteria 1293
1915 Ga0501313_000292 3300049529 Bacteria 3129
1916 Ga0501313_000495 3300049529 Bacteria 2736
1917 Ga0501313_000546 3300049529 Bacteria 2658
1918 Ga0501313_031015 3300049529 Bacteria 693
1919 Ga0501314_001218 3300049530 Bacteria 1825
1920 Ga0501314_002963 3300049530 Bacteria 1345
1921 Ga0501314_015087 3300049530 Bacteria 762
1922 Ga0501315_000004 3300049531 Bacteria 11326
1923 Ga0501315_000754 3300049531 Bacteria 2426
1924 Ga0501315_003030 3300049531 Bacteria 1647
1925 Ga0501315_005958 3300049531 Bacteria 1340
1926 Ga0501315_012600 3300049531 Bacteria 1048
1927 Ga0501315_045069 3300049531 Bacteria 678
1928 Ga0501315_051891 3300049531 Bacteria 646
1929 Ga0501316_000002 3300049532 Bacteria 13278
1930 Ga0501316_001189 3300049532 Bacteria 2134
1931 Ga0501316_001227 3300049532 Bacteria 2118
1932 Ga0501316_026469 3300049532 Bacteria 759
1933 Ga0501317_000290 3300049533 Bacteria 3266
1934 Ga0501317_002431 3300049533 Bacteria 1759
1935 Ga0501317_007694 3300049533 Bacteria 1223
1936 Ga0501318_000040 3300049534 Bacteria 5307
1937 Ga0501318_001648 3300049534 Bacteria 1802
1938 Ga0501319_000027 3300049535 Bacteria 4992
1939 Ga0501319_025246 3300049535 Bacteria 551
1940 Ga0501320_001179 3300049536 Bacteria 1838
1941 Ga0501320_001910 3300049536 Bacteria 1600
1942 Ga0501320_003292 3300049536 Bacteria 1359
1943 Ga0501320_009368 3300049536 Bacteria 979
1944 Ga0501321_001759 3300049537 Bacteria 1786
1945 Ga0501321_005466 3300049537 Bacteria 1258
1946 Ga0501321_005923 3300049537 Bacteria 1226
1947 Ga0501322_010033 3300049538 Bacteria 724
1948 Ga0501322_012491 3300049538 Bacteria 676
1949 Ga0501323_000015 3300049539 Bacteria 8085
1950 Ga0501323_000822 3300049539 Bacteria 2504
1951 Ga0501323_001128 3300049539 Bacteria 2270
1952 Ga0501323_002535 3300049539 Bacteria 1781
1953 Ga0501323_006919 3300049539 Bacteria 1280
1954 Ga0501323_012755 3300049539 Bacteria 1030
1955 Ga0501323_017279 3300049539 Bacteria 926
1956 Ga0501324_015903 3300049540 Bacteria 734
1957 Ga0501324_021834 3300049540 Bacteria 659
1958 Ga0501325_005953 3300049541 Bacteria 986
1959 Ga0501326_05772 3300049542 Bacteria 680
1960 Ga0501327_00336 3300049543 Bacteria 1781
1961 Ga0501330_000369 3300049546 Bacteria 1841
1962 Ga0501334_11546 3300049550 Bacteria 648
1963 Ga0501335_003176 3300049551 Bacteria 1380
1964 Ga0501335_022410 3300049551 Bacteria 680
1965 Ga0501336_000669 3300049552 Bacteria 1807
1966 Ga0501336_001280 3300049552 Bacteria 1472
1967 Ga0501337_000673 3300049553 Bacteria 1774
1968 Ga0501337_024160 3300049553 Bacteria 506
1969 Ga0501340_003556 3300049556 Bacteria 951
1970 Ga0501032_0051651 3300049569 Bacteria 2772
1971 Ga0501032_0244711 3300049569 Bacteria 1165
1972 Ga0501033_0032115 3300049570 Bacteria 3942
1973 Ga0501033_0187485 3300049570 Bacteria 1481
1974 Ga0501034_0944157 3300049571 Bacteria 749
1975 Ga0501034_1182171 3300049571 Bacteria 644
1976 Ga0501036_0283908 3300049572 Bacteria 1385
1977 Ga0501036_0375199 3300049572 Bacteria 1187
1978 Ga0501037_0403748 3300049573 Bacteria 937
1979 Ga0501038_0184283 3300049574 Bacteria 1683
1980 Ga0501038_0388532 3300049574 Bacteria 1081
1981 Ga0501038_0681881 3300049574 Bacteria 771
1982 Ga0501043_0311069 3300049579 Bacteria 1202
1983 Ga0501047_0017972 3300049581 Bacteria 6777
1984 Ga0501047_0408279 3300049581 Bacteria 1191
1985 Ga0501048_0110710 3300049582 Bacteria 1939
1986 Ga0501207_010936 3300049654 Bacteria 1345
1987 Ga0501210_004862 3300049657 Bacteria 941
1988 Ga0501211_006351 3300049658 Bacteria 1172
1989 Ga0501217_133450 3300049661 Bacteria 730
1990 Ga0501222_005375 3300049662 Bacteria 1730
1991 Ga0501230_002593 3300049667 Bacteria 2321
1992 Ga0501233_077131 3300049668 Bacteria 853
1993 Ga0501238_000213 3300049671 Bacteria 8393
1994 Ga0501249_002499 3300049679 Bacteria 3714
1995 Ga0501257_034882 3300049686 Bacteria 1222
1996 Ga0501221_018188 3300049704 Bacteria 1351
1997 Ga0501263_018035 3300049760 Bacteria 931
1998 Ga0501269_000003 3300049766 Bacteria 111299
1999 Ga0501279_001682 3300049775 Bacteria 2912
2000 Ga0501279_019904 3300049775 Bacteria 951
2001 Ga0501035_0010452 3300049822 Bacteria 8602
2002 Ga0501035_0010523 3300049822 Bacteria 8572
2003 Ga0501035_0011202 3300049822 Bacteria 8305
2004 Ga0501035_0314676 3300049822 Bacteria 1316
2005 Ga0501044_0000210 3300049823 Bacteria 74323
2006 Ga0501044_0024898 3300049823 Bacteria 6347
2007 Ga0501044_0078211 3300049823 Bacteria 3352
2008 Ga0501044_0358594 3300049823 Bacteria 1376
2009 Ga0501044_0853919 3300049823 Bacteria 787
2010 Ga0501226_005181 3300049853 Bacteria 1494
2011 nmdc:mga03683_216870_c1 3300050489 Bacteria 882
2012 nmdc:mga03n38_298936_c1 3300050490 Bacteria 864
2013 nmdc:mga03n38_4317_c1 3300050490 Bacteria 4691
2014 nmdc:mga00v17_12098_c1 3300050491 Bacteria 4754
2015 nmdc:mga00v17_184456_c1 3300050491 Bacteria 1347
2016 nmdc:mga0k408_139838_c1 3300050493 Bacteria 1440
2017 nmdc:mga0k408_43703_c1 3300050493 Bacteria 2583
2018 nmdc:mga0k408_712_c1 3300050493 Bacteria 18213
2019 nmdc:mga0k408_98510_c1 3300050493 Bacteria 1723
2020 nmdc:mga06z11_1936_c1 3300050494 Bacteria 7811
2021 nmdc:mga07m45_13904_c1 3300050496 Bacteria 4278
2022 nmdc:mga07m45_45273_c1 3300050496 Bacteria 2470
2023 nmdc:mga07m45_521668_c1 3300050496 Bacteria 688
2024 nmdc:mga07m45_6867_c1 3300050496 Bacteria 5791
2025 nmdc:mga05p37_434571_c1 3300050507 Bacteria 1524
2026 nmdc:mga05p37_750093_c1 3300050507 Bacteria 1076
2027 nmdc:mga08y16_79438_c1 3300050511 Bacteria 3419
2028 nmdc:mga0n895_56341_c1 3300050512 Bacteria 3872
2029 nmdc:mga08x19_336538_c1 3300050514 Bacteria 1052
2030 nmdc:mga0a205_171614_c1 3300050515 Bacteria 2065
2031 nmdc:mga0sz30_439069_c1 3300050516 Bacteria 586
2032 Ga0495655_0104305 3300053083 Bacteria 844
2033 Ga0500644_0035969 3300053088 Bacteria 1608
2034 Ga0500646_0009238 3300053090 Bacteria 2523
2035 Ga0500641_0039435 3300053096 Bacteria 1903
2036 Ga0500650_0075460 3300053098 Bacteria 1576
2037 Ga0500555_069725 3300053103 Bacteria 929
2038 Ga0500618_003056 3300053125 Bacteria 5938
2039 Ga0500628_002187 3300053129 Bacteria 3263
2040 Ga0500655_002279 3300053133 Bacteria 3523
2041 Ga0500559_0103340 3300053136 Bacteria 1315
2042 Ga0500568_0055223 3300053139 Bacteria 1551
2043 Ga0500573_0439913 3300053140 Bacteria 606
2044 Ga0500577_0289774 3300053142 Bacteria 714
2045 Ga0500586_017865 3300053145 Bacteria 2178
2046 Ga0500600_0129045 3300053149 Bacteria 1290
2047 Ga0500604_0000352 3300053151 Bacteria 12731
2048 Ga0500616_0170867 3300053153 Bacteria 987
2049 Ga0500619_138164 3300053154 Bacteria 830
2050 Ga0500622_0000002 3300053156 Bacteria 646442
2051 Ga0500622_0060471 3300053156 Bacteria 1933
2052 Ga0500622_0103807 3300053156 Bacteria 1396
2053 Ga0500645_035372 3300053730 Bacteria 1488
2054 Ga0500645_191047 3300053730 Bacteria 554
2055 Ga0500565_012675 3300053734 Bacteria 901
2056 Ga0587084_000161 3300059477 Bacteria 4157
2057 Ga0587084_001109 3300059477 Bacteria 2453
2058 Ga0587084_002020 3300059477 Bacteria 2038
2059 Ga0587084_098994 3300059477 Bacteria 589
2060 Ga0587093_081804 3300059478 Bacteria 558
2061 Ga0587066_000001 3300059490 Bacteria 11779
2062 Ga0587070_000065 3300059491 Bacteria 5371
2063 Ga0587070_075589 3300059491 Bacteria 728
2064 Ga0587070_092774 3300059491 Bacteria 682
2065 Ga0587073_0001671 3300059492 Bacteria 2662
2066 Ga0587073_0129733 3300059492 Bacteria 691
2067 Ga0587077_001151 3300059493 Bacteria 2731
2068 Ga0587077_020126 3300059493 Bacteria 1169
2069 Ga0587080_002147 3300059503 Bacteria 2280
2070 Ga0587080_077620 3300059503 Bacteria 676
2071 Ga0587082_000884 3300059504 Bacteria 2839
2072 Ga0587083_0000094 3300059505 Bacteria 5249
2073 Ga0587083_0000200 3300059505 Bacteria 4379
2074 Ga0587083_0069435 3300059505 Bacteria 814
2075 Ga0587085_021468 3300059506 Bacteria 987
2076 Ga0587086_066732 3300059507 Bacteria 610
2077 Ga0587088_000001 3300059508 Bacteria 14678
2078 Ga0587088_037690 3300059508 Bacteria 896
2079 Ga0587089_043032 3300059509 Bacteria 704
2080 Ga0587090_008198 3300059510 Bacteria 1394
2081 Ga0587091_000335 3300059511 Bacteria 3779
2082 Ga0587091_096258 3300059511 Bacteria 687
2083 Ga0587092_006055 3300059512 Bacteria 1517
2084 Ga0587098_001373 3300059604 Bacteria 1852
2085 Ga0587098_009967 3300059604 Bacteria 1043
2086 Ga0587098_038216 3300059604 Bacteria 688
2087 Ga0587106_000819 3300059605 Bacteria 2456
2088 Ga0587106_008375 3300059605 Bacteria 1284
2089 Ga0587125_003092 3300059607 Bacteria 1390
2090 Ga0587099_000096 3300059622 Bacteria 3472
2091 Ga0587101_005751 3300059623 Bacteria 1390
2092 Ga0587117_015850 3300059627 Bacteria 996
2093 Ga0587128_000098 3300059630 Bacteria 4404
2094 Ga0587128_007622 3300059630 Bacteria 1374
2095 Ga0587062_016401 3300059639 Bacteria 1001
2096 Ga0587062_038847 3300059639 Bacteria 764
2097 Ga0587067_000303 3300059640 Bacteria 4022
2098 Ga0587067_017051 3300059640 Bacteria 1201
2099 Ga0587068_000002 3300059641 Bacteria 13671
2100 Ga0587068_000145 3300059641 Bacteria 5029
2101 Ga0587068_000228 3300059641 Bacteria 4429
2102 Ga0587068_005731 3300059641 Bacteria 1708
2103 Ga0587069_001414 3300059642 Bacteria 2197
2104 Ga0587069_004834 3300059642 Bacteria 1537
2105 Ga0587072_001765 3300059643 Bacteria 2769
2106 Ga0587072_003430 3300059643 Bacteria 2226
2107 Ga0587072_005754 3300059643 Bacteria 1863
2108 Ga0587075_000434 3300059644 Bacteria 3285
2109 Ga0587076_000914 3300059645 Bacteria 2766
2110 Ga0587076_004751 3300059645 Bacteria 1717
2111 Ga0587078_000693 3300059646 Bacteria 2693
2112 Ga0587078_011692 3300059646 Bacteria 1023
2113 Ga0587078_045061 3300059646 Bacteria 633
2114 Ga0587079_000913 3300059647 Bacteria 3025
2115 Ga0587079_011093 3300059647 Bacteria 1443
2116 Ga0587079_034989 3300059647 Bacteria 986
2117 Ga0587079_037199 3300059647 Bacteria 966
2118 Ga0587100_007975 3300059648 Bacteria 848
2119 Ga0587102_019683 3300059649 Bacteria 752
2120 Ga0587107_000137 3300059652 Bacteria 3765
2121 Ga0587107_051316 3300059652 Bacteria 700
2122 Ga0587114_004063 3300059655 Bacteria 1499
2123 Ga0587071_000116 3300060344 Bacteria 5683
2124 Ga0587071_183420 3300060344 Bacteria 539
2125 Ga0587111_0000227 3300060346 Bacteria 4609
2126 Ga0587111_0000229 3300060346 Bacteria 4601
2127 Ga0587111_0002272 3300060346 Bacteria 2528
2128 Ga0587111_0017972 3300060346 Bacteria 1324
2129 Ga0466962_0001202 3300061719 Bacteria 11897
2130 Ga0466962_0016232 3300061719 Bacteria 3591
2131 Ga0466962_0029411 3300061719 Bacteria 2630
2132 Ga0466962_0147138 3300061719 Bacteria 1142
2133 Ga0466962_0464838 3300061719 Bacteria 638
2134 2501074046 2501025501 Bacteria 7768574
2135 2501084118 2501025502 Bacteria 9641094
2136 2501414355 2501025504 Bacteria 8008976
2137 2509132518 2508501125 Bacteria 7208311
2138 2510252583 2510065045 Bacteria 7761063
2139 2511093330 2510917013 Bacteria 9951648
2140 2511099778 2510917014 Bacteria 8296963
2141 2511102451 2510917015 Bacteria 7950052
2142 2511245083 2511231002 Bacteria 5042903
2143 2512348441 2512047030 Bacteria 9031815
2144 2513556141 2513237082 Bacteria 8640282
2145 2513564327 2513237083 Bacteria 8410967
2146 2513962592 2513237151 Bacteria 6309801
2147 2514050901 2513237166 Bacteria 10373764
2148 2515684861 2515154122 Bacteria 8609520
2149 2515690948 2515154123 Bacteria 6387382
2150 2516022230 2515154189 Bacteria 9629850
2151 2519457515 2519103095 Bacteria 6629912
2152 2527080587 2526164713 Bacteria 6780608
2153 2563061523 2562617112 Bacteria 10918404
2154 2585294150 2582581311 Bacteria 6763856
2155 2599741043 2599185239 Bacteria 8686614
2156 2599748350 2599185240 Bacteria 7968121
2157 2600210262 2599185355 Bacteria 7968906
2158 2600813801 2600255067 Bacteria 6795583
2159 2643792076 2643221554 Bacteria 6603920
2160 2643799429 2643221556 Bacteria 7251154
2161 2644123358 2643221621 Bacteria 6212786
2162 2644216443 2643221638 Bacteria 6579467
2163 2644254807 2643221645 Bacteria 7207331
2164 2644360368 2643221664 Bacteria 7272945
2165 2644471522 2643221684 Bacteria 7145183
2166 2676745814 2675903129 Bacteria 7964495
2167 2713478613 2711768613 Bacteria 11048459
2168 2719641681 2718217991 Bacteria 7829542
2169 2738738116 2738541280 Bacteria 6630198
2170 2738824029 2738541296 Bacteria 7285013
2171 2738826789 2738541297 Bacteria 6549566
2172 2738836420 2738541298 Bacteria 7286732
2173 2738843086 2738541300 Bacteria 6675882
2174 2738877950 2738541306 Bacteria 7284992
2175 2739150586 2738541357 Bacteria 6549408
2176 2739189656 2738543002 Bacteria 7284546
2177 2739192505 2738543003 Bacteria 6549560
2178 2739224543 2738543008 Bacteria 7282815
2179 2739273837 2738543018 Bacteria 6718814
2180 2739318982 2738543026 Bacteria 6549408
2181 2739337223 2738543029 Bacteria 6549249
2182 2739342881 2738543030 Bacteria 6719714
2183 2746087224 2744054900 Bacteria 8399525
2184 2746093269 2744054901 Bacteria 8397047
2185 2753566201 2751185846 Bacteria 7242164
2186 2792837062 2791355137 Bacteria 9654227
2187 2808972857 2808606384 Bacteria 8474373
2188 2809007978 2808606390 Bacteria 8476311
2189 2809015382 2808606391 Bacteria 8308166
2190 2817259705 2816332253 Bacteria 6764532
2191 2817277374 2816332256 Bacteria 6891714
2192 2817453540 2816332286 Bacteria 6853759
2193 2819624163 2818991450 Bacteria 6962147
2194 2819636795 2818991452 Bacteria 8442785
2195 2842332188 2842324504 Bacteria 9364110
2196 2842356360 2842348783 Bacteria 9002918
2197 2842461299 2842454564 Bacteria 8730687
2198 2842712337 2842711865 Bacteria 7155354
2199 2855735567 2855730933 Bacteria 7047938
2200 2856289407 2856287931 Bacteria 7223934
2201 2857362279 2857357740 Bacteria 9937880
2202 2857556281 2857553236 Bacteria 6166726
2203 2857560802 2857558681 Bacteria 6617694
2204 2863426496 2863421361 Bacteria 7300805
2205 2870069402 2870068957 Bacteria 8925310
2206 2883091437 2883087390 Bacteria 9532701
2207 2885272359 2885270888 Bacteria 9831543
2208 2900637068 2900634093 Bacteria 10263517
2209 2902686677 2902682994 Bacteria 8951596
2210 2904428883 2904424332 Bacteria 7633521
2211 2904438988 2904434214 Bacteria 6230908
2212 2904490114 2904483920 Bacteria 7545285
2213 2904569340 2904564687 Bacteria 7609577
2214 2904576823 2904571731 Bacteria 7608790
2215 2904624834 2904615490 Bacteria 10047340
2216 2919476957 2919476304 Bacteria 5888696
2217 2919533283 2919527303 Bacteria 7718827
2218 2921651507 2921643360 Bacteria 11448031
2219 2928114211 2928108538 Bacteria 7360024
2220 2928141041 2928135762 Bacteria 7259641
2221 2928163049 2928157003 Bacteria 7522202
2222 2928170201 2928163908 Bacteria 7561269
2223 2928176337 2928170801 Bacteria 8785406
2224 2928509206 2928503688 Bacteria 7268108
2225 2928542017 2928536128 Bacteria 7657547
2226 2945934568 2945934425 Bacteria 7444609
2227 2981996104 2981990288 Bacteria 7590678
2228 2990704874 2990703756 Bacteria 7715990
2229 642426538 641736151 Bacteria 7477263
2230 642417676 641736154 Bacteria 7689995
2231 642594616 642555112 Bacteria 8676562
2232 642623205 642555113 Bacteria 8214658
2233 8003956820 8003955200 Bacteria 8601927
2234 8018847929 8018845410 Bacteria 8933938
2235 8020813917 8020807995 Bacteria 6801506
2236 8020939047 8020938398 Bacteria 7472757
2237 8020947762 8020945358 Bacteria 8467355
2238 8020953406 8020953355 Bacteria 7439080
2239 8021127513 8021120328 Bacteria 8782274
2240 8039099663 8039098773 Bacteria 6602928
2241 8040171494 8040167225 Bacteria 6542727
2242 8040174108 8040173305 Bacteria 6827067
2243 8047676077 8047673197 Bacteria 7395230
2244 8055269423 8055266321 Bacteria 7999742
2245 8055307415 8055301274 Bacteria 8587385
2246 Ga0075368_10003054
2247 JGI24736J21556_1000961
2248 JGI24736J21556_1014262
2249 JGI24741J21665_1000624
2250 JGI24741J21665_1002145
2251 JGI24740J21852_10008508
2252 JGI24740J21852_10010715
2253 JGI24740J21852_10022184
2254 JGI24739J22299_10010870
2255 JGI24739J22299_10015549
2256 JGI24739J22299_10028555
2257 JGI24739J22299_10040738
2258 JGI24737J22298_10004674
2259 JGI24737J22298_10008370
2260 JGI24737J22298_10022836
2261 JGI24737J22298_10027585
2262 JGI24735J21928_10002193
2263 JGI24735J21928_10011144
2264 JGI24735J21928_10014430
2265 JGI24735J21928_10019381
2266 JGI24738J21930_10006803
2267 JGI25155J39150_1007058
2268 JGI25156J39149_1006223
2269 JGI25156J39149_1012871
2270 JGI25156J39149_1014425
2271 JGI25156J39149_1016459
2272 JGI25156J39149_1020451
2273 JGI25156J39149_1033188
2274 JGI25154J39366_1000303
2275 JGI25154J39366_1001042
2276 JGI25158J39367_1000542
2277 JGI25152J39213_1013037
2278 JGI25150J39212_1001923
2279 JGI25150J39212_1003501
2280 Ga0006763J43179_104166
2281 JGI25159J45721_1005729
2282 JGI25159J45721_1006200
2283 Ga0006765J45826_105454
2284 Ga0006765J45826_108890
2285 Ga0006765J45826_116549
2286 Ga0006778J45830_1013714
2287 Ga0006778J45830_1018992
2288 Ga0006759J45824_1009839
2289 Ga0006759J45824_1019440
2290 Ga0006759J45824_1019946
2291 Ga0006759J45824_1026311
2292 JGI25151J46595_10000457
2293 JGI25151J46595_10071766
2294 JGI25151J46595_10077557
2295 JGI25406J46586_10002509
2296 JGI25406J46586_10005813
2297 JGI25165J46597_1001391
2298 JGI25153J46596_10002258
2299 Ga0006758J48902_1003546
2300 Ga0006758J48902_1008911
2301 Ga0006758J48902_1013469
2302 Ga0006770J48903_1023756
2303 Ga0006777J48905_1011571
2304 Ga0006777J48905_1023402
2305 JGI25160J50197_1001051
2306 JGI25160J50197_1002367
2307 JGI25161J50226_1003265
2308 Ga0006556J51387_1013500
2309 Ga0006556J51387_1016929
2310 Ga0007417J51691_1002612
2311 Ga0007417J51691_1012996
2312 Ga0007417J51691_1036180
2313 Ga0006558J51389_1019156
2314 Ga0006558J51389_1029442
2315 Ga0007427J51700_104412
2316 Ga0007427J51700_116762
2317 Ga0007427J51700_120270
2318 Ga0006560J51390_1011017
2319 Ga0006560J51390_1020307
2320 Ga0006554J51385_1017299
2321 Ga0007410J51695_1004597
2322 Ga0007410J51695_1005147
2323 Ga0007410J51695_1012689
2324 Ga0007410J51695_1015723
2325 Ga0007409J51694_1002712
2326 Ga0007409J51694_1007029
2327 Ga0007409J51694_1025202
2328 Ga0007416J51690_1009369
2329 Ga0007429J51699_1012288
2330 Ga0007429J51699_1013730
2331 Ga0007411J51799_103551
2332 Ga0007411J51799_118133
2333 Ga0007415J51800_102854
2334 Ga0032354_1003172
2335 Ga0032354_1006520
2336 Ga0032354_1013175
2337 Ga0032354_1073470
2338 Ga0032354_1175332
2339 Ga0006780_1003512
2340 Ga0055539_1001132
2341 Ga0055539_1005718
2342 Ga0055533_1003286
2343 Ga0055533_1003606
2344 Ga0055533_1005127
2345 Ga0055533_1006769
2346 Ga0055532_1000066
2347 Ga0055532_1000261
2348 Ga0055532_1002406
2349 Ga0055525_1000018
2350 Ga0055527_1000035
2351 Ga0055527_1000602
2352 Ga0055535_1000046
2353 Ga0055535_1000050
2354 Ga0055542_1000512
2355 Ga0055542_1001443
2356 Ga0055542_1008179
2357 Ga0055529_1000079
2358 Ga0055529_1000087
2359 Ga0055529_1000089
2360 Ga0055529_1000804
2361 Ga0055529_1019136
2362 Ga0055526_1008246
2363 Ga0055526_1008253
2364 Ga0055526_1012574
2365 Ga0055526_1017962
2366 Ga0055537_1000038
2367 Ga0055537_1007557
2368 Ga0055524_1000024
2369 Ga0055524_1003212
2370 Ga0055524_1038927
2371 Ga0055534_1003773
2372 Ga0055534_1005461
2373 Ga0055528_1000489
2374 Ga0055528_1012285
2375 Ga0055528_1013311
2376 Ga0055528_1029760
2377 Ga0055530_10007831
2378 Ga0055531_10006076
2379 Ga0058692_1002213
2380 Ga0055543_1004039
2381 Ga0058860_10029302
2382 Ga0058862_12800340
2383 Ga0065165_1000504
2384 Ga0065165_1000885
2385 Ga0065165_1006561
2386 Ga0065165_1043988
2387 Ga0065714_10175573
2388 Ga0065714_10264494
2389 Ga0065712_10086127
2390 Ga0065707_10200663
2391 Ga0070658_10012014
2392 Ga0070658_10028760
2393 Ga0070658_10051816
2394 Ga0070658_10197036
2395 Ga0070658_10210675
2396 Ga0070658_11224510
2397 Ga0070683_100130959
2398 Ga0070690_100665097
2399 Ga0070670_100436011
2400 Ga0070670_100588559
2401 Ga0070670_101020706
2402 Ga0068869_100000239
2403 Ga0068869_100792341
2404 Ga0068869_100940796
2405 Ga0070666_10064761
2406 Ga0070666_10851489
2407 Ga0070680_100028265
2408 Ga0070682_100104638
2409 Ga0070682_100335096
2410 Ga0068868_100019350
2411 Ga0068868_100470939
2412 Ga0068868_100985634
2413 Ga0070660_100026003
2414 Ga0070660_100034626
2415 Ga0070689_101355443
2416 Ga0070691_10586771
2417 Ga0070687_100449060
2418 Ga0070661_100000276
2419 Ga0070661_100425658
2420 Ga0070661_100577942
2421 Ga0070661_100922623
2422 Ga0070669_100615595
2423 Ga0070669_100767176
2424 Ga0070675_100789602
2425 Ga0070671_100130518
2426 Ga0070671_101474927
2427 Ga0070673_100420566
2428 Ga0070688_100394510
2429 Ga0070659_100000426
2430 Ga0070659_100235446
2431 Ga0070659_100755623
2432 Ga0070659_100766022
2433 Ga0070667_100263553
2434 Ga0070694_100214288
2435 Ga0070663_100001053
2436 Ga0070663_100021946
2437 Ga0070663_100434756
2438 Ga0070663_100882448
2439 Ga0070663_101124597
2440 Ga0070678_100045788
2441 Ga0070678_100253166
2442 Ga0070678_100667905
2443 Ga0070662_100612492
2444 Ga0070681_10376443
2445 Ga0070681_10446735
2446 Ga0068867_101635410
2447 Ga0070685_11308658
2448 Ga0070706_100494586
2449 Ga0070699_100041691
2450 Ga0070699_100043286
2451 Ga0070699_100085640
2452 Ga0070679_100263732
2453 Ga0070679_100272175
2454 Ga0070684_100277906
2455 Ga0068853_100029320
2456 Ga0068853_101060371
2457 Ga0068853_101493106
2458 Ga0070672_100692733
2459 Ga0070665_100065427
2460 Ga0070665_100442535
2461 Ga0068855_100018349
2462 Ga0068855_100077376
2463 Ga0068855_100131783
2464 Ga0068855_100257086
2465 Ga0070664_100000018
2466 Ga0070664_100010409
2467 Ga0070664_100068369
2468 Ga0070664_100142127
2469 Ga0068857_100128424
2470 Ga0068857_100178268
2471 Ga0068857_100409644
2472 Ga0068854_100000225
2473 Ga0068854_100363057
2474 Ga0068856_100000070
2475 Ga0068856_100117908
2476 Ga0068856_100155750
2477 Ga0068852_100001513
2478 Ga0068852_100022501
2479 Ga0068852_100840357
2480 Ga0068864_101369740
2481 Ga0068864_102390113
2482 Ga0068866_10292215
2483 Ga0068851_10115256
2484 Ga0068863_100046276
2485 Ga0068863_100532459
2486 Ga0068858_100013226
2487 Ga0068860_100019846
2488 Ga0068862_100708291
2489 Ga0081539_10000142
2490 Ga0081539_10000215
2491 Ga0081539_10003297
2492 Ga0075363_100000856
2493 Ga0075363_100086667
2494 Ga0075364_10015296
2495 Ga0075364_10316984
2496 Ga0075362_10000565
2497 Ga0075362_10081459
2498 Ga0075362_10527349
2499 Ga0075367_10001881
2500 Ga0075369_10003827
2501 Ga0075369_10490397
2502 Ga0075366_10064801
2503 Ga0075366_10132503
2504 Ga0075366_10267362
2505 Ga0075366_10332276
2506 Ga0075366_10519688
2507 Ga0097621_100165035
2508 Ga0097621_100233100
2509 Ga0075370_10036206
2510 Ga0075370_10136978
2511 Ga0075370_10154017
2512 Ga0075370_10521963
2513 Ga0068871_100003989
2514 Ga0075433_10131861
2515 Ga0075433_10263794
2516 Ga0075434_100017973
2517 Ga0068865_100052525
2518 Ga0068865_101583434
2519 Ga0079104_1004078
2520 Ga0099826_10000010
2521 Ga0099826_10000024
2522 Ga0075435_100031259
2523 Ga0105251_10010131
2524 Ga0105251_10027169
2525 Ga0105251_10039647
2526 Ga0105251_10053947
2527 Ga0105244_10095626
2528 Ga0105244_10129506
2529 Ga0105250_10050101
2530 Ga0105250_10051084
2531 Ga0105250_10079808
2532 Ga0105250_10493009
2533 Ga0105240_10063879
2534 Ga0105240_10103920
2535 Ga0105240_10108670
2536 Ga0105240_10407148
2537 Ga0105240_10456788
2538 Ga0105240_10661229
2539 Ga0111539_10009725
2540 Ga0111539_10063652
2541 Ga0105245_10323321
2542 Ga0105245_11159602
2543 Ga0105247_10248107
2544 Ga0114129_10905627
2545 Ga0114129_11391926
2546 Ga0105243_10006860
2547 Ga0105243_10168772
2548 Ga0105243_10233819
2549 Ga0105243_10413272
2550 Ga0105241_10021276
2551 Ga0105241_10177715
2552 Ga0105241_10799341
2553 Ga0105241_12077056
2554 Ga0105242_10702387
2555 Ga0105248_10010314
2556 Ga0105248_10015430
2557 Ga0105248_10091471
2558 Ga0105248_10393633
2559 Ga0105248_10562764
2560 Ga0105248_10930503
2561 Ga0105248_11153309
2562 Ga0105237_10056847
2563 Ga0105237_10137397
2564 Ga0105237_10145717
2565 Ga0105237_11052499
2566 Ga0105238_10003065
2567 Ga0105238_10478980
2568 Ga0105238_10910308
2569 Ga0105238_11215312
2570 Ga0105239_10057421
2571 Ga0105239_10143140
2572 Ga0105239_10325011
2573 Ga0105239_11049668
2574 Ga0105246_10193299
2575 Ga0105246_10212712
2576 Ga0105246_10681807
2577 Ga0157318_1017671
2578 Ga0157325_1002140
2579 Ga0157341_1023988
2580 Ga0157327_1046759
2581 Ga0154012_136784
2582 Ga0157373_10015732
2583 Ga0157371_10036577
2584 Ga0157371_10054196
2585 Ga0157371_10058062
2586 Ga0157370_10062522
2587 Ga0157370_10069903
2588 Ga0157370_10872950
2589 Ga0157369_10078496
2590 Ga0157369_10088073
2591 Ga0157369_10088210
2592 Ga0157369_10093282
2593 Ga0157369_10188597
2594 Ga0157369_10450338
2595 Ga0157374_10000466
2596 Ga0157374_10032559
2597 Ga0157374_10069107
2598 Ga0157374_10130817
2599 Ga0157378_10027087
2600 Ga0157378_10097687
2601 Ga0157378_10140170
2602 Ga0157378_12622117
2603 Ga0163162_10076123
2604 Ga0163162_10086678
2605 Ga0163162_11126646
2606 Ga0163162_11245599
2607 Ga0157372_10023322
2608 Ga0157372_10381065
2609 Ga0157372_11235545
2610 Ga0157375_10099540
2611 Ga0157375_10411520
2612 Ga0157375_10514513
2613 Ga0157375_11027771
2614 Ga0157375_12256222
2615 Ga0163163_10694503
2616 Ga0163163_10812622
2617 Ga0182008_10003186
2618 Ga0182008_10079122
2619 Ga0157376_10069893
2620 Ga0157376_10493710
2621 Ga0157376_11933336
2622 Ga0157376_12048211
2623 Ga0182006_1000240
2624 Ga0182006_1009882
2625 Ga0182006_1041809
2626 Ga0182006_1235790
2627 Ga0182007_10012896
2628 Ga0182007_10021036
2629 Ga0182007_10039882
2630 Ga0182005_1000016
2631 Ga0183361_10015
2632 Ga0184593_113785
2633 Ga0184594_128061
2634 Ga0197907_10133130
2635 Ga0197907_11250558
2636 Ga0206356_10498037
2637 Ga0206356_10847300
2638 Ga0206355_1030836
2639 Ga0206355_1157373
2640 Ga0206355_1331117
2641 Ga0206355_1594134
2642 Ga0206355_1647216
2643 Ga0206351_10165518
2644 Ga0206351_10211974
2645 Ga0206352_11278378
2646 Ga0206350_10425581
2647 Ga0206350_10705675
2648 Ga0206350_11246990
2649 Ga0206354_10086599
2650 Ga0206354_11361223
2651 Ga0206354_11564442
2652 Ga0206353_10280775
2653 Ga0206353_10343767
2654 Ga0206353_11104472
2655 Ga0154015_1522148
2656 Ga0154015_1692537
2657 Ga0213872_10010693
2658 Ga0213872_10047302
2659 Ga0213872_10332396
2660 Ga0224712_10002193
2661 Ga0224712_10060966
2662 Ga0224712_10125668
2663 Ga0247514_106419
2664 Ga0209436_100401
2665 Ga0209784_100052
2666 Ga0209784_103737
2667 Ga0209566_100068
2668 Ga0209566_100801
2669 Ga0209566_102355
2670 Ga0209566_108979
2671 Ga0209674_100087
2672 Ga0209674_100153
2673 Ga0209674_102800
2674 Ga0209674_103913
2675 Ga0209674_105404
2676 Ga0209672_100073
2677 Ga0209672_100276
2678 Ga0209672_100383
2679 Ga0209672_102256
2680 Ga0209672_102285
2681 Ga0209672_116278
2682 Ga0209147_100090
2683 Ga0209147_100093
2684 Ga0209147_102318
2685 Ga0209563_100011
2686 Ga0209563_100373
2687 Ga0209563_100470
2688 Ga0209563_119837
2689 Ga0207427_100807
2690 Ga0209437_103924
2691 Ga0209258_100130
2692 Ga0209258_100140
2693 Ga0209258_102394
2694 Ga0209258_103856
2695 Ga0207425_1000021
2696 Ga0207425_1000845
2697 Ga0207425_1000932
2698 Ga0209646_1000068
2699 Ga0209646_1000119
2700 Ga0209677_100043
2701 Ga0209677_107281
2702 Ga0209148_1000119
2703 Ga0209148_1000140
2704 Ga0209148_1000444
2705 Ga0209148_1001671
2706 Ga0209759_1001723
2707 Ga0209759_1004738
2708 Ga0209759_1008563
2709 Ga0209759_1010191
2710 Ga0209759_1012475
2711 Ga0209759_1014574
2712 Ga0209759_1014581
2713 Ga0209759_1026805
2714 Ga0209129_1000020
2715 Ga0209233_1000173
2716 Ga0209565_1000123
2717 Ga0209565_1001042
2718 Ga0209565_1003095
2719 Ga0209455_1000070
2720 Ga0209455_1000119
2721 Ga0209455_1000125
2722 Ga0209455_1000244
2723 Ga0209455_1001216
2724 Ga0209673_1000040
2725 Ga0209673_1000098
2726 Ga0209673_1004818
2727 Ga0209673_1112596
2728 Ga0209130_1000290
2729 Ga0209130_1002182
2730 Ga0209675_1000117
2731 Ga0209675_1002785
2732 Ga0209025_1000039
2733 Ga0209025_1011110
2734 Ga0209564_1000027
2735 Ga0209564_1000047
2736 Ga0209564_1000121
2737 Ga0209564_1002740
2738 Ga0209564_1006738
2739 Ga0209564_1032951
2740 Ga0209564_1041569
2741 Ga0209758_1000077
2742 Ga0209758_1000322
2743 Ga0209050_1000050
2744 Ga0209050_1002922
2745 Ga0209256_1000054
2746 Ga0209256_1001933
2747 Ga0209256_1002719
2748 Ga0209256_1024911
2749 Ga0209256_1058574
2750 Ga0207426_1000199
2751 Ga0207426_1000802
2752 Ga0207426_1010681
2753 Ga0207426_1047907
2754 Ga0209051_1052723
2755 Ga0209051_1053753
2756 Ga0209257_1000075
2757 Ga0207656_10080640
2758 Ga0207656_10187581
2759 Ga0207696_1020741
2760 Ga0207696_1166247
2761 Ga0207696_1181955
2762 Ga0207655_1000499
2763 Ga0207713_1004623
2764 Ga0207713_1005407
2765 Ga0207713_1023386
2766 Ga0207710_10161546
2767 Ga0207680_10163642
2768 Ga0207680_10716637
2769 Ga0207647_10004870
2770 Ga0207647_10007364
2771 Ga0207647_10104384
2772 Ga0207643_10273624
2773 Ga0207705_10004265
2774 Ga0207705_10011628
2775 Ga0207705_10060061
2776 Ga0207705_10103487
2777 Ga0207705_10122104
2778 Ga0207684_10223837
2779 Ga0207684_10567778
2780 Ga0207654_10002111
2781 Ga0207654_10090331
2782 Ga0207654_10395591
2783 Ga0207654_10496717
2784 Ga0207695_10008376
2785 Ga0207695_10027074
2786 Ga0207695_10035527
2787 Ga0207695_10227793
2788 Ga0207695_10246637
2789 Ga0207695_10269527
2790 Ga0207695_11012665
2791 Ga0207695_11263733
2792 Ga0207671_10004456
2793 Ga0207671_10201201
2794 Ga0207671_10215175
2795 Ga0207660_10011879
2796 Ga0207662_10615472
2797 Ga0207657_10014049
2798 Ga0207657_10030110
2799 Ga0207657_10044711
2800 Ga0207657_10377992
2801 Ga0207649_10000490
2802 Ga0207649_10023804
2803 Ga0207652_10090095
2804 Ga0207652_10434543
2805 Ga0207646_10808223
2806 Ga0207694_10002733
2807 Ga0207694_10045423
2808 Ga0207694_10100374
2809 Ga0207694_10108713
2810 Ga0207650_10291854
2811 Ga0207659_10648536
2812 Ga0207687_10187681
2813 Ga0207687_10444164
2814 Ga0207664_11036144
2815 Ga0207644_10095363
2816 Ga0207644_10560838
2817 Ga0207690_10000040
2818 Ga0207690_10048382
2819 Ga0207690_10182111
2820 Ga0207690_10375638
2821 Ga0207690_10619049
2822 Ga0207690_10823820
2823 Ga0207706_10008025
2824 Ga0207686_10724498
2825 Ga0207709_10001005
2826 Ga0207709_10020009
2827 Ga0207709_10115312
2828 Ga0207704_10176248
2829 Ga0207704_10836131
2830 Ga0207704_11259073
2831 Ga0207711_10057542
2832 Ga0207711_10105192
2833 Ga0207711_10582575
2834 Ga0207711_10745958
2835 Ga0207689_10000370
2836 Ga0207689_10056742
2837 Ga0207689_10943752
2838 Ga0207689_10951974
2839 Ga0207679_10000032
2840 Ga0207679_10108686
2841 Ga0207679_10237693
2842 Ga0207679_11677414
2843 Ga0207667_10006131
2844 Ga0207667_10009212
2845 Ga0207667_10015897
2846 Ga0207667_10128204
2847 Ga0207667_10384789
2848 Ga0207651_10446093
2849 Ga0207651_10469680
2850 Ga0207651_10764166
2851 Ga0207668_11173430
2852 Ga0207640_10001991
2853 Ga0207640_10022226
2854 Ga0207658_10165595
2855 Ga0207658_10257424
2856 Ga0207658_11175935
2857 Ga0207677_10006249
2858 Ga0207703_10041315
2859 Ga0207678_10000024
2860 Ga0207678_10003236
2861 Ga0207678_10043906
2862 Ga0207678_10238626
2863 Ga0207678_10248922
2864 Ga0207678_10381905
2865 Ga0207702_10000973
2866 Ga0207702_10185671
2867 Ga0207641_10789388
2868 Ga0207648_10002176
2869 Ga0207648_10873460
2870 Ga0207676_10231338
2871 Ga0207676_10813761
2872 Ga0207676_11424445
2873 Ga0207674_10003250
2874 Ga0207674_10033169
2875 Ga0207674_10173522
2876 Ga0207675_101338134
2877 Ga0207683_10065088
2878 Ga0207683_10148309
2879 Ga0207683_10228973
2880 Ga0207683_10351656
2881 Ga0207683_10505174
2882 Ga0207698_10017410
2883 Ga0207698_10023299
2884 Ga0207698_10790935
2885 Ga0207698_11334281
2886 Ga0209281_1002282
2887 Ga0209371_1000325
2888 Ga0209371_1000766
2889 Ga0209371_1003600
2890 Ga0209282_1000032
2891 Ga0209282_1000072
2892 Ga0209813_10001024
2893 Ga0209974_10092867
2894 Ga0207428_10008382
2895 Ga0268266_10117830
2896 Ga0268265_10565558
2897 Ga0268265_10897546
2898 Ga0265336_10000618
2899 Ga0307515_10067022
2900 Ga0307515_10084890
2901 Ga0307515_10119204
2902 Ga0307515_10276308
2903 Ga0265338_10004608
2904 Ga0265338_10005463
2905 Ga0265324_10000002
2906 Ga0265324_10000500
2907 Ga0268256_1001275
2908 Ga0268256_1002981
2909 Ga0307512_10116329
2910 Ga0316176_1210209
2911 Ga0314311_1150818
2912 Ga0316179_1017842
2913 Ga0316178_1040944
2914 Ga0316180_1026989
2915 Ga0316183_1084783
2916 Ga0316181_1091528
2917 Ga0316182_1108504
2918 Ga0316182_1184435
2919 Ga0316182_1433823
2920 Ga0265767_100009
2921 Ga0265766_1000099
2922 Ga0265766_1000407
2923 Ga0265766_1000435
2924 Ga0265766_1000731
2925 Ga0265766_1003268
2926 Ga0265769_100464
2927 Ga0265769_100729
2928 Ga0265769_102846
2929 Ga0265769_113786
2930 Ga0265768_100424
2931 Ga0265773_1008002
2932 Ga0265328_10003595
2933 Ga0265331_10000050
2934 Ga0265331_10003466
2935 Ga0265327_10000109
2936 Ga0265327_10000161
2937 Ga0265327_10000178
2938 Ga0265327_10009306
2939 Ga0265327_10028075
2940 Ga0265327_10098857
2941 Ga0265316_10067921
2942 Ga0265316_10182264
2943 Ga0265316_10503563
2944 Ga0307513_10011808
2945 Ga0307513_10124367
2946 Ga0307513_10769558
2947 Ga0307509_10109747
2948 Ga0307509_10192810
2949 Ga0307509_10286613
2950 Ga0307408_100000089
2951 Ga0307408_100001167
2952 Ga0307408_100004683
2953 Ga0307408_100292357
2954 Ga0307408_100297420
2955 Ga0307408_100477718
2956 Ga0307408_100820655
2957 Ga0316575_10000771
2958 Ga0316575_10038338
2959 Ga0310111_101033
2960 Ga0310111_122416
2961 Ga0316579_10026608
2962 Ga0265314_10158374
2963 Ga0316576_10029129
2964 Ga0316578_10033675
2965 Ga0307516_10583188
2966 Ga0307405_10052007
2967 Ga0307405_10394290
2968 Ga0307405_10964520
2969 Ga0316577_10146540
2970 Ga0247548_101784
2971 Ga0247548_107337
2972 Ga0307518_10004256
2973 Ga0307410_10632467
2974 Ga0307406_10400159
2975 Ga0307406_10504504
2976 Ga0307407_10777831
2977 Ga0307412_10000056
2978 Ga0307412_10011111
2979 Ga0307412_10507816
2980 Ga0307416_100002061
2981 Ga0307416_100003624
2982 Ga0307416_100006305
2983 Ga0307416_100212411
2984 Ga0307411_10233740
2985 Ga0307411_10411105
2986 Ga0307411_10487888
2987 Ga0307411_10724848
2988 Ga0307411_10836349
2989 Ga0307411_11073839
2990 Ga0307415_101279947
2991 Ga0316583_10196422
2992 Ga0316580_10001102
2993 Ga0316593_10000198
2994 Ga0316593_10193303
2995 Ga0316593_10223821
2996 Ga0307507_10149043
2997 Ga0307510_10228403
2998 Ga0316592_1001786
2999 Ga0316596_1000040
3000 Ga0373950_0017579
3001 Ga0373940_0012763
3002 Ga0373940_0097521
3003 Ga0373932_0048427
3004 Ga0373939_0000348
3005 Ga0373960_0000482
3006 Ga0373961_0059684
3007 Ga0373962_0035579
3008 Ga0316574_0003365
3009 Ga0373931_0000535
3010 Ga0373931_0008660
3011 Ga0373931_0861160
3012 Ga0373947_0765701
3013 Ga0310112_026650
3014 Ga0310109_000061
3015 Ga0310110_014822
3016 Ga0395899_0000080
3017 Ga0395899_0000218
3018 Ga0395899_0005268
3019 Ga0395899_0079277
3020 Ga0395899_0462873
3021 Ga0395900_0000087
3022 Ga0395900_0103484
3023 Ga0395900_0104724
3024 Ga0395900_0682800
3025 Ga0395900_0699378
3026 Ga0395900_1333168
3027 Ga0395900_1707164
3028 Ga0395898_0000448
3029 Ga0395898_0004701
3030 Ga0395898_0091559
3031 Ga0395898_0139979
3032 Ga0395898_1142440
3033 Ga0395898_1218083
3034 Ga0395905_0001371
3035 Ga0395905_0002507
3036 Ga0395905_0097862
3037 Ga0395905_0173708
3038 Ga0395905_0177460
3039 Ga0395901_0000378
3040 Ga0395901_0062325
3041 Ga0395901_0207707
3042 Ga0395901_0565724
3043 Ga0395901_0798512
3044 Ga0395901_1105207
3045 Ga0395901_1341045
3046 Ga0400490_00437
3047 Ga0400490_03371
3048 Ga0400490_46672
3049 Ga0400491_08907
3050 Ga0400488_51157
3051 Ga0400486_01341
3052 Ga0400486_03874
3053 Ga0400486_32640
3054 Ga0400483_035353
3055 Ga0400483_062435
3056 Ga0400483_071897
3057 Ga0400483_074535
3058 Ga0400483_080413
3059 Ga0400483_131418
3060 Ga0400483_159229
3061 Ga0400483_205660
3062 Ga0400489_88546
3063 Ga0436365_1248808
3064 Ga0436360_0476119
3065 Ga0436361_0141197
3066 Ga0436361_0378504
3067 Ga0436361_0575526
3068 Ga0436361_0830526
3069 Ga0439436_0003093
3070 Ga0439436_0101864
3071 Ga0439439_0027171
3072 Ga0439439_0087288
3073 Ga0439439_0245793
3074 Ga0439447_063185
3075 Ga0439453_0009071
3076 Ga0439466_0050203
3077 Ga0439465_0010238
3078 Ga0439465_0042679
3079 Ga0439465_0098774
3080 Ga0451791_0429238
3081 Ga0451805_077998
3082 Ga0451805_100255
3083 Ga0451835_1143204
3084 Ga0451841_0463776
3085 Ga0451850_01102
3086 Ga0451850_20986
3087 Ga0451853_0562209
3088 Ga0452271_59633
3089 Ga0439431_0002191
3090 Ga0439433_0000255
3091 Ga0439437_001479
3092 Ga0439442_017115
3093 Ga0439442_047946
3094 Ga0439445_0003892
3095 Ga0439448_0000118
3096 Ga0439448_0036301
3097 Ga0439448_0044502
3098 Ga0439448_0095964
3099 Ga0439432_001484
3100 Ga0439449_0008668
3101 Ga0439449_0013168
3102 Ga0439449_0098851
3103 Ga0439452_030522
3104 Ga0439452_091319
3105 Ga0439454_011850
3106 Ga0439454_022677
3107 Ga0439455_0000425
3108 Ga0439455_0026675
3109 Ga0439455_0035150
3110 Ga0439457_010422
3111 Ga0450911_004506
3112 Ga0450917_000001
3113 Ga0450920_039592
3114 Ga0450923_056631
3115 Ga0450888_000936
3116 Ga0450890_000549
3117 Ga0450890_001085
3118 Ga0450897_002592
3119 Ga0450891_000655
3120 Ga0450892_001248
3121 Ga0450898_043606
3122 Ga0450902_024020
3123 Ga0450904_002765
3124 Ga0450904_008721
3125 Ga0450889_000161
3126 Ga0450907_011958
3127 Ga0450910_017596
3128 Ga0439446_0029603
3129 Ga0439446_0048229
3130 Ga0439446_0056828
3131 Ga0439458_0009491
3132 Ga0450909_012865
3133 Ga0450916_001782
3134 Ga0450893_0002428
3135 Ga0450893_0016245
3136 Ga0450901_013383
3137 Ga0451577_0000013
3138 Ga0451577_0000191
3139 Ga0451577_0056781
3140 Ga0451577_0128321
3141 Ga0451577_0218523
3142 Ga0451577_0283539
3143 Ga0451577_0286581
3144 Ga0466969_0001722
3145 Ga0466969_0004256
3146 Ga0466969_0010770
3147 Ga0466969_0011638
3148 Ga0466969_0131244
3149 Ga0466972_0060383
3150 Ga0466972_0095863
3151 Ga0466972_0154934
3152 Ga0466972_0202782
3153 Ga0466973_0049331
3154 Ga0466981_0147961
3155 Ga0453683_0000059
3156 Ga0466965_0001145
3157 Ga0466965_0015818
3158 Ga0466965_0063634
3159 Ga0466965_0071942
3160 Ga0466965_0221193
3161 Ga0466965_0321709
3162 Ga0466965_0321710
3163 Ga0466966_0003725
3164 Ga0466966_0059810
3165 Ga0466966_0062883
3166 Ga0466966_0062980
3167 Ga0466966_0067908
3168 Ga0466966_0093495
3169 Ga0466961_0000296
3170 Ga0466961_0000649
3171 Ga0466961_0036745
3172 Ga0466961_0053995
3173 Ga0466961_0072863
3174 Ga0466961_0117187
3175 Ga0466961_0118072
3176 Ga0466961_0335951
3177 Ga0466961_0391601
3178 Ga0466961_0800640
3179 Ga0466963_0047825
3180 Ga0466963_0662781
3181 Ga0466964_0015332
3182 Ga0466964_0020973
3183 Ga0466964_0105381
3184 Ga0453684_0000585
3185 Ga0453684_0000590
3186 Ga0453684_0000989
3187 Ga0453684_0035225
3188 Ga0453684_0065104
3189 Ga0453684_0239607
3190 Ga0453684_0317486
3191 Ga0453684_0456100
3192 Ga0453684_0860212
3193 Ga0453684_1755614
3194 Ga0466971_0000181
3195 Ga0466971_0035698
3196 Ga0466971_0136841
3197 Ga0466968_0242976
3198 Ga0466968_0272311
3199 Ga0466968_0282713
3200 Ga0466970_0002988
3201 Ga0466970_0015188
3202 Ga0466970_0070556
3203 Ga0466970_0178995
3204 Ga0466957_0002562
3205 Ga0466957_0014461
3206 Ga0466957_0019611
3207 Ga0466957_0027993
3208 Ga0466957_0096700
3209 Ga0466957_0197429
3210 Ga0466957_0218243
3211 Ga0466957_0379455
3212 Ga0466959_0000926
3213 Ga0466959_0005512
3214 Ga0466959_0007380
3215 Ga0466959_0071231
3216 Ga0466959_0265929
3217 Ga0451576_0000013
3218 Ga0451576_0000018
3219 Ga0451576_0005877
3220 Ga0451576_0010036
3221 Ga0451576_0025038
3222 Ga0451576_0100286
3223 Ga0451576_0193652
3224 Ga0451576_0280918
3225 Ga0451576_0999273
3226 Ga0466958_0001887
3227 Ga0466958_0019865
3228 Ga0466958_0060303
3229 Ga0466958_0065480
3230 Ga0466958_0159333
3231 Ga0466967_0187281
3232 Ga0466967_0545245
3233 Ga0466967_0746643
3234 Ga0495617_000397
3235 Ga0495617_000636
3236 Ga0495617_000830
3237 Ga0495617_007711
3238 Ga0495617_009077
3239 Ga0495617_107059
3240 Ga0495627_004713
3241 Ga0495627_008079
3242 Ga0495592_0100631
3243 Ga0495592_0205027
3244 Ga0495603_0001612
3245 Ga0495603_0009392
3246 Ga0495603_0021343
3247 Ga0495603_0036844
3248 Ga0495603_0121153
3249 Ga0495603_0344095
3250 Ga0495603_0365634
3251 Ga0495590_0000020
3252 Ga0495590_0000632
3253 Ga0495590_0001551
3254 Ga0495590_0006208
3255 Ga0495590_0018240
3256 Ga0495590_0035656
3257 Ga0495590_0084356
3258 Ga0495590_0407092
3259 Ga0495591_010774
3260 Ga0495629_0008019
3261 Ga0495629_0015926
3262 Ga0495629_0143741
3263 Ga0495629_0185132
3264 Ga0495629_0248372
3265 Ga0495629_0919744
3266 Ga0495638_0000235
3267 Ga0495638_0010507
3268 Ga0495638_0016045
3269 Ga0495638_0058891
3270 Ga0495638_0066492
3271 Ga0495638_0127888
3272 Ga0495638_0138245
3273 Ga0495638_0143356
3274 Ga0495638_0175482
3275 Ga0495638_0192509
3276 Ga0495641_0049296
3277 Ga0495653_0000067
3278 Ga0495653_0004702
3279 Ga0495653_0030611
3280 Ga0495653_0071030
3281 Ga0495653_0091071
3282 Ga0495653_0300755
3283 Ga0495650_0000200
3284 Ga0495650_0000436
3285 Ga0495650_0001809
3286 Ga0495650_0007290
3287 Ga0495650_0017593
3288 Ga0495650_0020204
3289 Ga0495650_0023276
3290 Ga0495650_0025873
3291 Ga0495650_0028055
3292 Ga0495650_0046362
3293 Ga0495650_0086014
3294 Ga0495580_0006554
3295 Ga0495580_0016805
3296 Ga0495580_0020632
3297 Ga0495580_0130646
3298 Ga0495580_0295525
3299 Ga0495580_0716936
3300 Ga0495582_0005108
3301 Ga0495582_0014415
3302 Ga0495582_0033837
3303 Ga0495582_0181417
3304 Ga0495582_0545605
3305 Ga0495605_0000061
3306 Ga0495605_0001735
3307 Ga0495605_0005449
3308 Ga0495605_0009198
3309 Ga0495605_0010393
3310 Ga0495605_0012129
3311 Ga0495605_0013819
3312 Ga0495605_0014824
3313 Ga0495605_0017339
3314 Ga0495605_0066496
3315 Ga0495605_0085995
3316 Ga0495605_0125990
3317 Ga0495605_0272644
3318 Ga0495639_0038910
3319 Ga0495639_0088103
3320 Ga0495639_0088932
3321 Ga0495639_0150524
3322 Ga0495662_0024098
3323 Ga0495662_0180757
3324 Ga0495664_0006673
3325 Ga0495664_0069337
3326 Ga0495664_0072529
3327 Ga0495664_0095229
3328 Ga0495664_0097358
3329 Ga0495664_0250066
3330 Ga0495584_0000636
3331 Ga0495584_0002002
3332 Ga0495584_0011799
3333 Ga0495584_0012155
3334 Ga0495584_0021670
3335 Ga0495584_0032055
3336 Ga0495584_0033893
3337 Ga0495584_0144920
3338 Ga0495584_0190186
3339 Ga0495584_0201597
3340 Ga0495585_0000497
3341 Ga0495585_0006666
3342 Ga0495585_0037607
3343 Ga0495585_0040726
3344 Ga0495585_0041550
3345 Ga0495585_0050808
3346 Ga0495585_0053985
3347 Ga0495585_0057251
3348 Ga0495585_0067131
3349 Ga0495594_0010435
3350 Ga0495594_0017612
3351 Ga0495594_0034748
3352 Ga0495594_0073377
3353 Ga0495594_0125027
3354 Ga0495594_0244040
3355 Ga0495596_0001745
3356 Ga0495596_0001963
3357 Ga0495596_0020643
3358 Ga0495596_0142796
3359 Ga0495596_0165675
3360 Ga0495596_0199960
3361 Ga0495596_0254795
3362 Ga0495607_0009755
3363 Ga0495607_0017761
3364 Ga0495607_0021914
3365 Ga0495607_0038368
3366 Ga0495607_0042397
3367 Ga0495607_0059953
3368 Ga0495607_0062866
3369 Ga0495607_0063124
3370 Ga0495607_0100890
3371 Ga0495607_0103502
3372 Ga0495607_0159222
3373 Ga0495607_0318419
3374 Ga0495607_0319723
3375 Ga0495583_0000317
3376 Ga0495583_0002046
3377 Ga0495583_0004594
3378 Ga0495583_0004815
3379 Ga0495583_0011949
3380 Ga0495583_0016574
3381 Ga0495583_0018545
3382 Ga0495583_0019465
3383 Ga0495583_0094359
3384 Ga0495606_0009877
3385 Ga0495606_0031882
3386 Ga0495606_0035311
3387 Ga0495606_0035595
3388 Ga0495606_0037967
3389 Ga0495606_0048233
3390 Ga0495606_0054164
3391 Ga0495606_0064595
3392 Ga0495606_0066613
3393 Ga0495606_0070973
3394 Ga0495606_0080050
3395 Ga0495606_0085615
3396 Ga0495606_0109571
3397 Ga0495606_0147485
3398 Ga0495608_0188850
3399 Ga0495608_0308495
3400 Ga0495610_0000017
3401 Ga0495610_0065030
3402 Ga0495610_0125032
3403 Ga0495616_0003800
3404 Ga0495616_0011842
3405 Ga0495616_0034996
3406 Ga0495616_0072460
3407 Ga0495616_0086533
3408 Ga0495616_0102252
3409 Ga0495616_0111084
3410 Ga0495616_0117328
3411 Ga0495616_0119592
3412 Ga0495616_0163239
3413 Ga0495616_0390385
3414 Ga0495618_0018095
3415 Ga0495618_0138514
3416 Ga0495618_0469722
3417 Ga0495620_0001543
3418 Ga0495620_0014491
3419 Ga0495620_0053647
3420 Ga0495628_0006292
3421 Ga0495628_0069084
3422 Ga0495628_0075933
3423 Ga0495628_0079554
3424 Ga0495628_0109587
3425 Ga0495628_0205693
3426 Ga0495630_0038355
3427 Ga0495630_0100382
3428 Ga0495630_0109243
3429 Ga0495630_0134360
3430 Ga0495630_0207757
3431 Ga0495631_0011063
3432 Ga0495631_0011843
3433 Ga0495631_0019480
3434 Ga0495631_0030651
3435 Ga0495631_0161756
3436 Ga0495632_0016465
3437 Ga0495632_0026864
3438 Ga0495632_0089406
3439 Ga0495632_0096913
3440 Ga0495632_0172654
3441 Ga0495637_0000053
3442 Ga0495637_0002190
3443 Ga0495637_0011543
3444 Ga0495637_0012032
3445 Ga0495637_0056898
3446 Ga0495643_0012013
3447 Ga0495643_0014375
3448 Ga0495643_0019530
3449 Ga0495643_0026159
3450 Ga0495643_0040991
3451 Ga0495643_0044520
3452 Ga0495643_0048287
3453 Ga0495643_0054593
3454 Ga0495643_0104068
3455 Ga0495644_0003110
3456 Ga0495644_0013221
3457 Ga0495644_0019769
3458 Ga0495644_0053726
3459 Ga0495644_0075233
3460 Ga0495644_0218639
3461 Ga0495648_0003167
3462 Ga0495648_0015922
3463 Ga0495648_0025782
3464 Ga0495648_0026850
3465 Ga0495648_0044310
3466 Ga0495648_0046480
3467 Ga0495648_0056197
3468 Ga0495648_0087678
3469 Ga0495648_0098552
3470 Ga0495648_0100591
3471 Ga0495648_0120126
3472 Ga0495648_0150736
3473 Ga0495648_0155108
3474 Ga0495648_0209849
3475 Ga0495648_0320024
3476 Ga0495663_0006063
3477 Ga0495663_0008461
3478 Ga0495663_0012604
3479 Ga0495663_0017530
3480 Ga0495663_0065824
3481 Ga0495663_0124763
3482 Ga0495666_0002416
3483 Ga0495666_0040638
3484 Ga0495666_0049585
3485 Ga0495666_0098357
3486 Ga0495666_0105624
3487 Ga0495666_0115943
3488 Ga0495666_0162411
3489 Ga0495666_0287216
3490 Ga0495666_0391822
3491 Ga0495666_0446510
3492 Ga0495642_0005824
3493 Ga0495642_0007577
3494 Ga0495642_0008349
3495 Ga0495642_0019574
3496 Ga0495642_0026738
3497 Ga0495642_0030583
3498 Ga0495642_0048741
3499 Ga0495642_0056434
3500 Ga0495642_0075423
3501 Ga0495642_0079432
3502 Ga0495642_0168073
3503 Ga0495642_0213337
3504 Ga0495642_0231611
3505 Ga0495652_0035356
3506 Ga0495652_0115773
3507 Ga0495652_0146004
3508 Ga0495652_0151599
3509 Ga0495654_0000060
3510 Ga0495654_0030668
3511 Ga0495654_0109550
3512 Ga0495654_0176808
3513 Ga0495654_0191212
3514 Ga0495654_0247759
3515 Ga0495665_0008466
3516 Ga0495665_0018585
3517 Ga0495665_0031045
3518 Ga0495665_0034628
3519 Ga0495665_0057876
3520 Ga0495665_0069907
3521 Ga0495665_0091889
3522 Ga0495665_0221276
3523 Ga0495640_0041811
3524 Ga0495640_0475601
3525 Ga0495586_0008133
3526 Ga0495586_0018161
3527 Ga0495586_0051587
3528 Ga0495586_0070537
3529 Ga0495586_0072077
3530 Ga0495586_0106892
3531 Ga0495587_0007790
3532 Ga0495587_0037993
3533 Ga0495587_0086906
3534 Ga0495587_0263774
3535 Ga0495587_0427665
3536 Ga0495598_0027767
3537 Ga0495609_0000007
3538 Ga0495609_0000666
3539 Ga0495609_0033507
3540 Ga0495609_0046714
3541 Ga0495609_0084127
3542 Ga0495609_0085504
3543 Ga0495609_0164311
3544 Ga0495609_0211129
3545 Ga0495621_0161107
3546 Ga0495621_0161323
3547 Ga0495621_0351269
3548 Ga0495597_0007533
3549 Ga0495597_0007961
3550 Ga0495597_0014198
3551 Ga0495597_0022360
3552 Ga0495597_0023086
3553 Ga0495597_0073396
3554 Ga0495597_0073428
3555 Ga0495597_0079026
3556 Ga0495597_0125983
3557 Ga0495597_0185257
3558 Ga0495597_0232401
3559 Ga0495597_0323992
3560 Ga0495645_0009368
3561 Ga0495645_0061503
3562 Ga0495645_0102644
3563 Ga0495645_0450145
3564 Ga0495622_0002163
3565 Ga0495622_0012942
3566 Ga0495622_0014615
3567 Ga0495622_0031049
3568 Ga0495622_0031817
3569 Ga0495622_0035080
3570 Ga0495622_0041092
3571 Ga0495622_0110653
3572 Ga0495622_0192080
3573 Ga0495622_0207613
3574 Ga0495633_0006566
3575 Ga0495633_0023121
3576 Ga0495633_0025281
3577 Ga0495633_0036777
3578 Ga0495633_0062271
3579 Ga0495633_0068032
3580 Ga0495633_0097194
3581 Ga0495633_0160994
3582 Ga0495633_0171885
3583 Ga0495633_0175653
3584 Ga0495667_0043286
3585 Ga0495667_0151288
3586 Ga0495667_0555975
3587 Ga0495656_0010416
3588 Ga0495656_0081304
3589 Ga0495656_0084934
3590 Ga0495656_0099696
3591 Ga0495656_0169174
3592 Ga0495656_0267756
3593 Ga0495668_0002640
3594 Ga0495668_0005163
3595 Ga0495668_0008733
3596 Ga0495668_0011342
3597 Ga0495668_0011816
3598 Ga0495668_0018916
3599 Ga0495668_0029452
3600 Ga0495668_0051941
3601 Ga0495668_0103355
3602 Ga0495668_0120245
3603 Ga0495668_0162205
3604 Ga0495668_0311153
3605 Ga0495668_0337344
3606 Ga0495668_0395203
3607 Ga0495634_0045859
3608 Ga0495634_0121713
3609 Ga0495634_0202784
3610 Ga0495634_0211208
3611 Ga0495611_0001662
3612 Ga0495611_0002069
3613 Ga0495611_0005909
3614 Ga0495611_0011874
3615 Ga0495611_0093136
3616 Ga0495611_0182449
3617 Ga0495611_0248659
3618 Ga0495625_0011213
3619 Ga0495625_0033151
3620 Ga0495625_0034116
3621 Ga0495625_0047734
3622 Ga0495625_0087655
3623 Ga0495625_0166164
3624 Ga0495625_0167010
3625 Ga0495625_0190370
3626 Ga0495625_0199527
3627 Ga0495625_0208462
3628 Ga0495625_0265594
3629 Ga0495635_0008977
3630 Ga0495635_0078555
3631 Ga0495635_0142420
3632 Ga0495635_0200952
3633 Ga0495659_0003686
3634 Ga0495659_0004277
3635 Ga0495659_0007839
3636 Ga0495659_0025538
3637 Ga0495659_0079281
3638 Ga0495659_0093802
3639 Ga0495659_0149661
3640 Ga0495659_0558240
3641 Ga0495661_0019060
3642 Ga0495661_0022315
3643 Ga0495661_0027641
3644 Ga0495661_0036532
3645 Ga0495661_0042541
3646 Ga0495661_0062587
3647 Ga0495661_0089042
3648 Ga0495661_0119891
3649 Ga0495661_0148229
3650 Ga0495661_0188840
3651 Ga0495661_0219532
3652 Ga0495661_0293686
3653 Ga0495661_0298181
3654 Ga0495661_0421205
3655 Ga0495588_0009027
3656 Ga0495588_0011149
3657 Ga0495588_0017870
3658 Ga0495588_0018679
3659 Ga0495588_0040525
3660 Ga0495588_0046528
3661 Ga0495588_0050054
3662 Ga0495588_0230874
3663 Ga0495657_0727578
3664 Ga0495657_0736393
3665 Ga0495599_0052585
3666 Ga0495599_0060094
3667 Ga0495599_0204471
3668 Ga0495599_0222351
3669 Ga0495623_0031929
3670 Ga0495623_0100910
3671 Ga0495623_0118836
3672 Ga0495623_0154907
3673 Ga0495623_0164039
3674 Ga0495623_0164428
3675 Ga0495623_0175824
3676 Ga0495623_0178944
3677 Ga0495646_0038676
3678 Ga0495646_0043675
3679 Ga0495646_0054683
3680 Ga0495646_0076384
3681 Ga0495646_0154791
3682 Ga0495646_0158928
3683 Ga0495646_0405134
3684 Ga0495658_0114704
3685 Ga0495658_0283936
3686 Ga0495658_0289894
3687 Ga0495658_0558190
3688 Ga0495669_0001596
3689 Ga0495669_0002717
3690 Ga0495669_0031367
3691 Ga0495669_0041852
3692 Ga0495669_0086878
3693 Ga0495669_0116277
3694 Ga0495669_0350587
3695 Ga0495613_0072609
3696 Ga0495613_0082016
3697 Ga0495613_0092389
3698 Ga0495613_0130385
3699 Ga0495613_0226145
3700 Ga0495613_0566434
3701 Ga0495624_0020482
3702 Ga0495624_0039682
3703 Ga0495624_0053509
3704 Ga0495624_0069830
3705 Ga0495624_0097562
3706 Ga0495624_0149960
3707 Ga0495624_0499649
3708 Ga0495624_0599869
3709 Ga0495670_0009867
3710 Ga0495670_0028896
3711 Ga0495670_0035188
3712 Ga0495670_0067273
3713 Ga0495670_0102977
3714 Ga0495670_0119876
3715 Ga0495670_0150687
3716 Ga0495670_0166291
3717 Ga0495670_0320214
3718 Ga0495671_0000037
3719 Ga0495671_0005005
3720 Ga0495671_0012352
3721 Ga0495671_0014262
3722 Ga0495671_0387612
3723 Ga0495671_0457852
3724 Ga0495649_0007567
3725 Ga0495649_0041099
3726 Ga0495649_0055982
3727 Ga0495649_0064779
3728 Ga0495649_0088148
3729 Ga0495649_0129516
3730 Ga0495649_0136805
3731 Ga0495649_0140298
3732 Ga0495649_0152737
3733 Ga0495649_0226406
3734 Ga0495649_0246537
3735 Ga0495589_0016595
3736 Ga0495589_0021019
3737 Ga0495589_0056788
3738 Ga0495589_0063428
3739 Ga0495589_0074703
3740 Ga0495589_0140971
3741 Ga0495589_0157145
3742 Ga0495589_0232418
3743 Ga0495589_0312150
3744 Ga0495600_0004009
3745 Ga0495600_0039828
3746 Ga0495600_0178346
3747 Ga0495600_0185571
3748 Ga0495600_0198806
3749 Ga0495600_0493571
3750 Ga0495660_0010186
3751 Ga0495660_0011018
3752 Ga0495660_0012969
3753 Ga0495660_0015683
3754 Ga0495660_0034744
3755 Ga0495660_0048108
3756 Ga0495660_0051977
3757 Ga0495660_0065924
3758 Ga0495660_0084002
3759 Ga0495660_0116780
3760 Ga0495660_0119454
3761 Ga0495660_0174053
3762 Ga0495660_0208048
3763 Ga0495660_0285985
3764 Ga0495581_0003269
3765 Ga0495581_0011615
3766 Ga0495581_0027016
3767 Ga0495581_0040802
3768 Ga0495581_0078701
3769 Ga0495581_0157473
3770 Ga0495581_0176605
3771 Ga0495604_0003421
3772 Ga0495604_0010804
3773 Ga0495604_0048599
3774 Ga0495604_0096566
3775 Ga0495604_0126319
3776 Ga0495604_0290778
3777 Ga0495604_0433131
3778 Ga0495636_0001434
3779 Ga0495636_0003890
3780 Ga0495636_0006133
3781 Ga0495636_0006316
3782 Ga0495636_0018170
3783 Ga0495636_0040864
3784 Ga0495636_0106143
3785 Ga0495636_0259312
3786 Ga0495636_0337773
3787 Ga0495674_0013576
3788 Ga0495674_0022526
3789 Ga0495674_0031660
3790 Ga0495674_0046418
3791 Ga0495674_0055008
3792 Ga0495674_0102840
3793 Ga0495674_0280785
3794 Ga0495672_0000013
3795 Ga0495672_0000157
3796 Ga0495672_0007686
3797 Ga0495672_0015499
3798 Ga0495672_0029479
3799 Ga0495672_0031965
3800 Ga0495672_0033248
3801 Ga0495672_0035691
3802 Ga0495672_0045766
3803 Ga0495672_0119798
3804 Ga0495672_0161124
3805 Ga0495672_0357737
3806 Ga0495676_0010234
3807 Ga0495676_0024323
3808 Ga0495676_0026376
3809 Ga0495676_0067455
3810 Ga0495676_0077394
3811 Ga0495676_0098301
3812 Ga0495676_0113267
3813 Ga0495676_0120830
3814 Ga0495676_0275944
3815 Ga0495680_0007818
3816 Ga0495680_0074468
3817 Ga0495680_0100796
3818 Ga0495680_0134396
3819 Ga0495680_0186233
3820 Ga0495680_0232979
3821 Ga0495680_0250054
3822 Ga0495680_0404052
3823 Ga0495680_1032052
3824 Ga0495683_0001129
3825 Ga0495683_0017957
3826 Ga0495683_0022066
3827 Ga0495683_0023372
3828 Ga0495683_0032766
3829 Ga0495683_0033028
3830 Ga0495683_0044638
3831 Ga0495683_0049847
3832 Ga0495683_0059991
3833 Ga0495683_0070031
3834 Ga0495683_0093261
3835 Ga0495683_0188735
3836 Ga0495683_0275552
3837 Ga0495687_000216
3838 Ga0495687_000342
3839 Ga0495687_001562
3840 Ga0495687_002921
3841 Ga0495687_007470
3842 Ga0495687_013991
3843 Ga0495687_027846
3844 Ga0495687_062464
3845 Ga0495687_084824
3846 Ga0495687_095851
3847 Ga0495687_171650
3848 Ga0495675_0013567
3849 Ga0495675_0021158
3850 Ga0495675_0053131
3851 Ga0495675_0072252
3852 Ga0495675_0098979
3853 Ga0495675_0191731
3854 Ga0495677_0001866
3855 Ga0495677_0005942
3856 Ga0495677_0008079
3857 Ga0495677_0009137
3858 Ga0495677_0015597
3859 Ga0495677_0044661
3860 Ga0495677_0109477
3861 Ga0495677_0176898
3862 Ga0495677_0275635
3863 Ga0495677_0289370
3864 Ga0495679_008349
3865 Ga0495679_012257
3866 Ga0495679_017521
3867 Ga0495679_017686
3868 Ga0495679_023106
3869 Ga0495679_041737
3870 Ga0495685_000291
3871 Ga0495685_001965
3872 Ga0495685_014389
3873 Ga0495685_019727
3874 Ga0495685_034014
3875 Ga0495685_071378
3876 Ga0495685_079079
3877 Ga0495685_108989
3878 Ga0495685_138553
3879 Ga0495673_0000248
3880 Ga0495673_0019105
3881 Ga0495673_0030733
3882 Ga0495673_0067504
3883 Ga0495673_0078261
3884 Ga0495673_0132106
3885 Ga0495673_0310455
3886 Ga0495681_0009083
3887 Ga0495681_0010756
3888 Ga0495681_0011744
3889 Ga0495681_0021475
3890 Ga0495681_0043390
3891 Ga0495681_0046827
3892 Ga0495681_0086167
3893 Ga0495681_0126902
3894 Ga0495681_0249667
3895 Ga0495681_0271015
3896 Ga0495684_0068039
3897 Ga0495686_0000214
3898 Ga0495686_0000787
3899 Ga0495686_0001126
3900 Ga0495686_0007683
3901 Ga0495686_0010875
3902 Ga0495686_0057869
3903 Ga0495686_0189431
3904 Ga0495686_0290820
3905 Ga0495686_0391768
3906 Ga0495686_0458937
3907 Ga0495686_0584168
3908 Ga0495593_0002955
3909 Ga0495593_0015413
3910 Ga0495593_0018189
3911 Ga0495593_0036990
3912 Ga0495593_0185141
3913 Ga0495593_0466381
3914 Ga0495602_0036361
3915 Ga0495602_0051607
3916 Ga0495602_0075551
3917 Ga0495602_0313649
3918 Ga0495602_0783218
3919 Ga0495614_0048811
3920 Ga0495614_0048818
3921 Ga0495614_0056437
3922 Ga0495614_0320971
3923 Ga0495615_0013648
3924 Ga0495615_0100569
3925 Ga0495626_0000227
3926 Ga0495626_0010154
3927 Ga0495626_0021350
3928 Ga0495626_0022785
3929 Ga0495626_0040841
3930 Ga0495626_0044118
3931 Ga0495626_0055982
3932 Ga0495626_0060164
3933 Ga0495626_0073481
3934 Ga0495626_0073528
3935 Ga0495626_0083647
3936 Ga0495626_0084714
3937 Ga0495626_0096000
3938 Ga0495626_0097284
3939 Ga0495626_0126416
3940 Ga0495626_0202562
3941 Ga0495626_0212790
3942 Ga0495626_0290644
3943 Ga0496100_0067106
3944 Ga0496100_0111532
3945 Ga0496100_0114800
3946 Ga0496100_0275250
3947 Ga0496100_0294264
3948 Ga0496100_0641645
3949 Ga0496101_0009727
3950 Ga0496101_0046173
3951 Ga0496101_0211964
3952 Ga0496101_0560311
3953 Ga0496101_0907796
3954 Ga0496101_1140934
3955 Ga0496102_0006537
3956 Ga0496102_0039654
3957 Ga0496102_0075112
3958 Ga0496102_0092053
3959 Ga0496102_0197397
3960 Ga0496102_0214439
3961 Ga0496102_0413289
3962 Ga0496102_1758156
3963 Ga0496103_0003318
3964 Ga0496103_0017021
3965 Ga0496103_0032288
3966 Ga0496103_0038283
3967 Ga0496103_0155309
3968 Ga0496103_0210497
3969 Ga0496103_0343097
3970 Ga0496103_0426401
3971 Ga0496104_0018044
3972 Ga0496104_0336166
3973 Ga0496104_0505298
3974 Ga0496104_0651804
3975 Ga0496104_0807072
3976 Ga0496104_1163973
3977 Ga0496105_0035800
3978 Ga0496105_0223701
3979 Ga0496105_0350800
3980 Ga0496106_0006711
3981 Ga0496106_0036102
3982 Ga0496106_0042023
3983 Ga0496106_0171980
3984 Ga0496106_0691124
3985 Ga0496107_0069085
3986 Ga0496107_0088073
3987 Ga0496107_0160774
3988 Ga0496107_0222414
3989 Ga0496107_0848596
3990 Ga0496108_0409678
3991 Ga0496108_1331530
3992 Ga0496109_0042732
3993 Ga0496109_0548480
3994 Ga0496110_0032653
3995 Ga0496110_0294723
3996 Ga0496110_0456356
3997 Ga0496110_0457031
3998 Ga0496110_0794302
3999 Ga0496110_1205357
4000 Ga0496110_1261699
4001 Ga0496111_0013924
4002 Ga0496111_0408873
4003 Ga0496111_0830563
4004 Ga0496112_0014789
4005 Ga0496112_0196015
4006 Ga0496112_0529748
4007 Ga0496113_0023586
4008 Ga0496113_0027568
4009 Ga0496113_0173984
4010 Ga0496113_0274888
4011 Ga0496113_0476254
4012 Ga0496113_0757937
4013 Ga0496114_0018505
4014 Ga0496114_0091484
4015 Ga0496114_0372797
4016 Ga0496114_0845291
4017 Ga0496115_0040092
4018 Ga0496115_0062017
4019 Ga0496115_0131007
4020 Ga0496115_0131327
4021 Ga0496115_0254757
4022 Ga0496115_0376151
4023 Ga0496115_0379901
4024 Ga0496115_0431565
4025 Ga0496115_0532444
4026 Ga0496115_0572610
4027 Ga0496115_0608123
4028 Ga0496116_0006663
4029 Ga0496116_0032654
4030 Ga0496116_0054709
4031 Ga0496116_0120515
4032 Ga0496116_0122217
4033 Ga0496116_0174618
4034 Ga0496116_0226636
4035 Ga0496116_0393203
4036 Ga0496117_0002850
4037 Ga0496117_0029031
4038 Ga0496117_0104585
4039 Ga0496118_0010366
4040 Ga0496118_0027422
4041 Ga0496118_0039741
4042 Ga0496118_0100694
4043 Ga0496118_0127248
4044 Ga0496118_0201720
4045 Ga0496118_0207405
4046 Ga0496119_0006975
4047 Ga0496119_0033005
4048 Ga0496119_0151658
4049 Ga0496119_0188727
4050 Ga0496120_0152393
4051 Ga0496120_0182412
4052 Ga0496120_0264386
4053 Ga0496121_0002928
4054 Ga0496121_0015151
4055 Ga0496121_0023493
4056 Ga0496121_0031966
4057 Ga0496121_0040564
4058 Ga0496121_0060060
4059 Ga0496121_0064627
4060 Ga0496121_0233788
4061 Ga0496121_0672503
4062 Ga0496122_0002652
4063 Ga0496122_0006384
4064 Ga0496122_0045238
4065 Ga0496122_0117785
4066 Ga0496122_0241896
4067 Ga0496123_0007601
4068 Ga0496123_0011446
4069 Ga0496123_0024316
4070 Ga0496123_0031548
4071 Ga0496123_0050572
4072 Ga0496124_0035888
4073 Ga0496124_0042938
4074 Ga0496124_0052609
4075 Ga0496124_0080875
4076 Ga0496124_0083920
4077 Ga0496124_0089738
4078 Ga0496124_0235447
4079 Ga0496124_0237303
4080 Ga0496124_0317340
4081 Ga0496124_0542713
4082 Ga0496125_0001934
4083 Ga0496125_0005068
4084 Ga0496125_0134373
4085 Ga0496125_0164527
4086 Ga0496125_0177292
4087 Ga0496125_0253014
4088 Ga0496125_0412167
4089 Ga0496126_0004622
4090 Ga0496126_0005787
4091 Ga0496126_0007973
4092 Ga0496126_0031015
4093 Ga0496126_0051319
4094 Ga0496126_0090828
4095 Ga0496126_0173352
4096 Ga0496126_0763102
4097 Ga0501306_000005
4098 Ga0501306_000357
4099 Ga0501306_000359
4100 Ga0501306_002633
4101 Ga0501306_006022
4102 Ga0501306_051944
4103 Ga0501306_104473
4104 Ga0501308_000002
4105 Ga0501308_000101
4106 Ga0501308_001514
4107 Ga0501308_005869
4108 Ga0501309_000053
4109 Ga0501309_000994
4110 Ga0501309_008348
4111 Ga0501309_018310
4112 Ga0501310_000065
4113 Ga0501310_000908
4114 Ga0501310_001119
4115 Ga0501310_001494
4116 Ga0501310_005775
4117 Ga0501310_006883
4118 Ga0501343_001045
4119 Ga0501343_003853
4120 Ga0501304_000001
4121 Ga0501304_000110
4122 Ga0501305_000138
4123 Ga0501305_001754
4124 Ga0501305_002625
4125 Ga0501307_000084
4126 Ga0501307_000295
4127 Ga0501307_000470
4128 Ga0501307_000643
4129 Ga0501307_008590
4130 Ga0501307_027472
4131 Ga0495678_000010
4132 Ga0495678_006058
4133 Ga0495678_006909
4134 Ga0495678_008007
4135 Ga0495678_016621
4136 Ga0495678_016940
4137 Ga0495678_021632
4138 Ga0495678_031895
4139 Ga0495678_052645
4140 Ga0495678_058254
4141 Ga0495678_093588
4142 Ga0495678_172811
4143 Ga0495678_187690
4144 Ga0495682_0003087
4145 Ga0495682_0003914
4146 Ga0495682_0006686
4147 Ga0495682_0015613
4148 Ga0495682_0067593
4149 Ga0495682_0128104
4150 Ga0501292_002630
4151 Ga0501298_064091
4152 Ga0501303_013329
4153 Ga0501311_000002
4154 Ga0501311_002478
4155 Ga0501311_024768
4156 Ga0501312_000249
4157 Ga0501312_004300
4158 Ga0501312_006986
4159 Ga0501312_009302
4160 Ga0501313_000292
4161 Ga0501313_000495
4162 Ga0501313_000546
4163 Ga0501313_031015
4164 Ga0501314_001218
4165 Ga0501314_002963
4166 Ga0501314_015087
4167 Ga0501315_000004
4168 Ga0501315_000754
4169 Ga0501315_003030
4170 Ga0501315_005958
4171 Ga0501315_012600
4172 Ga0501315_045069
4173 Ga0501315_051891
4174 Ga0501316_000002
4175 Ga0501316_001189
4176 Ga0501316_001227
4177 Ga0501316_026469
4178 Ga0501317_000290
4179 Ga0501317_002431
4180 Ga0501317_007694
4181 Ga0501318_000040
4182 Ga0501318_001648
4183 Ga0501319_000027
4184 Ga0501319_025246
4185 Ga0501320_001179
4186 Ga0501320_001910
4187 Ga0501320_003292
4188 Ga0501320_009368
4189 Ga0501321_001759
4190 Ga0501321_005466
4191 Ga0501321_005923
4192 Ga0501322_010033
4193 Ga0501322_012491
4194 Ga0501323_000015
4195 Ga0501323_000822
4196 Ga0501323_001128
4197 Ga0501323_002535
4198 Ga0501323_006919
4199 Ga0501323_012755
4200 Ga0501323_017279
4201 Ga0501324_015903
4202 Ga0501324_021834
4203 Ga0501325_005953
4204 Ga0501326_05772
4205 Ga0501327_00336
4206 Ga0501330_000369
4207 Ga0501334_11546
4208 Ga0501335_003176
4209 Ga0501335_022410
4210 Ga0501336_000669
4211 Ga0501336_001280
4212 Ga0501337_000673
4213 Ga0501337_024160
4214 Ga0501340_003556
4215 Ga0501032_0051651
4216 Ga0501032_0244711
4217 Ga0501033_0032115
4218 Ga0501033_0187485
4219 Ga0501034_0944157
4220 Ga0501034_1182171
4221 Ga0501036_0283908
4222 Ga0501036_0375199
4223 Ga0501037_0403748
4224 Ga0501038_0184283
4225 Ga0501038_0388532
4226 Ga0501038_0681881
4227 Ga0501043_0311069
4228 Ga0501047_0017972
4229 Ga0501047_0408279
4230 Ga0501048_0110710
4231 Ga0501207_010936
4232 Ga0501210_004862
4233 Ga0501211_006351
4234 Ga0501217_133450
4235 Ga0501222_005375
4236 Ga0501230_002593
4237 Ga0501233_077131
4238 Ga0501238_000213
4239 Ga0501249_002499
4240 Ga0501257_034882
4241 Ga0501221_018188
4242 Ga0501263_018035
4243 Ga0501269_000003
4244 Ga0501279_001682
4245 Ga0501279_019904
4246 Ga0501035_0010452
4247 Ga0501035_0010523
4248 Ga0501035_0011202
4249 Ga0501035_0314676
4250 Ga0501044_0000210
4251 Ga0501044_0024898
4252 Ga0501044_0078211
4253 Ga0501044_0358594
4254 Ga0501044_0853919
4255 Ga0501226_005181
4256 nmdc:mga03683_216870_c1
4257 nmdc:mga03n38_298936_c1
4258 nmdc:mga03n38_4317_c1
4259 nmdc:mga00v17_12098_c1
4260 nmdc:mga00v17_184456_c1
4261 nmdc:mga0k408_139838_c1
4262 nmdc:mga0k408_43703_c1
4263 nmdc:mga0k408_712_c1
4264 nmdc:mga0k408_98510_c1
4265 nmdc:mga06z11_1936_c1
4266 nmdc:mga07m45_13904_c1
4267 nmdc:mga07m45_45273_c1
4268 nmdc:mga07m45_521668_c1
4269 nmdc:mga07m45_6867_c1
4270 nmdc:mga05p37_434571_c1
4271 nmdc:mga05p37_750093_c1
4272 nmdc:mga08y16_79438_c1
4273 nmdc:mga0n895_56341_c1
4274 nmdc:mga08x19_336538_c1
4275 nmdc:mga0a205_171614_c1
4276 nmdc:mga0sz30_439069_c1
4277 Ga0495655_0104305
4278 Ga0500644_0035969
4279 Ga0500646_0009238
4280 Ga0500641_0039435
4281 Ga0500650_0075460
4282 Ga0500555_069725
4283 Ga0500618_003056
4284 Ga0500628_002187
4285 Ga0500655_002279
4286 Ga0500559_0103340
4287 Ga0500568_0055223
4288 Ga0500573_0439913
4289 Ga0500577_0289774
4290 Ga0500586_017865
4291 Ga0500600_0129045
4292 Ga0500604_0000352
4293 Ga0500616_0170867
4294 Ga0500619_138164
4295 Ga0500622_0000002
4296 Ga0500622_0060471
4297 Ga0500622_0103807
4298 Ga0500645_035372
4299 Ga0500645_191047
4300 Ga0500565_012675
4301 Ga0587084_000161
4302 Ga0587084_001109
4303 Ga0587084_002020
4304 Ga0587084_098994
4305 Ga0587093_081804
4306 Ga0587066_000001
4307 Ga0587070_000065
4308 Ga0587070_075589
4309 Ga0587070_092774
4310 Ga0587073_0001671
4311 Ga0587073_0129733
4312 Ga0587077_001151
4313 Ga0587077_020126
4314 Ga0587080_002147
4315 Ga0587080_077620
4316 Ga0587082_000884
4317 Ga0587083_0000094
4318 Ga0587083_0000200
4319 Ga0587083_0069435
4320 Ga0587085_021468
4321 Ga0587086_066732
4322 Ga0587088_000001
4323 Ga0587088_037690
4324 Ga0587089_043032
4325 Ga0587090_008198
4326 Ga0587091_000335
4327 Ga0587091_096258
4328 Ga0587092_006055
4329 Ga0587098_001373
4330 Ga0587098_009967
4331 Ga0587098_038216
4332 Ga0587106_000819
4333 Ga0587106_008375
4334 Ga0587125_003092
4335 Ga0587099_000096
4336 Ga0587101_005751
4337 Ga0587117_015850
4338 Ga0587128_000098
4339 Ga0587128_007622
4340 Ga0587062_016401
4341 Ga0587062_038847
4342 Ga0587067_000303
4343 Ga0587067_017051
4344 Ga0587068_000002
4345 Ga0587068_000145
4346 Ga0587068_000228
4347 Ga0587068_005731
4348 Ga0587069_001414
4349 Ga0587069_004834
4350 Ga0587072_001765
4351 Ga0587072_003430
4352 Ga0587072_005754
4353 Ga0587075_000434
4354 Ga0587076_000914
4355 Ga0587076_004751
4356 Ga0587078_000693
4357 Ga0587078_011692
4358 Ga0587078_045061
4359 Ga0587079_000913
4360 Ga0587079_011093
4361 Ga0587079_034989
4362 Ga0587079_037199
4363 Ga0587100_007975
4364 Ga0587102_019683
4365 Ga0587107_000137
4366 Ga0587107_051316
4367 Ga0587114_004063
4368 Ga0587071_000116
4369 Ga0587071_183420
4370 Ga0587111_0000227
4371 Ga0587111_0000229
4372 Ga0587111_0002272
4373 Ga0587111_0017972
4374 Ga0466962_0001202
4375 Ga0466962_0016232
4376 Ga0466962_0029411
4377 Ga0466962_0147138
4378 Ga0466962_0464838
4379 2501074046
4380 2501084118
4381 2501414355
4382 2509132518
4383 2510252583
4384 2511093330
4385 2511099778
4386 2511102451
4387 2511245083
4388 2512348441
4389 2513556141
4390 2513564327
4391 2513962592
4392 2514050901
4393 2515684861
4394 2515690948
4395 2516022230
4396 2519457515
4397 2527080587
4398 2563061523
4399 2585294150
4400 2599741043
4401 2599748350
4402 2600210262
4403 2600813801
4404 2643792076
4405 2643799429
4406 2644123358
4407 2644216443
4408 2644254807
4409 2644360368
4410 2644471522
4411 2676745814
4412 2713478613
4413 2719641681
4414 2738738116
4415 2738824029
4416 2738826789
4417 2738836420
4418 2738843086
4419 2738877950
4420 2739150586
4421 2739189656
4422 2739192505
4423 2739224543
4424 2739273837
4425 2739318982
4426 2739337223
4427 2739342881
4428 2746087224
4429 2746093269
4430 2753566201
4431 2792837062
4432 2808972857
4433 2809007978
4434 2809015382
4435 2817259705
4436 2817277374
4437 2817453540
4438 2819624163
4439 2819636795
4440 2842332188
4441 2842356360
4442 2842461299
4443 2842712337
4444 2855735567
4445 2856289407
4446 2857362279
4447 2857556281
4448 2857560802
4449 2863426496
4450 2870069402
4451 2883091437
4452 2885272359
4453 2900637068
4454 2902686677
4455 2904428883
4456 2904438988
4457 2904490114
4458 2904569340
4459 2904576823
4460 2904624834
4461 2919476957
4462 2919533283
4463 2921651507
4464 2928114211
4465 2928141041
4466 2928163049
4467 2928170201
4468 2928176337
4469 2928509206
4470 2928542017
4471 2945934568
4472 2981996104
4473 2990704874
4474 642426538
4475 642417676
4476 642594616
4477 642623205
4478 8003956820
4479 8018847929
4480 8020813917
4481 8020939047
4482 8020947762
4483 8020953406
4484 8021127513
4485 8039099663
4486 8040171494
4487 8040174108
4488 8047676077
4489 8055269423
4490 8055307415

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00828

Ribosomal_L27A

Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A

12

129

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v5z-assembly1.cif.gz_Bo structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map 0.8349 95 129
6hix-assembly1.cif.gz_AP cryo-em structure of the trypanosoma brucei mitochondrial ribosome - this entry contains the large mitoribosomal subunit 0.7791 61 129
1w2b-assembly1.cif.gz_N trigger factor ribosome binding domain in complex with 50s 0.7716 62 129
8c95-assembly1.cif.gz_L cryo-em captures early ribosome assembly in action 0.7482 40 131
4v48-assembly1.cif.gz_AJ real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.7312 62 130
ID Description Score Start End Superfamily
af_P02413_75_144_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.968 62 131 3.100.10.10
af_P02413_75_144_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.9548 62 131 3.100.10.10
af_Q6UUH5_140_226_3.100.10.10 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.8914 63 130 3.100.10.10
5v7qL01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.8856 63 131 3.100.10.10
4qjsP01 Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; 0.8841 63 129 3.100.10.10
ID Description Score Start End GO Terms
AF-A0A661D962-F1-model_v4 50S ribosomal protein L15 0.9846 60 131 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A4Q3ZTU2-F1-model_v4 deleted 0.9813 60 130
AF-A0A080LUN8-F1-model_v4 50S ribosomal protein L15 0.9711 56 131 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A1B5EQ26-F1-model_v4 deleted 0.9696 61 131
AF-A7MPG9-F1-model_v4 50S ribosomal protein L15 0.9684 61 131 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Map