F496594
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2245 | 783 | 4490 | 130 |
Family's Representative Sequence
| Representative Sequence | 3300006042|Ga0075368_10003054|Ga0075368_100030542 |
| Length | 145 |
| Sequence | MKLNTIKPAEGAKHAKRRGHKGQKSRAGGFHKVGFEGGQMPLQRRLPKRGFSSLTREFVAEVRLDELERLEATDITLDVLKAAGVVPVLTIRAKVILSGKLARKVALSAGVIATKGAKSAVEAAGGSVAEVVVKPVERKLKAKAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 10 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 11 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 12 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 13 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 14 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 15 | 3300002870 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 17 | 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 21 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 22 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 23 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 24 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 25 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 26 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 27 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 28 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 29 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 30 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 31 | 3300003558 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 32 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 33 | 3300003565 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 34 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 35 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 36 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 37 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 38 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 39 | 3300003611 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 40 | 3300003613 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 41 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 42 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 43 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 44 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 45 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 46 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 47 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 48 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 49 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 50 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 51 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 52 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 53 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 54 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 55 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 56 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 57 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 58 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 59 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 60 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 61 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 62 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 63 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 64 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 65 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 66 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 69 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 71 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 75 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 77 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 85 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 92 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 93 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 94 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 97 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 98 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 99 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 102 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 104 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 105 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 106 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 107 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 108 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 109 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 110 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 111 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 112 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 113 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 114 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 115 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 116 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 117 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 118 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 119 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 120 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 121 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 123 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 124 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 125 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 126 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 127 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 128 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 129 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 130 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 147 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 148 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 149 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 150 | 3300013059 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 162 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 164 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 165 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 166 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 167 | 3300019179 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300019181 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 170 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 171 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 172 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 174 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 175 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 176 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 177 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 179 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 180 | 3300023560 | Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRI3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 181 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 192 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 193 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 196 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 199 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 201 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 203 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 205 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 208 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 261 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 263 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 266 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 269 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 270 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 271 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 272 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 273 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 274 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 275 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 276 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 277 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 278 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 279 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 280 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 281 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 282 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 288 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 289 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 290 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 291 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 292 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 293 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 294 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 295 | 3300031667 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 296 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 297 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 298 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 299 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 300 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 301 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 302 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 303 | 3300031814 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 305 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 306 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 307 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 308 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 309 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 310 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 311 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 312 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 313 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 314 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 316 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 317 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 320 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 321 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 322 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 323 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 324 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 325 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 326 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 327 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 328 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 329 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 330 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 331 | 3300036535 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 332 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 333 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 334 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 335 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 336 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 337 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 338 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 339 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 340 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 341 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 342 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 343 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 344 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 345 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 346 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 347 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 348 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 349 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 350 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 351 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 352 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 353 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 354 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 355 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 356 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 357 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 358 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 359 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 360 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 361 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 362 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 363 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 364 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 365 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 366 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 367 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 368 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 369 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 370 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 371 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 372 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 373 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 374 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 375 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 376 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 377 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 378 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 379 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 380 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 381 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 382 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 383 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 384 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 385 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 386 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 387 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 388 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 389 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 390 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 391 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 392 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 393 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 394 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 395 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 396 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 397 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 398 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 399 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 400 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 401 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 402 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 403 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 404 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 405 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 406 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 407 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 408 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 409 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 410 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 411 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 412 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 512 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 513 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 514 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 515 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 516 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 517 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 518 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 519 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 520 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 521 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 522 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 523 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 524 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 525 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 526 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 527 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 528 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 529 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 530 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 531 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 532 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 533 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 534 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 535 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 536 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 537 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 538 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 539 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 540 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 541 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 542 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 543 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 544 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 545 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 546 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 549 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 550 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 551 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 552 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 553 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 554 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 555 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 556 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 557 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 558 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 559 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 560 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 561 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 562 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 563 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 564 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 565 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 566 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 567 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 568 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 569 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 570 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 571 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 572 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 573 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 574 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 575 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 576 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 577 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 578 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 579 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 580 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 581 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 582 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 583 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 584 | 3300049657 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought | Metagenome | Rhizosphere |
| 585 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 586 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 587 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 588 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 589 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 590 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 591 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 592 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 593 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 594 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 595 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 596 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 597 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 598 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 599 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 600 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 601 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 602 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 603 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 604 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 605 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 606 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 607 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 608 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 609 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 610 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 611 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 612 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 614 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 615 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 616 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 617 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 618 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 619 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 620 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 621 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 622 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 623 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 624 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 625 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 626 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 627 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 628 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 629 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 630 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 631 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 632 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 633 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 634 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 635 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 636 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 637 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 638 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 639 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 640 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 641 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 642 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 643 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 644 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 645 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 646 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 647 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 648 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 649 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 650 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 651 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 652 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 653 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 654 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 655 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 656 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 657 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 658 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 659 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 660 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 661 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 662 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 663 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 664 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 665 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 666 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 667 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 668 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 669 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 670 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 671 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 672 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 673 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 674 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 675 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 676 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 677 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 678 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 679 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 680 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 681 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 682 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 683 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 684 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 685 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 686 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 687 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 688 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 689 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 690 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 691 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 692 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 693 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 694 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 695 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 696 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 697 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 698 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 699 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 700 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 701 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 702 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 703 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 704 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 705 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 706 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 707 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 708 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 709 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 710 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 711 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 712 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 713 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 714 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 715 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 716 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 717 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 718 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 719 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 720 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 721 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 722 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 723 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 724 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 725 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 726 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 727 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 728 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 729 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 730 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 731 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 732 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 733 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 734 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 735 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 736 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 737 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 738 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 739 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 740 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 741 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 742 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 743 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 744 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 745 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 746 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 747 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 748 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 749 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 750 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 751 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 752 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 753 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 754 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 755 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 756 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 757 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 758 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 759 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 760 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 761 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 762 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 763 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 764 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 765 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 766 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 767 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 768 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 769 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 770 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 771 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 772 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 773 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 774 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 775 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 776 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 777 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 778 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 779 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 780 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 781 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 782 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 783 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.63 |
| Metatranscriptomes | 12.38 |
| Isolates | 4.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.91 |
| Nodule | 1.2 |
| Rhizoplane | 4.14 |
| Rhizosphere | 77.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075368_10003054 | 3300006042 | Bacteria | 5542 |
| 2 | JGI24736J21556_1000961 | 3300001904 | Bacteria | 5319 |
| 3 | JGI24736J21556_1014262 | 3300001904 | Bacteria | 1278 |
| 4 | JGI24741J21665_1000624 | 3300001915 | Bacteria | 10681 |
| 5 | JGI24741J21665_1002145 | 3300001915 | Bacteria | 5249 |
| 6 | JGI24740J21852_10008508 | 3300001979 | Bacteria | 4085 |
| 7 | JGI24740J21852_10010715 | 3300001979 | Bacteria | 3517 |
| 8 | JGI24740J21852_10022184 | 3300001979 | Bacteria | 2190 |
| 9 | JGI24739J22299_10010870 | 3300001989 | Bacteria | 3368 |
| 10 | JGI24739J22299_10015549 | 3300001989 | Bacteria | 2765 |
| 11 | JGI24739J22299_10028555 | 3300001989 | Bacteria | 1945 |
| 12 | JGI24739J22299_10040738 | 3300001989 | Bacteria | 1549 |
| 13 | JGI24737J22298_10004674 | 3300001990 | Bacteria | 4762 |
| 14 | JGI24737J22298_10008370 | 3300001990 | Bacteria | 3466 |
| 15 | JGI24737J22298_10022836 | 3300001990 | Bacteria | 1987 |
| 16 | JGI24737J22298_10027585 | 3300001990 | Bacteria | 1790 |
| 17 | JGI24735J21928_10002193 | 3300002067 | Bacteria | 6859 |
| 18 | JGI24735J21928_10011144 | 3300002067 | Bacteria | 2855 |
| 19 | JGI24735J21928_10014430 | 3300002067 | Bacteria | 2475 |
| 20 | JGI24735J21928_10019381 | 3300002067 | Bacteria | 2091 |
| 21 | JGI24738J21930_10006803 | 3300002075 | Bacteria | 2657 |
| 22 | JGI25155J39150_1007058 | 3300002704 | Bacteria | 522 |
| 23 | JGI25156J39149_1006223 | 3300002705 | Bacteria | 3295 |
| 24 | JGI25156J39149_1012871 | 3300002705 | Bacteria | 1811 |
| 25 | JGI25156J39149_1014425 | 3300002705 | Bacteria | 1629 |
| 26 | JGI25156J39149_1016459 | 3300002705 | Bacteria | 1437 |
| 27 | JGI25156J39149_1020451 | 3300002705 | Bacteria | 1164 |
| 28 | JGI25156J39149_1033188 | 3300002705 | Bacteria | 756 |
| 29 | JGI25154J39366_1000303 | 3300002738 | Bacteria | 29179 |
| 30 | JGI25154J39366_1001042 | 3300002738 | Bacteria | 11063 |
| 31 | JGI25158J39367_1000542 | 3300002739 | Bacteria | 7614 |
| 32 | JGI25152J39213_1013037 | 3300002773 | Bacteria | 1750 |
| 33 | JGI25150J39212_1001923 | 3300002774 | Bacteria | 5456 |
| 34 | JGI25150J39212_1003501 | 3300002774 | Bacteria | 3664 |
| 35 | Ga0006763J43179_104166 | 3300002870 | Bacteria | 5040 |
| 36 | JGI25159J45721_1005729 | 3300002987 | Bacteria | 3846 |
| 37 | JGI25159J45721_1006200 | 3300002987 | Bacteria | 3618 |
| 38 | Ga0006765J45826_105454 | 3300003161 | Bacteria | 4839 |
| 39 | Ga0006765J45826_108890 | 3300003161 | Bacteria | 1165 |
| 40 | Ga0006765J45826_116549 | 3300003161 | Bacteria | 533 |
| 41 | Ga0006778J45830_1013714 | 3300003162 | Bacteria | 8778 |
| 42 | Ga0006778J45830_1018992 | 3300003162 | Bacteria | 2451 |
| 43 | Ga0006759J45824_1009839 | 3300003163 | Bacteria | 1691 |
| 44 | Ga0006759J45824_1019440 | 3300003163 | Bacteria | 3635 |
| 45 | Ga0006759J45824_1019946 | 3300003163 | Bacteria | 12757 |
| 46 | Ga0006759J45824_1026311 | 3300003163 | Bacteria | 2275 |
| 47 | JGI25151J46595_10000457 | 3300003187 | Bacteria | 39373 |
| 48 | JGI25151J46595_10071766 | 3300003187 | Bacteria | 1044 |
| 49 | JGI25151J46595_10077557 | 3300003187 | Bacteria | 976 |
| 50 | JGI25406J46586_10002509 | 3300003203 | Bacteria | 8686 |
| 51 | JGI25406J46586_10005813 | 3300003203 | Bacteria | 5709 |
| 52 | JGI25165J46597_1001391 | 3300003214 | Bacteria | 13253 |
| 53 | JGI25153J46596_10002258 | 3300003215 | Bacteria | 11225 |
| 54 | Ga0006758J48902_1003546 | 3300003300 | Bacteria | 6400 |
| 55 | Ga0006758J48902_1008911 | 3300003300 | Bacteria | 7674 |
| 56 | Ga0006758J48902_1013469 | 3300003300 | Bacteria | 2905 |
| 57 | Ga0006770J48903_1023756 | 3300003305 | Bacteria | 3863 |
| 58 | Ga0006777J48905_1011571 | 3300003308 | Bacteria | 3265 |
| 59 | Ga0006777J48905_1023402 | 3300003308 | Bacteria | 1830 |
| 60 | JGI25160J50197_1001051 | 3300003354 | Bacteria | 14224 |
| 61 | JGI25160J50197_1002367 | 3300003354 | Bacteria | 8808 |
| 62 | JGI25161J50226_1003265 | 3300003374 | Bacteria | 3777 |
| 63 | Ga0006556J51387_1013500 | 3300003479 | Bacteria | 15419 |
| 64 | Ga0006556J51387_1016929 | 3300003479 | Bacteria | 14599 |
| 65 | Ga0007417J51691_1002612 | 3300003544 | Bacteria | 14201 |
| 66 | Ga0007417J51691_1012996 | 3300003544 | Bacteria | 3246 |
| 67 | Ga0007417J51691_1036180 | 3300003544 | Bacteria | 1373 |
| 68 | Ga0006558J51389_1019156 | 3300003558 | Bacteria | 14283 |
| 69 | Ga0006558J51389_1029442 | 3300003558 | Bacteria | 4339 |
| 70 | Ga0007427J51700_104412 | 3300003559 | Bacteria | 1776 |
| 71 | Ga0007427J51700_116762 | 3300003559 | Bacteria | 1067 |
| 72 | Ga0007427J51700_120270 | 3300003559 | Bacteria | 618 |
| 73 | Ga0006560J51390_1011017 | 3300003565 | Bacteria | 19884 |
| 74 | Ga0006560J51390_1020307 | 3300003565 | Bacteria | 14892 |
| 75 | Ga0006554J51385_1017299 | 3300003567 | Bacteria | 14985 |
| 76 | Ga0007410J51695_1004597 | 3300003574 | Bacteria | 14339 |
| 77 | Ga0007410J51695_1005147 | 3300003574 | Bacteria | 1659 |
| 78 | Ga0007410J51695_1012689 | 3300003574 | Bacteria | 12724 |
| 79 | Ga0007410J51695_1015723 | 3300003574 | Bacteria | 3888 |
| 80 | Ga0007409J51694_1002712 | 3300003575 | Bacteria | 865 |
| 81 | Ga0007409J51694_1007029 | 3300003575 | Bacteria | 1871 |
| 82 | Ga0007409J51694_1025202 | 3300003575 | Bacteria | 1643 |
| 83 | Ga0007416J51690_1009369 | 3300003577 | Bacteria | 4951 |
| 84 | Ga0007429J51699_1012288 | 3300003579 | Bacteria | 4157 |
| 85 | Ga0007429J51699_1013730 | 3300003579 | Bacteria | 3438 |
| 86 | Ga0007411J51799_103551 | 3300003611 | Bacteria | 13349 |
| 87 | Ga0007411J51799_118133 | 3300003611 | Bacteria | 750 |
| 88 | Ga0007415J51800_102854 | 3300003613 | Bacteria | 5009 |
| 89 | Ga0032354_1003172 | 3300003693 | Bacteria | 6308 |
| 90 | Ga0032354_1006520 | 3300003693 | Bacteria | 1872 |
| 91 | Ga0032354_1013175 | 3300003693 | Bacteria | 5546 |
| 92 | Ga0032354_1073470 | 3300003693 | Bacteria | 3279 |
| 93 | Ga0032354_1175332 | 3300003693 | Bacteria | 524 |
| 94 | Ga0006780_1003512 | 3300003735 | Bacteria | 4326 |
| 95 | Ga0055539_1001132 | 3300003752 | Bacteria | 5509 |
| 96 | Ga0055539_1005718 | 3300003752 | Bacteria | 1607 |
| 97 | Ga0055533_1003286 | 3300003756 | Bacteria | 3303 |
| 98 | Ga0055533_1003606 | 3300003756 | Bacteria | 3054 |
| 99 | Ga0055533_1005127 | 3300003756 | Bacteria | 2180 |
| 100 | Ga0055533_1006769 | 3300003756 | Bacteria | 1642 |
| 101 | Ga0055532_1000066 | 3300003758 | Bacteria | 139987 |
| 102 | Ga0055532_1000261 | 3300003758 | Bacteria | 35339 |
| 103 | Ga0055532_1002406 | 3300003758 | Bacteria | 3918 |
| 104 | Ga0055525_1000018 | 3300003759 | Bacteria | 393974 |
| 105 | Ga0055527_1000035 | 3300003760 | Bacteria | 138481 |
| 106 | Ga0055527_1000602 | 3300003760 | Bacteria | 11576 |
| 107 | Ga0055535_1000046 | 3300003761 | Bacteria | 139987 |
| 108 | Ga0055535_1000050 | 3300003761 | Bacteria | 138481 |
| 109 | Ga0055542_1000512 | 3300003762 | Bacteria | 35339 |
| 110 | Ga0055542_1001443 | 3300003762 | Bacteria | 11849 |
| 111 | Ga0055542_1008179 | 3300003762 | Bacteria | 2062 |
| 112 | Ga0055529_1000079 | 3300003763 | Bacteria | 149370 |
| 113 | Ga0055529_1000087 | 3300003763 | Bacteria | 139975 |
| 114 | Ga0055529_1000089 | 3300003763 | Bacteria | 138481 |
| 115 | Ga0055529_1000804 | 3300003763 | Bacteria | 19180 |
| 116 | Ga0055529_1019136 | 3300003763 | Bacteria | 856 |
| 117 | Ga0055526_1008246 | 3300003771 | Bacteria | 5232 |
| 118 | Ga0055526_1008253 | 3300003771 | Bacteria | 5230 |
| 119 | Ga0055526_1012574 | 3300003771 | Bacteria | 3674 |
| 120 | Ga0055526_1017962 | 3300003771 | Bacteria | 2668 |
| 121 | Ga0055537_1000038 | 3300003773 | Bacteria | 92762 |
| 122 | Ga0055537_1007557 | 3300003773 | Bacteria | 2609 |
| 123 | Ga0055524_1000024 | 3300003775 | Bacteria | 217953 |
| 124 | Ga0055524_1003212 | 3300003775 | Bacteria | 8017 |
| 125 | Ga0055524_1038927 | 3300003775 | Bacteria | 1236 |
| 126 | Ga0055534_1003773 | 3300003784 | Bacteria | 4660 |
| 127 | Ga0055534_1005461 | 3300003784 | Bacteria | 3395 |
| 128 | Ga0055528_1000489 | 3300003790 | Bacteria | 31350 |
| 129 | Ga0055528_1012285 | 3300003790 | Bacteria | 3335 |
| 130 | Ga0055528_1013311 | 3300003790 | Bacteria | 3124 |
| 131 | Ga0055528_1029760 | 3300003790 | Bacteria | 1468 |
| 132 | Ga0055530_10007831 | 3300003791 | Bacteria | 4408 |
| 133 | Ga0055531_10006076 | 3300003794 | Bacteria | 6916 |
| 134 | Ga0058692_1002213 | 3300003856 | Bacteria | 6626 |
| 135 | Ga0055543_1004039 | 3300004625 | Bacteria | 4114 |
| 136 | Ga0058860_10029302 | 3300004801 | Bacteria | 1277 |
| 137 | Ga0058862_12800340 | 3300004803 | Bacteria | 1822 |
| 138 | Ga0065165_1000504 | 3300005262 | Bacteria | 60378 |
| 139 | Ga0065165_1000885 | 3300005262 | Bacteria | 38659 |
| 140 | Ga0065165_1006561 | 3300005262 | Bacteria | 6061 |
| 141 | Ga0065165_1043988 | 3300005262 | Bacteria | 1308 |
| 142 | Ga0065714_10175573 | 3300005288 | Bacteria | 985 |
| 143 | Ga0065714_10264494 | 3300005288 | Bacteria | 745 |
| 144 | Ga0065712_10086127 | 3300005290 | Bacteria | 2651 |
| 145 | Ga0065707_10200663 | 3300005295 | Bacteria | 1308 |
| 146 | Ga0070658_10012014 | 3300005327 | Bacteria | 6954 |
| 147 | Ga0070658_10028760 | 3300005327 | Bacteria | 4462 |
| 148 | Ga0070658_10051816 | 3300005327 | Bacteria | 3326 |
| 149 | Ga0070658_10197036 | 3300005327 | Bacteria | 1698 |
| 150 | Ga0070658_10210675 | 3300005327 | Bacteria | 1642 |
| 151 | Ga0070658_11224510 | 3300005327 | Bacteria | 652 |
| 152 | Ga0070683_100130959 | 3300005329 | Bacteria | 2373 |
| 153 | Ga0070690_100665097 | 3300005330 | Bacteria | 797 |
| 154 | Ga0070670_100436011 | 3300005331 | Bacteria | 1160 |
| 155 | Ga0070670_100588559 | 3300005331 | Bacteria | 995 |
| 156 | Ga0070670_101020706 | 3300005331 | Bacteria | 753 |
| 157 | Ga0068869_100000239 | 3300005334 | Bacteria | 28911 |
| 158 | Ga0068869_100792341 | 3300005334 | Bacteria | 814 |
| 159 | Ga0068869_100940796 | 3300005334 | Bacteria | 750 |
| 160 | Ga0070666_10064761 | 3300005335 | Bacteria | 2479 |
| 161 | Ga0070666_10851489 | 3300005335 | Bacteria | 673 |
| 162 | Ga0070680_100028265 | 3300005336 | Bacteria | 4496 |
| 163 | Ga0070682_100104638 | 3300005337 | Bacteria | 1875 |
| 164 | Ga0070682_100335096 | 3300005337 | Bacteria | 1122 |
| 165 | Ga0068868_100019350 | 3300005338 | Bacteria | 5101 |
| 166 | Ga0068868_100470939 | 3300005338 | Bacteria | 1096 |
| 167 | Ga0068868_100985634 | 3300005338 | Bacteria | 770 |
| 168 | Ga0070660_100026003 | 3300005339 | Bacteria | 4356 |
| 169 | Ga0070660_100034626 | 3300005339 | Bacteria | 3817 |
| 170 | Ga0070689_101355443 | 3300005340 | Bacteria | 642 |
| 171 | Ga0070691_10586771 | 3300005341 | Bacteria | 656 |
| 172 | Ga0070687_100449060 | 3300005343 | Bacteria | 857 |
| 173 | Ga0070661_100000276 | 3300005344 | Bacteria | 41562 |
| 174 | Ga0070661_100425658 | 3300005344 | Bacteria | 1053 |
| 175 | Ga0070661_100577942 | 3300005344 | Bacteria | 906 |
| 176 | Ga0070661_100922623 | 3300005344 | Bacteria | 722 |
| 177 | Ga0070669_100615595 | 3300005353 | Bacteria | 911 |
| 178 | Ga0070669_100767176 | 3300005353 | Bacteria | 818 |
| 179 | Ga0070675_100789602 | 3300005354 | Bacteria | 868 |
| 180 | Ga0070671_100130518 | 3300005355 | Bacteria | 2116 |
| 181 | Ga0070671_101474927 | 3300005355 | Bacteria | 602 |
| 182 | Ga0070673_100420566 | 3300005364 | Bacteria | 1198 |
| 183 | Ga0070688_100394510 | 3300005365 | Bacteria | 1023 |
| 184 | Ga0070659_100000426 | 3300005366 | Bacteria | 31940 |
| 185 | Ga0070659_100235446 | 3300005366 | Bacteria | 1514 |
| 186 | Ga0070659_100755623 | 3300005366 | Bacteria | 843 |
| 187 | Ga0070659_100766022 | 3300005366 | Bacteria | 838 |
| 188 | Ga0070667_100263553 | 3300005367 | Bacteria | 1544 |
| 189 | Ga0070694_100214288 | 3300005444 | Bacteria | 1442 |
| 190 | Ga0070663_100001053 | 3300005455 | Bacteria | 15091 |
| 191 | Ga0070663_100021946 | 3300005455 | Bacteria | 4257 |
| 192 | Ga0070663_100434756 | 3300005455 | Bacteria | 1079 |
| 193 | Ga0070663_100882448 | 3300005455 | Bacteria | 771 |
| 194 | Ga0070663_101124597 | 3300005455 | Bacteria | 687 |
| 195 | Ga0070678_100045788 | 3300005456 | Bacteria | 3132 |
| 196 | Ga0070678_100253166 | 3300005456 | Bacteria | 1477 |
| 197 | Ga0070678_100667905 | 3300005456 | Bacteria | 933 |
| 198 | Ga0070662_100612492 | 3300005457 | Bacteria | 916 |
| 199 | Ga0070681_10376443 | 3300005458 | Bacteria | 1330 |
| 200 | Ga0070681_10446735 | 3300005458 | Bacteria | 1205 |
| 201 | Ga0068867_101635410 | 3300005459 | Bacteria | 603 |
| 202 | Ga0070685_11308658 | 3300005466 | Bacteria | 554 |
| 203 | Ga0070706_100494586 | 3300005467 | Bacteria | 1138 |
| 204 | Ga0070699_100041691 | 3300005518 | Bacteria | 3973 |
| 205 | Ga0070699_100043286 | 3300005518 | Bacteria | 3897 |
| 206 | Ga0070699_100085640 | 3300005518 | Bacteria | 2750 |
| 207 | Ga0070679_100263732 | 3300005530 | Bacteria | 1678 |
| 208 | Ga0070679_100272175 | 3300005530 | Bacteria | 1647 |
| 209 | Ga0070684_100277906 | 3300005535 | Bacteria | 1534 |
| 210 | Ga0068853_100029320 | 3300005539 | Bacteria | 4637 |
| 211 | Ga0068853_101060371 | 3300005539 | Bacteria | 781 |
| 212 | Ga0068853_101493106 | 3300005539 | Unclassified | 654 |
| 213 | Ga0070672_100692733 | 3300005543 | Bacteria | 892 |
| 214 | Ga0070665_100065427 | 3300005548 | Bacteria | 3647 |
| 215 | Ga0070665_100442535 | 3300005548 | Bacteria | 1309 |
| 216 | Ga0068855_100018349 | 3300005563 | Bacteria | 8405 |
| 217 | Ga0068855_100077376 | 3300005563 | Bacteria | 3860 |
| 218 | Ga0068855_100131783 | 3300005563 | Bacteria | 2854 |
| 219 | Ga0068855_100257086 | 3300005563 | Bacteria | 1947 |
| 220 | Ga0070664_100000018 | 3300005564 | Bacteria | 125281 |
| 221 | Ga0070664_100010409 | 3300005564 | Bacteria | 7543 |
| 222 | Ga0070664_100068369 | 3300005564 | Bacteria | 3037 |
| 223 | Ga0070664_100142127 | 3300005564 | Bacteria | 2114 |
| 224 | Ga0068857_100128424 | 3300005577 | Bacteria | 2285 |
| 225 | Ga0068857_100178268 | 3300005577 | Bacteria | 1933 |
| 226 | Ga0068857_100409644 | 3300005577 | Bacteria | 1262 |
| 227 | Ga0068854_100000225 | 3300005578 | Bacteria | 38422 |
| 228 | Ga0068854_100363057 | 3300005578 | Bacteria | 1189 |
| 229 | Ga0068856_100000070 | 3300005614 | Bacteria | 95320 |
| 230 | Ga0068856_100117908 | 3300005614 | Bacteria | 2655 |
| 231 | Ga0068856_100155750 | 3300005614 | Bacteria | 2295 |
| 232 | Ga0068852_100001513 | 3300005616 | Bacteria | 15722 |
| 233 | Ga0068852_100022501 | 3300005616 | Bacteria | 5056 |
| 234 | Ga0068852_100840357 | 3300005616 | Bacteria | 933 |
| 235 | Ga0068864_101369740 | 3300005618 | Bacteria | 709 |
| 236 | Ga0068864_102390113 | 3300005618 | Bacteria | 535 |
| 237 | Ga0068866_10292215 | 3300005718 | Bacteria | 1014 |
| 238 | Ga0068851_10115256 | 3300005834 | Bacteria | 1439 |
| 239 | Ga0068863_100046276 | 3300005841 | Bacteria | 4129 |
| 240 | Ga0068863_100532459 | 3300005841 | Bacteria | 1159 |
| 241 | Ga0068858_100013226 | 3300005842 | Bacteria | 7776 |
| 242 | Ga0068860_100019846 | 3300005843 | Bacteria | 6518 |
| 243 | Ga0068862_100708291 | 3300005844 | Bacteria | 976 |
| 244 | Ga0081539_10000142 | 3300005985 | Bacteria | 165444 |
| 245 | Ga0081539_10000215 | 3300005985 | Bacteria | 135054 |
| 246 | Ga0081539_10003297 | 3300005985 | Bacteria | 20197 |
| 247 | Ga0075363_100000856 | 3300006048 | Bacteria | 10631 |
| 248 | Ga0075363_100086667 | 3300006048 | Bacteria | 1719 |
| 249 | Ga0075364_10015296 | 3300006051 | Bacteria | 4757 |
| 250 | Ga0075364_10316984 | 3300006051 | Bacteria | 1062 |
| 251 | Ga0075362_10000565 | 3300006177 | Bacteria | 10784 |
| 252 | Ga0075362_10081459 | 3300006177 | Bacteria | 1492 |
| 253 | Ga0075362_10527349 | 3300006177 | Bacteria | 606 |
| 254 | Ga0075367_10001881 | 3300006178 | Bacteria | 9288 |
| 255 | Ga0075369_10003827 | 3300006186 | Bacteria | 5518 |
| 256 | Ga0075369_10490397 | 3300006186 | Bacteria | 583 |
| 257 | Ga0075366_10064801 | 3300006195 | Bacteria | 2173 |
| 258 | Ga0075366_10132503 | 3300006195 | Bacteria | 1504 |
| 259 | Ga0075366_10267362 | 3300006195 | Bacteria | 1044 |
| 260 | Ga0075366_10332276 | 3300006195 | Bacteria | 932 |
| 261 | Ga0075366_10519688 | 3300006195 | Bacteria | 736 |
| 262 | Ga0097621_100165035 | 3300006237 | Bacteria | 1906 |
| 263 | Ga0097621_100233100 | 3300006237 | Bacteria | 1608 |
| 264 | Ga0075370_10036206 | 3300006353 | Bacteria | 2772 |
| 265 | Ga0075370_10136978 | 3300006353 | Bacteria | 1430 |
| 266 | Ga0075370_10154017 | 3300006353 | Bacteria | 1347 |
| 267 | Ga0075370_10521963 | 3300006353 | Bacteria | 717 |
| 268 | Ga0068871_100003989 | 3300006358 | Bacteria | 10207 |
| 269 | Ga0075433_10131861 | 3300006852 | Bacteria | 2220 |
| 270 | Ga0075433_10263794 | 3300006852 | Bacteria | 1527 |
| 271 | Ga0075434_100017973 | 3300006871 | Bacteria | 6823 |
| 272 | Ga0068865_100052525 | 3300006881 | Bacteria | 2825 |
| 273 | Ga0068865_101583434 | 3300006881 | Bacteria | 589 |
| 274 | Ga0079104_1004078 | 3300006946 | Bacteria | 6424 |
| 275 | Ga0099826_10000010 | 3300006948 | Bacteria | 314346 |
| 276 | Ga0099826_10000024 | 3300006948 | Bacteria | 148974 |
| 277 | Ga0075435_100031259 | 3300007076 | Bacteria | 4193 |
| 278 | Ga0105251_10010131 | 3300009011 | Bacteria | 5495 |
| 279 | Ga0105251_10027169 | 3300009011 | Bacteria | 2906 |
| 280 | Ga0105251_10039647 | 3300009011 | Bacteria | 2300 |
| 281 | Ga0105251_10053947 | 3300009011 | Bacteria | 1910 |
| 282 | Ga0105244_10095626 | 3300009036 | Bacteria | 1457 |
| 283 | Ga0105244_10129506 | 3300009036 | Bacteria | 1218 |
| 284 | Ga0105250_10050101 | 3300009092 | Bacteria | 1675 |
| 285 | Ga0105250_10051084 | 3300009092 | Bacteria | 1659 |
| 286 | Ga0105250_10079808 | 3300009092 | Bacteria | 1326 |
| 287 | Ga0105250_10493009 | 3300009092 | Bacteria | 555 |
| 288 | Ga0105240_10063879 | 3300009093 | Bacteria | 4577 |
| 289 | Ga0105240_10103920 | 3300009093 | Bacteria | 3450 |
| 290 | Ga0105240_10108670 | 3300009093 | Bacteria | 3360 |
| 291 | Ga0105240_10407148 | 3300009093 | Bacteria | 1531 |
| 292 | Ga0105240_10456788 | 3300009093 | Bacteria | 1428 |
| 293 | Ga0105240_10661229 | 3300009093 | Bacteria | 1144 |
| 294 | Ga0111539_10009725 | 3300009094 | Bacteria | 12138 |
| 295 | Ga0111539_10063652 | 3300009094 | Bacteria | 4364 |
| 296 | Ga0105245_10323321 | 3300009098 | Bacteria | 1520 |
| 297 | Ga0105245_11159602 | 3300009098 | Bacteria | 820 |
| 298 | Ga0105247_10248107 | 3300009101 | Bacteria | 1216 |
| 299 | Ga0114129_10905627 | 3300009147 | Bacteria | 1117 |
| 300 | Ga0114129_11391926 | 3300009147 | Bacteria | 866 |
| 301 | Ga0105243_10006860 | 3300009148 | Bacteria | 8779 |
| 302 | Ga0105243_10168772 | 3300009148 | Bacteria | 1893 |
| 303 | Ga0105243_10233819 | 3300009148 | Bacteria | 1632 |
| 304 | Ga0105243_10413272 | 3300009148 | Bacteria | 1256 |
| 305 | Ga0105241_10021276 | 3300009174 | Bacteria | 4793 |
| 306 | Ga0105241_10177715 | 3300009174 | Bacteria | 1763 |
| 307 | Ga0105241_10799341 | 3300009174 | Bacteria | 869 |
| 308 | Ga0105241_12077056 | 3300009174 | Bacteria | 561 |
| 309 | Ga0105242_10702387 | 3300009176 | Bacteria | 990 |
| 310 | Ga0105248_10010314 | 3300009177 | Bacteria | 10284 |
| 311 | Ga0105248_10015430 | 3300009177 | Bacteria | 8421 |
| 312 | Ga0105248_10091471 | 3300009177 | Bacteria | 3427 |
| 313 | Ga0105248_10393633 | 3300009177 | Bacteria | 1560 |
| 314 | Ga0105248_10562764 | 3300009177 | Bacteria | 1286 |
| 315 | Ga0105248_10930503 | 3300009177 | Bacteria | 982 |
| 316 | Ga0105248_11153309 | 3300009177 | Bacteria | 876 |
| 317 | Ga0105237_10056847 | 3300009545 | Bacteria | 3915 |
| 318 | Ga0105237_10137397 | 3300009545 | Bacteria | 2438 |
| 319 | Ga0105237_10145717 | 3300009545 | Bacteria | 2363 |
| 320 | Ga0105237_11052499 | 3300009545 | Bacteria | 820 |
| 321 | Ga0105238_10003065 | 3300009551 | Bacteria | 16659 |
| 322 | Ga0105238_10478980 | 3300009551 | Bacteria | 1244 |
| 323 | Ga0105238_10910308 | 3300009551 | Bacteria | 898 |
| 324 | Ga0105238_11215312 | 3300009551 | Bacteria | 778 |
| 325 | Ga0105239_10057421 | 3300010375 | Bacteria | 4269 |
| 326 | Ga0105239_10143140 | 3300010375 | Bacteria | 2665 |
| 327 | Ga0105239_10325011 | 3300010375 | Bacteria | 1735 |
| 328 | Ga0105239_11049668 | 3300010375 | Bacteria | 937 |
| 329 | Ga0105246_10193299 | 3300011119 | Bacteria | 1577 |
| 330 | Ga0105246_10212712 | 3300011119 | Bacteria | 1510 |
| 331 | Ga0105246_10681807 | 3300011119 | Bacteria | 898 |
| 332 | Ga0157318_1017671 | 3300012482 | Bacteria | 604 |
| 333 | Ga0157325_1002140 | 3300012485 | Bacteria | 980 |
| 334 | Ga0157341_1023988 | 3300012494 | Bacteria | 620 |
| 335 | Ga0157327_1046759 | 3300012512 | Bacteria | 602 |
| 336 | Ga0154012_136784 | 3300013059 | Bacteria | 2113 |
| 337 | Ga0157373_10015732 | 3300013100 | Bacteria | 5524 |
| 338 | Ga0157371_10036577 | 3300013102 | Bacteria | 3515 |
| 339 | Ga0157371_10054196 | 3300013102 | Bacteria | 2848 |
| 340 | Ga0157371_10058062 | 3300013102 | Bacteria | 2745 |
| 341 | Ga0157370_10062522 | 3300013104 | Bacteria | 3530 |
| 342 | Ga0157370_10069903 | 3300013104 | Bacteria | 3316 |
| 343 | Ga0157370_10872950 | 3300013104 | Bacteria | 817 |
| 344 | Ga0157369_10078496 | 3300013105 | Bacteria | 3537 |
| 345 | Ga0157369_10088073 | 3300013105 | Bacteria | 3314 |
| 346 | Ga0157369_10088210 | 3300013105 | Bacteria | 3311 |
| 347 | Ga0157369_10093282 | 3300013105 | Bacteria | 3214 |
| 348 | Ga0157369_10188597 | 3300013105 | Bacteria | 2167 |
| 349 | Ga0157369_10450338 | 3300013105 | Bacteria | 1333 |
| 350 | Ga0157374_10000466 | 3300013296 | Bacteria | 36782 |
| 351 | Ga0157374_10032559 | 3300013296 | Bacteria | 4748 |
| 352 | Ga0157374_10069107 | 3300013296 | Bacteria | 3325 |
| 353 | Ga0157374_10130817 | 3300013296 | Bacteria | 2429 |
| 354 | Ga0157378_10027087 | 3300013297 | Bacteria | 5057 |
| 355 | Ga0157378_10097687 | 3300013297 | Bacteria | 2677 |
| 356 | Ga0157378_10140170 | 3300013297 | Bacteria | 2245 |
| 357 | Ga0157378_12622117 | 3300013297 | Bacteria | 556 |
| 358 | Ga0163162_10076123 | 3300013306 | Bacteria | 3417 |
| 359 | Ga0163162_10086678 | 3300013306 | Bacteria | 3209 |
| 360 | Ga0163162_11126646 | 3300013306 | Bacteria | 889 |
| 361 | Ga0163162_11245599 | 3300013306 | Bacteria | 845 |
| 362 | Ga0157372_10023322 | 3300013307 | Bacteria | 6707 |
| 363 | Ga0157372_10381065 | 3300013307 | Bacteria | 1643 |
| 364 | Ga0157372_11235545 | 3300013307 | Bacteria | 863 |
| 365 | Ga0157375_10099540 | 3300013308 | Bacteria | 2987 |
| 366 | Ga0157375_10411520 | 3300013308 | Bacteria | 1519 |
| 367 | Ga0157375_10514513 | 3300013308 | Bacteria | 1360 |
| 368 | Ga0157375_11027771 | 3300013308 | Bacteria | 963 |
| 369 | Ga0157375_12256222 | 3300013308 | Bacteria | 649 |
| 370 | Ga0163163_10694503 | 3300014325 | Bacteria | 1081 |
| 371 | Ga0163163_10812622 | 3300014325 | Bacteria | 998 |
| 372 | Ga0182008_10003186 | 3300014497 | Bacteria | 10028 |
| 373 | Ga0182008_10079122 | 3300014497 | Bacteria | 1617 |
| 374 | Ga0157376_10069893 | 3300014969 | Bacteria | 2979 |
| 375 | Ga0157376_10493710 | 3300014969 | Bacteria | 1202 |
| 376 | Ga0157376_11933336 | 3300014969 | Bacteria | 627 |
| 377 | Ga0157376_12048211 | 3300014969 | Bacteria | 610 |
| 378 | Ga0182006_1000240 | 3300015261 | Bacteria | 51334 |
| 379 | Ga0182006_1009882 | 3300015261 | Bacteria | 4266 |
| 380 | Ga0182006_1041809 | 3300015261 | Bacteria | 1798 |
| 381 | Ga0182006_1235790 | 3300015261 | Bacteria | 602 |
| 382 | Ga0182007_10012896 | 3300015262 | Bacteria | 3204 |
| 383 | Ga0182007_10021036 | 3300015262 | Bacteria | 2322 |
| 384 | Ga0182007_10039882 | 3300015262 | Bacteria | 1569 |
| 385 | Ga0182005_1000016 | 3300015265 | Bacteria | 346889 |
| 386 | Ga0183361_10015 | 3300016635 | Bacteria | 166772 |
| 387 | Ga0184593_113785 | 3300019179 | Bacteria | 1316 |
| 388 | Ga0184594_128061 | 3300019181 | Bacteria | 2351 |
| 389 | Ga0197907_10133130 | 3300020069 | Bacteria | 3203 |
| 390 | Ga0197907_11250558 | 3300020069 | Bacteria | 757 |
| 391 | Ga0206356_10498037 | 3300020070 | Bacteria | 8711 |
| 392 | Ga0206356_10847300 | 3300020070 | Bacteria | 1439 |
| 393 | Ga0206355_1030836 | 3300020076 | Bacteria | 4092 |
| 394 | Ga0206355_1157373 | 3300020076 | Bacteria | 1847 |
| 395 | Ga0206355_1331117 | 3300020076 | Bacteria | 1480 |
| 396 | Ga0206355_1594134 | 3300020076 | Bacteria | 852 |
| 397 | Ga0206355_1647216 | 3300020076 | Bacteria | 1384 |
| 398 | Ga0206351_10165518 | 3300020077 | Bacteria | 2290 |
| 399 | Ga0206351_10211974 | 3300020077 | Bacteria | 1162 |
| 400 | Ga0206352_11278378 | 3300020078 | Bacteria | 1040 |
| 401 | Ga0206350_10425581 | 3300020080 | Bacteria | 3340 |
| 402 | Ga0206350_10705675 | 3300020080 | Bacteria | 3953 |
| 403 | Ga0206350_11246990 | 3300020080 | Bacteria | 2177 |
| 404 | Ga0206354_10086599 | 3300020081 | Bacteria | 3665 |
| 405 | Ga0206354_11361223 | 3300020081 | Bacteria | 3291 |
| 406 | Ga0206354_11564442 | 3300020081 | Bacteria | 2672 |
| 407 | Ga0206353_10280775 | 3300020082 | Bacteria | 2088 |
| 408 | Ga0206353_10343767 | 3300020082 | Bacteria | 2679 |
| 409 | Ga0206353_11104472 | 3300020082 | Bacteria | 2372 |
| 410 | Ga0154015_1522148 | 3300020610 | Bacteria | 1971 |
| 411 | Ga0154015_1692537 | 3300020610 | Bacteria | 4101 |
| 412 | Ga0213872_10010693 | 3300021361 | Bacteria | 4359 |
| 413 | Ga0213872_10047302 | 3300021361 | Bacteria | 1956 |
| 414 | Ga0213872_10332396 | 3300021361 | Bacteria | 626 |
| 415 | Ga0224712_10002193 | 3300022467 | Bacteria | 4763 |
| 416 | Ga0224712_10060966 | 3300022467 | Bacteria | 1503 |
| 417 | Ga0224712_10125668 | 3300022467 | Bacteria | 1115 |
| 418 | Ga0247514_106419 | 3300023560 | Bacteria | 1381 |
| 419 | Ga0209436_100401 | 3300025208 | Bacteria | 19545 |
| 420 | Ga0209784_100052 | 3300025224 | Bacteria | 182783 |
| 421 | Ga0209784_103737 | 3300025224 | Bacteria | 1213 |
| 422 | Ga0209566_100068 | 3300025225 | Bacteria | 177484 |
| 423 | Ga0209566_100801 | 3300025225 | Bacteria | 16448 |
| 424 | Ga0209566_102355 | 3300025225 | Bacteria | 3595 |
| 425 | Ga0209566_108979 | 3300025225 | Bacteria | 1059 |
| 426 | Ga0209674_100087 | 3300025226 | Bacteria | 182783 |
| 427 | Ga0209674_100153 | 3300025226 | Bacteria | 94333 |
| 428 | Ga0209674_102800 | 3300025226 | Bacteria | 3515 |
| 429 | Ga0209674_103913 | 3300025226 | Bacteria | 2577 |
| 430 | Ga0209674_105404 | 3300025226 | Bacteria | 1893 |
| 431 | Ga0209672_100073 | 3300025228 | Bacteria | 166621 |
| 432 | Ga0209672_100276 | 3300025228 | Bacteria | 37317 |
| 433 | Ga0209672_100383 | 3300025228 | Bacteria | 26965 |
| 434 | Ga0209672_102256 | 3300025228 | Bacteria | 4964 |
| 435 | Ga0209672_102285 | 3300025228 | Bacteria | 4911 |
| 436 | Ga0209672_116278 | 3300025228 | Bacteria | 813 |
| 437 | Ga0209147_100090 | 3300025229 | Bacteria | 176176 |
| 438 | Ga0209147_100093 | 3300025229 | Bacteria | 167196 |
| 439 | Ga0209147_102318 | 3300025229 | Bacteria | 4911 |
| 440 | Ga0209563_100011 | 3300025230 | Bacteria | 1187808 |
| 441 | Ga0209563_100373 | 3300025230 | Bacteria | 16406 |
| 442 | Ga0209563_100470 | 3300025230 | Bacteria | 13814 |
| 443 | Ga0209563_119837 | 3300025230 | Bacteria | 765 |
| 444 | Ga0207427_100807 | 3300025231 | Bacteria | 14176 |
| 445 | Ga0209437_103924 | 3300025233 | Bacteria | 2645 |
| 446 | Ga0209258_100130 | 3300025242 | Bacteria | 176078 |
| 447 | Ga0209258_100140 | 3300025242 | Bacteria | 167245 |
| 448 | Ga0209258_102394 | 3300025242 | Bacteria | 4911 |
| 449 | Ga0209258_103856 | 3300025242 | Bacteria | 3054 |
| 450 | Ga0207425_1000021 | 3300025245 | Bacteria | 367537 |
| 451 | Ga0207425_1000845 | 3300025245 | Bacteria | 15112 |
| 452 | Ga0207425_1000932 | 3300025245 | Bacteria | 13905 |
| 453 | Ga0209646_1000068 | 3300025246 | Bacteria | 233765 |
| 454 | Ga0209646_1000119 | 3300025246 | Bacteria | 147427 |
| 455 | Ga0209677_100043 | 3300025253 | Bacteria | 222331 |
| 456 | Ga0209677_107281 | 3300025253 | Bacteria | 2389 |
| 457 | Ga0209148_1000119 | 3300025254 | Bacteria | 188079 |
| 458 | Ga0209148_1000140 | 3300025254 | Bacteria | 166819 |
| 459 | Ga0209148_1000444 | 3300025254 | Bacteria | 45400 |
| 460 | Ga0209148_1001671 | 3300025254 | Bacteria | 9966 |
| 461 | Ga0209759_1001723 | 3300025256 | Bacteria | 11286 |
| 462 | Ga0209759_1004738 | 3300025256 | Bacteria | 4974 |
| 463 | Ga0209759_1008563 | 3300025256 | Bacteria | 3175 |
| 464 | Ga0209759_1010191 | 3300025256 | Bacteria | 2773 |
| 465 | Ga0209759_1012475 | 3300025256 | Bacteria | 2352 |
| 466 | Ga0209759_1014574 | 3300025256 | Bacteria | 2071 |
| 467 | Ga0209759_1014581 | 3300025256 | Bacteria | 2071 |
| 468 | Ga0209759_1026805 | 3300025256 | Bacteria | 1201 |
| 469 | Ga0209129_1000020 | 3300025258 | Bacteria | 457053 |
| 470 | Ga0209233_1000173 | 3300025261 | Bacteria | 145995 |
| 471 | Ga0209565_1000123 | 3300025263 | Bacteria | 111069 |
| 472 | Ga0209565_1001042 | 3300025263 | Bacteria | 14043 |
| 473 | Ga0209565_1003095 | 3300025263 | Bacteria | 5581 |
| 474 | Ga0209455_1000070 | 3300025272 | Bacteria | 307867 |
| 475 | Ga0209455_1000119 | 3300025272 | Bacteria | 174994 |
| 476 | Ga0209455_1000125 | 3300025272 | Bacteria | 166819 |
| 477 | Ga0209455_1000244 | 3300025272 | Bacteria | 67136 |
| 478 | Ga0209455_1001216 | 3300025272 | Bacteria | 12270 |
| 479 | Ga0209673_1000040 | 3300025273 | Bacteria | 312633 |
| 480 | Ga0209673_1000098 | 3300025273 | Bacteria | 193352 |
| 481 | Ga0209673_1004818 | 3300025273 | Bacteria | 7072 |
| 482 | Ga0209673_1112596 | 3300025273 | Bacteria | 567 |
| 483 | Ga0209130_1000290 | 3300025284 | Bacteria | 61271 |
| 484 | Ga0209130_1002182 | 3300025284 | Bacteria | 10312 |
| 485 | Ga0209675_1000117 | 3300025291 | Bacteria | 111087 |
| 486 | Ga0209675_1002785 | 3300025291 | Bacteria | 8724 |
| 487 | Ga0209025_1000039 | 3300025294 | Bacteria | 377396 |
| 488 | Ga0209025_1011110 | 3300025294 | Bacteria | 5993 |
| 489 | Ga0209564_1000027 | 3300025295 | Bacteria | 518458 |
| 490 | Ga0209564_1000047 | 3300025295 | Bacteria | 368031 |
| 491 | Ga0209564_1000121 | 3300025295 | Bacteria | 204081 |
| 492 | Ga0209564_1002740 | 3300025295 | Bacteria | 13260 |
| 493 | Ga0209564_1006738 | 3300025295 | Bacteria | 6100 |
| 494 | Ga0209564_1032951 | 3300025295 | Bacteria | 1549 |
| 495 | Ga0209564_1041569 | 3300025295 | Bacteria | 1231 |
| 496 | Ga0209758_1000077 | 3300025297 | Bacteria | 268195 |
| 497 | Ga0209758_1000322 | 3300025297 | Bacteria | 92458 |
| 498 | Ga0209050_1000050 | 3300025298 | Bacteria | 362578 |
| 499 | Ga0209050_1002922 | 3300025298 | Bacteria | 13390 |
| 500 | Ga0209256_1000054 | 3300025299 | Bacteria | 298431 |
| 501 | Ga0209256_1001933 | 3300025299 | Bacteria | 18898 |
| 502 | Ga0209256_1002719 | 3300025299 | Bacteria | 13723 |
| 503 | Ga0209256_1024911 | 3300025299 | Bacteria | 1753 |
| 504 | Ga0209256_1058574 | 3300025299 | Bacteria | 905 |
| 505 | Ga0207426_1000199 | 3300025302 | Bacteria | 145826 |
| 506 | Ga0207426_1000802 | 3300025302 | Bacteria | 34010 |
| 507 | Ga0207426_1010681 | 3300025302 | Bacteria | 3549 |
| 508 | Ga0207426_1047907 | 3300025302 | Bacteria | 1287 |
| 509 | Ga0209051_1052723 | 3300025303 | Bacteria | 1341 |
| 510 | Ga0209051_1053753 | 3300025303 | Bacteria | 1320 |
| 511 | Ga0209257_1000075 | 3300025304 | Bacteria | 324855 |
| 512 | Ga0207656_10080640 | 3300025321 | Bacteria | 1462 |
| 513 | Ga0207656_10187581 | 3300025321 | Bacteria | 995 |
| 514 | Ga0207696_1020741 | 3300025711 | Bacteria | 2112 |
| 515 | Ga0207696_1166247 | 3300025711 | Bacteria | 586 |
| 516 | Ga0207696_1181955 | 3300025711 | Bacteria | 555 |
| 517 | Ga0207655_1000499 | 3300025728 | Bacteria | 50341 |
| 518 | Ga0207713_1004623 | 3300025735 | Bacteria | 8892 |
| 519 | Ga0207713_1005407 | 3300025735 | Bacteria | 7998 |
| 520 | Ga0207713_1023386 | 3300025735 | Bacteria | 2909 |
| 521 | Ga0207710_10161546 | 3300025900 | Bacteria | 1092 |
| 522 | Ga0207680_10163642 | 3300025903 | Bacteria | 1494 |
| 523 | Ga0207680_10716637 | 3300025903 | Bacteria | 717 |
| 524 | Ga0207647_10004870 | 3300025904 | Bacteria | 9917 |
| 525 | Ga0207647_10007364 | 3300025904 | Bacteria | 7955 |
| 526 | Ga0207647_10104384 | 3300025904 | Bacteria | 1680 |
| 527 | Ga0207643_10273624 | 3300025908 | Bacteria | 1046 |
| 528 | Ga0207705_10004265 | 3300025909 | Bacteria | 10829 |
| 529 | Ga0207705_10011628 | 3300025909 | Bacteria | 6360 |
| 530 | Ga0207705_10060061 | 3300025909 | Bacteria | 2745 |
| 531 | Ga0207705_10103487 | 3300025909 | Bacteria | 2097 |
| 532 | Ga0207705_10122104 | 3300025909 | Bacteria | 1934 |
| 533 | Ga0207684_10223837 | 3300025910 | Bacteria | 1624 |
| 534 | Ga0207684_10567778 | 3300025910 | Bacteria | 970 |
| 535 | Ga0207654_10002111 | 3300025911 | Bacteria | 10175 |
| 536 | Ga0207654_10090331 | 3300025911 | Bacteria | 1865 |
| 537 | Ga0207654_10395591 | 3300025911 | Bacteria | 960 |
| 538 | Ga0207654_10496717 | 3300025911 | Bacteria | 861 |
| 539 | Ga0207695_10008376 | 3300025913 | Bacteria | 12952 |
| 540 | Ga0207695_10027074 | 3300025913 | Bacteria | 6388 |
| 541 | Ga0207695_10035527 | 3300025913 | Bacteria | 5403 |
| 542 | Ga0207695_10227793 | 3300025913 | Bacteria | 1769 |
| 543 | Ga0207695_10246637 | 3300025913 | Bacteria | 1686 |
| 544 | Ga0207695_10269527 | 3300025913 | Bacteria | 1598 |
| 545 | Ga0207695_11012665 | 3300025913 | Bacteria | 710 |
| 546 | Ga0207695_11263733 | 3300025913 | Bacteria | 619 |
| 547 | Ga0207671_10004456 | 3300025914 | Bacteria | 13379 |
| 548 | Ga0207671_10201201 | 3300025914 | Bacteria | 1556 |
| 549 | Ga0207671_10215175 | 3300025914 | Bacteria | 1504 |
| 550 | Ga0207660_10011879 | 3300025917 | Bacteria | 5680 |
| 551 | Ga0207662_10615472 | 3300025918 | Bacteria | 756 |
| 552 | Ga0207657_10014049 | 3300025919 | Bacteria | 7833 |
| 553 | Ga0207657_10030110 | 3300025919 | Bacteria | 4931 |
| 554 | Ga0207657_10044711 | 3300025919 | Bacteria | 3891 |
| 555 | Ga0207657_10377992 | 3300025919 | Bacteria | 1116 |
| 556 | Ga0207649_10000490 | 3300025920 | Bacteria | 28067 |
| 557 | Ga0207649_10023804 | 3300025920 | Bacteria | 3551 |
| 558 | Ga0207652_10090095 | 3300025921 | Bacteria | 2694 |
| 559 | Ga0207652_10434543 | 3300025921 | Bacteria | 1184 |
| 560 | Ga0207646_10808223 | 3300025922 | Bacteria | 835 |
| 561 | Ga0207694_10002733 | 3300025924 | Bacteria | 14269 |
| 562 | Ga0207694_10045423 | 3300025924 | Bacteria | 3393 |
| 563 | Ga0207694_10100374 | 3300025924 | Bacteria | 2293 |
| 564 | Ga0207694_10108713 | 3300025924 | Bacteria | 2204 |
| 565 | Ga0207650_10291854 | 3300025925 | Bacteria | 1330 |
| 566 | Ga0207659_10648536 | 3300025926 | Bacteria | 902 |
| 567 | Ga0207687_10187681 | 3300025927 | Bacteria | 1606 |
| 568 | Ga0207687_10444164 | 3300025927 | Bacteria | 1075 |
| 569 | Ga0207664_11036144 | 3300025929 | Bacteria | 735 |
| 570 | Ga0207644_10095363 | 3300025931 | Bacteria | 2225 |
| 571 | Ga0207644_10560838 | 3300025931 | Bacteria | 946 |
| 572 | Ga0207690_10000040 | 3300025932 | Bacteria | 130300 |
| 573 | Ga0207690_10048382 | 3300025932 | Bacteria | 2827 |
| 574 | Ga0207690_10182111 | 3300025932 | Bacteria | 1583 |
| 575 | Ga0207690_10375638 | 3300025932 | Bacteria | 1129 |
| 576 | Ga0207690_10619049 | 3300025932 | Bacteria | 885 |
| 577 | Ga0207690_10823820 | 3300025932 | Bacteria | 768 |
| 578 | Ga0207706_10008025 | 3300025933 | Bacteria | 9741 |
| 579 | Ga0207686_10724498 | 3300025934 | Bacteria | 792 |
| 580 | Ga0207709_10001005 | 3300025935 | Bacteria | 20902 |
| 581 | Ga0207709_10020009 | 3300025935 | Bacteria | 3772 |
| 582 | Ga0207709_10115312 | 3300025935 | Bacteria | 1804 |
| 583 | Ga0207704_10176248 | 3300025938 | Bacteria | 1540 |
| 584 | Ga0207704_10836131 | 3300025938 | Bacteria | 771 |
| 585 | Ga0207704_11259073 | 3300025938 | Bacteria | 632 |
| 586 | Ga0207711_10057542 | 3300025941 | Bacteria | 3342 |
| 587 | Ga0207711_10105192 | 3300025941 | Bacteria | 2502 |
| 588 | Ga0207711_10582575 | 3300025941 | Bacteria | 1044 |
| 589 | Ga0207711_10745958 | 3300025941 | Bacteria | 913 |
| 590 | Ga0207689_10000370 | 3300025942 | Bacteria | 42422 |
| 591 | Ga0207689_10056742 | 3300025942 | Bacteria | 3223 |
| 592 | Ga0207689_10943752 | 3300025942 | Bacteria | 728 |
| 593 | Ga0207689_10951974 | 3300025942 | Bacteria | 724 |
| 594 | Ga0207679_10000032 | 3300025945 | Bacteria | 158845 |
| 595 | Ga0207679_10108686 | 3300025945 | Bacteria | 2184 |
| 596 | Ga0207679_10237693 | 3300025945 | Bacteria | 1542 |
| 597 | Ga0207679_11677414 | 3300025945 | Bacteria | 582 |
| 598 | Ga0207667_10006131 | 3300025949 | Bacteria | 14607 |
| 599 | Ga0207667_10009212 | 3300025949 | Bacteria | 11656 |
| 600 | Ga0207667_10015897 | 3300025949 | Bacteria | 8521 |
| 601 | Ga0207667_10128204 | 3300025949 | Bacteria | 2613 |
| 602 | Ga0207667_10384789 | 3300025949 | Bacteria | 1429 |
| 603 | Ga0207651_10446093 | 3300025960 | Bacteria | 1109 |
| 604 | Ga0207651_10469680 | 3300025960 | Bacteria | 1082 |
| 605 | Ga0207651_10764166 | 3300025960 | Bacteria | 855 |
| 606 | Ga0207668_11173430 | 3300025972 | Bacteria | 690 |
| 607 | Ga0207640_10001991 | 3300025981 | Bacteria | 11019 |
| 608 | Ga0207640_10022226 | 3300025981 | Bacteria | 3792 |
| 609 | Ga0207658_10165595 | 3300025986 | Bacteria | 1816 |
| 610 | Ga0207658_10257424 | 3300025986 | Bacteria | 1486 |
| 611 | Ga0207658_11175935 | 3300025986 | Bacteria | 701 |
| 612 | Ga0207677_10006249 | 3300026023 | Bacteria | 6514 |
| 613 | Ga0207703_10041315 | 3300026035 | Bacteria | 3694 |
| 614 | Ga0207678_10000024 | 3300026067 | Bacteria | 125239 |
| 615 | Ga0207678_10003236 | 3300026067 | Bacteria | 14714 |
| 616 | Ga0207678_10043906 | 3300026067 | Bacteria | 3867 |
| 617 | Ga0207678_10238626 | 3300026067 | Bacteria | 1557 |
| 618 | Ga0207678_10248922 | 3300026067 | Bacteria | 1522 |
| 619 | Ga0207678_10381905 | 3300026067 | Bacteria | 1218 |
| 620 | Ga0207702_10000973 | 3300026078 | Bacteria | 29351 |
| 621 | Ga0207702_10185671 | 3300026078 | Bacteria | 1917 |
| 622 | Ga0207641_10789388 | 3300026088 | Bacteria | 939 |
| 623 | Ga0207648_10002176 | 3300026089 | Bacteria | 21281 |
| 624 | Ga0207648_10873460 | 3300026089 | Bacteria | 839 |
| 625 | Ga0207676_10231338 | 3300026095 | Bacteria | 1653 |
| 626 | Ga0207676_10813761 | 3300026095 | Bacteria | 912 |
| 627 | Ga0207676_11424445 | 3300026095 | Bacteria | 689 |
| 628 | Ga0207674_10003250 | 3300026116 | Bacteria | 20001 |
| 629 | Ga0207674_10033169 | 3300026116 | Bacteria | 5406 |
| 630 | Ga0207674_10173522 | 3300026116 | Bacteria | 2109 |
| 631 | Ga0207675_101338134 | 3300026118 | Bacteria | 737 |
| 632 | Ga0207683_10065088 | 3300026121 | Bacteria | 3213 |
| 633 | Ga0207683_10148309 | 3300026121 | Bacteria | 2116 |
| 634 | Ga0207683_10228973 | 3300026121 | Bacteria | 1694 |
| 635 | Ga0207683_10351656 | 3300026121 | Bacteria | 1352 |
| 636 | Ga0207683_10505174 | 3300026121 | Bacteria | 1117 |
| 637 | Ga0207698_10017410 | 3300026142 | Bacteria | 4874 |
| 638 | Ga0207698_10023299 | 3300026142 | Bacteria | 4323 |
| 639 | Ga0207698_10790935 | 3300026142 | Bacteria | 950 |
| 640 | Ga0207698_11334281 | 3300026142 | Bacteria | 732 |
| 641 | Ga0209281_1002282 | 3300027111 | Bacteria | 8082 |
| 642 | Ga0209371_1000325 | 3300027312 | Bacteria | 52216 |
| 643 | Ga0209371_1000766 | 3300027312 | Bacteria | 26728 |
| 644 | Ga0209371_1003600 | 3300027312 | Bacteria | 7407 |
| 645 | Ga0209282_1000032 | 3300027666 | Bacteria | 149218 |
| 646 | Ga0209282_1000072 | 3300027666 | Bacteria | 81137 |
| 647 | Ga0209813_10001024 | 3300027866 | Bacteria | 6287 |
| 648 | Ga0209974_10092867 | 3300027876 | Bacteria | 1048 |
| 649 | Ga0207428_10008382 | 3300027907 | Bacteria | 9335 |
| 650 | Ga0268266_10117830 | 3300028379 | Bacteria | 2360 |
| 651 | Ga0268265_10565558 | 3300028380 | Bacteria | 1081 |
| 652 | Ga0268265_10897546 | 3300028380 | Bacteria | 870 |
| 653 | Ga0265336_10000618 | 3300028666 | Bacteria | 19547 |
| 654 | Ga0307515_10067022 | 3300028794 | Bacteria | 4959 |
| 655 | Ga0307515_10084890 | 3300028794 | Bacteria | 4059 |
| 656 | Ga0307515_10119204 | 3300028794 | Bacteria | 3004 |
| 657 | Ga0307515_10276308 | 3300028794 | Bacteria | 1393 |
| 658 | Ga0265338_10004608 | 3300028800 | Bacteria | 18530 |
| 659 | Ga0265338_10005463 | 3300028800 | Bacteria | 16588 |
| 660 | Ga0265324_10000002 | 3300029957 | Bacteria | 382754 |
| 661 | Ga0265324_10000500 | 3300029957 | Bacteria | 27131 |
| 662 | Ga0268256_1001275 | 3300030500 | Bacteria | 15647 |
| 663 | Ga0268256_1002981 | 3300030500 | Bacteria | 8011 |
| 664 | Ga0307512_10116329 | 3300030522 | Bacteria | 1738 |
| 665 | Ga0316176_1210209 | 3300030732 | Bacteria | 1192 |
| 666 | Ga0314311_1150818 | 3300030733 | Bacteria | 1473 |
| 667 | Ga0316179_1017842 | 3300030734 | Bacteria | 1012 |
| 668 | Ga0316178_1040944 | 3300030735 | Bacteria | 1141 |
| 669 | Ga0316180_1026989 | 3300030736 | Bacteria | 4122 |
| 670 | Ga0316183_1084783 | 3300030742 | Bacteria | 1538 |
| 671 | Ga0316181_1091528 | 3300030744 | Bacteria | 717 |
| 672 | Ga0316182_1108504 | 3300030745 | Bacteria | 3080 |
| 673 | Ga0316182_1184435 | 3300030745 | Bacteria | 617 |
| 674 | Ga0316182_1433823 | 3300030745 | Bacteria | 630 |
| 675 | Ga0265767_100009 | 3300030836 | Bacteria | 6118 |
| 676 | Ga0265766_1000099 | 3300030863 | Bacteria | 2843 |
| 677 | Ga0265766_1000407 | 3300030863 | Bacteria | 1830 |
| 678 | Ga0265766_1000435 | 3300030863 | Bacteria | 1791 |
| 679 | Ga0265766_1000731 | 3300030863 | Bacteria | 1481 |
| 680 | Ga0265766_1003268 | 3300030863 | Bacteria | 938 |
| 681 | Ga0265769_100464 | 3300030888 | Bacteria | 1672 |
| 682 | Ga0265769_100729 | 3300030888 | Bacteria | 1415 |
| 683 | Ga0265769_102846 | 3300030888 | Bacteria | 932 |
| 684 | Ga0265769_113786 | 3300030888 | Bacteria | 586 |
| 685 | Ga0265768_100424 | 3300030963 | Bacteria | 1645 |
| 686 | Ga0265773_1008002 | 3300031018 | Bacteria | 838 |
| 687 | Ga0265328_10003595 | 3300031239 | Bacteria | 6839 |
| 688 | Ga0265331_10000050 | 3300031250 | Bacteria | 181286 |
| 689 | Ga0265331_10003466 | 3300031250 | Bacteria | 10177 |
| 690 | Ga0265327_10000109 | 3300031251 | Bacteria | 181275 |
| 691 | Ga0265327_10000161 | 3300031251 | Bacteria | 144768 |
| 692 | Ga0265327_10000178 | 3300031251 | Bacteria | 135732 |
| 693 | Ga0265327_10009306 | 3300031251 | Bacteria | 7110 |
| 694 | Ga0265327_10028075 | 3300031251 | Bacteria | 3226 |
| 695 | Ga0265327_10098857 | 3300031251 | Bacteria | 1411 |
| 696 | Ga0265316_10067921 | 3300031344 | Bacteria | 2756 |
| 697 | Ga0265316_10182264 | 3300031344 | Bacteria | 1563 |
| 698 | Ga0265316_10503563 | 3300031344 | Bacteria | 865 |
| 699 | Ga0307513_10011808 | 3300031456 | Bacteria | 10825 |
| 700 | Ga0307513_10124367 | 3300031456 | Bacteria | 2539 |
| 701 | Ga0307513_10769558 | 3300031456 | Bacteria | 668 |
| 702 | Ga0307509_10109747 | 3300031507 | Bacteria | 2767 |
| 703 | Ga0307509_10192810 | 3300031507 | Bacteria | 1886 |
| 704 | Ga0307509_10286613 | 3300031507 | Bacteria | 1404 |
| 705 | Ga0307408_100000089 | 3300031548 | Bacteria | 100712 |
| 706 | Ga0307408_100001167 | 3300031548 | Bacteria | 19940 |
| 707 | Ga0307408_100004683 | 3300031548 | Bacteria | 9240 |
| 708 | Ga0307408_100292357 | 3300031548 | Bacteria | 1361 |
| 709 | Ga0307408_100297420 | 3300031548 | Bacteria | 1350 |
| 710 | Ga0307408_100477718 | 3300031548 | Bacteria | 1087 |
| 711 | Ga0307408_100820655 | 3300031548 | Bacteria | 845 |
| 712 | Ga0316575_10000771 | 3300031665 | Bacteria | 9685 |
| 713 | Ga0316575_10038338 | 3300031665 | Bacteria | 1890 |
| 714 | Ga0310111_101033 | 3300031667 | Bacteria | 2830 |
| 715 | Ga0310111_122416 | 3300031667 | Bacteria | 763 |
| 716 | Ga0316579_10026608 | 3300031691 | Bacteria | 2621 |
| 717 | Ga0265314_10158374 | 3300031711 | Bacteria | 1381 |
| 718 | Ga0316576_10029129 | 3300031727 | Bacteria | 3899 |
| 719 | Ga0316578_10033675 | 3300031728 | Bacteria | 2937 |
| 720 | Ga0307516_10583188 | 3300031730 | Bacteria | 772 |
| 721 | Ga0307405_10052007 | 3300031731 | Bacteria | 2545 |
| 722 | Ga0307405_10394290 | 3300031731 | Bacteria | 1082 |
| 723 | Ga0307405_10964520 | 3300031731 | Bacteria | 725 |
| 724 | Ga0316577_10146540 | 3300031733 | Bacteria | 1330 |
| 725 | Ga0247548_101784 | 3300031814 | Bacteria | 896 |
| 726 | Ga0247548_107337 | 3300031814 | Bacteria | 548 |
| 727 | Ga0307518_10004256 | 3300031838 | Bacteria | 10276 |
| 728 | Ga0307410_10632467 | 3300031852 | Bacteria | 896 |
| 729 | Ga0307406_10400159 | 3300031901 | Bacteria | 1088 |
| 730 | Ga0307406_10504504 | 3300031901 | Bacteria | 981 |
| 731 | Ga0307407_10777831 | 3300031903 | Bacteria | 727 |
| 732 | Ga0307412_10000056 | 3300031911 | Bacteria | 145861 |
| 733 | Ga0307412_10011111 | 3300031911 | Bacteria | 5206 |
| 734 | Ga0307412_10507816 | 3300031911 | Bacteria | 1005 |
| 735 | Ga0307416_100002061 | 3300032002 | Bacteria | 11324 |
| 736 | Ga0307416_100003624 | 3300032002 | Bacteria | 9121 |
| 737 | Ga0307416_100006305 | 3300032002 | Bacteria | 7414 |
| 738 | Ga0307416_100212411 | 3300032002 | Bacteria | 1847 |
| 739 | Ga0307411_10233740 | 3300032005 | Bacteria | 1435 |
| 740 | Ga0307411_10411105 | 3300032005 | Bacteria | 1121 |
| 741 | Ga0307411_10487888 | 3300032005 | Bacteria | 1039 |
| 742 | Ga0307411_10724848 | 3300032005 | Bacteria | 869 |
| 743 | Ga0307411_10836349 | 3300032005 | Bacteria | 813 |
| 744 | Ga0307411_11073839 | 3300032005 | Bacteria | 724 |
| 745 | Ga0307415_101279947 | 3300032126 | Bacteria | 694 |
| 746 | Ga0316583_10196422 | 3300032133 | Bacteria | 700 |
| 747 | Ga0316580_10001102 | 3300032139 | Bacteria | 6814 |
| 748 | Ga0316593_10000198 | 3300032168 | Bacteria | 9333 |
| 749 | Ga0316593_10193303 | 3300032168 | Bacteria | 750 |
| 750 | Ga0316593_10223821 | 3300032168 | Bacteria | 699 |
| 751 | Ga0307507_10149043 | 3300033179 | Bacteria | 1767 |
| 752 | Ga0307510_10228403 | 3300033180 | Bacteria | 1366 |
| 753 | Ga0316592_1001786 | 3300033524 | Bacteria | 3582 |
| 754 | Ga0316596_1000040 | 3300033541 | Bacteria | 13770 |
| 755 | Ga0373950_0017579 | 3300034818 | Bacteria | 1233 |
| 756 | Ga0373940_0012763 | 3300035088 | Bacteria | 2018 |
| 757 | Ga0373940_0097521 | 3300035088 | Bacteria | 888 |
| 758 | Ga0373932_0048427 | 3300035112 | Bacteria | 1252 |
| 759 | Ga0373939_0000348 | 3300035114 | Bacteria | 11798 |
| 760 | Ga0373960_0000482 | 3300035121 | Bacteria | 7922 |
| 761 | Ga0373961_0059684 | 3300035241 | Bacteria | 1154 |
| 762 | Ga0373962_0035579 | 3300035242 | Bacteria | 1383 |
| 763 | Ga0316574_0003365 | 3300035398 | Bacteria | 8235 |
| 764 | Ga0373931_0000535 | 3300035691 | Bacteria | 15604 |
| 765 | Ga0373931_0008660 | 3300035691 | Bacteria | 4836 |
| 766 | Ga0373931_0861160 | 3300035691 | Bacteria | 607 |
| 767 | Ga0373947_0765701 | 3300035725 | Bacteria | 659 |
| 768 | Ga0310112_026650 | 3300036458 | Bacteria | 799 |
| 769 | Ga0310109_000061 | 3300036534 | Bacteria | 5065 |
| 770 | Ga0310110_014822 | 3300036535 | Bacteria | 1120 |
| 771 | Ga0395899_0000080 | 3300037312 | Bacteria | 171568 |
| 772 | Ga0395899_0000218 | 3300037312 | Bacteria | 79718 |
| 773 | Ga0395899_0005268 | 3300037312 | Bacteria | 10047 |
| 774 | Ga0395899_0079277 | 3300037312 | Bacteria | 2391 |
| 775 | Ga0395899_0462873 | 3300037312 | Bacteria | 828 |
| 776 | Ga0395900_0000087 | 3300037418 | Bacteria | 171568 |
| 777 | Ga0395900_0103484 | 3300037418 | Bacteria | 2924 |
| 778 | Ga0395900_0104724 | 3300037418 | Bacteria | 2906 |
| 779 | Ga0395900_0682800 | 3300037418 | Bacteria | 961 |
| 780 | Ga0395900_0699378 | 3300037418 | Bacteria | 947 |
| 781 | Ga0395900_1333168 | 3300037418 | Bacteria | 631 |
| 782 | Ga0395900_1707164 | 3300037418 | Bacteria | 540 |
| 783 | Ga0395898_0000448 | 3300037466 | Bacteria | 84953 |
| 784 | Ga0395898_0004701 | 3300037466 | Bacteria | 14859 |
| 785 | Ga0395898_0091559 | 3300037466 | Bacteria | 2925 |
| 786 | Ga0395898_0139979 | 3300037466 | Bacteria | 2316 |
| 787 | Ga0395898_1142440 | 3300037466 | Bacteria | 711 |
| 788 | Ga0395898_1218083 | 3300037466 | Bacteria | 684 |
| 789 | Ga0395905_0001371 | 3300037471 | Bacteria | 29596 |
| 790 | Ga0395905_0002507 | 3300037471 | Bacteria | 20284 |
| 791 | Ga0395905_0097862 | 3300037471 | Bacteria | 2755 |
| 792 | Ga0395905_0173708 | 3300037471 | Bacteria | 2023 |
| 793 | Ga0395905_0177460 | 3300037471 | Bacteria | 1999 |
| 794 | Ga0395901_0000378 | 3300038443 | Bacteria | 53368 |
| 795 | Ga0395901_0062325 | 3300038443 | Bacteria | 3880 |
| 796 | Ga0395901_0207707 | 3300038443 | Bacteria | 2050 |
| 797 | Ga0395901_0565724 | 3300038443 | Bacteria | 1150 |
| 798 | Ga0395901_0798512 | 3300038443 | Bacteria | 933 |
| 799 | Ga0395901_1105207 | 3300038443 | Bacteria | 763 |
| 800 | Ga0395901_1341045 | 3300038443 | Bacteria | 676 |
| 801 | Ga0400490_00437 | 3300038726 | Bacteria | 17578 |
| 802 | Ga0400490_03371 | 3300038726 | Bacteria | 14955 |
| 803 | Ga0400490_46672 | 3300038726 | Bacteria | 1597 |
| 804 | Ga0400491_08907 | 3300038727 | Bacteria | 2331 |
| 805 | Ga0400488_51157 | 3300038741 | Bacteria | 5303 |
| 806 | Ga0400486_01341 | 3300038742 | Bacteria | 7086 |
| 807 | Ga0400486_03874 | 3300038742 | Bacteria | 2575 |
| 808 | Ga0400486_32640 | 3300038742 | Bacteria | 3848 |
| 809 | Ga0400483_035353 | 3300039062 | Bacteria | 8181 |
| 810 | Ga0400483_062435 | 3300039062 | Bacteria | 2108 |
| 811 | Ga0400483_071897 | 3300039062 | Bacteria | 4924 |
| 812 | Ga0400483_074535 | 3300039062 | Bacteria | 1920 |
| 813 | Ga0400483_080413 | 3300039062 | Bacteria | 2696 |
| 814 | Ga0400483_131418 | 3300039062 | Bacteria | 2090 |
| 815 | Ga0400483_159229 | 3300039062 | Bacteria | 2986 |
| 816 | Ga0400483_205660 | 3300039062 | Bacteria | 9867 |
| 817 | Ga0400489_88546 | 3300039093 | Bacteria | 4330 |
| 818 | Ga0436365_1248808 | 3300039437 | Bacteria | 996 |
| 819 | Ga0436360_0476119 | 3300039438 | Bacteria | 2627 |
| 820 | Ga0436361_0141197 | 3300039447 | Bacteria | 3173 |
| 821 | Ga0436361_0378504 | 3300039447 | Bacteria | 3034 |
| 822 | Ga0436361_0575526 | 3300039447 | Bacteria | 1312 |
| 823 | Ga0436361_0830526 | 3300039447 | Bacteria | 3680 |
| 824 | Ga0439436_0003093 | 3300041404 | Bacteria | 5043 |
| 825 | Ga0439436_0101864 | 3300041404 | Bacteria | 801 |
| 826 | Ga0439439_0027171 | 3300041406 | Bacteria | 1445 |
| 827 | Ga0439439_0087288 | 3300041406 | Bacteria | 849 |
| 828 | Ga0439439_0245793 | 3300041406 | Bacteria | 529 |
| 829 | Ga0439447_063185 | 3300041407 | Bacteria | 868 |
| 830 | Ga0439453_0009071 | 3300041408 | Bacteria | 1613 |
| 831 | Ga0439466_0050203 | 3300041411 | Bacteria | 1368 |
| 832 | Ga0439465_0010238 | 3300041413 | Bacteria | 2947 |
| 833 | Ga0439465_0042679 | 3300041413 | Bacteria | 1470 |
| 834 | Ga0439465_0098774 | 3300041413 | Bacteria | 1006 |
| 835 | Ga0451791_0429238 | 3300041451 | Bacteria | 1115 |
| 836 | Ga0451805_077998 | 3300041461 | Bacteria | 694 |
| 837 | Ga0451805_100255 | 3300041461 | Bacteria | 1908 |
| 838 | Ga0451835_1143204 | 3300041492 | Bacteria | 570 |
| 839 | Ga0451841_0463776 | 3300041498 | Bacteria | 702 |
| 840 | Ga0451850_01102 | 3300041506 | Bacteria | 709 |
| 841 | Ga0451850_20986 | 3300041506 | Bacteria | 830 |
| 842 | Ga0451853_0562209 | 3300041512 | Bacteria | 1045 |
| 843 | Ga0452271_59633 | 3300041916 | Bacteria | 1191 |
| 844 | Ga0439431_0002191 | 3300041997 | Bacteria | 4307 |
| 845 | Ga0439433_0000255 | 3300041999 | Bacteria | 8970 |
| 846 | Ga0439437_001479 | 3300042000 | Bacteria | 2468 |
| 847 | Ga0439442_017115 | 3300042002 | Bacteria | 1496 |
| 848 | Ga0439442_047946 | 3300042002 | Bacteria | 900 |
| 849 | Ga0439445_0003892 | 3300042004 | Bacteria | 3360 |
| 850 | Ga0439448_0000118 | 3300042005 | Bacteria | 14718 |
| 851 | Ga0439448_0036301 | 3300042005 | Bacteria | 1581 |
| 852 | Ga0439448_0044502 | 3300042005 | Bacteria | 1443 |
| 853 | Ga0439448_0095964 | 3300042005 | Bacteria | 1004 |
| 854 | Ga0439432_001484 | 3300042006 | Bacteria | 8802 |
| 855 | Ga0439449_0008668 | 3300042007 | Bacteria | 3860 |
| 856 | Ga0439449_0013168 | 3300042007 | Bacteria | 3111 |
| 857 | Ga0439449_0098851 | 3300042007 | Bacteria | 1078 |
| 858 | Ga0439452_030522 | 3300042010 | Bacteria | 1328 |
| 859 | Ga0439452_091319 | 3300042010 | Bacteria | 658 |
| 860 | Ga0439454_011850 | 3300042011 | Bacteria | 1172 |
| 861 | Ga0439454_022677 | 3300042011 | Bacteria | 937 |
| 862 | Ga0439455_0000425 | 3300042012 | Bacteria | 5666 |
| 863 | Ga0439455_0026675 | 3300042012 | Bacteria | 1411 |
| 864 | Ga0439455_0035150 | 3300042012 | Bacteria | 1263 |
| 865 | Ga0439457_010422 | 3300042014 | Bacteria | 2137 |
| 866 | Ga0450911_004506 | 3300042115 | Bacteria | 2277 |
| 867 | Ga0450917_000001 | 3300042120 | Bacteria | 12228 |
| 868 | Ga0450920_039592 | 3300042122 | Bacteria | 939 |
| 869 | Ga0450923_056631 | 3300042125 | Bacteria | 850 |
| 870 | Ga0450888_000936 | 3300042126 | Bacteria | 2776 |
| 871 | Ga0450890_000549 | 3300042127 | Bacteria | 5493 |
| 872 | Ga0450890_001085 | 3300042127 | Bacteria | 3967 |
| 873 | Ga0450897_002592 | 3300042128 | Bacteria | 1373 |
| 874 | Ga0450891_000655 | 3300042129 | Bacteria | 3612 |
| 875 | Ga0450892_001248 | 3300042130 | Bacteria | 2585 |
| 876 | Ga0450898_043606 | 3300042134 | Bacteria | 854 |
| 877 | Ga0450902_024020 | 3300042137 | Bacteria | 1013 |
| 878 | Ga0450904_002765 | 3300042139 | Bacteria | 2007 |
| 879 | Ga0450904_008721 | 3300042139 | Bacteria | 1001 |
| 880 | Ga0450889_000161 | 3300042144 | Bacteria | 6993 |
| 881 | Ga0450907_011958 | 3300042146 | Bacteria | 1442 |
| 882 | Ga0450910_017596 | 3300042147 | Bacteria | 1065 |
| 883 | Ga0439446_0029603 | 3300042156 | Bacteria | 1580 |
| 884 | Ga0439446_0048229 | 3300042156 | Bacteria | 1268 |
| 885 | Ga0439446_0056828 | 3300042156 | Bacteria | 1176 |
| 886 | Ga0439458_0009491 | 3300042157 | Bacteria | 2166 |
| 887 | Ga0450909_012865 | 3300042185 | Bacteria | 1228 |
| 888 | Ga0450916_001782 | 3300042530 | Bacteria | 2198 |
| 889 | Ga0450893_0002428 | 3300042532 | Bacteria | 2901 |
| 890 | Ga0450893_0016245 | 3300042532 | Bacteria | 1259 |
| 891 | Ga0450901_013383 | 3300042533 | Bacteria | 859 |
| 892 | Ga0451577_0000013 | 3300042876 | Bacteria | 550689 |
| 893 | Ga0451577_0000191 | 3300042876 | Bacteria | 128991 |
| 894 | Ga0451577_0056781 | 3300042876 | Bacteria | 3492 |
| 895 | Ga0451577_0128321 | 3300042876 | Bacteria | 2274 |
| 896 | Ga0451577_0218523 | 3300042876 | Bacteria | 1722 |
| 897 | Ga0451577_0283539 | 3300042876 | Bacteria | 1501 |
| 898 | Ga0451577_0286581 | 3300042876 | Bacteria | 1492 |
| 899 | Ga0466969_0001722 | 3300044656 | Bacteria | 11695 |
| 900 | Ga0466969_0004256 | 3300044656 | Bacteria | 7608 |
| 901 | Ga0466969_0010770 | 3300044656 | Bacteria | 4844 |
| 902 | Ga0466969_0011638 | 3300044656 | Bacteria | 4654 |
| 903 | Ga0466969_0131244 | 3300044656 | Bacteria | 1161 |
| 904 | Ga0466972_0060383 | 3300044658 | Bacteria | 1819 |
| 905 | Ga0466972_0095863 | 3300044658 | Bacteria | 1405 |
| 906 | Ga0466972_0154934 | 3300044658 | Bacteria | 1076 |
| 907 | Ga0466972_0202782 | 3300044658 | Bacteria | 929 |
| 908 | Ga0466973_0049331 | 3300044659 | Bacteria | 3901 |
| 909 | Ga0466981_0147961 | 3300044669 | Bacteria | 1617 |
| 910 | Ga0453683_0000059 | 3300044673 | Bacteria | 187158 |
| 911 | Ga0466965_0001145 | 3300044683 | Bacteria | 10416 |
| 912 | Ga0466965_0015818 | 3300044683 | Bacteria | 3584 |
| 913 | Ga0466965_0063634 | 3300044683 | Bacteria | 1846 |
| 914 | Ga0466965_0071942 | 3300044683 | Bacteria | 1740 |
| 915 | Ga0466965_0221193 | 3300044683 | Bacteria | 1009 |
| 916 | Ga0466965_0321709 | 3300044683 | Bacteria | 842 |
| 917 | Ga0466965_0321710 | 3300044683 | Bacteria | 842 |
| 918 | Ga0466966_0003725 | 3300044684 | Bacteria | 10048 |
| 919 | Ga0466966_0059810 | 3300044684 | Bacteria | 2406 |
| 920 | Ga0466966_0062883 | 3300044684 | Bacteria | 2339 |
| 921 | Ga0466966_0062980 | 3300044684 | Bacteria | 2337 |
| 922 | Ga0466966_0067908 | 3300044684 | Bacteria | 2238 |
| 923 | Ga0466966_0093495 | 3300044684 | Bacteria | 1865 |
| 924 | Ga0466961_0000296 | 3300044693 | Bacteria | 33082 |
| 925 | Ga0466961_0000649 | 3300044693 | Bacteria | 21880 |
| 926 | Ga0466961_0036745 | 3300044693 | Bacteria | 3143 |
| 927 | Ga0466961_0053995 | 3300044693 | Bacteria | 2563 |
| 928 | Ga0466961_0072863 | 3300044693 | Bacteria | 2178 |
| 929 | Ga0466961_0117187 | 3300044693 | Bacteria | 1673 |
| 930 | Ga0466961_0118072 | 3300044693 | Bacteria | 1666 |
| 931 | Ga0466961_0335951 | 3300044693 | Bacteria | 920 |
| 932 | Ga0466961_0391601 | 3300044693 | Bacteria | 843 |
| 933 | Ga0466961_0800640 | 3300044693 | Bacteria | 562 |
| 934 | Ga0466963_0047825 | 3300044694 | Bacteria | 2824 |
| 935 | Ga0466963_0662781 | 3300044694 | Bacteria | 736 |
| 936 | Ga0466964_0015332 | 3300044706 | Bacteria | 2915 |
| 937 | Ga0466964_0020973 | 3300044706 | Bacteria | 2522 |
| 938 | Ga0466964_0105381 | 3300044706 | Bacteria | 1249 |
| 939 | Ga0453684_0000585 | 3300044712 | Bacteria | 135647 |
| 940 | Ga0453684_0000590 | 3300044712 | Bacteria | 134718 |
| 941 | Ga0453684_0000989 | 3300044712 | Bacteria | 92793 |
| 942 | Ga0453684_0035225 | 3300044712 | Bacteria | 6924 |
| 943 | Ga0453684_0065104 | 3300044712 | Bacteria | 4650 |
| 944 | Ga0453684_0239607 | 3300044712 | Bacteria | 2089 |
| 945 | Ga0453684_0317486 | 3300044712 | Bacteria | 1766 |
| 946 | Ga0453684_0456100 | 3300044712 | Bacteria | 1422 |
| 947 | Ga0453684_0860212 | 3300044712 | Bacteria | 974 |
| 948 | Ga0453684_1755614 | 3300044712 | Bacteria | 632 |
| 949 | Ga0466971_0000181 | 3300044719 | Bacteria | 23780 |
| 950 | Ga0466971_0035698 | 3300044719 | Bacteria | 2229 |
| 951 | Ga0466971_0136841 | 3300044719 | Bacteria | 1139 |
| 952 | Ga0466968_0242976 | 3300044735 | Bacteria | 853 |
| 953 | Ga0466968_0272311 | 3300044735 | Bacteria | 808 |
| 954 | Ga0466968_0282713 | 3300044735 | Bacteria | 794 |
| 955 | Ga0466970_0002988 | 3300044765 | Bacteria | 8198 |
| 956 | Ga0466970_0015188 | 3300044765 | Bacteria | 3960 |
| 957 | Ga0466970_0070556 | 3300044765 | Bacteria | 1878 |
| 958 | Ga0466970_0178995 | 3300044765 | Bacteria | 1176 |
| 959 | Ga0466957_0002562 | 3300044842 | Bacteria | 9780 |
| 960 | Ga0466957_0014461 | 3300044842 | Bacteria | 4595 |
| 961 | Ga0466957_0019611 | 3300044842 | Bacteria | 3978 |
| 962 | Ga0466957_0027993 | 3300044842 | Bacteria | 3352 |
| 963 | Ga0466957_0096700 | 3300044842 | Bacteria | 1856 |
| 964 | Ga0466957_0197429 | 3300044842 | Bacteria | 1320 |
| 965 | Ga0466957_0218243 | 3300044842 | Bacteria | 1258 |
| 966 | Ga0466957_0379455 | 3300044842 | Bacteria | 964 |
| 967 | Ga0466959_0000926 | 3300045049 | Bacteria | 17409 |
| 968 | Ga0466959_0005512 | 3300045049 | Bacteria | 8680 |
| 969 | Ga0466959_0007380 | 3300045049 | Bacteria | 7712 |
| 970 | Ga0466959_0071231 | 3300045049 | Bacteria | 2517 |
| 971 | Ga0466959_0265929 | 3300045049 | Bacteria | 1180 |
| 972 | Ga0451576_0000013 | 3300045051 | Bacteria | 665120 |
| 973 | Ga0451576_0000018 | 3300045051 | Bacteria | 550689 |
| 974 | Ga0451576_0005877 | 3300045051 | Bacteria | 15243 |
| 975 | Ga0451576_0010036 | 3300045051 | Bacteria | 10905 |
| 976 | Ga0451576_0025038 | 3300045051 | Bacteria | 6436 |
| 977 | Ga0451576_0100286 | 3300045051 | Bacteria | 3011 |
| 978 | Ga0451576_0193652 | 3300045051 | Bacteria | 2123 |
| 979 | Ga0451576_0280918 | 3300045051 | Bacteria | 1741 |
| 980 | Ga0451576_0999273 | 3300045051 | Bacteria | 877 |
| 981 | Ga0466958_0001887 | 3300045836 | Bacteria | 10239 |
| 982 | Ga0466958_0019865 | 3300045836 | Bacteria | 3913 |
| 983 | Ga0466958_0060303 | 3300045836 | Bacteria | 2309 |
| 984 | Ga0466958_0065480 | 3300045836 | Bacteria | 2217 |
| 985 | Ga0466958_0159333 | 3300045836 | Bacteria | 1425 |
| 986 | Ga0466967_0187281 | 3300045976 | Bacteria | 1955 |
| 987 | Ga0466967_0545245 | 3300045976 | Bacteria | 1141 |
| 988 | Ga0466967_0746643 | 3300045976 | Bacteria | 970 |
| 989 | Ga0495617_000397 | 3300046452 | Bacteria | 24142 |
| 990 | Ga0495617_000636 | 3300046452 | Bacteria | 17611 |
| 991 | Ga0495617_000830 | 3300046452 | Bacteria | 14706 |
| 992 | Ga0495617_007711 | 3300046452 | Bacteria | 3722 |
| 993 | Ga0495617_009077 | 3300046452 | Bacteria | 3418 |
| 994 | Ga0495617_107059 | 3300046452 | Bacteria | 906 |
| 995 | Ga0495627_004713 | 3300046453 | Bacteria | 5636 |
| 996 | Ga0495627_008079 | 3300046453 | Bacteria | 3967 |
| 997 | Ga0495592_0100631 | 3300046454 | Bacteria | 2060 |
| 998 | Ga0495592_0205027 | 3300046454 | Bacteria | 1328 |
| 999 | Ga0495603_0001612 | 3300046455 | Bacteria | 13252 |
| 1000 | Ga0495603_0009392 | 3300046455 | Bacteria | 5909 |
| 1001 | Ga0495603_0021343 | 3300046455 | Bacteria | 3921 |
| 1002 | Ga0495603_0036844 | 3300046455 | Bacteria | 2935 |
| 1003 | Ga0495603_0121153 | 3300046455 | Bacteria | 1524 |
| 1004 | Ga0495603_0344095 | 3300046455 | Bacteria | 855 |
| 1005 | Ga0495603_0365634 | 3300046455 | Bacteria | 828 |
| 1006 | Ga0495590_0000020 | 3300046457 | Bacteria | 212352 |
| 1007 | Ga0495590_0000632 | 3300046457 | Bacteria | 16341 |
| 1008 | Ga0495590_0001551 | 3300046457 | Bacteria | 9865 |
| 1009 | Ga0495590_0006208 | 3300046457 | Bacteria | 4677 |
| 1010 | Ga0495590_0018240 | 3300046457 | Bacteria | 2513 |
| 1011 | Ga0495590_0035656 | 3300046457 | Bacteria | 1736 |
| 1012 | Ga0495590_0084356 | 3300046457 | Bacteria | 1120 |
| 1013 | Ga0495590_0407092 | 3300046457 | Bacteria | 522 |
| 1014 | Ga0495591_010774 | 3300046458 | Bacteria | 3514 |
| 1015 | Ga0495629_0008019 | 3300046459 | Bacteria | 7771 |
| 1016 | Ga0495629_0015926 | 3300046459 | Bacteria | 5401 |
| 1017 | Ga0495629_0143741 | 3300046459 | Bacteria | 1659 |
| 1018 | Ga0495629_0185132 | 3300046459 | Bacteria | 1442 |
| 1019 | Ga0495629_0248372 | 3300046459 | Bacteria | 1224 |
| 1020 | Ga0495629_0919744 | 3300046459 | Bacteria | 572 |
| 1021 | Ga0495638_0000235 | 3300046460 | Bacteria | 75760 |
| 1022 | Ga0495638_0010507 | 3300046460 | Bacteria | 6417 |
| 1023 | Ga0495638_0016045 | 3300046460 | Bacteria | 5020 |
| 1024 | Ga0495638_0058891 | 3300046460 | Bacteria | 2379 |
| 1025 | Ga0495638_0066492 | 3300046460 | Bacteria | 2215 |
| 1026 | Ga0495638_0127888 | 3300046460 | Bacteria | 1495 |
| 1027 | Ga0495638_0138245 | 3300046460 | Bacteria | 1424 |
| 1028 | Ga0495638_0143356 | 3300046460 | Bacteria | 1392 |
| 1029 | Ga0495638_0175482 | 3300046460 | Bacteria | 1226 |
| 1030 | Ga0495638_0192509 | 3300046460 | Bacteria | 1156 |
| 1031 | Ga0495641_0049296 | 3300046461 | Bacteria | 1928 |
| 1032 | Ga0495653_0000067 | 3300046463 | Bacteria | 90116 |
| 1033 | Ga0495653_0004702 | 3300046463 | Bacteria | 11053 |
| 1034 | Ga0495653_0030611 | 3300046463 | Bacteria | 4284 |
| 1035 | Ga0495653_0071030 | 3300046463 | Bacteria | 2603 |
| 1036 | Ga0495653_0091071 | 3300046463 | Bacteria | 2229 |
| 1037 | Ga0495653_0300755 | 3300046463 | Bacteria | 1046 |
| 1038 | Ga0495650_0000200 | 3300046471 | Bacteria | 130223 |
| 1039 | Ga0495650_0000436 | 3300046471 | Bacteria | 67167 |
| 1040 | Ga0495650_0001809 | 3300046471 | Bacteria | 19254 |
| 1041 | Ga0495650_0007290 | 3300046471 | Bacteria | 6684 |
| 1042 | Ga0495650_0017593 | 3300046471 | Bacteria | 3580 |
| 1043 | Ga0495650_0020204 | 3300046471 | Bacteria | 3253 |
| 1044 | Ga0495650_0023276 | 3300046471 | Bacteria | 2951 |
| 1045 | Ga0495650_0025873 | 3300046471 | Bacteria | 2740 |
| 1046 | Ga0495650_0028055 | 3300046471 | Bacteria | 2591 |
| 1047 | Ga0495650_0046362 | 3300046471 | Bacteria | 1824 |
| 1048 | Ga0495650_0086014 | 3300046471 | Bacteria | 1204 |
| 1049 | Ga0495580_0006554 | 3300046472 | Bacteria | 9466 |
| 1050 | Ga0495580_0016805 | 3300046472 | Bacteria | 5490 |
| 1051 | Ga0495580_0020632 | 3300046472 | Bacteria | 4873 |
| 1052 | Ga0495580_0130646 | 3300046472 | Bacteria | 1742 |
| 1053 | Ga0495580_0295525 | 3300046472 | Bacteria | 1103 |
| 1054 | Ga0495580_0716936 | 3300046472 | Bacteria | 653 |
| 1055 | Ga0495582_0005108 | 3300046473 | Bacteria | 7350 |
| 1056 | Ga0495582_0014415 | 3300046473 | Bacteria | 4345 |
| 1057 | Ga0495582_0033837 | 3300046473 | Bacteria | 2810 |
| 1058 | Ga0495582_0181417 | 3300046473 | Bacteria | 1199 |
| 1059 | Ga0495582_0545605 | 3300046473 | Bacteria | 670 |
| 1060 | Ga0495605_0000061 | 3300046474 | Bacteria | 145286 |
| 1061 | Ga0495605_0001735 | 3300046474 | Bacteria | 13971 |
| 1062 | Ga0495605_0005449 | 3300046474 | Bacteria | 7411 |
| 1063 | Ga0495605_0009198 | 3300046474 | Bacteria | 5554 |
| 1064 | Ga0495605_0010393 | 3300046474 | Bacteria | 5209 |
| 1065 | Ga0495605_0012129 | 3300046474 | Bacteria | 4788 |
| 1066 | Ga0495605_0013819 | 3300046474 | Bacteria | 4436 |
| 1067 | Ga0495605_0014824 | 3300046474 | Bacteria | 4254 |
| 1068 | Ga0495605_0017339 | 3300046474 | Bacteria | 3880 |
| 1069 | Ga0495605_0066496 | 3300046474 | Bacteria | 1712 |
| 1070 | Ga0495605_0085995 | 3300046474 | Bacteria | 1463 |
| 1071 | Ga0495605_0125990 | 3300046474 | Bacteria | 1158 |
| 1072 | Ga0495605_0272644 | 3300046474 | Bacteria | 720 |
| 1073 | Ga0495639_0038910 | 3300046475 | Bacteria | 2137 |
| 1074 | Ga0495639_0088103 | 3300046475 | Bacteria | 1453 |
| 1075 | Ga0495639_0088932 | 3300046475 | Bacteria | 1446 |
| 1076 | Ga0495639_0150524 | 3300046475 | Bacteria | 1122 |
| 1077 | Ga0495662_0024098 | 3300046476 | Bacteria | 2936 |
| 1078 | Ga0495662_0180757 | 3300046476 | Bacteria | 1039 |
| 1079 | Ga0495664_0006673 | 3300046477 | Bacteria | 6381 |
| 1080 | Ga0495664_0069337 | 3300046477 | Bacteria | 2105 |
| 1081 | Ga0495664_0072529 | 3300046477 | Bacteria | 2057 |
| 1082 | Ga0495664_0095229 | 3300046477 | Bacteria | 1792 |
| 1083 | Ga0495664_0097358 | 3300046477 | Bacteria | 1771 |
| 1084 | Ga0495664_0250066 | 3300046477 | Bacteria | 1072 |
| 1085 | Ga0495584_0000636 | 3300046491 | Bacteria | 23364 |
| 1086 | Ga0495584_0002002 | 3300046491 | Bacteria | 11717 |
| 1087 | Ga0495584_0011799 | 3300046491 | Bacteria | 4468 |
| 1088 | Ga0495584_0012155 | 3300046491 | Bacteria | 4399 |
| 1089 | Ga0495584_0021670 | 3300046491 | Bacteria | 3262 |
| 1090 | Ga0495584_0032055 | 3300046491 | Bacteria | 2660 |
| 1091 | Ga0495584_0033893 | 3300046491 | Bacteria | 2583 |
| 1092 | Ga0495584_0144920 | 3300046491 | Bacteria | 1206 |
| 1093 | Ga0495584_0190186 | 3300046491 | Bacteria | 1043 |
| 1094 | Ga0495584_0201597 | 3300046491 | Bacteria | 1011 |
| 1095 | Ga0495585_0000497 | 3300046492 | Bacteria | 37109 |
| 1096 | Ga0495585_0006666 | 3300046492 | Bacteria | 7134 |
| 1097 | Ga0495585_0037607 | 3300046492 | Bacteria | 2725 |
| 1098 | Ga0495585_0040726 | 3300046492 | Bacteria | 2607 |
| 1099 | Ga0495585_0041550 | 3300046492 | Bacteria | 2578 |
| 1100 | Ga0495585_0050808 | 3300046492 | Bacteria | 2298 |
| 1101 | Ga0495585_0053985 | 3300046492 | Bacteria | 2222 |
| 1102 | Ga0495585_0057251 | 3300046492 | Bacteria | 2151 |
| 1103 | Ga0495585_0067131 | 3300046492 | Bacteria | 1962 |
| 1104 | Ga0495594_0010435 | 3300046499 | Bacteria | 4818 |
| 1105 | Ga0495594_0017612 | 3300046499 | Bacteria | 3776 |
| 1106 | Ga0495594_0034748 | 3300046499 | Bacteria | 2743 |
| 1107 | Ga0495594_0073377 | 3300046499 | Bacteria | 1904 |
| 1108 | Ga0495594_0125027 | 3300046499 | Bacteria | 1455 |
| 1109 | Ga0495594_0244040 | 3300046499 | Bacteria | 1023 |
| 1110 | Ga0495596_0001745 | 3300046500 | Bacteria | 12192 |
| 1111 | Ga0495596_0001963 | 3300046500 | Bacteria | 11349 |
| 1112 | Ga0495596_0020643 | 3300046500 | Bacteria | 2694 |
| 1113 | Ga0495596_0142796 | 3300046500 | Bacteria | 930 |
| 1114 | Ga0495596_0165675 | 3300046500 | Bacteria | 859 |
| 1115 | Ga0495596_0199960 | 3300046500 | Bacteria | 776 |
| 1116 | Ga0495596_0254795 | 3300046500 | Bacteria | 681 |
| 1117 | Ga0495607_0009755 | 3300046501 | Bacteria | 6481 |
| 1118 | Ga0495607_0017761 | 3300046501 | Bacteria | 4554 |
| 1119 | Ga0495607_0021914 | 3300046501 | Bacteria | 4018 |
| 1120 | Ga0495607_0038368 | 3300046501 | Bacteria | 2869 |
| 1121 | Ga0495607_0042397 | 3300046501 | Bacteria | 2697 |
| 1122 | Ga0495607_0059953 | 3300046501 | Bacteria | 2167 |
| 1123 | Ga0495607_0062866 | 3300046501 | Bacteria | 2102 |
| 1124 | Ga0495607_0063124 | 3300046501 | Bacteria | 2097 |
| 1125 | Ga0495607_0100890 | 3300046501 | Bacteria | 1546 |
| 1126 | Ga0495607_0103502 | 3300046501 | Bacteria | 1521 |
| 1127 | Ga0495607_0159222 | 3300046501 | Bacteria | 1148 |
| 1128 | Ga0495607_0318419 | 3300046501 | Bacteria | 726 |
| 1129 | Ga0495607_0319723 | 3300046501 | Bacteria | 724 |
| 1130 | Ga0495583_0000317 | 3300046506 | Bacteria | 76193 |
| 1131 | Ga0495583_0002046 | 3300046506 | Bacteria | 18350 |
| 1132 | Ga0495583_0004594 | 3300046506 | Bacteria | 9786 |
| 1133 | Ga0495583_0004815 | 3300046506 | Bacteria | 9459 |
| 1134 | Ga0495583_0011949 | 3300046506 | Bacteria | 4952 |
| 1135 | Ga0495583_0016574 | 3300046506 | Bacteria | 3954 |
| 1136 | Ga0495583_0018545 | 3300046506 | Bacteria | 3659 |
| 1137 | Ga0495583_0019465 | 3300046506 | Bacteria | 3542 |
| 1138 | Ga0495583_0094359 | 3300046506 | Bacteria | 1284 |
| 1139 | Ga0495606_0009877 | 3300046507 | Bacteria | 8000 |
| 1140 | Ga0495606_0031882 | 3300046507 | Bacteria | 3658 |
| 1141 | Ga0495606_0035311 | 3300046507 | Bacteria | 3418 |
| 1142 | Ga0495606_0035595 | 3300046507 | Bacteria | 3401 |
| 1143 | Ga0495606_0037967 | 3300046507 | Bacteria | 3264 |
| 1144 | Ga0495606_0048233 | 3300046507 | Bacteria | 2802 |
| 1145 | Ga0495606_0054164 | 3300046507 | Bacteria | 2598 |
| 1146 | Ga0495606_0064595 | 3300046507 | Bacteria | 2328 |
| 1147 | Ga0495606_0066613 | 3300046507 | Bacteria | 2283 |
| 1148 | Ga0495606_0070973 | 3300046507 | Bacteria | 2194 |
| 1149 | Ga0495606_0080050 | 3300046507 | Bacteria | 2033 |
| 1150 | Ga0495606_0085615 | 3300046507 | Bacteria | 1949 |
| 1151 | Ga0495606_0109571 | 3300046507 | Bacteria | 1667 |
| 1152 | Ga0495606_0147485 | 3300046507 | Bacteria | 1383 |
| 1153 | Ga0495608_0188850 | 3300046511 | Bacteria | 1301 |
| 1154 | Ga0495608_0308495 | 3300046511 | Bacteria | 979 |
| 1155 | Ga0495610_0000017 | 3300046512 | Bacteria | 365675 |
| 1156 | Ga0495610_0065030 | 3300046512 | Bacteria | 1722 |
| 1157 | Ga0495610_0125032 | 3300046512 | Bacteria | 1122 |
| 1158 | Ga0495616_0003800 | 3300046513 | Bacteria | 9623 |
| 1159 | Ga0495616_0011842 | 3300046513 | Bacteria | 4974 |
| 1160 | Ga0495616_0034996 | 3300046513 | Bacteria | 2602 |
| 1161 | Ga0495616_0072460 | 3300046513 | Bacteria | 1663 |
| 1162 | Ga0495616_0086533 | 3300046513 | Bacteria | 1490 |
| 1163 | Ga0495616_0102252 | 3300046513 | Bacteria | 1342 |
| 1164 | Ga0495616_0111084 | 3300046513 | Bacteria | 1273 |
| 1165 | Ga0495616_0117328 | 3300046513 | Bacteria | 1231 |
| 1166 | Ga0495616_0119592 | 3300046513 | Bacteria | 1217 |
| 1167 | Ga0495616_0163239 | 3300046513 | Bacteria | 1000 |
| 1168 | Ga0495616_0390385 | 3300046513 | Bacteria | 573 |
| 1169 | Ga0495618_0018095 | 3300046514 | Bacteria | 4325 |
| 1170 | Ga0495618_0138514 | 3300046514 | Bacteria | 1556 |
| 1171 | Ga0495618_0469722 | 3300046514 | Bacteria | 761 |
| 1172 | Ga0495620_0001543 | 3300046515 | Bacteria | 13683 |
| 1173 | Ga0495620_0014491 | 3300046515 | Bacteria | 4006 |
| 1174 | Ga0495620_0053647 | 3300046515 | Bacteria | 1706 |
| 1175 | Ga0495628_0006292 | 3300046516 | Bacteria | 10367 |
| 1176 | Ga0495628_0069084 | 3300046516 | Bacteria | 2755 |
| 1177 | Ga0495628_0075933 | 3300046516 | Bacteria | 2616 |
| 1178 | Ga0495628_0079554 | 3300046516 | Bacteria | 2548 |
| 1179 | Ga0495628_0109587 | 3300046516 | Bacteria | 2124 |
| 1180 | Ga0495628_0205693 | 3300046516 | Bacteria | 1482 |
| 1181 | Ga0495630_0038355 | 3300046517 | Bacteria | 3583 |
| 1182 | Ga0495630_0100382 | 3300046517 | Bacteria | 2189 |
| 1183 | Ga0495630_0109243 | 3300046517 | Bacteria | 2095 |
| 1184 | Ga0495630_0134360 | 3300046517 | Bacteria | 1879 |
| 1185 | Ga0495630_0207757 | 3300046517 | Bacteria | 1494 |
| 1186 | Ga0495631_0011063 | 3300046518 | Bacteria | 4450 |
| 1187 | Ga0495631_0011843 | 3300046518 | Bacteria | 4278 |
| 1188 | Ga0495631_0019480 | 3300046518 | Bacteria | 3181 |
| 1189 | Ga0495631_0030651 | 3300046518 | Bacteria | 2438 |
| 1190 | Ga0495631_0161756 | 3300046518 | Bacteria | 960 |
| 1191 | Ga0495632_0016465 | 3300046519 | Bacteria | 4111 |
| 1192 | Ga0495632_0026864 | 3300046519 | Bacteria | 3022 |
| 1193 | Ga0495632_0089406 | 3300046519 | Bacteria | 1462 |
| 1194 | Ga0495632_0096913 | 3300046519 | Bacteria | 1392 |
| 1195 | Ga0495632_0172654 | 3300046519 | Bacteria | 992 |
| 1196 | Ga0495637_0000053 | 3300046520 | Bacteria | 99739 |
| 1197 | Ga0495637_0002190 | 3300046520 | Bacteria | 10923 |
| 1198 | Ga0495637_0011543 | 3300046520 | Bacteria | 4242 |
| 1199 | Ga0495637_0012032 | 3300046520 | Bacteria | 4149 |
| 1200 | Ga0495637_0056898 | 3300046520 | Bacteria | 1617 |
| 1201 | Ga0495643_0012013 | 3300046522 | Bacteria | 5240 |
| 1202 | Ga0495643_0014375 | 3300046522 | Bacteria | 4711 |
| 1203 | Ga0495643_0019530 | 3300046522 | Bacteria | 3918 |
| 1204 | Ga0495643_0026159 | 3300046522 | Bacteria | 3295 |
| 1205 | Ga0495643_0040991 | 3300046522 | Bacteria | 2526 |
| 1206 | Ga0495643_0044520 | 3300046522 | Bacteria | 2411 |
| 1207 | Ga0495643_0048287 | 3300046522 | Bacteria | 2301 |
| 1208 | Ga0495643_0054593 | 3300046522 | Bacteria | 2138 |
| 1209 | Ga0495643_0104068 | 3300046522 | Bacteria | 1451 |
| 1210 | Ga0495644_0003110 | 3300046523 | Bacteria | 6566 |
| 1211 | Ga0495644_0013221 | 3300046523 | Bacteria | 3170 |
| 1212 | Ga0495644_0019769 | 3300046523 | Bacteria | 2571 |
| 1213 | Ga0495644_0053726 | 3300046523 | Bacteria | 1513 |
| 1214 | Ga0495644_0075233 | 3300046523 | Bacteria | 1271 |
| 1215 | Ga0495644_0218639 | 3300046523 | Bacteria | 736 |
| 1216 | Ga0495648_0003167 | 3300046524 | Bacteria | 14648 |
| 1217 | Ga0495648_0015922 | 3300046524 | Bacteria | 5434 |
| 1218 | Ga0495648_0025782 | 3300046524 | Bacteria | 3971 |
| 1219 | Ga0495648_0026850 | 3300046524 | Bacteria | 3867 |
| 1220 | Ga0495648_0044310 | 3300046524 | Bacteria | 2778 |
| 1221 | Ga0495648_0046480 | 3300046524 | Bacteria | 2690 |
| 1222 | Ga0495648_0056197 | 3300046524 | Bacteria | 2368 |
| 1223 | Ga0495648_0087678 | 3300046524 | Bacteria | 1751 |
| 1224 | Ga0495648_0098552 | 3300046524 | Bacteria | 1618 |
| 1225 | Ga0495648_0100591 | 3300046524 | Bacteria | 1596 |
| 1226 | Ga0495648_0120126 | 3300046524 | Bacteria | 1414 |
| 1227 | Ga0495648_0150736 | 3300046524 | Bacteria | 1213 |
| 1228 | Ga0495648_0155108 | 3300046524 | Bacteria | 1190 |
| 1229 | Ga0495648_0209849 | 3300046524 | Bacteria | 968 |
| 1230 | Ga0495648_0320024 | 3300046524 | Bacteria | 719 |
| 1231 | Ga0495663_0006063 | 3300046525 | Bacteria | 3344 |
| 1232 | Ga0495663_0008461 | 3300046525 | Bacteria | 2849 |
| 1233 | Ga0495663_0012604 | 3300046525 | Bacteria | 2357 |
| 1234 | Ga0495663_0017530 | 3300046525 | Bacteria | 2033 |
| 1235 | Ga0495663_0065824 | 3300046525 | Bacteria | 1146 |
| 1236 | Ga0495663_0124763 | 3300046525 | Bacteria | 864 |
| 1237 | Ga0495666_0002416 | 3300046526 | Bacteria | 9296 |
| 1238 | Ga0495666_0040638 | 3300046526 | Bacteria | 2254 |
| 1239 | Ga0495666_0049585 | 3300046526 | Bacteria | 2019 |
| 1240 | Ga0495666_0098357 | 3300046526 | Bacteria | 1379 |
| 1241 | Ga0495666_0105624 | 3300046526 | Bacteria | 1325 |
| 1242 | Ga0495666_0115943 | 3300046526 | Bacteria | 1256 |
| 1243 | Ga0495666_0162411 | 3300046526 | Bacteria | 1035 |
| 1244 | Ga0495666_0287216 | 3300046526 | Bacteria | 745 |
| 1245 | Ga0495666_0391822 | 3300046526 | Bacteria | 624 |
| 1246 | Ga0495666_0446510 | 3300046526 | Bacteria | 579 |
| 1247 | Ga0495642_0005824 | 3300046528 | Bacteria | 4726 |
| 1248 | Ga0495642_0007577 | 3300046528 | Bacteria | 4159 |
| 1249 | Ga0495642_0008349 | 3300046528 | Bacteria | 3963 |
| 1250 | Ga0495642_0019574 | 3300046528 | Bacteria | 2654 |
| 1251 | Ga0495642_0026738 | 3300046528 | Bacteria | 2293 |
| 1252 | Ga0495642_0030583 | 3300046528 | Bacteria | 2154 |
| 1253 | Ga0495642_0048741 | 3300046528 | Bacteria | 1738 |
| 1254 | Ga0495642_0056434 | 3300046528 | Bacteria | 1622 |
| 1255 | Ga0495642_0075423 | 3300046528 | Bacteria | 1414 |
| 1256 | Ga0495642_0079432 | 3300046528 | Bacteria | 1379 |
| 1257 | Ga0495642_0168073 | 3300046528 | Bacteria | 952 |
| 1258 | Ga0495642_0213337 | 3300046528 | Bacteria | 842 |
| 1259 | Ga0495642_0231611 | 3300046528 | Bacteria | 807 |
| 1260 | Ga0495652_0035356 | 3300046529 | Bacteria | 4349 |
| 1261 | Ga0495652_0115773 | 3300046529 | Bacteria | 2147 |
| 1262 | Ga0495652_0146004 | 3300046529 | Bacteria | 1854 |
| 1263 | Ga0495652_0151599 | 3300046529 | Bacteria | 1810 |
| 1264 | Ga0495654_0000060 | 3300046530 | Bacteria | 134307 |
| 1265 | Ga0495654_0030668 | 3300046530 | Bacteria | 2734 |
| 1266 | Ga0495654_0109550 | 3300046530 | Bacteria | 1261 |
| 1267 | Ga0495654_0176808 | 3300046530 | Bacteria | 927 |
| 1268 | Ga0495654_0191212 | 3300046530 | Bacteria | 881 |
| 1269 | Ga0495654_0247759 | 3300046530 | Bacteria | 743 |
| 1270 | Ga0495665_0008466 | 3300046531 | Bacteria | 5581 |
| 1271 | Ga0495665_0018585 | 3300046531 | Bacteria | 3734 |
| 1272 | Ga0495665_0031045 | 3300046531 | Bacteria | 2859 |
| 1273 | Ga0495665_0034628 | 3300046531 | Bacteria | 2700 |
| 1274 | Ga0495665_0057876 | 3300046531 | Bacteria | 2046 |
| 1275 | Ga0495665_0069907 | 3300046531 | Bacteria | 1850 |
| 1276 | Ga0495665_0091889 | 3300046531 | Bacteria | 1595 |
| 1277 | Ga0495665_0221276 | 3300046531 | Bacteria | 978 |
| 1278 | Ga0495640_0041811 | 3300046533 | Bacteria | 3201 |
| 1279 | Ga0495640_0475601 | 3300046533 | Bacteria | 761 |
| 1280 | Ga0495586_0008133 | 3300046535 | Bacteria | 5590 |
| 1281 | Ga0495586_0018161 | 3300046535 | Bacteria | 3741 |
| 1282 | Ga0495586_0051587 | 3300046535 | Bacteria | 2226 |
| 1283 | Ga0495586_0070537 | 3300046535 | Bacteria | 1908 |
| 1284 | Ga0495586_0072077 | 3300046535 | Bacteria | 1888 |
| 1285 | Ga0495586_0106892 | 3300046535 | Bacteria | 1556 |
| 1286 | Ga0495587_0007790 | 3300046536 | Bacteria | 6919 |
| 1287 | Ga0495587_0037993 | 3300046536 | Bacteria | 2888 |
| 1288 | Ga0495587_0086906 | 3300046536 | Bacteria | 1809 |
| 1289 | Ga0495587_0263774 | 3300046536 | Bacteria | 967 |
| 1290 | Ga0495587_0427665 | 3300046536 | Bacteria | 735 |
| 1291 | Ga0495598_0027767 | 3300046537 | Bacteria | 1564 |
| 1292 | Ga0495609_0000007 | 3300046538 | Bacteria | 398812 |
| 1293 | Ga0495609_0000666 | 3300046538 | Bacteria | 26632 |
| 1294 | Ga0495609_0033507 | 3300046538 | Bacteria | 2332 |
| 1295 | Ga0495609_0046714 | 3300046538 | Bacteria | 1938 |
| 1296 | Ga0495609_0084127 | 3300046538 | Bacteria | 1388 |
| 1297 | Ga0495609_0085504 | 3300046538 | Bacteria | 1375 |
| 1298 | Ga0495609_0164311 | 3300046538 | Bacteria | 939 |
| 1299 | Ga0495609_0211129 | 3300046538 | Bacteria | 808 |
| 1300 | Ga0495621_0161107 | 3300046539 | Bacteria | 887 |
| 1301 | Ga0495621_0161323 | 3300046539 | Bacteria | 887 |
| 1302 | Ga0495621_0351269 | 3300046539 | Bacteria | 619 |
| 1303 | Ga0495597_0007533 | 3300046542 | Bacteria | 5520 |
| 1304 | Ga0495597_0007961 | 3300046542 | Bacteria | 5336 |
| 1305 | Ga0495597_0014198 | 3300046542 | Bacteria | 3796 |
| 1306 | Ga0495597_0022360 | 3300046542 | Bacteria | 2933 |
| 1307 | Ga0495597_0023086 | 3300046542 | Bacteria | 2879 |
| 1308 | Ga0495597_0073396 | 3300046542 | Bacteria | 1471 |
| 1309 | Ga0495597_0073428 | 3300046542 | Bacteria | 1470 |
| 1310 | Ga0495597_0079026 | 3300046542 | Bacteria | 1409 |
| 1311 | Ga0495597_0125983 | 3300046542 | Bacteria | 1065 |
| 1312 | Ga0495597_0185257 | 3300046542 | Bacteria | 839 |
| 1313 | Ga0495597_0232401 | 3300046542 | Bacteria | 729 |
| 1314 | Ga0495597_0323992 | 3300046542 | Bacteria | 594 |
| 1315 | Ga0495645_0009368 | 3300046543 | Bacteria | 6846 |
| 1316 | Ga0495645_0061503 | 3300046543 | Bacteria | 2720 |
| 1317 | Ga0495645_0102644 | 3300046543 | Bacteria | 2032 |
| 1318 | Ga0495645_0450145 | 3300046543 | Bacteria | 812 |
| 1319 | Ga0495622_0002163 | 3300046557 | Bacteria | 9573 |
| 1320 | Ga0495622_0012942 | 3300046557 | Bacteria | 3869 |
| 1321 | Ga0495622_0014615 | 3300046557 | Bacteria | 3646 |
| 1322 | Ga0495622_0031049 | 3300046557 | Bacteria | 2498 |
| 1323 | Ga0495622_0031817 | 3300046557 | Bacteria | 2464 |
| 1324 | Ga0495622_0035080 | 3300046557 | Bacteria | 2339 |
| 1325 | Ga0495622_0041092 | 3300046557 | Bacteria | 2150 |
| 1326 | Ga0495622_0110653 | 3300046557 | Bacteria | 1257 |
| 1327 | Ga0495622_0192080 | 3300046557 | Bacteria | 912 |
| 1328 | Ga0495622_0207613 | 3300046557 | Bacteria | 871 |
| 1329 | Ga0495633_0006566 | 3300046558 | Bacteria | 6874 |
| 1330 | Ga0495633_0023121 | 3300046558 | Bacteria | 3080 |
| 1331 | Ga0495633_0025281 | 3300046558 | Bacteria | 2925 |
| 1332 | Ga0495633_0036777 | 3300046558 | Bacteria | 2344 |
| 1333 | Ga0495633_0062271 | 3300046558 | Bacteria | 1746 |
| 1334 | Ga0495633_0068032 | 3300046558 | Bacteria | 1662 |
| 1335 | Ga0495633_0097194 | 3300046558 | Bacteria | 1367 |
| 1336 | Ga0495633_0160994 | 3300046558 | Bacteria | 1035 |
| 1337 | Ga0495633_0171885 | 3300046558 | Bacteria | 998 |
| 1338 | Ga0495633_0175653 | 3300046558 | Bacteria | 986 |
| 1339 | Ga0495667_0043286 | 3300046559 | Bacteria | 2984 |
| 1340 | Ga0495667_0151288 | 3300046559 | Bacteria | 1494 |
| 1341 | Ga0495667_0555975 | 3300046559 | Bacteria | 717 |
| 1342 | Ga0495656_0010416 | 3300046615 | Bacteria | 3380 |
| 1343 | Ga0495656_0081304 | 3300046615 | Bacteria | 1462 |
| 1344 | Ga0495656_0084934 | 3300046615 | Bacteria | 1436 |
| 1345 | Ga0495656_0099696 | 3300046615 | Bacteria | 1341 |
| 1346 | Ga0495656_0169174 | 3300046615 | Bacteria | 1067 |
| 1347 | Ga0495656_0267756 | 3300046615 | Bacteria | 867 |
| 1348 | Ga0495668_0002640 | 3300046616 | Bacteria | 14406 |
| 1349 | Ga0495668_0005163 | 3300046616 | Bacteria | 8962 |
| 1350 | Ga0495668_0008733 | 3300046616 | Bacteria | 6291 |
| 1351 | Ga0495668_0011342 | 3300046616 | Bacteria | 5343 |
| 1352 | Ga0495668_0011816 | 3300046616 | Bacteria | 5204 |
| 1353 | Ga0495668_0018916 | 3300046616 | Bacteria | 3978 |
| 1354 | Ga0495668_0029452 | 3300046616 | Bacteria | 3101 |
| 1355 | Ga0495668_0051941 | 3300046616 | Bacteria | 2269 |
| 1356 | Ga0495668_0103355 | 3300046616 | Bacteria | 1559 |
| 1357 | Ga0495668_0120245 | 3300046616 | Bacteria | 1437 |
| 1358 | Ga0495668_0162205 | 3300046616 | Bacteria | 1224 |
| 1359 | Ga0495668_0311153 | 3300046616 | Bacteria | 864 |
| 1360 | Ga0495668_0337344 | 3300046616 | Bacteria | 827 |
| 1361 | Ga0495668_0395203 | 3300046616 | Bacteria | 759 |
| 1362 | Ga0495634_0045859 | 3300046642 | Bacteria | 2952 |
| 1363 | Ga0495634_0121713 | 3300046642 | Bacteria | 1670 |
| 1364 | Ga0495634_0202784 | 3300046642 | Bacteria | 1231 |
| 1365 | Ga0495634_0211208 | 3300046642 | Bacteria | 1201 |
| 1366 | Ga0495611_0001662 | 3300046648 | Bacteria | 10778 |
| 1367 | Ga0495611_0002069 | 3300046648 | Bacteria | 9442 |
| 1368 | Ga0495611_0005909 | 3300046648 | Bacteria | 5219 |
| 1369 | Ga0495611_0011874 | 3300046648 | Bacteria | 3697 |
| 1370 | Ga0495611_0093136 | 3300046648 | Bacteria | 1393 |
| 1371 | Ga0495611_0182449 | 3300046648 | Bacteria | 980 |
| 1372 | Ga0495611_0248659 | 3300046648 | Bacteria | 824 |
| 1373 | Ga0495625_0011213 | 3300046660 | Bacteria | 7328 |
| 1374 | Ga0495625_0033151 | 3300046660 | Bacteria | 3822 |
| 1375 | Ga0495625_0034116 | 3300046660 | Bacteria | 3757 |
| 1376 | Ga0495625_0047734 | 3300046660 | Bacteria | 3086 |
| 1377 | Ga0495625_0087655 | 3300046660 | Bacteria | 2157 |
| 1378 | Ga0495625_0166164 | 3300046660 | Bacteria | 1475 |
| 1379 | Ga0495625_0167010 | 3300046660 | Bacteria | 1471 |
| 1380 | Ga0495625_0190370 | 3300046660 | Bacteria | 1359 |
| 1381 | Ga0495625_0199527 | 3300046660 | Bacteria | 1321 |
| 1382 | Ga0495625_0208462 | 3300046660 | Bacteria | 1285 |
| 1383 | Ga0495625_0265594 | 3300046660 | Bacteria | 1109 |
| 1384 | Ga0495635_0008977 | 3300046663 | Bacteria | 6978 |
| 1385 | Ga0495635_0078555 | 3300046663 | Bacteria | 2259 |
| 1386 | Ga0495635_0142420 | 3300046663 | Bacteria | 1632 |
| 1387 | Ga0495635_0200952 | 3300046663 | Bacteria | 1352 |
| 1388 | Ga0495659_0003686 | 3300046664 | Bacteria | 4871 |
| 1389 | Ga0495659_0004277 | 3300046664 | Bacteria | 4502 |
| 1390 | Ga0495659_0007839 | 3300046664 | Bacteria | 3385 |
| 1391 | Ga0495659_0025538 | 3300046664 | Bacteria | 2023 |
| 1392 | Ga0495659_0079281 | 3300046664 | Bacteria | 1244 |
| 1393 | Ga0495659_0093802 | 3300046664 | Bacteria | 1155 |
| 1394 | Ga0495659_0149661 | 3300046664 | Bacteria | 936 |
| 1395 | Ga0495659_0558240 | 3300046664 | Bacteria | 505 |
| 1396 | Ga0495661_0019060 | 3300046665 | Bacteria | 4500 |
| 1397 | Ga0495661_0022315 | 3300046665 | Bacteria | 4118 |
| 1398 | Ga0495661_0027641 | 3300046665 | Bacteria | 3639 |
| 1399 | Ga0495661_0036532 | 3300046665 | Bacteria | 3075 |
| 1400 | Ga0495661_0042541 | 3300046665 | Bacteria | 2799 |
| 1401 | Ga0495661_0062587 | 3300046665 | Bacteria | 2203 |
| 1402 | Ga0495661_0089042 | 3300046665 | Bacteria | 1760 |
| 1403 | Ga0495661_0119891 | 3300046665 | Bacteria | 1454 |
| 1404 | Ga0495661_0148229 | 3300046665 | Bacteria | 1269 |
| 1405 | Ga0495661_0188840 | 3300046665 | Bacteria | 1086 |
| 1406 | Ga0495661_0219532 | 3300046665 | Bacteria | 985 |
| 1407 | Ga0495661_0293686 | 3300046665 | Bacteria | 815 |
| 1408 | Ga0495661_0298181 | 3300046665 | Bacteria | 807 |
| 1409 | Ga0495661_0421205 | 3300046665 | Bacteria | 646 |
| 1410 | Ga0495588_0009027 | 3300046674 | Bacteria | 4594 |
| 1411 | Ga0495588_0011149 | 3300046674 | Bacteria | 4209 |
| 1412 | Ga0495588_0017870 | 3300046674 | Bacteria | 3451 |
| 1413 | Ga0495588_0018679 | 3300046674 | Bacteria | 3384 |
| 1414 | Ga0495588_0040525 | 3300046674 | Bacteria | 2375 |
| 1415 | Ga0495588_0046528 | 3300046674 | Bacteria | 2225 |
| 1416 | Ga0495588_0050054 | 3300046674 | Bacteria | 2149 |
| 1417 | Ga0495588_0230874 | 3300046674 | Bacteria | 976 |
| 1418 | Ga0495657_0727578 | 3300046675 | Bacteria | 569 |
| 1419 | Ga0495657_0736393 | 3300046675 | Bacteria | 565 |
| 1420 | Ga0495599_0052585 | 3300046678 | Bacteria | 2551 |
| 1421 | Ga0495599_0060094 | 3300046678 | Bacteria | 2377 |
| 1422 | Ga0495599_0204471 | 3300046678 | Bacteria | 1212 |
| 1423 | Ga0495599_0222351 | 3300046678 | Bacteria | 1155 |
| 1424 | Ga0495623_0031929 | 3300046679 | Bacteria | 3385 |
| 1425 | Ga0495623_0100910 | 3300046679 | Bacteria | 1758 |
| 1426 | Ga0495623_0118836 | 3300046679 | Bacteria | 1593 |
| 1427 | Ga0495623_0154907 | 3300046679 | Bacteria | 1351 |
| 1428 | Ga0495623_0164039 | 3300046679 | Bacteria | 1303 |
| 1429 | Ga0495623_0164428 | 3300046679 | Bacteria | 1301 |
| 1430 | Ga0495623_0175824 | 3300046679 | Bacteria | 1247 |
| 1431 | Ga0495623_0178944 | 3300046679 | Bacteria | 1233 |
| 1432 | Ga0495646_0038676 | 3300046680 | Bacteria | 2944 |
| 1433 | Ga0495646_0043675 | 3300046680 | Bacteria | 2743 |
| 1434 | Ga0495646_0054683 | 3300046680 | Bacteria | 2400 |
| 1435 | Ga0495646_0076384 | 3300046680 | Bacteria | 1961 |
| 1436 | Ga0495646_0154791 | 3300046680 | Bacteria | 1272 |
| 1437 | Ga0495646_0158928 | 3300046680 | Bacteria | 1252 |
| 1438 | Ga0495646_0405134 | 3300046680 | Bacteria | 708 |
| 1439 | Ga0495658_0114704 | 3300046683 | Bacteria | 1624 |
| 1440 | Ga0495658_0283936 | 3300046683 | Bacteria | 1045 |
| 1441 | Ga0495658_0289894 | 3300046683 | Bacteria | 1034 |
| 1442 | Ga0495658_0558190 | 3300046683 | Bacteria | 733 |
| 1443 | Ga0495669_0001596 | 3300046684 | Bacteria | 9305 |
| 1444 | Ga0495669_0002717 | 3300046684 | Bacteria | 7249 |
| 1445 | Ga0495669_0031367 | 3300046684 | Bacteria | 2334 |
| 1446 | Ga0495669_0041852 | 3300046684 | Bacteria | 2035 |
| 1447 | Ga0495669_0086878 | 3300046684 | Bacteria | 1440 |
| 1448 | Ga0495669_0116277 | 3300046684 | Bacteria | 1251 |
| 1449 | Ga0495669_0350587 | 3300046684 | Bacteria | 713 |
| 1450 | Ga0495613_0072609 | 3300046689 | Bacteria | 2508 |
| 1451 | Ga0495613_0082016 | 3300046689 | Bacteria | 2342 |
| 1452 | Ga0495613_0092389 | 3300046689 | Bacteria | 2191 |
| 1453 | Ga0495613_0130385 | 3300046689 | Bacteria | 1800 |
| 1454 | Ga0495613_0226145 | 3300046689 | Bacteria | 1312 |
| 1455 | Ga0495613_0566434 | 3300046689 | Bacteria | 759 |
| 1456 | Ga0495624_0020482 | 3300046690 | Bacteria | 4401 |
| 1457 | Ga0495624_0039682 | 3300046690 | Bacteria | 3017 |
| 1458 | Ga0495624_0053509 | 3300046690 | Bacteria | 2548 |
| 1459 | Ga0495624_0069830 | 3300046690 | Bacteria | 2187 |
| 1460 | Ga0495624_0097562 | 3300046690 | Bacteria | 1810 |
| 1461 | Ga0495624_0149960 | 3300046690 | Bacteria | 1426 |
| 1462 | Ga0495624_0499649 | 3300046690 | Bacteria | 727 |
| 1463 | Ga0495624_0599869 | 3300046690 | Bacteria | 656 |
| 1464 | Ga0495670_0009867 | 3300046691 | Bacteria | 4696 |
| 1465 | Ga0495670_0028896 | 3300046691 | Bacteria | 2749 |
| 1466 | Ga0495670_0035188 | 3300046691 | Bacteria | 2495 |
| 1467 | Ga0495670_0067273 | 3300046691 | Bacteria | 1808 |
| 1468 | Ga0495670_0102977 | 3300046691 | Bacteria | 1471 |
| 1469 | Ga0495670_0119876 | 3300046691 | Bacteria | 1366 |
| 1470 | Ga0495670_0150687 | 3300046691 | Bacteria | 1219 |
| 1471 | Ga0495670_0166291 | 3300046691 | Bacteria | 1160 |
| 1472 | Ga0495670_0320214 | 3300046691 | Bacteria | 832 |
| 1473 | Ga0495671_0000037 | 3300046692 | Bacteria | 177605 |
| 1474 | Ga0495671_0005005 | 3300046692 | Bacteria | 7807 |
| 1475 | Ga0495671_0012352 | 3300046692 | Bacteria | 4668 |
| 1476 | Ga0495671_0014262 | 3300046692 | Bacteria | 4282 |
| 1477 | Ga0495671_0387612 | 3300046692 | Bacteria | 669 |
| 1478 | Ga0495671_0457852 | 3300046692 | Bacteria | 609 |
| 1479 | Ga0495649_0007567 | 3300046694 | Bacteria | 6610 |
| 1480 | Ga0495649_0041099 | 3300046694 | Bacteria | 2529 |
| 1481 | Ga0495649_0055982 | 3300046694 | Bacteria | 2130 |
| 1482 | Ga0495649_0064779 | 3300046694 | Bacteria | 1962 |
| 1483 | Ga0495649_0088148 | 3300046694 | Bacteria | 1655 |
| 1484 | Ga0495649_0129516 | 3300046694 | Bacteria | 1331 |
| 1485 | Ga0495649_0136805 | 3300046694 | Bacteria | 1291 |
| 1486 | Ga0495649_0140298 | 3300046694 | Bacteria | 1272 |
| 1487 | Ga0495649_0152737 | 3300046694 | Bacteria | 1212 |
| 1488 | Ga0495649_0226406 | 3300046694 | Bacteria | 966 |
| 1489 | Ga0495649_0246537 | 3300046694 | Bacteria | 918 |
| 1490 | Ga0495589_0016595 | 3300046794 | Bacteria | 3783 |
| 1491 | Ga0495589_0021019 | 3300046794 | Bacteria | 3335 |
| 1492 | Ga0495589_0056788 | 3300046794 | Bacteria | 1926 |
| 1493 | Ga0495589_0063428 | 3300046794 | Bacteria | 1812 |
| 1494 | Ga0495589_0074703 | 3300046794 | Bacteria | 1653 |
| 1495 | Ga0495589_0140971 | 3300046794 | Bacteria | 1154 |
| 1496 | Ga0495589_0157145 | 3300046794 | Bacteria | 1084 |
| 1497 | Ga0495589_0232418 | 3300046794 | Bacteria | 864 |
| 1498 | Ga0495589_0312150 | 3300046794 | Bacteria | 727 |
| 1499 | Ga0495600_0004009 | 3300046809 | Bacteria | 8753 |
| 1500 | Ga0495600_0039828 | 3300046809 | Bacteria | 3060 |
| 1501 | Ga0495600_0178346 | 3300046809 | Bacteria | 1369 |
| 1502 | Ga0495600_0185571 | 3300046809 | Bacteria | 1339 |
| 1503 | Ga0495600_0198806 | 3300046809 | Bacteria | 1288 |
| 1504 | Ga0495600_0493571 | 3300046809 | Bacteria | 753 |
| 1505 | Ga0495660_0010186 | 3300046810 | Bacteria | 5468 |
| 1506 | Ga0495660_0011018 | 3300046810 | Bacteria | 5250 |
| 1507 | Ga0495660_0012969 | 3300046810 | Bacteria | 4831 |
| 1508 | Ga0495660_0015683 | 3300046810 | Bacteria | 4375 |
| 1509 | Ga0495660_0034744 | 3300046810 | Bacteria | 2819 |
| 1510 | Ga0495660_0048108 | 3300046810 | Bacteria | 2332 |
| 1511 | Ga0495660_0051977 | 3300046810 | Bacteria | 2227 |
| 1512 | Ga0495660_0065924 | 3300046810 | Bacteria | 1931 |
| 1513 | Ga0495660_0084002 | 3300046810 | Bacteria | 1665 |
| 1514 | Ga0495660_0116780 | 3300046810 | Bacteria | 1355 |
| 1515 | Ga0495660_0119454 | 3300046810 | Bacteria | 1335 |
| 1516 | Ga0495660_0174053 | 3300046810 | Bacteria | 1046 |
| 1517 | Ga0495660_0208048 | 3300046810 | Bacteria | 930 |
| 1518 | Ga0495660_0285985 | 3300046810 | Bacteria | 752 |
| 1519 | Ga0495581_0003269 | 3300047315 | Bacteria | 9295 |
| 1520 | Ga0495581_0011615 | 3300047315 | Bacteria | 5097 |
| 1521 | Ga0495581_0027016 | 3300047315 | Bacteria | 3328 |
| 1522 | Ga0495581_0040802 | 3300047315 | Bacteria | 2684 |
| 1523 | Ga0495581_0078701 | 3300047315 | Bacteria | 1908 |
| 1524 | Ga0495581_0157473 | 3300047315 | Bacteria | 1327 |
| 1525 | Ga0495581_0176605 | 3300047315 | Bacteria | 1248 |
| 1526 | Ga0495604_0003421 | 3300047317 | Bacteria | 12655 |
| 1527 | Ga0495604_0010804 | 3300047317 | Bacteria | 7251 |
| 1528 | Ga0495604_0048599 | 3300047317 | Bacteria | 3300 |
| 1529 | Ga0495604_0096566 | 3300047317 | Bacteria | 2180 |
| 1530 | Ga0495604_0126319 | 3300047317 | Bacteria | 1843 |
| 1531 | Ga0495604_0290778 | 3300047317 | Bacteria | 1100 |
| 1532 | Ga0495604_0433131 | 3300047317 | Bacteria | 861 |
| 1533 | Ga0495636_0001434 | 3300047318 | Bacteria | 9014 |
| 1534 | Ga0495636_0003890 | 3300047318 | Bacteria | 5826 |
| 1535 | Ga0495636_0006133 | 3300047318 | Bacteria | 4722 |
| 1536 | Ga0495636_0006316 | 3300047318 | Bacteria | 4654 |
| 1537 | Ga0495636_0018170 | 3300047318 | Bacteria | 2820 |
| 1538 | Ga0495636_0040864 | 3300047318 | Bacteria | 1923 |
| 1539 | Ga0495636_0106143 | 3300047318 | Bacteria | 1232 |
| 1540 | Ga0495636_0259312 | 3300047318 | Bacteria | 806 |
| 1541 | Ga0495636_0337773 | 3300047318 | Bacteria | 709 |
| 1542 | Ga0495674_0013576 | 3300047319 | Bacteria | 7652 |
| 1543 | Ga0495674_0022526 | 3300047319 | Bacteria | 5810 |
| 1544 | Ga0495674_0031660 | 3300047319 | Bacteria | 4803 |
| 1545 | Ga0495674_0046418 | 3300047319 | Bacteria | 3855 |
| 1546 | Ga0495674_0055008 | 3300047319 | Bacteria | 3491 |
| 1547 | Ga0495674_0102840 | 3300047319 | Bacteria | 2429 |
| 1548 | Ga0495674_0280785 | 3300047319 | Bacteria | 1364 |
| 1549 | Ga0495672_0000013 | 3300047320 | Bacteria | 511827 |
| 1550 | Ga0495672_0000157 | 3300047320 | Bacteria | 98544 |
| 1551 | Ga0495672_0007686 | 3300047320 | Bacteria | 8079 |
| 1552 | Ga0495672_0015499 | 3300047320 | Bacteria | 5172 |
| 1553 | Ga0495672_0029479 | 3300047320 | Bacteria | 3455 |
| 1554 | Ga0495672_0031965 | 3300047320 | Bacteria | 3280 |
| 1555 | Ga0495672_0033248 | 3300047320 | Bacteria | 3196 |
| 1556 | Ga0495672_0035691 | 3300047320 | Bacteria | 3060 |
| 1557 | Ga0495672_0045766 | 3300047320 | Bacteria | 2615 |
| 1558 | Ga0495672_0119798 | 3300047320 | Bacteria | 1400 |
| 1559 | Ga0495672_0161124 | 3300047320 | Bacteria | 1153 |
| 1560 | Ga0495672_0357737 | 3300047320 | Bacteria | 676 |
| 1561 | Ga0495676_0010234 | 3300047321 | Bacteria | 8515 |
| 1562 | Ga0495676_0024323 | 3300047321 | Bacteria | 5246 |
| 1563 | Ga0495676_0026376 | 3300047321 | Bacteria | 5003 |
| 1564 | Ga0495676_0067455 | 3300047321 | Bacteria | 2767 |
| 1565 | Ga0495676_0077394 | 3300047321 | Bacteria | 2536 |
| 1566 | Ga0495676_0098301 | 3300047321 | Bacteria | 2172 |
| 1567 | Ga0495676_0113267 | 3300047321 | Bacteria | 1986 |
| 1568 | Ga0495676_0120830 | 3300047321 | Bacteria | 1906 |
| 1569 | Ga0495676_0275944 | 3300047321 | Bacteria | 1139 |
| 1570 | Ga0495680_0007818 | 3300047322 | Bacteria | 9766 |
| 1571 | Ga0495680_0074468 | 3300047322 | Bacteria | 2578 |
| 1572 | Ga0495680_0100796 | 3300047322 | Bacteria | 2151 |
| 1573 | Ga0495680_0134396 | 3300047322 | Bacteria | 1814 |
| 1574 | Ga0495680_0186233 | 3300047322 | Bacteria | 1495 |
| 1575 | Ga0495680_0232979 | 3300047322 | Bacteria | 1310 |
| 1576 | Ga0495680_0250054 | 3300047322 | Bacteria | 1256 |
| 1577 | Ga0495680_0404052 | 3300047322 | Bacteria | 942 |
| 1578 | Ga0495680_1032052 | 3300047322 | Bacteria | 523 |
| 1579 | Ga0495683_0001129 | 3300047323 | Bacteria | 18380 |
| 1580 | Ga0495683_0017957 | 3300047323 | Bacteria | 3662 |
| 1581 | Ga0495683_0022066 | 3300047323 | Bacteria | 3275 |
| 1582 | Ga0495683_0023372 | 3300047323 | Bacteria | 3176 |
| 1583 | Ga0495683_0032766 | 3300047323 | Bacteria | 2646 |
| 1584 | Ga0495683_0033028 | 3300047323 | Bacteria | 2635 |
| 1585 | Ga0495683_0044638 | 3300047323 | Bacteria | 2229 |
| 1586 | Ga0495683_0049847 | 3300047323 | Bacteria | 2096 |
| 1587 | Ga0495683_0059991 | 3300047323 | Bacteria | 1886 |
| 1588 | Ga0495683_0070031 | 3300047323 | Bacteria | 1722 |
| 1589 | Ga0495683_0093261 | 3300047323 | Bacteria | 1456 |
| 1590 | Ga0495683_0188735 | 3300047323 | Bacteria | 936 |
| 1591 | Ga0495683_0275552 | 3300047323 | Bacteria | 730 |
| 1592 | Ga0495687_000216 | 3300047443 | Bacteria | 81734 |
| 1593 | Ga0495687_000342 | 3300047443 | Bacteria | 59692 |
| 1594 | Ga0495687_001562 | 3300047443 | Bacteria | 20787 |
| 1595 | Ga0495687_002921 | 3300047443 | Bacteria | 12995 |
| 1596 | Ga0495687_007470 | 3300047443 | Bacteria | 6428 |
| 1597 | Ga0495687_013991 | 3300047443 | Bacteria | 4152 |
| 1598 | Ga0495687_027846 | 3300047443 | Bacteria | 2638 |
| 1599 | Ga0495687_062464 | 3300047443 | Bacteria | 1528 |
| 1600 | Ga0495687_084824 | 3300047443 | Bacteria | 1229 |
| 1601 | Ga0495687_095851 | 3300047443 | Bacteria | 1124 |
| 1602 | Ga0495687_171650 | 3300047443 | Bacteria | 717 |
| 1603 | Ga0495675_0013567 | 3300047444 | Bacteria | 5145 |
| 1604 | Ga0495675_0021158 | 3300047444 | Bacteria | 4140 |
| 1605 | Ga0495675_0053131 | 3300047444 | Bacteria | 2572 |
| 1606 | Ga0495675_0072252 | 3300047444 | Bacteria | 2176 |
| 1607 | Ga0495675_0098979 | 3300047444 | Bacteria | 1826 |
| 1608 | Ga0495675_0191731 | 3300047444 | Bacteria | 1247 |
| 1609 | Ga0495677_0001866 | 3300047445 | Bacteria | 8421 |
| 1610 | Ga0495677_0005942 | 3300047445 | Bacteria | 4622 |
| 1611 | Ga0495677_0008079 | 3300047445 | Bacteria | 3906 |
| 1612 | Ga0495677_0009137 | 3300047445 | Bacteria | 3662 |
| 1613 | Ga0495677_0015597 | 3300047445 | Bacteria | 2760 |
| 1614 | Ga0495677_0044661 | 3300047445 | Bacteria | 1624 |
| 1615 | Ga0495677_0109477 | 3300047445 | Bacteria | 1049 |
| 1616 | Ga0495677_0176898 | 3300047445 | Bacteria | 826 |
| 1617 | Ga0495677_0275635 | 3300047445 | Bacteria | 659 |
| 1618 | Ga0495677_0289370 | 3300047445 | Bacteria | 643 |
| 1619 | Ga0495679_008349 | 3300047446 | Bacteria | 4218 |
| 1620 | Ga0495679_012257 | 3300047446 | Bacteria | 3270 |
| 1621 | Ga0495679_017521 | 3300047446 | Bacteria | 2562 |
| 1622 | Ga0495679_017686 | 3300047446 | Bacteria | 2546 |
| 1623 | Ga0495679_023106 | 3300047446 | Bacteria | 2115 |
| 1624 | Ga0495679_041737 | 3300047446 | Bacteria | 1418 |
| 1625 | Ga0495685_000291 | 3300047447 | Bacteria | 16719 |
| 1626 | Ga0495685_001965 | 3300047447 | Bacteria | 6380 |
| 1627 | Ga0495685_014389 | 3300047447 | Bacteria | 2688 |
| 1628 | Ga0495685_019727 | 3300047447 | Bacteria | 2316 |
| 1629 | Ga0495685_034014 | 3300047447 | Bacteria | 1751 |
| 1630 | Ga0495685_071378 | 3300047447 | Bacteria | 1162 |
| 1631 | Ga0495685_079079 | 3300047447 | Bacteria | 1096 |
| 1632 | Ga0495685_108989 | 3300047447 | Bacteria | 912 |
| 1633 | Ga0495685_138553 | 3300047447 | Bacteria | 793 |
| 1634 | Ga0495673_0000248 | 3300047469 | Bacteria | 75224 |
| 1635 | Ga0495673_0019105 | 3300047469 | Bacteria | 3439 |
| 1636 | Ga0495673_0030733 | 3300047469 | Bacteria | 2520 |
| 1637 | Ga0495673_0067504 | 3300047469 | Bacteria | 1513 |
| 1638 | Ga0495673_0078261 | 3300047469 | Bacteria | 1375 |
| 1639 | Ga0495673_0132106 | 3300047469 | Bacteria | 980 |
| 1640 | Ga0495673_0310455 | 3300047469 | Bacteria | 563 |
| 1641 | Ga0495681_0009083 | 3300047470 | Bacteria | 6161 |
| 1642 | Ga0495681_0010756 | 3300047470 | Bacteria | 5512 |
| 1643 | Ga0495681_0011744 | 3300047470 | Bacteria | 5189 |
| 1644 | Ga0495681_0021475 | 3300047470 | Bacteria | 3477 |
| 1645 | Ga0495681_0043390 | 3300047470 | Bacteria | 2169 |
| 1646 | Ga0495681_0046827 | 3300047470 | Bacteria | 2059 |
| 1647 | Ga0495681_0086167 | 3300047470 | Bacteria | 1394 |
| 1648 | Ga0495681_0126902 | 3300047470 | Bacteria | 1089 |
| 1649 | Ga0495681_0249667 | 3300047470 | Bacteria | 701 |
| 1650 | Ga0495681_0271015 | 3300047470 | Bacteria | 664 |
| 1651 | Ga0495684_0068039 | 3300047471 | Bacteria | 2708 |
| 1652 | Ga0495686_0000214 | 3300047472 | Bacteria | 106493 |
| 1653 | Ga0495686_0000787 | 3300047472 | Bacteria | 41374 |
| 1654 | Ga0495686_0001126 | 3300047472 | Bacteria | 31591 |
| 1655 | Ga0495686_0007683 | 3300047472 | Bacteria | 8051 |
| 1656 | Ga0495686_0010875 | 3300047472 | Bacteria | 6444 |
| 1657 | Ga0495686_0057869 | 3300047472 | Bacteria | 2418 |
| 1658 | Ga0495686_0189431 | 3300047472 | Bacteria | 1186 |
| 1659 | Ga0495686_0290820 | 3300047472 | Bacteria | 905 |
| 1660 | Ga0495686_0391768 | 3300047472 | Bacteria | 747 |
| 1661 | Ga0495686_0458937 | 3300047472 | Bacteria | 676 |
| 1662 | Ga0495686_0584168 | 3300047472 | Bacteria | 580 |
| 1663 | Ga0495593_0002955 | 3300047673 | Bacteria | 10225 |
| 1664 | Ga0495593_0015413 | 3300047673 | Bacteria | 4328 |
| 1665 | Ga0495593_0018189 | 3300047673 | Bacteria | 3952 |
| 1666 | Ga0495593_0036990 | 3300047673 | Bacteria | 2643 |
| 1667 | Ga0495593_0185141 | 3300047673 | Bacteria | 1048 |
| 1668 | Ga0495593_0466381 | 3300047673 | Bacteria | 632 |
| 1669 | Ga0495602_0036361 | 3300048088 | Bacteria | 4584 |
| 1670 | Ga0495602_0051607 | 3300048088 | Bacteria | 3661 |
| 1671 | Ga0495602_0075551 | 3300048088 | Bacteria | 2859 |
| 1672 | Ga0495602_0313649 | 3300048088 | Bacteria | 1143 |
| 1673 | Ga0495602_0783218 | 3300048088 | Bacteria | 641 |
| 1674 | Ga0495614_0048811 | 3300048089 | Bacteria | 1814 |
| 1675 | Ga0495614_0048818 | 3300048089 | Bacteria | 1814 |
| 1676 | Ga0495614_0056437 | 3300048089 | Bacteria | 1685 |
| 1677 | Ga0495614_0320971 | 3300048089 | Bacteria | 718 |
| 1678 | Ga0495615_0013648 | 3300048090 | Bacteria | 1701 |
| 1679 | Ga0495615_0100569 | 3300048090 | Bacteria | 816 |
| 1680 | Ga0495626_0000227 | 3300048091 | Bacteria | 66048 |
| 1681 | Ga0495626_0010154 | 3300048091 | Bacteria | 5050 |
| 1682 | Ga0495626_0021350 | 3300048091 | Bacteria | 3212 |
| 1683 | Ga0495626_0022785 | 3300048091 | Bacteria | 3091 |
| 1684 | Ga0495626_0040841 | 3300048091 | Bacteria | 2189 |
| 1685 | Ga0495626_0044118 | 3300048091 | Bacteria | 2088 |
| 1686 | Ga0495626_0055982 | 3300048091 | Bacteria | 1806 |
| 1687 | Ga0495626_0060164 | 3300048091 | Bacteria | 1731 |
| 1688 | Ga0495626_0073481 | 3300048091 | Bacteria | 1531 |
| 1689 | Ga0495626_0073528 | 3300048091 | Bacteria | 1531 |
| 1690 | Ga0495626_0083647 | 3300048091 | Bacteria | 1413 |
| 1691 | Ga0495626_0084714 | 3300048091 | Bacteria | 1402 |
| 1692 | Ga0495626_0096000 | 3300048091 | Bacteria | 1297 |
| 1693 | Ga0495626_0097284 | 3300048091 | Bacteria | 1287 |
| 1694 | Ga0495626_0126416 | 3300048091 | Bacteria | 1095 |
| 1695 | Ga0495626_0202562 | 3300048091 | Bacteria | 813 |
| 1696 | Ga0495626_0212790 | 3300048091 | Bacteria | 788 |
| 1697 | Ga0495626_0290644 | 3300048091 | Bacteria | 647 |
| 1698 | Ga0496100_0067106 | 3300048903 | Bacteria | 2381 |
| 1699 | Ga0496100_0111532 | 3300048903 | Bacteria | 1901 |
| 1700 | Ga0496100_0114800 | 3300048903 | Bacteria | 1876 |
| 1701 | Ga0496100_0275250 | 3300048903 | Bacteria | 1253 |
| 1702 | Ga0496100_0294264 | 3300048903 | Bacteria | 1213 |
| 1703 | Ga0496100_0641645 | 3300048903 | Bacteria | 826 |
| 1704 | Ga0496101_0009727 | 3300048904 | Bacteria | 6329 |
| 1705 | Ga0496101_0046173 | 3300048904 | Bacteria | 3123 |
| 1706 | Ga0496101_0211964 | 3300048904 | Bacteria | 1501 |
| 1707 | Ga0496101_0560311 | 3300048904 | Bacteria | 903 |
| 1708 | Ga0496101_0907796 | 3300048904 | Bacteria | 693 |
| 1709 | Ga0496101_1140934 | 3300048904 | Bacteria | 611 |
| 1710 | Ga0496102_0006537 | 3300048905 | Bacteria | 9950 |
| 1711 | Ga0496102_0039654 | 3300048905 | Bacteria | 4256 |
| 1712 | Ga0496102_0075112 | 3300048905 | Bacteria | 3106 |
| 1713 | Ga0496102_0092053 | 3300048905 | Bacteria | 2807 |
| 1714 | Ga0496102_0197397 | 3300048905 | Bacteria | 1896 |
| 1715 | Ga0496102_0214439 | 3300048905 | Bacteria | 1814 |
| 1716 | Ga0496102_0413289 | 3300048905 | Bacteria | 1267 |
| 1717 | Ga0496102_1758156 | 3300048905 | Bacteria | 537 |
| 1718 | Ga0496103_0003318 | 3300048906 | Bacteria | 9844 |
| 1719 | Ga0496103_0017021 | 3300048906 | Bacteria | 4345 |
| 1720 | Ga0496103_0032288 | 3300048906 | Bacteria | 3195 |
| 1721 | Ga0496103_0038283 | 3300048906 | Bacteria | 2942 |
| 1722 | Ga0496103_0155309 | 3300048906 | Bacteria | 1466 |
| 1723 | Ga0496103_0210497 | 3300048906 | Bacteria | 1250 |
| 1724 | Ga0496103_0343097 | 3300048906 | Bacteria | 960 |
| 1725 | Ga0496103_0426401 | 3300048906 | Bacteria | 851 |
| 1726 | Ga0496104_0018044 | 3300048907 | Bacteria | 6433 |
| 1727 | Ga0496104_0336166 | 3300048907 | Bacteria | 1423 |
| 1728 | Ga0496104_0505298 | 3300048907 | Bacteria | 1120 |
| 1729 | Ga0496104_0651804 | 3300048907 | Bacteria | 962 |
| 1730 | Ga0496104_0807072 | 3300048907 | Bacteria | 844 |
| 1731 | Ga0496104_1163973 | 3300048907 | Bacteria | 674 |
| 1732 | Ga0496105_0035800 | 3300048908 | Bacteria | 4087 |
| 1733 | Ga0496105_0223701 | 3300048908 | Bacteria | 1531 |
| 1734 | Ga0496105_0350800 | 3300048908 | Bacteria | 1178 |
| 1735 | Ga0496106_0006711 | 3300048909 | Bacteria | 8526 |
| 1736 | Ga0496106_0036102 | 3300048909 | Bacteria | 3697 |
| 1737 | Ga0496106_0042023 | 3300048909 | Bacteria | 3427 |
| 1738 | Ga0496106_0171980 | 3300048909 | Bacteria | 1717 |
| 1739 | Ga0496106_0691124 | 3300048909 | Bacteria | 813 |
| 1740 | Ga0496107_0069085 | 3300048910 | Bacteria | 2564 |
| 1741 | Ga0496107_0088073 | 3300048910 | Bacteria | 2266 |
| 1742 | Ga0496107_0160774 | 3300048910 | Bacteria | 1664 |
| 1743 | Ga0496107_0222414 | 3300048910 | Bacteria | 1404 |
| 1744 | Ga0496107_0848596 | 3300048910 | Bacteria | 667 |
| 1745 | Ga0496108_0409678 | 3300048911 | Bacteria | 1184 |
| 1746 | Ga0496108_1331530 | 3300048911 | Bacteria | 603 |
| 1747 | Ga0496109_0042732 | 3300048912 | Bacteria | 4107 |
| 1748 | Ga0496109_0548480 | 3300048912 | Bacteria | 1090 |
| 1749 | Ga0496110_0032653 | 3300048913 | Bacteria | 4498 |
| 1750 | Ga0496110_0294723 | 3300048913 | Bacteria | 1478 |
| 1751 | Ga0496110_0456356 | 3300048913 | Bacteria | 1164 |
| 1752 | Ga0496110_0457031 | 3300048913 | Bacteria | 1163 |
| 1753 | Ga0496110_0794302 | 3300048913 | Bacteria | 851 |
| 1754 | Ga0496110_1205357 | 3300048913 | Bacteria | 666 |
| 1755 | Ga0496110_1261699 | 3300048913 | Bacteria | 648 |
| 1756 | Ga0496111_0013924 | 3300048914 | Bacteria | 5484 |
| 1757 | Ga0496111_0408873 | 3300048914 | Bacteria | 1003 |
| 1758 | Ga0496111_0830563 | 3300048914 | Bacteria | 668 |
| 1759 | Ga0496112_0014789 | 3300048915 | Bacteria | 7256 |
| 1760 | Ga0496112_0196015 | 3300048915 | Bacteria | 1980 |
| 1761 | Ga0496112_0529748 | 3300048915 | Bacteria | 1112 |
| 1762 | Ga0496113_0023586 | 3300048916 | Bacteria | 4363 |
| 1763 | Ga0496113_0027568 | 3300048916 | Bacteria | 4073 |
| 1764 | Ga0496113_0173984 | 3300048916 | Bacteria | 1705 |
| 1765 | Ga0496113_0274888 | 3300048916 | Bacteria | 1347 |
| 1766 | Ga0496113_0476254 | 3300048916 | Bacteria | 1003 |
| 1767 | Ga0496113_0757937 | 3300048916 | Bacteria | 772 |
| 1768 | Ga0496114_0018505 | 3300048917 | Bacteria | 5633 |
| 1769 | Ga0496114_0091484 | 3300048917 | Bacteria | 2584 |
| 1770 | Ga0496114_0372797 | 3300048917 | Bacteria | 1263 |
| 1771 | Ga0496114_0845291 | 3300048917 | Bacteria | 795 |
| 1772 | Ga0496115_0040092 | 3300048918 | Bacteria | 3721 |
| 1773 | Ga0496115_0062017 | 3300048918 | Bacteria | 3015 |
| 1774 | Ga0496115_0131007 | 3300048918 | Bacteria | 2067 |
| 1775 | Ga0496115_0131327 | 3300048918 | Bacteria | 2064 |
| 1776 | Ga0496115_0254757 | 3300048918 | Bacteria | 1444 |
| 1777 | Ga0496115_0376151 | 3300048918 | Bacteria | 1156 |
| 1778 | Ga0496115_0379901 | 3300048918 | Bacteria | 1149 |
| 1779 | Ga0496115_0431565 | 3300048918 | Bacteria | 1066 |
| 1780 | Ga0496115_0532444 | 3300048918 | Bacteria | 941 |
| 1781 | Ga0496115_0572610 | 3300048918 | Bacteria | 900 |
| 1782 | Ga0496115_0608123 | 3300048918 | Bacteria | 868 |
| 1783 | Ga0496116_0006663 | 3300048919 | Bacteria | 10425 |
| 1784 | Ga0496116_0032654 | 3300048919 | Bacteria | 3706 |
| 1785 | Ga0496116_0054709 | 3300048919 | Bacteria | 2626 |
| 1786 | Ga0496116_0120515 | 3300048919 | Bacteria | 1519 |
| 1787 | Ga0496116_0122217 | 3300048919 | Bacteria | 1504 |
| 1788 | Ga0496116_0174618 | 3300048919 | Bacteria | 1159 |
| 1789 | Ga0496116_0226636 | 3300048919 | Bacteria | 952 |
| 1790 | Ga0496116_0393203 | 3300048919 | Bacteria | 617 |
| 1791 | Ga0496117_0002850 | 3300048920 | Bacteria | 21031 |
| 1792 | Ga0496117_0029031 | 3300048920 | Bacteria | 4270 |
| 1793 | Ga0496117_0104585 | 3300048920 | Bacteria | 1781 |
| 1794 | Ga0496118_0010366 | 3300048921 | Bacteria | 9235 |
| 1795 | Ga0496118_0027422 | 3300048921 | Bacteria | 4820 |
| 1796 | Ga0496118_0039741 | 3300048921 | Bacteria | 3750 |
| 1797 | Ga0496118_0100694 | 3300048921 | Bacteria | 1953 |
| 1798 | Ga0496118_0127248 | 3300048921 | Bacteria | 1644 |
| 1799 | Ga0496118_0201720 | 3300048921 | Bacteria | 1177 |
| 1800 | Ga0496118_0207405 | 3300048921 | Bacteria | 1153 |
| 1801 | Ga0496119_0006975 | 3300048922 | Bacteria | 10299 |
| 1802 | Ga0496119_0033005 | 3300048922 | Bacteria | 3441 |
| 1803 | Ga0496119_0151658 | 3300048922 | Bacteria | 1241 |
| 1804 | Ga0496119_0188727 | 3300048922 | Bacteria | 1075 |
| 1805 | Ga0496120_0152393 | 3300048923 | Bacteria | 1160 |
| 1806 | Ga0496120_0182412 | 3300048923 | Bacteria | 1029 |
| 1807 | Ga0496120_0264386 | 3300048923 | Bacteria | 802 |
| 1808 | Ga0496121_0002928 | 3300048924 | Bacteria | 24987 |
| 1809 | Ga0496121_0015151 | 3300048924 | Bacteria | 8107 |
| 1810 | Ga0496121_0023493 | 3300048924 | Bacteria | 5935 |
| 1811 | Ga0496121_0031966 | 3300048924 | Bacteria | 4796 |
| 1812 | Ga0496121_0040564 | 3300048924 | Bacteria | 4081 |
| 1813 | Ga0496121_0060060 | 3300048924 | Bacteria | 3130 |
| 1814 | Ga0496121_0064627 | 3300048924 | Bacteria | 2982 |
| 1815 | Ga0496121_0233788 | 3300048924 | Bacteria | 1285 |
| 1816 | Ga0496121_0672503 | 3300048924 | Bacteria | 627 |
| 1817 | Ga0496122_0002652 | 3300048925 | Bacteria | 24985 |
| 1818 | Ga0496122_0006384 | 3300048925 | Bacteria | 13553 |
| 1819 | Ga0496122_0045238 | 3300048925 | Bacteria | 3423 |
| 1820 | Ga0496122_0117785 | 3300048925 | Bacteria | 1723 |
| 1821 | Ga0496122_0241896 | 3300048925 | Bacteria | 1017 |
| 1822 | Ga0496123_0007601 | 3300048926 | Bacteria | 10151 |
| 1823 | Ga0496123_0011446 | 3300048926 | Bacteria | 7687 |
| 1824 | Ga0496123_0024316 | 3300048926 | Bacteria | 4607 |
| 1825 | Ga0496123_0031548 | 3300048926 | Bacteria | 3853 |
| 1826 | Ga0496123_0050572 | 3300048926 | Bacteria | 2775 |
| 1827 | Ga0496124_0035888 | 3300048927 | Bacteria | 4332 |
| 1828 | Ga0496124_0042938 | 3300048927 | Bacteria | 3889 |
| 1829 | Ga0496124_0052609 | 3300048927 | Bacteria | 3458 |
| 1830 | Ga0496124_0080875 | 3300048927 | Bacteria | 2672 |
| 1831 | Ga0496124_0083920 | 3300048927 | Bacteria | 2613 |
| 1832 | Ga0496124_0089738 | 3300048927 | Bacteria | 2509 |
| 1833 | Ga0496124_0235447 | 3300048927 | Bacteria | 1365 |
| 1834 | Ga0496124_0237303 | 3300048927 | Bacteria | 1358 |
| 1835 | Ga0496124_0317340 | 3300048927 | Bacteria | 1117 |
| 1836 | Ga0496124_0542713 | 3300048927 | Bacteria | 769 |
| 1837 | Ga0496125_0001934 | 3300048928 | Bacteria | 28316 |
| 1838 | Ga0496125_0005068 | 3300048928 | Bacteria | 14849 |
| 1839 | Ga0496125_0134373 | 3300048928 | Bacteria | 1733 |
| 1840 | Ga0496125_0164527 | 3300048928 | Bacteria | 1501 |
| 1841 | Ga0496125_0177292 | 3300048928 | Bacteria | 1424 |
| 1842 | Ga0496125_0253014 | 3300048928 | Bacteria | 1110 |
| 1843 | Ga0496125_0412167 | 3300048928 | Bacteria | 786 |
| 1844 | Ga0496126_0004622 | 3300048929 | Bacteria | 16312 |
| 1845 | Ga0496126_0005787 | 3300048929 | Bacteria | 13974 |
| 1846 | Ga0496126_0007973 | 3300048929 | Bacteria | 11505 |
| 1847 | Ga0496126_0031015 | 3300048929 | Bacteria | 5056 |
| 1848 | Ga0496126_0051319 | 3300048929 | Bacteria | 3755 |
| 1849 | Ga0496126_0090828 | 3300048929 | Bacteria | 2686 |
| 1850 | Ga0496126_0173352 | 3300048929 | Bacteria | 1836 |
| 1851 | Ga0496126_0763102 | 3300048929 | Bacteria | 745 |
| 1852 | Ga0501306_000005 | 3300049127 | Bacteria | 11576 |
| 1853 | Ga0501306_000357 | 3300049127 | Bacteria | 3332 |
| 1854 | Ga0501306_000359 | 3300049127 | Bacteria | 3323 |
| 1855 | Ga0501306_002633 | 3300049127 | Bacteria | 1863 |
| 1856 | Ga0501306_006022 | 3300049127 | Bacteria | 1409 |
| 1857 | Ga0501306_051944 | 3300049127 | Bacteria | 659 |
| 1858 | Ga0501306_104473 | 3300049127 | Bacteria | 509 |
| 1859 | Ga0501308_000002 | 3300049128 | Bacteria | 13277 |
| 1860 | Ga0501308_000101 | 3300049128 | Bacteria | 3987 |
| 1861 | Ga0501308_001514 | 3300049128 | Bacteria | 1877 |
| 1862 | Ga0501308_005869 | 3300049128 | Bacteria | 1240 |
| 1863 | Ga0501309_000053 | 3300049129 | Bacteria | 5860 |
| 1864 | Ga0501309_000994 | 3300049129 | Bacteria | 2589 |
| 1865 | Ga0501309_008348 | 3300049129 | Bacteria | 1302 |
| 1866 | Ga0501309_018310 | 3300049129 | Bacteria | 967 |
| 1867 | Ga0501310_000065 | 3300049130 | Bacteria | 9861 |
| 1868 | Ga0501310_000908 | 3300049130 | Bacteria | 2638 |
| 1869 | Ga0501310_001119 | 3300049130 | Bacteria | 2408 |
| 1870 | Ga0501310_001494 | 3300049130 | Bacteria | 2132 |
| 1871 | Ga0501310_005775 | 3300049130 | Bacteria | 1278 |
| 1872 | Ga0501310_006883 | 3300049130 | Bacteria | 1204 |
| 1873 | Ga0501343_001045 | 3300049132 | Bacteria | 1805 |
| 1874 | Ga0501343_003853 | 3300049132 | Bacteria | 1115 |
| 1875 | Ga0501304_000001 | 3300049160 | Bacteria | 14569 |
| 1876 | Ga0501304_000110 | 3300049160 | Bacteria | 3123 |
| 1877 | Ga0501305_000138 | 3300049161 | Bacteria | 4738 |
| 1878 | Ga0501305_001754 | 3300049161 | Bacteria | 2204 |
| 1879 | Ga0501305_002625 | 3300049161 | Bacteria | 1958 |
| 1880 | Ga0501307_000084 | 3300049162 | Bacteria | 4158 |
| 1881 | Ga0501307_000295 | 3300049162 | Bacteria | 3069 |
| 1882 | Ga0501307_000470 | 3300049162 | Bacteria | 2735 |
| 1883 | Ga0501307_000643 | 3300049162 | Bacteria | 2526 |
| 1884 | Ga0501307_008590 | 3300049162 | Bacteria | 1151 |
| 1885 | Ga0501307_027472 | 3300049162 | Bacteria | 774 |
| 1886 | Ga0495678_000010 | 3300049459 | Bacteria | 357896 |
| 1887 | Ga0495678_006058 | 3300049459 | Bacteria | 6512 |
| 1888 | Ga0495678_006909 | 3300049459 | Bacteria | 5955 |
| 1889 | Ga0495678_008007 | 3300049459 | Bacteria | 5399 |
| 1890 | Ga0495678_016621 | 3300049459 | Bacteria | 3359 |
| 1891 | Ga0495678_016940 | 3300049459 | Bacteria | 3315 |
| 1892 | Ga0495678_021632 | 3300049459 | Bacteria | 2828 |
| 1893 | Ga0495678_031895 | 3300049459 | Bacteria | 2191 |
| 1894 | Ga0495678_052645 | 3300049459 | Bacteria | 1566 |
| 1895 | Ga0495678_058254 | 3300049459 | Bacteria | 1460 |
| 1896 | Ga0495678_093588 | 3300049459 | Bacteria | 1053 |
| 1897 | Ga0495678_172811 | 3300049459 | Bacteria | 682 |
| 1898 | Ga0495678_187690 | 3300049459 | Bacteria | 644 |
| 1899 | Ga0495682_0003087 | 3300049460 | Bacteria | 7552 |
| 1900 | Ga0495682_0003914 | 3300049460 | Bacteria | 6501 |
| 1901 | Ga0495682_0006686 | 3300049460 | Bacteria | 4656 |
| 1902 | Ga0495682_0015613 | 3300049460 | Bacteria | 2877 |
| 1903 | Ga0495682_0067593 | 3300049460 | Bacteria | 1287 |
| 1904 | Ga0495682_0128104 | 3300049460 | Bacteria | 908 |
| 1905 | Ga0501292_002630 | 3300049515 | Bacteria | 2332 |
| 1906 | Ga0501298_064091 | 3300049521 | Bacteria | 783 |
| 1907 | Ga0501303_013329 | 3300049526 | Bacteria | 802 |
| 1908 | Ga0501311_000002 | 3300049527 | Bacteria | 12093 |
| 1909 | Ga0501311_002478 | 3300049527 | Bacteria | 1773 |
| 1910 | Ga0501311_024768 | 3300049527 | Bacteria | 837 |
| 1911 | Ga0501312_000249 | 3300049528 | Bacteria | 3886 |
| 1912 | Ga0501312_004300 | 3300049528 | Bacteria | 1670 |
| 1913 | Ga0501312_006986 | 3300049528 | Bacteria | 1426 |
| 1914 | Ga0501312_009302 | 3300049528 | Bacteria | 1293 |
| 1915 | Ga0501313_000292 | 3300049529 | Bacteria | 3129 |
| 1916 | Ga0501313_000495 | 3300049529 | Bacteria | 2736 |
| 1917 | Ga0501313_000546 | 3300049529 | Bacteria | 2658 |
| 1918 | Ga0501313_031015 | 3300049529 | Bacteria | 693 |
| 1919 | Ga0501314_001218 | 3300049530 | Bacteria | 1825 |
| 1920 | Ga0501314_002963 | 3300049530 | Bacteria | 1345 |
| 1921 | Ga0501314_015087 | 3300049530 | Bacteria | 762 |
| 1922 | Ga0501315_000004 | 3300049531 | Bacteria | 11326 |
| 1923 | Ga0501315_000754 | 3300049531 | Bacteria | 2426 |
| 1924 | Ga0501315_003030 | 3300049531 | Bacteria | 1647 |
| 1925 | Ga0501315_005958 | 3300049531 | Bacteria | 1340 |
| 1926 | Ga0501315_012600 | 3300049531 | Bacteria | 1048 |
| 1927 | Ga0501315_045069 | 3300049531 | Bacteria | 678 |
| 1928 | Ga0501315_051891 | 3300049531 | Bacteria | 646 |
| 1929 | Ga0501316_000002 | 3300049532 | Bacteria | 13278 |
| 1930 | Ga0501316_001189 | 3300049532 | Bacteria | 2134 |
| 1931 | Ga0501316_001227 | 3300049532 | Bacteria | 2118 |
| 1932 | Ga0501316_026469 | 3300049532 | Bacteria | 759 |
| 1933 | Ga0501317_000290 | 3300049533 | Bacteria | 3266 |
| 1934 | Ga0501317_002431 | 3300049533 | Bacteria | 1759 |
| 1935 | Ga0501317_007694 | 3300049533 | Bacteria | 1223 |
| 1936 | Ga0501318_000040 | 3300049534 | Bacteria | 5307 |
| 1937 | Ga0501318_001648 | 3300049534 | Bacteria | 1802 |
| 1938 | Ga0501319_000027 | 3300049535 | Bacteria | 4992 |
| 1939 | Ga0501319_025246 | 3300049535 | Bacteria | 551 |
| 1940 | Ga0501320_001179 | 3300049536 | Bacteria | 1838 |
| 1941 | Ga0501320_001910 | 3300049536 | Bacteria | 1600 |
| 1942 | Ga0501320_003292 | 3300049536 | Bacteria | 1359 |
| 1943 | Ga0501320_009368 | 3300049536 | Bacteria | 979 |
| 1944 | Ga0501321_001759 | 3300049537 | Bacteria | 1786 |
| 1945 | Ga0501321_005466 | 3300049537 | Bacteria | 1258 |
| 1946 | Ga0501321_005923 | 3300049537 | Bacteria | 1226 |
| 1947 | Ga0501322_010033 | 3300049538 | Bacteria | 724 |
| 1948 | Ga0501322_012491 | 3300049538 | Bacteria | 676 |
| 1949 | Ga0501323_000015 | 3300049539 | Bacteria | 8085 |
| 1950 | Ga0501323_000822 | 3300049539 | Bacteria | 2504 |
| 1951 | Ga0501323_001128 | 3300049539 | Bacteria | 2270 |
| 1952 | Ga0501323_002535 | 3300049539 | Bacteria | 1781 |
| 1953 | Ga0501323_006919 | 3300049539 | Bacteria | 1280 |
| 1954 | Ga0501323_012755 | 3300049539 | Bacteria | 1030 |
| 1955 | Ga0501323_017279 | 3300049539 | Bacteria | 926 |
| 1956 | Ga0501324_015903 | 3300049540 | Bacteria | 734 |
| 1957 | Ga0501324_021834 | 3300049540 | Bacteria | 659 |
| 1958 | Ga0501325_005953 | 3300049541 | Bacteria | 986 |
| 1959 | Ga0501326_05772 | 3300049542 | Bacteria | 680 |
| 1960 | Ga0501327_00336 | 3300049543 | Bacteria | 1781 |
| 1961 | Ga0501330_000369 | 3300049546 | Bacteria | 1841 |
| 1962 | Ga0501334_11546 | 3300049550 | Bacteria | 648 |
| 1963 | Ga0501335_003176 | 3300049551 | Bacteria | 1380 |
| 1964 | Ga0501335_022410 | 3300049551 | Bacteria | 680 |
| 1965 | Ga0501336_000669 | 3300049552 | Bacteria | 1807 |
| 1966 | Ga0501336_001280 | 3300049552 | Bacteria | 1472 |
| 1967 | Ga0501337_000673 | 3300049553 | Bacteria | 1774 |
| 1968 | Ga0501337_024160 | 3300049553 | Bacteria | 506 |
| 1969 | Ga0501340_003556 | 3300049556 | Bacteria | 951 |
| 1970 | Ga0501032_0051651 | 3300049569 | Bacteria | 2772 |
| 1971 | Ga0501032_0244711 | 3300049569 | Bacteria | 1165 |
| 1972 | Ga0501033_0032115 | 3300049570 | Bacteria | 3942 |
| 1973 | Ga0501033_0187485 | 3300049570 | Bacteria | 1481 |
| 1974 | Ga0501034_0944157 | 3300049571 | Bacteria | 749 |
| 1975 | Ga0501034_1182171 | 3300049571 | Bacteria | 644 |
| 1976 | Ga0501036_0283908 | 3300049572 | Bacteria | 1385 |
| 1977 | Ga0501036_0375199 | 3300049572 | Bacteria | 1187 |
| 1978 | Ga0501037_0403748 | 3300049573 | Bacteria | 937 |
| 1979 | Ga0501038_0184283 | 3300049574 | Bacteria | 1683 |
| 1980 | Ga0501038_0388532 | 3300049574 | Bacteria | 1081 |
| 1981 | Ga0501038_0681881 | 3300049574 | Bacteria | 771 |
| 1982 | Ga0501043_0311069 | 3300049579 | Bacteria | 1202 |
| 1983 | Ga0501047_0017972 | 3300049581 | Bacteria | 6777 |
| 1984 | Ga0501047_0408279 | 3300049581 | Bacteria | 1191 |
| 1985 | Ga0501048_0110710 | 3300049582 | Bacteria | 1939 |
| 1986 | Ga0501207_010936 | 3300049654 | Bacteria | 1345 |
| 1987 | Ga0501210_004862 | 3300049657 | Bacteria | 941 |
| 1988 | Ga0501211_006351 | 3300049658 | Bacteria | 1172 |
| 1989 | Ga0501217_133450 | 3300049661 | Bacteria | 730 |
| 1990 | Ga0501222_005375 | 3300049662 | Bacteria | 1730 |
| 1991 | Ga0501230_002593 | 3300049667 | Bacteria | 2321 |
| 1992 | Ga0501233_077131 | 3300049668 | Bacteria | 853 |
| 1993 | Ga0501238_000213 | 3300049671 | Bacteria | 8393 |
| 1994 | Ga0501249_002499 | 3300049679 | Bacteria | 3714 |
| 1995 | Ga0501257_034882 | 3300049686 | Bacteria | 1222 |
| 1996 | Ga0501221_018188 | 3300049704 | Bacteria | 1351 |
| 1997 | Ga0501263_018035 | 3300049760 | Bacteria | 931 |
| 1998 | Ga0501269_000003 | 3300049766 | Bacteria | 111299 |
| 1999 | Ga0501279_001682 | 3300049775 | Bacteria | 2912 |
| 2000 | Ga0501279_019904 | 3300049775 | Bacteria | 951 |
| 2001 | Ga0501035_0010452 | 3300049822 | Bacteria | 8602 |
| 2002 | Ga0501035_0010523 | 3300049822 | Bacteria | 8572 |
| 2003 | Ga0501035_0011202 | 3300049822 | Bacteria | 8305 |
| 2004 | Ga0501035_0314676 | 3300049822 | Bacteria | 1316 |
| 2005 | Ga0501044_0000210 | 3300049823 | Bacteria | 74323 |
| 2006 | Ga0501044_0024898 | 3300049823 | Bacteria | 6347 |
| 2007 | Ga0501044_0078211 | 3300049823 | Bacteria | 3352 |
| 2008 | Ga0501044_0358594 | 3300049823 | Bacteria | 1376 |
| 2009 | Ga0501044_0853919 | 3300049823 | Bacteria | 787 |
| 2010 | Ga0501226_005181 | 3300049853 | Bacteria | 1494 |
| 2011 | nmdc:mga03683_216870_c1 | 3300050489 | Bacteria | 882 |
| 2012 | nmdc:mga03n38_298936_c1 | 3300050490 | Bacteria | 864 |
| 2013 | nmdc:mga03n38_4317_c1 | 3300050490 | Bacteria | 4691 |
| 2014 | nmdc:mga00v17_12098_c1 | 3300050491 | Bacteria | 4754 |
| 2015 | nmdc:mga00v17_184456_c1 | 3300050491 | Bacteria | 1347 |
| 2016 | nmdc:mga0k408_139838_c1 | 3300050493 | Bacteria | 1440 |
| 2017 | nmdc:mga0k408_43703_c1 | 3300050493 | Bacteria | 2583 |
| 2018 | nmdc:mga0k408_712_c1 | 3300050493 | Bacteria | 18213 |
| 2019 | nmdc:mga0k408_98510_c1 | 3300050493 | Bacteria | 1723 |
| 2020 | nmdc:mga06z11_1936_c1 | 3300050494 | Bacteria | 7811 |
| 2021 | nmdc:mga07m45_13904_c1 | 3300050496 | Bacteria | 4278 |
| 2022 | nmdc:mga07m45_45273_c1 | 3300050496 | Bacteria | 2470 |
| 2023 | nmdc:mga07m45_521668_c1 | 3300050496 | Bacteria | 688 |
| 2024 | nmdc:mga07m45_6867_c1 | 3300050496 | Bacteria | 5791 |
| 2025 | nmdc:mga05p37_434571_c1 | 3300050507 | Bacteria | 1524 |
| 2026 | nmdc:mga05p37_750093_c1 | 3300050507 | Bacteria | 1076 |
| 2027 | nmdc:mga08y16_79438_c1 | 3300050511 | Bacteria | 3419 |
| 2028 | nmdc:mga0n895_56341_c1 | 3300050512 | Bacteria | 3872 |
| 2029 | nmdc:mga08x19_336538_c1 | 3300050514 | Bacteria | 1052 |
| 2030 | nmdc:mga0a205_171614_c1 | 3300050515 | Bacteria | 2065 |
| 2031 | nmdc:mga0sz30_439069_c1 | 3300050516 | Bacteria | 586 |
| 2032 | Ga0495655_0104305 | 3300053083 | Bacteria | 844 |
| 2033 | Ga0500644_0035969 | 3300053088 | Bacteria | 1608 |
| 2034 | Ga0500646_0009238 | 3300053090 | Bacteria | 2523 |
| 2035 | Ga0500641_0039435 | 3300053096 | Bacteria | 1903 |
| 2036 | Ga0500650_0075460 | 3300053098 | Bacteria | 1576 |
| 2037 | Ga0500555_069725 | 3300053103 | Bacteria | 929 |
| 2038 | Ga0500618_003056 | 3300053125 | Bacteria | 5938 |
| 2039 | Ga0500628_002187 | 3300053129 | Bacteria | 3263 |
| 2040 | Ga0500655_002279 | 3300053133 | Bacteria | 3523 |
| 2041 | Ga0500559_0103340 | 3300053136 | Bacteria | 1315 |
| 2042 | Ga0500568_0055223 | 3300053139 | Bacteria | 1551 |
| 2043 | Ga0500573_0439913 | 3300053140 | Bacteria | 606 |
| 2044 | Ga0500577_0289774 | 3300053142 | Bacteria | 714 |
| 2045 | Ga0500586_017865 | 3300053145 | Bacteria | 2178 |
| 2046 | Ga0500600_0129045 | 3300053149 | Bacteria | 1290 |
| 2047 | Ga0500604_0000352 | 3300053151 | Bacteria | 12731 |
| 2048 | Ga0500616_0170867 | 3300053153 | Bacteria | 987 |
| 2049 | Ga0500619_138164 | 3300053154 | Bacteria | 830 |
| 2050 | Ga0500622_0000002 | 3300053156 | Bacteria | 646442 |
| 2051 | Ga0500622_0060471 | 3300053156 | Bacteria | 1933 |
| 2052 | Ga0500622_0103807 | 3300053156 | Bacteria | 1396 |
| 2053 | Ga0500645_035372 | 3300053730 | Bacteria | 1488 |
| 2054 | Ga0500645_191047 | 3300053730 | Bacteria | 554 |
| 2055 | Ga0500565_012675 | 3300053734 | Bacteria | 901 |
| 2056 | Ga0587084_000161 | 3300059477 | Bacteria | 4157 |
| 2057 | Ga0587084_001109 | 3300059477 | Bacteria | 2453 |
| 2058 | Ga0587084_002020 | 3300059477 | Bacteria | 2038 |
| 2059 | Ga0587084_098994 | 3300059477 | Bacteria | 589 |
| 2060 | Ga0587093_081804 | 3300059478 | Bacteria | 558 |
| 2061 | Ga0587066_000001 | 3300059490 | Bacteria | 11779 |
| 2062 | Ga0587070_000065 | 3300059491 | Bacteria | 5371 |
| 2063 | Ga0587070_075589 | 3300059491 | Bacteria | 728 |
| 2064 | Ga0587070_092774 | 3300059491 | Bacteria | 682 |
| 2065 | Ga0587073_0001671 | 3300059492 | Bacteria | 2662 |
| 2066 | Ga0587073_0129733 | 3300059492 | Bacteria | 691 |
| 2067 | Ga0587077_001151 | 3300059493 | Bacteria | 2731 |
| 2068 | Ga0587077_020126 | 3300059493 | Bacteria | 1169 |
| 2069 | Ga0587080_002147 | 3300059503 | Bacteria | 2280 |
| 2070 | Ga0587080_077620 | 3300059503 | Bacteria | 676 |
| 2071 | Ga0587082_000884 | 3300059504 | Bacteria | 2839 |
| 2072 | Ga0587083_0000094 | 3300059505 | Bacteria | 5249 |
| 2073 | Ga0587083_0000200 | 3300059505 | Bacteria | 4379 |
| 2074 | Ga0587083_0069435 | 3300059505 | Bacteria | 814 |
| 2075 | Ga0587085_021468 | 3300059506 | Bacteria | 987 |
| 2076 | Ga0587086_066732 | 3300059507 | Bacteria | 610 |
| 2077 | Ga0587088_000001 | 3300059508 | Bacteria | 14678 |
| 2078 | Ga0587088_037690 | 3300059508 | Bacteria | 896 |
| 2079 | Ga0587089_043032 | 3300059509 | Bacteria | 704 |
| 2080 | Ga0587090_008198 | 3300059510 | Bacteria | 1394 |
| 2081 | Ga0587091_000335 | 3300059511 | Bacteria | 3779 |
| 2082 | Ga0587091_096258 | 3300059511 | Bacteria | 687 |
| 2083 | Ga0587092_006055 | 3300059512 | Bacteria | 1517 |
| 2084 | Ga0587098_001373 | 3300059604 | Bacteria | 1852 |
| 2085 | Ga0587098_009967 | 3300059604 | Bacteria | 1043 |
| 2086 | Ga0587098_038216 | 3300059604 | Bacteria | 688 |
| 2087 | Ga0587106_000819 | 3300059605 | Bacteria | 2456 |
| 2088 | Ga0587106_008375 | 3300059605 | Bacteria | 1284 |
| 2089 | Ga0587125_003092 | 3300059607 | Bacteria | 1390 |
| 2090 | Ga0587099_000096 | 3300059622 | Bacteria | 3472 |
| 2091 | Ga0587101_005751 | 3300059623 | Bacteria | 1390 |
| 2092 | Ga0587117_015850 | 3300059627 | Bacteria | 996 |
| 2093 | Ga0587128_000098 | 3300059630 | Bacteria | 4404 |
| 2094 | Ga0587128_007622 | 3300059630 | Bacteria | 1374 |
| 2095 | Ga0587062_016401 | 3300059639 | Bacteria | 1001 |
| 2096 | Ga0587062_038847 | 3300059639 | Bacteria | 764 |
| 2097 | Ga0587067_000303 | 3300059640 | Bacteria | 4022 |
| 2098 | Ga0587067_017051 | 3300059640 | Bacteria | 1201 |
| 2099 | Ga0587068_000002 | 3300059641 | Bacteria | 13671 |
| 2100 | Ga0587068_000145 | 3300059641 | Bacteria | 5029 |
| 2101 | Ga0587068_000228 | 3300059641 | Bacteria | 4429 |
| 2102 | Ga0587068_005731 | 3300059641 | Bacteria | 1708 |
| 2103 | Ga0587069_001414 | 3300059642 | Bacteria | 2197 |
| 2104 | Ga0587069_004834 | 3300059642 | Bacteria | 1537 |
| 2105 | Ga0587072_001765 | 3300059643 | Bacteria | 2769 |
| 2106 | Ga0587072_003430 | 3300059643 | Bacteria | 2226 |
| 2107 | Ga0587072_005754 | 3300059643 | Bacteria | 1863 |
| 2108 | Ga0587075_000434 | 3300059644 | Bacteria | 3285 |
| 2109 | Ga0587076_000914 | 3300059645 | Bacteria | 2766 |
| 2110 | Ga0587076_004751 | 3300059645 | Bacteria | 1717 |
| 2111 | Ga0587078_000693 | 3300059646 | Bacteria | 2693 |
| 2112 | Ga0587078_011692 | 3300059646 | Bacteria | 1023 |
| 2113 | Ga0587078_045061 | 3300059646 | Bacteria | 633 |
| 2114 | Ga0587079_000913 | 3300059647 | Bacteria | 3025 |
| 2115 | Ga0587079_011093 | 3300059647 | Bacteria | 1443 |
| 2116 | Ga0587079_034989 | 3300059647 | Bacteria | 986 |
| 2117 | Ga0587079_037199 | 3300059647 | Bacteria | 966 |
| 2118 | Ga0587100_007975 | 3300059648 | Bacteria | 848 |
| 2119 | Ga0587102_019683 | 3300059649 | Bacteria | 752 |
| 2120 | Ga0587107_000137 | 3300059652 | Bacteria | 3765 |
| 2121 | Ga0587107_051316 | 3300059652 | Bacteria | 700 |
| 2122 | Ga0587114_004063 | 3300059655 | Bacteria | 1499 |
| 2123 | Ga0587071_000116 | 3300060344 | Bacteria | 5683 |
| 2124 | Ga0587071_183420 | 3300060344 | Bacteria | 539 |
| 2125 | Ga0587111_0000227 | 3300060346 | Bacteria | 4609 |
| 2126 | Ga0587111_0000229 | 3300060346 | Bacteria | 4601 |
| 2127 | Ga0587111_0002272 | 3300060346 | Bacteria | 2528 |
| 2128 | Ga0587111_0017972 | 3300060346 | Bacteria | 1324 |
| 2129 | Ga0466962_0001202 | 3300061719 | Bacteria | 11897 |
| 2130 | Ga0466962_0016232 | 3300061719 | Bacteria | 3591 |
| 2131 | Ga0466962_0029411 | 3300061719 | Bacteria | 2630 |
| 2132 | Ga0466962_0147138 | 3300061719 | Bacteria | 1142 |
| 2133 | Ga0466962_0464838 | 3300061719 | Bacteria | 638 |
| 2134 | 2501074046 | 2501025501 | Bacteria | 7768574 |
| 2135 | 2501084118 | 2501025502 | Bacteria | 9641094 |
| 2136 | 2501414355 | 2501025504 | Bacteria | 8008976 |
| 2137 | 2509132518 | 2508501125 | Bacteria | 7208311 |
| 2138 | 2510252583 | 2510065045 | Bacteria | 7761063 |
| 2139 | 2511093330 | 2510917013 | Bacteria | 9951648 |
| 2140 | 2511099778 | 2510917014 | Bacteria | 8296963 |
| 2141 | 2511102451 | 2510917015 | Bacteria | 7950052 |
| 2142 | 2511245083 | 2511231002 | Bacteria | 5042903 |
| 2143 | 2512348441 | 2512047030 | Bacteria | 9031815 |
| 2144 | 2513556141 | 2513237082 | Bacteria | 8640282 |
| 2145 | 2513564327 | 2513237083 | Bacteria | 8410967 |
| 2146 | 2513962592 | 2513237151 | Bacteria | 6309801 |
| 2147 | 2514050901 | 2513237166 | Bacteria | 10373764 |
| 2148 | 2515684861 | 2515154122 | Bacteria | 8609520 |
| 2149 | 2515690948 | 2515154123 | Bacteria | 6387382 |
| 2150 | 2516022230 | 2515154189 | Bacteria | 9629850 |
| 2151 | 2519457515 | 2519103095 | Bacteria | 6629912 |
| 2152 | 2527080587 | 2526164713 | Bacteria | 6780608 |
| 2153 | 2563061523 | 2562617112 | Bacteria | 10918404 |
| 2154 | 2585294150 | 2582581311 | Bacteria | 6763856 |
| 2155 | 2599741043 | 2599185239 | Bacteria | 8686614 |
| 2156 | 2599748350 | 2599185240 | Bacteria | 7968121 |
| 2157 | 2600210262 | 2599185355 | Bacteria | 7968906 |
| 2158 | 2600813801 | 2600255067 | Bacteria | 6795583 |
| 2159 | 2643792076 | 2643221554 | Bacteria | 6603920 |
| 2160 | 2643799429 | 2643221556 | Bacteria | 7251154 |
| 2161 | 2644123358 | 2643221621 | Bacteria | 6212786 |
| 2162 | 2644216443 | 2643221638 | Bacteria | 6579467 |
| 2163 | 2644254807 | 2643221645 | Bacteria | 7207331 |
| 2164 | 2644360368 | 2643221664 | Bacteria | 7272945 |
| 2165 | 2644471522 | 2643221684 | Bacteria | 7145183 |
| 2166 | 2676745814 | 2675903129 | Bacteria | 7964495 |
| 2167 | 2713478613 | 2711768613 | Bacteria | 11048459 |
| 2168 | 2719641681 | 2718217991 | Bacteria | 7829542 |
| 2169 | 2738738116 | 2738541280 | Bacteria | 6630198 |
| 2170 | 2738824029 | 2738541296 | Bacteria | 7285013 |
| 2171 | 2738826789 | 2738541297 | Bacteria | 6549566 |
| 2172 | 2738836420 | 2738541298 | Bacteria | 7286732 |
| 2173 | 2738843086 | 2738541300 | Bacteria | 6675882 |
| 2174 | 2738877950 | 2738541306 | Bacteria | 7284992 |
| 2175 | 2739150586 | 2738541357 | Bacteria | 6549408 |
| 2176 | 2739189656 | 2738543002 | Bacteria | 7284546 |
| 2177 | 2739192505 | 2738543003 | Bacteria | 6549560 |
| 2178 | 2739224543 | 2738543008 | Bacteria | 7282815 |
| 2179 | 2739273837 | 2738543018 | Bacteria | 6718814 |
| 2180 | 2739318982 | 2738543026 | Bacteria | 6549408 |
| 2181 | 2739337223 | 2738543029 | Bacteria | 6549249 |
| 2182 | 2739342881 | 2738543030 | Bacteria | 6719714 |
| 2183 | 2746087224 | 2744054900 | Bacteria | 8399525 |
| 2184 | 2746093269 | 2744054901 | Bacteria | 8397047 |
| 2185 | 2753566201 | 2751185846 | Bacteria | 7242164 |
| 2186 | 2792837062 | 2791355137 | Bacteria | 9654227 |
| 2187 | 2808972857 | 2808606384 | Bacteria | 8474373 |
| 2188 | 2809007978 | 2808606390 | Bacteria | 8476311 |
| 2189 | 2809015382 | 2808606391 | Bacteria | 8308166 |
| 2190 | 2817259705 | 2816332253 | Bacteria | 6764532 |
| 2191 | 2817277374 | 2816332256 | Bacteria | 6891714 |
| 2192 | 2817453540 | 2816332286 | Bacteria | 6853759 |
| 2193 | 2819624163 | 2818991450 | Bacteria | 6962147 |
| 2194 | 2819636795 | 2818991452 | Bacteria | 8442785 |
| 2195 | 2842332188 | 2842324504 | Bacteria | 9364110 |
| 2196 | 2842356360 | 2842348783 | Bacteria | 9002918 |
| 2197 | 2842461299 | 2842454564 | Bacteria | 8730687 |
| 2198 | 2842712337 | 2842711865 | Bacteria | 7155354 |
| 2199 | 2855735567 | 2855730933 | Bacteria | 7047938 |
| 2200 | 2856289407 | 2856287931 | Bacteria | 7223934 |
| 2201 | 2857362279 | 2857357740 | Bacteria | 9937880 |
| 2202 | 2857556281 | 2857553236 | Bacteria | 6166726 |
| 2203 | 2857560802 | 2857558681 | Bacteria | 6617694 |
| 2204 | 2863426496 | 2863421361 | Bacteria | 7300805 |
| 2205 | 2870069402 | 2870068957 | Bacteria | 8925310 |
| 2206 | 2883091437 | 2883087390 | Bacteria | 9532701 |
| 2207 | 2885272359 | 2885270888 | Bacteria | 9831543 |
| 2208 | 2900637068 | 2900634093 | Bacteria | 10263517 |
| 2209 | 2902686677 | 2902682994 | Bacteria | 8951596 |
| 2210 | 2904428883 | 2904424332 | Bacteria | 7633521 |
| 2211 | 2904438988 | 2904434214 | Bacteria | 6230908 |
| 2212 | 2904490114 | 2904483920 | Bacteria | 7545285 |
| 2213 | 2904569340 | 2904564687 | Bacteria | 7609577 |
| 2214 | 2904576823 | 2904571731 | Bacteria | 7608790 |
| 2215 | 2904624834 | 2904615490 | Bacteria | 10047340 |
| 2216 | 2919476957 | 2919476304 | Bacteria | 5888696 |
| 2217 | 2919533283 | 2919527303 | Bacteria | 7718827 |
| 2218 | 2921651507 | 2921643360 | Bacteria | 11448031 |
| 2219 | 2928114211 | 2928108538 | Bacteria | 7360024 |
| 2220 | 2928141041 | 2928135762 | Bacteria | 7259641 |
| 2221 | 2928163049 | 2928157003 | Bacteria | 7522202 |
| 2222 | 2928170201 | 2928163908 | Bacteria | 7561269 |
| 2223 | 2928176337 | 2928170801 | Bacteria | 8785406 |
| 2224 | 2928509206 | 2928503688 | Bacteria | 7268108 |
| 2225 | 2928542017 | 2928536128 | Bacteria | 7657547 |
| 2226 | 2945934568 | 2945934425 | Bacteria | 7444609 |
| 2227 | 2981996104 | 2981990288 | Bacteria | 7590678 |
| 2228 | 2990704874 | 2990703756 | Bacteria | 7715990 |
| 2229 | 642426538 | 641736151 | Bacteria | 7477263 |
| 2230 | 642417676 | 641736154 | Bacteria | 7689995 |
| 2231 | 642594616 | 642555112 | Bacteria | 8676562 |
| 2232 | 642623205 | 642555113 | Bacteria | 8214658 |
| 2233 | 8003956820 | 8003955200 | Bacteria | 8601927 |
| 2234 | 8018847929 | 8018845410 | Bacteria | 8933938 |
| 2235 | 8020813917 | 8020807995 | Bacteria | 6801506 |
| 2236 | 8020939047 | 8020938398 | Bacteria | 7472757 |
| 2237 | 8020947762 | 8020945358 | Bacteria | 8467355 |
| 2238 | 8020953406 | 8020953355 | Bacteria | 7439080 |
| 2239 | 8021127513 | 8021120328 | Bacteria | 8782274 |
| 2240 | 8039099663 | 8039098773 | Bacteria | 6602928 |
| 2241 | 8040171494 | 8040167225 | Bacteria | 6542727 |
| 2242 | 8040174108 | 8040173305 | Bacteria | 6827067 |
| 2243 | 8047676077 | 8047673197 | Bacteria | 7395230 |
| 2244 | 8055269423 | 8055266321 | Bacteria | 7999742 |
| 2245 | 8055307415 | 8055301274 | Bacteria | 8587385 |
| 2246 | Ga0075368_10003054 | |||
| 2247 | JGI24736J21556_1000961 | |||
| 2248 | JGI24736J21556_1014262 | |||
| 2249 | JGI24741J21665_1000624 | |||
| 2250 | JGI24741J21665_1002145 | |||
| 2251 | JGI24740J21852_10008508 | |||
| 2252 | JGI24740J21852_10010715 | |||
| 2253 | JGI24740J21852_10022184 | |||
| 2254 | JGI24739J22299_10010870 | |||
| 2255 | JGI24739J22299_10015549 | |||
| 2256 | JGI24739J22299_10028555 | |||
| 2257 | JGI24739J22299_10040738 | |||
| 2258 | JGI24737J22298_10004674 | |||
| 2259 | JGI24737J22298_10008370 | |||
| 2260 | JGI24737J22298_10022836 | |||
| 2261 | JGI24737J22298_10027585 | |||
| 2262 | JGI24735J21928_10002193 | |||
| 2263 | JGI24735J21928_10011144 | |||
| 2264 | JGI24735J21928_10014430 | |||
| 2265 | JGI24735J21928_10019381 | |||
| 2266 | JGI24738J21930_10006803 | |||
| 2267 | JGI25155J39150_1007058 | |||
| 2268 | JGI25156J39149_1006223 | |||
| 2269 | JGI25156J39149_1012871 | |||
| 2270 | JGI25156J39149_1014425 | |||
| 2271 | JGI25156J39149_1016459 | |||
| 2272 | JGI25156J39149_1020451 | |||
| 2273 | JGI25156J39149_1033188 | |||
| 2274 | JGI25154J39366_1000303 | |||
| 2275 | JGI25154J39366_1001042 | |||
| 2276 | JGI25158J39367_1000542 | |||
| 2277 | JGI25152J39213_1013037 | |||
| 2278 | JGI25150J39212_1001923 | |||
| 2279 | JGI25150J39212_1003501 | |||
| 2280 | Ga0006763J43179_104166 | |||
| 2281 | JGI25159J45721_1005729 | |||
| 2282 | JGI25159J45721_1006200 | |||
| 2283 | Ga0006765J45826_105454 | |||
| 2284 | Ga0006765J45826_108890 | |||
| 2285 | Ga0006765J45826_116549 | |||
| 2286 | Ga0006778J45830_1013714 | |||
| 2287 | Ga0006778J45830_1018992 | |||
| 2288 | Ga0006759J45824_1009839 | |||
| 2289 | Ga0006759J45824_1019440 | |||
| 2290 | Ga0006759J45824_1019946 | |||
| 2291 | Ga0006759J45824_1026311 | |||
| 2292 | JGI25151J46595_10000457 | |||
| 2293 | JGI25151J46595_10071766 | |||
| 2294 | JGI25151J46595_10077557 | |||
| 2295 | JGI25406J46586_10002509 | |||
| 2296 | JGI25406J46586_10005813 | |||
| 2297 | JGI25165J46597_1001391 | |||
| 2298 | JGI25153J46596_10002258 | |||
| 2299 | Ga0006758J48902_1003546 | |||
| 2300 | Ga0006758J48902_1008911 | |||
| 2301 | Ga0006758J48902_1013469 | |||
| 2302 | Ga0006770J48903_1023756 | |||
| 2303 | Ga0006777J48905_1011571 | |||
| 2304 | Ga0006777J48905_1023402 | |||
| 2305 | JGI25160J50197_1001051 | |||
| 2306 | JGI25160J50197_1002367 | |||
| 2307 | JGI25161J50226_1003265 | |||
| 2308 | Ga0006556J51387_1013500 | |||
| 2309 | Ga0006556J51387_1016929 | |||
| 2310 | Ga0007417J51691_1002612 | |||
| 2311 | Ga0007417J51691_1012996 | |||
| 2312 | Ga0007417J51691_1036180 | |||
| 2313 | Ga0006558J51389_1019156 | |||
| 2314 | Ga0006558J51389_1029442 | |||
| 2315 | Ga0007427J51700_104412 | |||
| 2316 | Ga0007427J51700_116762 | |||
| 2317 | Ga0007427J51700_120270 | |||
| 2318 | Ga0006560J51390_1011017 | |||
| 2319 | Ga0006560J51390_1020307 | |||
| 2320 | Ga0006554J51385_1017299 | |||
| 2321 | Ga0007410J51695_1004597 | |||
| 2322 | Ga0007410J51695_1005147 | |||
| 2323 | Ga0007410J51695_1012689 | |||
| 2324 | Ga0007410J51695_1015723 | |||
| 2325 | Ga0007409J51694_1002712 | |||
| 2326 | Ga0007409J51694_1007029 | |||
| 2327 | Ga0007409J51694_1025202 | |||
| 2328 | Ga0007416J51690_1009369 | |||
| 2329 | Ga0007429J51699_1012288 | |||
| 2330 | Ga0007429J51699_1013730 | |||
| 2331 | Ga0007411J51799_103551 | |||
| 2332 | Ga0007411J51799_118133 | |||
| 2333 | Ga0007415J51800_102854 | |||
| 2334 | Ga0032354_1003172 | |||
| 2335 | Ga0032354_1006520 | |||
| 2336 | Ga0032354_1013175 | |||
| 2337 | Ga0032354_1073470 | |||
| 2338 | Ga0032354_1175332 | |||
| 2339 | Ga0006780_1003512 | |||
| 2340 | Ga0055539_1001132 | |||
| 2341 | Ga0055539_1005718 | |||
| 2342 | Ga0055533_1003286 | |||
| 2343 | Ga0055533_1003606 | |||
| 2344 | Ga0055533_1005127 | |||
| 2345 | Ga0055533_1006769 | |||
| 2346 | Ga0055532_1000066 | |||
| 2347 | Ga0055532_1000261 | |||
| 2348 | Ga0055532_1002406 | |||
| 2349 | Ga0055525_1000018 | |||
| 2350 | Ga0055527_1000035 | |||
| 2351 | Ga0055527_1000602 | |||
| 2352 | Ga0055535_1000046 | |||
| 2353 | Ga0055535_1000050 | |||
| 2354 | Ga0055542_1000512 | |||
| 2355 | Ga0055542_1001443 | |||
| 2356 | Ga0055542_1008179 | |||
| 2357 | Ga0055529_1000079 | |||
| 2358 | Ga0055529_1000087 | |||
| 2359 | Ga0055529_1000089 | |||
| 2360 | Ga0055529_1000804 | |||
| 2361 | Ga0055529_1019136 | |||
| 2362 | Ga0055526_1008246 | |||
| 2363 | Ga0055526_1008253 | |||
| 2364 | Ga0055526_1012574 | |||
| 2365 | Ga0055526_1017962 | |||
| 2366 | Ga0055537_1000038 | |||
| 2367 | Ga0055537_1007557 | |||
| 2368 | Ga0055524_1000024 | |||
| 2369 | Ga0055524_1003212 | |||
| 2370 | Ga0055524_1038927 | |||
| 2371 | Ga0055534_1003773 | |||
| 2372 | Ga0055534_1005461 | |||
| 2373 | Ga0055528_1000489 | |||
| 2374 | Ga0055528_1012285 | |||
| 2375 | Ga0055528_1013311 | |||
| 2376 | Ga0055528_1029760 | |||
| 2377 | Ga0055530_10007831 | |||
| 2378 | Ga0055531_10006076 | |||
| 2379 | Ga0058692_1002213 | |||
| 2380 | Ga0055543_1004039 | |||
| 2381 | Ga0058860_10029302 | |||
| 2382 | Ga0058862_12800340 | |||
| 2383 | Ga0065165_1000504 | |||
| 2384 | Ga0065165_1000885 | |||
| 2385 | Ga0065165_1006561 | |||
| 2386 | Ga0065165_1043988 | |||
| 2387 | Ga0065714_10175573 | |||
| 2388 | Ga0065714_10264494 | |||
| 2389 | Ga0065712_10086127 | |||
| 2390 | Ga0065707_10200663 | |||
| 2391 | Ga0070658_10012014 | |||
| 2392 | Ga0070658_10028760 | |||
| 2393 | Ga0070658_10051816 | |||
| 2394 | Ga0070658_10197036 | |||
| 2395 | Ga0070658_10210675 | |||
| 2396 | Ga0070658_11224510 | |||
| 2397 | Ga0070683_100130959 | |||
| 2398 | Ga0070690_100665097 | |||
| 2399 | Ga0070670_100436011 | |||
| 2400 | Ga0070670_100588559 | |||
| 2401 | Ga0070670_101020706 | |||
| 2402 | Ga0068869_100000239 | |||
| 2403 | Ga0068869_100792341 | |||
| 2404 | Ga0068869_100940796 | |||
| 2405 | Ga0070666_10064761 | |||
| 2406 | Ga0070666_10851489 | |||
| 2407 | Ga0070680_100028265 | |||
| 2408 | Ga0070682_100104638 | |||
| 2409 | Ga0070682_100335096 | |||
| 2410 | Ga0068868_100019350 | |||
| 2411 | Ga0068868_100470939 | |||
| 2412 | Ga0068868_100985634 | |||
| 2413 | Ga0070660_100026003 | |||
| 2414 | Ga0070660_100034626 | |||
| 2415 | Ga0070689_101355443 | |||
| 2416 | Ga0070691_10586771 | |||
| 2417 | Ga0070687_100449060 | |||
| 2418 | Ga0070661_100000276 | |||
| 2419 | Ga0070661_100425658 | |||
| 2420 | Ga0070661_100577942 | |||
| 2421 | Ga0070661_100922623 | |||
| 2422 | Ga0070669_100615595 | |||
| 2423 | Ga0070669_100767176 | |||
| 2424 | Ga0070675_100789602 | |||
| 2425 | Ga0070671_100130518 | |||
| 2426 | Ga0070671_101474927 | |||
| 2427 | Ga0070673_100420566 | |||
| 2428 | Ga0070688_100394510 | |||
| 2429 | Ga0070659_100000426 | |||
| 2430 | Ga0070659_100235446 | |||
| 2431 | Ga0070659_100755623 | |||
| 2432 | Ga0070659_100766022 | |||
| 2433 | Ga0070667_100263553 | |||
| 2434 | Ga0070694_100214288 | |||
| 2435 | Ga0070663_100001053 | |||
| 2436 | Ga0070663_100021946 | |||
| 2437 | Ga0070663_100434756 | |||
| 2438 | Ga0070663_100882448 | |||
| 2439 | Ga0070663_101124597 | |||
| 2440 | Ga0070678_100045788 | |||
| 2441 | Ga0070678_100253166 | |||
| 2442 | Ga0070678_100667905 | |||
| 2443 | Ga0070662_100612492 | |||
| 2444 | Ga0070681_10376443 | |||
| 2445 | Ga0070681_10446735 | |||
| 2446 | Ga0068867_101635410 | |||
| 2447 | Ga0070685_11308658 | |||
| 2448 | Ga0070706_100494586 | |||
| 2449 | Ga0070699_100041691 | |||
| 2450 | Ga0070699_100043286 | |||
| 2451 | Ga0070699_100085640 | |||
| 2452 | Ga0070679_100263732 | |||
| 2453 | Ga0070679_100272175 | |||
| 2454 | Ga0070684_100277906 | |||
| 2455 | Ga0068853_100029320 | |||
| 2456 | Ga0068853_101060371 | |||
| 2457 | Ga0068853_101493106 | |||
| 2458 | Ga0070672_100692733 | |||
| 2459 | Ga0070665_100065427 | |||
| 2460 | Ga0070665_100442535 | |||
| 2461 | Ga0068855_100018349 | |||
| 2462 | Ga0068855_100077376 | |||
| 2463 | Ga0068855_100131783 | |||
| 2464 | Ga0068855_100257086 | |||
| 2465 | Ga0070664_100000018 | |||
| 2466 | Ga0070664_100010409 | |||
| 2467 | Ga0070664_100068369 | |||
| 2468 | Ga0070664_100142127 | |||
| 2469 | Ga0068857_100128424 | |||
| 2470 | Ga0068857_100178268 | |||
| 2471 | Ga0068857_100409644 | |||
| 2472 | Ga0068854_100000225 | |||
| 2473 | Ga0068854_100363057 | |||
| 2474 | Ga0068856_100000070 | |||
| 2475 | Ga0068856_100117908 | |||
| 2476 | Ga0068856_100155750 | |||
| 2477 | Ga0068852_100001513 | |||
| 2478 | Ga0068852_100022501 | |||
| 2479 | Ga0068852_100840357 | |||
| 2480 | Ga0068864_101369740 | |||
| 2481 | Ga0068864_102390113 | |||
| 2482 | Ga0068866_10292215 | |||
| 2483 | Ga0068851_10115256 | |||
| 2484 | Ga0068863_100046276 | |||
| 2485 | Ga0068863_100532459 | |||
| 2486 | Ga0068858_100013226 | |||
| 2487 | Ga0068860_100019846 | |||
| 2488 | Ga0068862_100708291 | |||
| 2489 | Ga0081539_10000142 | |||
| 2490 | Ga0081539_10000215 | |||
| 2491 | Ga0081539_10003297 | |||
| 2492 | Ga0075363_100000856 | |||
| 2493 | Ga0075363_100086667 | |||
| 2494 | Ga0075364_10015296 | |||
| 2495 | Ga0075364_10316984 | |||
| 2496 | Ga0075362_10000565 | |||
| 2497 | Ga0075362_10081459 | |||
| 2498 | Ga0075362_10527349 | |||
| 2499 | Ga0075367_10001881 | |||
| 2500 | Ga0075369_10003827 | |||
| 2501 | Ga0075369_10490397 | |||
| 2502 | Ga0075366_10064801 | |||
| 2503 | Ga0075366_10132503 | |||
| 2504 | Ga0075366_10267362 | |||
| 2505 | Ga0075366_10332276 | |||
| 2506 | Ga0075366_10519688 | |||
| 2507 | Ga0097621_100165035 | |||
| 2508 | Ga0097621_100233100 | |||
| 2509 | Ga0075370_10036206 | |||
| 2510 | Ga0075370_10136978 | |||
| 2511 | Ga0075370_10154017 | |||
| 2512 | Ga0075370_10521963 | |||
| 2513 | Ga0068871_100003989 | |||
| 2514 | Ga0075433_10131861 | |||
| 2515 | Ga0075433_10263794 | |||
| 2516 | Ga0075434_100017973 | |||
| 2517 | Ga0068865_100052525 | |||
| 2518 | Ga0068865_101583434 | |||
| 2519 | Ga0079104_1004078 | |||
| 2520 | Ga0099826_10000010 | |||
| 2521 | Ga0099826_10000024 | |||
| 2522 | Ga0075435_100031259 | |||
| 2523 | Ga0105251_10010131 | |||
| 2524 | Ga0105251_10027169 | |||
| 2525 | Ga0105251_10039647 | |||
| 2526 | Ga0105251_10053947 | |||
| 2527 | Ga0105244_10095626 | |||
| 2528 | Ga0105244_10129506 | |||
| 2529 | Ga0105250_10050101 | |||
| 2530 | Ga0105250_10051084 | |||
| 2531 | Ga0105250_10079808 | |||
| 2532 | Ga0105250_10493009 | |||
| 2533 | Ga0105240_10063879 | |||
| 2534 | Ga0105240_10103920 | |||
| 2535 | Ga0105240_10108670 | |||
| 2536 | Ga0105240_10407148 | |||
| 2537 | Ga0105240_10456788 | |||
| 2538 | Ga0105240_10661229 | |||
| 2539 | Ga0111539_10009725 | |||
| 2540 | Ga0111539_10063652 | |||
| 2541 | Ga0105245_10323321 | |||
| 2542 | Ga0105245_11159602 | |||
| 2543 | Ga0105247_10248107 | |||
| 2544 | Ga0114129_10905627 | |||
| 2545 | Ga0114129_11391926 | |||
| 2546 | Ga0105243_10006860 | |||
| 2547 | Ga0105243_10168772 | |||
| 2548 | Ga0105243_10233819 | |||
| 2549 | Ga0105243_10413272 | |||
| 2550 | Ga0105241_10021276 | |||
| 2551 | Ga0105241_10177715 | |||
| 2552 | Ga0105241_10799341 | |||
| 2553 | Ga0105241_12077056 | |||
| 2554 | Ga0105242_10702387 | |||
| 2555 | Ga0105248_10010314 | |||
| 2556 | Ga0105248_10015430 | |||
| 2557 | Ga0105248_10091471 | |||
| 2558 | Ga0105248_10393633 | |||
| 2559 | Ga0105248_10562764 | |||
| 2560 | Ga0105248_10930503 | |||
| 2561 | Ga0105248_11153309 | |||
| 2562 | Ga0105237_10056847 | |||
| 2563 | Ga0105237_10137397 | |||
| 2564 | Ga0105237_10145717 | |||
| 2565 | Ga0105237_11052499 | |||
| 2566 | Ga0105238_10003065 | |||
| 2567 | Ga0105238_10478980 | |||
| 2568 | Ga0105238_10910308 | |||
| 2569 | Ga0105238_11215312 | |||
| 2570 | Ga0105239_10057421 | |||
| 2571 | Ga0105239_10143140 | |||
| 2572 | Ga0105239_10325011 | |||
| 2573 | Ga0105239_11049668 | |||
| 2574 | Ga0105246_10193299 | |||
| 2575 | Ga0105246_10212712 | |||
| 2576 | Ga0105246_10681807 | |||
| 2577 | Ga0157318_1017671 | |||
| 2578 | Ga0157325_1002140 | |||
| 2579 | Ga0157341_1023988 | |||
| 2580 | Ga0157327_1046759 | |||
| 2581 | Ga0154012_136784 | |||
| 2582 | Ga0157373_10015732 | |||
| 2583 | Ga0157371_10036577 | |||
| 2584 | Ga0157371_10054196 | |||
| 2585 | Ga0157371_10058062 | |||
| 2586 | Ga0157370_10062522 | |||
| 2587 | Ga0157370_10069903 | |||
| 2588 | Ga0157370_10872950 | |||
| 2589 | Ga0157369_10078496 | |||
| 2590 | Ga0157369_10088073 | |||
| 2591 | Ga0157369_10088210 | |||
| 2592 | Ga0157369_10093282 | |||
| 2593 | Ga0157369_10188597 | |||
| 2594 | Ga0157369_10450338 | |||
| 2595 | Ga0157374_10000466 | |||
| 2596 | Ga0157374_10032559 | |||
| 2597 | Ga0157374_10069107 | |||
| 2598 | Ga0157374_10130817 | |||
| 2599 | Ga0157378_10027087 | |||
| 2600 | Ga0157378_10097687 | |||
| 2601 | Ga0157378_10140170 | |||
| 2602 | Ga0157378_12622117 | |||
| 2603 | Ga0163162_10076123 | |||
| 2604 | Ga0163162_10086678 | |||
| 2605 | Ga0163162_11126646 | |||
| 2606 | Ga0163162_11245599 | |||
| 2607 | Ga0157372_10023322 | |||
| 2608 | Ga0157372_10381065 | |||
| 2609 | Ga0157372_11235545 | |||
| 2610 | Ga0157375_10099540 | |||
| 2611 | Ga0157375_10411520 | |||
| 2612 | Ga0157375_10514513 | |||
| 2613 | Ga0157375_11027771 | |||
| 2614 | Ga0157375_12256222 | |||
| 2615 | Ga0163163_10694503 | |||
| 2616 | Ga0163163_10812622 | |||
| 2617 | Ga0182008_10003186 | |||
| 2618 | Ga0182008_10079122 | |||
| 2619 | Ga0157376_10069893 | |||
| 2620 | Ga0157376_10493710 | |||
| 2621 | Ga0157376_11933336 | |||
| 2622 | Ga0157376_12048211 | |||
| 2623 | Ga0182006_1000240 | |||
| 2624 | Ga0182006_1009882 | |||
| 2625 | Ga0182006_1041809 | |||
| 2626 | Ga0182006_1235790 | |||
| 2627 | Ga0182007_10012896 | |||
| 2628 | Ga0182007_10021036 | |||
| 2629 | Ga0182007_10039882 | |||
| 2630 | Ga0182005_1000016 | |||
| 2631 | Ga0183361_10015 | |||
| 2632 | Ga0184593_113785 | |||
| 2633 | Ga0184594_128061 | |||
| 2634 | Ga0197907_10133130 | |||
| 2635 | Ga0197907_11250558 | |||
| 2636 | Ga0206356_10498037 | |||
| 2637 | Ga0206356_10847300 | |||
| 2638 | Ga0206355_1030836 | |||
| 2639 | Ga0206355_1157373 | |||
| 2640 | Ga0206355_1331117 | |||
| 2641 | Ga0206355_1594134 | |||
| 2642 | Ga0206355_1647216 | |||
| 2643 | Ga0206351_10165518 | |||
| 2644 | Ga0206351_10211974 | |||
| 2645 | Ga0206352_11278378 | |||
| 2646 | Ga0206350_10425581 | |||
| 2647 | Ga0206350_10705675 | |||
| 2648 | Ga0206350_11246990 | |||
| 2649 | Ga0206354_10086599 | |||
| 2650 | Ga0206354_11361223 | |||
| 2651 | Ga0206354_11564442 | |||
| 2652 | Ga0206353_10280775 | |||
| 2653 | Ga0206353_10343767 | |||
| 2654 | Ga0206353_11104472 | |||
| 2655 | Ga0154015_1522148 | |||
| 2656 | Ga0154015_1692537 | |||
| 2657 | Ga0213872_10010693 | |||
| 2658 | Ga0213872_10047302 | |||
| 2659 | Ga0213872_10332396 | |||
| 2660 | Ga0224712_10002193 | |||
| 2661 | Ga0224712_10060966 | |||
| 2662 | Ga0224712_10125668 | |||
| 2663 | Ga0247514_106419 | |||
| 2664 | Ga0209436_100401 | |||
| 2665 | Ga0209784_100052 | |||
| 2666 | Ga0209784_103737 | |||
| 2667 | Ga0209566_100068 | |||
| 2668 | Ga0209566_100801 | |||
| 2669 | Ga0209566_102355 | |||
| 2670 | Ga0209566_108979 | |||
| 2671 | Ga0209674_100087 | |||
| 2672 | Ga0209674_100153 | |||
| 2673 | Ga0209674_102800 | |||
| 2674 | Ga0209674_103913 | |||
| 2675 | Ga0209674_105404 | |||
| 2676 | Ga0209672_100073 | |||
| 2677 | Ga0209672_100276 | |||
| 2678 | Ga0209672_100383 | |||
| 2679 | Ga0209672_102256 | |||
| 2680 | Ga0209672_102285 | |||
| 2681 | Ga0209672_116278 | |||
| 2682 | Ga0209147_100090 | |||
| 2683 | Ga0209147_100093 | |||
| 2684 | Ga0209147_102318 | |||
| 2685 | Ga0209563_100011 | |||
| 2686 | Ga0209563_100373 | |||
| 2687 | Ga0209563_100470 | |||
| 2688 | Ga0209563_119837 | |||
| 2689 | Ga0207427_100807 | |||
| 2690 | Ga0209437_103924 | |||
| 2691 | Ga0209258_100130 | |||
| 2692 | Ga0209258_100140 | |||
| 2693 | Ga0209258_102394 | |||
| 2694 | Ga0209258_103856 | |||
| 2695 | Ga0207425_1000021 | |||
| 2696 | Ga0207425_1000845 | |||
| 2697 | Ga0207425_1000932 | |||
| 2698 | Ga0209646_1000068 | |||
| 2699 | Ga0209646_1000119 | |||
| 2700 | Ga0209677_100043 | |||
| 2701 | Ga0209677_107281 | |||
| 2702 | Ga0209148_1000119 | |||
| 2703 | Ga0209148_1000140 | |||
| 2704 | Ga0209148_1000444 | |||
| 2705 | Ga0209148_1001671 | |||
| 2706 | Ga0209759_1001723 | |||
| 2707 | Ga0209759_1004738 | |||
| 2708 | Ga0209759_1008563 | |||
| 2709 | Ga0209759_1010191 | |||
| 2710 | Ga0209759_1012475 | |||
| 2711 | Ga0209759_1014574 | |||
| 2712 | Ga0209759_1014581 | |||
| 2713 | Ga0209759_1026805 | |||
| 2714 | Ga0209129_1000020 | |||
| 2715 | Ga0209233_1000173 | |||
| 2716 | Ga0209565_1000123 | |||
| 2717 | Ga0209565_1001042 | |||
| 2718 | Ga0209565_1003095 | |||
| 2719 | Ga0209455_1000070 | |||
| 2720 | Ga0209455_1000119 | |||
| 2721 | Ga0209455_1000125 | |||
| 2722 | Ga0209455_1000244 | |||
| 2723 | Ga0209455_1001216 | |||
| 2724 | Ga0209673_1000040 | |||
| 2725 | Ga0209673_1000098 | |||
| 2726 | Ga0209673_1004818 | |||
| 2727 | Ga0209673_1112596 | |||
| 2728 | Ga0209130_1000290 | |||
| 2729 | Ga0209130_1002182 | |||
| 2730 | Ga0209675_1000117 | |||
| 2731 | Ga0209675_1002785 | |||
| 2732 | Ga0209025_1000039 | |||
| 2733 | Ga0209025_1011110 | |||
| 2734 | Ga0209564_1000027 | |||
| 2735 | Ga0209564_1000047 | |||
| 2736 | Ga0209564_1000121 | |||
| 2737 | Ga0209564_1002740 | |||
| 2738 | Ga0209564_1006738 | |||
| 2739 | Ga0209564_1032951 | |||
| 2740 | Ga0209564_1041569 | |||
| 2741 | Ga0209758_1000077 | |||
| 2742 | Ga0209758_1000322 | |||
| 2743 | Ga0209050_1000050 | |||
| 2744 | Ga0209050_1002922 | |||
| 2745 | Ga0209256_1000054 | |||
| 2746 | Ga0209256_1001933 | |||
| 2747 | Ga0209256_1002719 | |||
| 2748 | Ga0209256_1024911 | |||
| 2749 | Ga0209256_1058574 | |||
| 2750 | Ga0207426_1000199 | |||
| 2751 | Ga0207426_1000802 | |||
| 2752 | Ga0207426_1010681 | |||
| 2753 | Ga0207426_1047907 | |||
| 2754 | Ga0209051_1052723 | |||
| 2755 | Ga0209051_1053753 | |||
| 2756 | Ga0209257_1000075 | |||
| 2757 | Ga0207656_10080640 | |||
| 2758 | Ga0207656_10187581 | |||
| 2759 | Ga0207696_1020741 | |||
| 2760 | Ga0207696_1166247 | |||
| 2761 | Ga0207696_1181955 | |||
| 2762 | Ga0207655_1000499 | |||
| 2763 | Ga0207713_1004623 | |||
| 2764 | Ga0207713_1005407 | |||
| 2765 | Ga0207713_1023386 | |||
| 2766 | Ga0207710_10161546 | |||
| 2767 | Ga0207680_10163642 | |||
| 2768 | Ga0207680_10716637 | |||
| 2769 | Ga0207647_10004870 | |||
| 2770 | Ga0207647_10007364 | |||
| 2771 | Ga0207647_10104384 | |||
| 2772 | Ga0207643_10273624 | |||
| 2773 | Ga0207705_10004265 | |||
| 2774 | Ga0207705_10011628 | |||
| 2775 | Ga0207705_10060061 | |||
| 2776 | Ga0207705_10103487 | |||
| 2777 | Ga0207705_10122104 | |||
| 2778 | Ga0207684_10223837 | |||
| 2779 | Ga0207684_10567778 | |||
| 2780 | Ga0207654_10002111 | |||
| 2781 | Ga0207654_10090331 | |||
| 2782 | Ga0207654_10395591 | |||
| 2783 | Ga0207654_10496717 | |||
| 2784 | Ga0207695_10008376 | |||
| 2785 | Ga0207695_10027074 | |||
| 2786 | Ga0207695_10035527 | |||
| 2787 | Ga0207695_10227793 | |||
| 2788 | Ga0207695_10246637 | |||
| 2789 | Ga0207695_10269527 | |||
| 2790 | Ga0207695_11012665 | |||
| 2791 | Ga0207695_11263733 | |||
| 2792 | Ga0207671_10004456 | |||
| 2793 | Ga0207671_10201201 | |||
| 2794 | Ga0207671_10215175 | |||
| 2795 | Ga0207660_10011879 | |||
| 2796 | Ga0207662_10615472 | |||
| 2797 | Ga0207657_10014049 | |||
| 2798 | Ga0207657_10030110 | |||
| 2799 | Ga0207657_10044711 | |||
| 2800 | Ga0207657_10377992 | |||
| 2801 | Ga0207649_10000490 | |||
| 2802 | Ga0207649_10023804 | |||
| 2803 | Ga0207652_10090095 | |||
| 2804 | Ga0207652_10434543 | |||
| 2805 | Ga0207646_10808223 | |||
| 2806 | Ga0207694_10002733 | |||
| 2807 | Ga0207694_10045423 | |||
| 2808 | Ga0207694_10100374 | |||
| 2809 | Ga0207694_10108713 | |||
| 2810 | Ga0207650_10291854 | |||
| 2811 | Ga0207659_10648536 | |||
| 2812 | Ga0207687_10187681 | |||
| 2813 | Ga0207687_10444164 | |||
| 2814 | Ga0207664_11036144 | |||
| 2815 | Ga0207644_10095363 | |||
| 2816 | Ga0207644_10560838 | |||
| 2817 | Ga0207690_10000040 | |||
| 2818 | Ga0207690_10048382 | |||
| 2819 | Ga0207690_10182111 | |||
| 2820 | Ga0207690_10375638 | |||
| 2821 | Ga0207690_10619049 | |||
| 2822 | Ga0207690_10823820 | |||
| 2823 | Ga0207706_10008025 | |||
| 2824 | Ga0207686_10724498 | |||
| 2825 | Ga0207709_10001005 | |||
| 2826 | Ga0207709_10020009 | |||
| 2827 | Ga0207709_10115312 | |||
| 2828 | Ga0207704_10176248 | |||
| 2829 | Ga0207704_10836131 | |||
| 2830 | Ga0207704_11259073 | |||
| 2831 | Ga0207711_10057542 | |||
| 2832 | Ga0207711_10105192 | |||
| 2833 | Ga0207711_10582575 | |||
| 2834 | Ga0207711_10745958 | |||
| 2835 | Ga0207689_10000370 | |||
| 2836 | Ga0207689_10056742 | |||
| 2837 | Ga0207689_10943752 | |||
| 2838 | Ga0207689_10951974 | |||
| 2839 | Ga0207679_10000032 | |||
| 2840 | Ga0207679_10108686 | |||
| 2841 | Ga0207679_10237693 | |||
| 2842 | Ga0207679_11677414 | |||
| 2843 | Ga0207667_10006131 | |||
| 2844 | Ga0207667_10009212 | |||
| 2845 | Ga0207667_10015897 | |||
| 2846 | Ga0207667_10128204 | |||
| 2847 | Ga0207667_10384789 | |||
| 2848 | Ga0207651_10446093 | |||
| 2849 | Ga0207651_10469680 | |||
| 2850 | Ga0207651_10764166 | |||
| 2851 | Ga0207668_11173430 | |||
| 2852 | Ga0207640_10001991 | |||
| 2853 | Ga0207640_10022226 | |||
| 2854 | Ga0207658_10165595 | |||
| 2855 | Ga0207658_10257424 | |||
| 2856 | Ga0207658_11175935 | |||
| 2857 | Ga0207677_10006249 | |||
| 2858 | Ga0207703_10041315 | |||
| 2859 | Ga0207678_10000024 | |||
| 2860 | Ga0207678_10003236 | |||
| 2861 | Ga0207678_10043906 | |||
| 2862 | Ga0207678_10238626 | |||
| 2863 | Ga0207678_10248922 | |||
| 2864 | Ga0207678_10381905 | |||
| 2865 | Ga0207702_10000973 | |||
| 2866 | Ga0207702_10185671 | |||
| 2867 | Ga0207641_10789388 | |||
| 2868 | Ga0207648_10002176 | |||
| 2869 | Ga0207648_10873460 | |||
| 2870 | Ga0207676_10231338 | |||
| 2871 | Ga0207676_10813761 | |||
| 2872 | Ga0207676_11424445 | |||
| 2873 | Ga0207674_10003250 | |||
| 2874 | Ga0207674_10033169 | |||
| 2875 | Ga0207674_10173522 | |||
| 2876 | Ga0207675_101338134 | |||
| 2877 | Ga0207683_10065088 | |||
| 2878 | Ga0207683_10148309 | |||
| 2879 | Ga0207683_10228973 | |||
| 2880 | Ga0207683_10351656 | |||
| 2881 | Ga0207683_10505174 | |||
| 2882 | Ga0207698_10017410 | |||
| 2883 | Ga0207698_10023299 | |||
| 2884 | Ga0207698_10790935 | |||
| 2885 | Ga0207698_11334281 | |||
| 2886 | Ga0209281_1002282 | |||
| 2887 | Ga0209371_1000325 | |||
| 2888 | Ga0209371_1000766 | |||
| 2889 | Ga0209371_1003600 | |||
| 2890 | Ga0209282_1000032 | |||
| 2891 | Ga0209282_1000072 | |||
| 2892 | Ga0209813_10001024 | |||
| 2893 | Ga0209974_10092867 | |||
| 2894 | Ga0207428_10008382 | |||
| 2895 | Ga0268266_10117830 | |||
| 2896 | Ga0268265_10565558 | |||
| 2897 | Ga0268265_10897546 | |||
| 2898 | Ga0265336_10000618 | |||
| 2899 | Ga0307515_10067022 | |||
| 2900 | Ga0307515_10084890 | |||
| 2901 | Ga0307515_10119204 | |||
| 2902 | Ga0307515_10276308 | |||
| 2903 | Ga0265338_10004608 | |||
| 2904 | Ga0265338_10005463 | |||
| 2905 | Ga0265324_10000002 | |||
| 2906 | Ga0265324_10000500 | |||
| 2907 | Ga0268256_1001275 | |||
| 2908 | Ga0268256_1002981 | |||
| 2909 | Ga0307512_10116329 | |||
| 2910 | Ga0316176_1210209 | |||
| 2911 | Ga0314311_1150818 | |||
| 2912 | Ga0316179_1017842 | |||
| 2913 | Ga0316178_1040944 | |||
| 2914 | Ga0316180_1026989 | |||
| 2915 | Ga0316183_1084783 | |||
| 2916 | Ga0316181_1091528 | |||
| 2917 | Ga0316182_1108504 | |||
| 2918 | Ga0316182_1184435 | |||
| 2919 | Ga0316182_1433823 | |||
| 2920 | Ga0265767_100009 | |||
| 2921 | Ga0265766_1000099 | |||
| 2922 | Ga0265766_1000407 | |||
| 2923 | Ga0265766_1000435 | |||
| 2924 | Ga0265766_1000731 | |||
| 2925 | Ga0265766_1003268 | |||
| 2926 | Ga0265769_100464 | |||
| 2927 | Ga0265769_100729 | |||
| 2928 | Ga0265769_102846 | |||
| 2929 | Ga0265769_113786 | |||
| 2930 | Ga0265768_100424 | |||
| 2931 | Ga0265773_1008002 | |||
| 2932 | Ga0265328_10003595 | |||
| 2933 | Ga0265331_10000050 | |||
| 2934 | Ga0265331_10003466 | |||
| 2935 | Ga0265327_10000109 | |||
| 2936 | Ga0265327_10000161 | |||
| 2937 | Ga0265327_10000178 | |||
| 2938 | Ga0265327_10009306 | |||
| 2939 | Ga0265327_10028075 | |||
| 2940 | Ga0265327_10098857 | |||
| 2941 | Ga0265316_10067921 | |||
| 2942 | Ga0265316_10182264 | |||
| 2943 | Ga0265316_10503563 | |||
| 2944 | Ga0307513_10011808 | |||
| 2945 | Ga0307513_10124367 | |||
| 2946 | Ga0307513_10769558 | |||
| 2947 | Ga0307509_10109747 | |||
| 2948 | Ga0307509_10192810 | |||
| 2949 | Ga0307509_10286613 | |||
| 2950 | Ga0307408_100000089 | |||
| 2951 | Ga0307408_100001167 | |||
| 2952 | Ga0307408_100004683 | |||
| 2953 | Ga0307408_100292357 | |||
| 2954 | Ga0307408_100297420 | |||
| 2955 | Ga0307408_100477718 | |||
| 2956 | Ga0307408_100820655 | |||
| 2957 | Ga0316575_10000771 | |||
| 2958 | Ga0316575_10038338 | |||
| 2959 | Ga0310111_101033 | |||
| 2960 | Ga0310111_122416 | |||
| 2961 | Ga0316579_10026608 | |||
| 2962 | Ga0265314_10158374 | |||
| 2963 | Ga0316576_10029129 | |||
| 2964 | Ga0316578_10033675 | |||
| 2965 | Ga0307516_10583188 | |||
| 2966 | Ga0307405_10052007 | |||
| 2967 | Ga0307405_10394290 | |||
| 2968 | Ga0307405_10964520 | |||
| 2969 | Ga0316577_10146540 | |||
| 2970 | Ga0247548_101784 | |||
| 2971 | Ga0247548_107337 | |||
| 2972 | Ga0307518_10004256 | |||
| 2973 | Ga0307410_10632467 | |||
| 2974 | Ga0307406_10400159 | |||
| 2975 | Ga0307406_10504504 | |||
| 2976 | Ga0307407_10777831 | |||
| 2977 | Ga0307412_10000056 | |||
| 2978 | Ga0307412_10011111 | |||
| 2979 | Ga0307412_10507816 | |||
| 2980 | Ga0307416_100002061 | |||
| 2981 | Ga0307416_100003624 | |||
| 2982 | Ga0307416_100006305 | |||
| 2983 | Ga0307416_100212411 | |||
| 2984 | Ga0307411_10233740 | |||
| 2985 | Ga0307411_10411105 | |||
| 2986 | Ga0307411_10487888 | |||
| 2987 | Ga0307411_10724848 | |||
| 2988 | Ga0307411_10836349 | |||
| 2989 | Ga0307411_11073839 | |||
| 2990 | Ga0307415_101279947 | |||
| 2991 | Ga0316583_10196422 | |||
| 2992 | Ga0316580_10001102 | |||
| 2993 | Ga0316593_10000198 | |||
| 2994 | Ga0316593_10193303 | |||
| 2995 | Ga0316593_10223821 | |||
| 2996 | Ga0307507_10149043 | |||
| 2997 | Ga0307510_10228403 | |||
| 2998 | Ga0316592_1001786 | |||
| 2999 | Ga0316596_1000040 | |||
| 3000 | Ga0373950_0017579 | |||
| 3001 | Ga0373940_0012763 | |||
| 3002 | Ga0373940_0097521 | |||
| 3003 | Ga0373932_0048427 | |||
| 3004 | Ga0373939_0000348 | |||
| 3005 | Ga0373960_0000482 | |||
| 3006 | Ga0373961_0059684 | |||
| 3007 | Ga0373962_0035579 | |||
| 3008 | Ga0316574_0003365 | |||
| 3009 | Ga0373931_0000535 | |||
| 3010 | Ga0373931_0008660 | |||
| 3011 | Ga0373931_0861160 | |||
| 3012 | Ga0373947_0765701 | |||
| 3013 | Ga0310112_026650 | |||
| 3014 | Ga0310109_000061 | |||
| 3015 | Ga0310110_014822 | |||
| 3016 | Ga0395899_0000080 | |||
| 3017 | Ga0395899_0000218 | |||
| 3018 | Ga0395899_0005268 | |||
| 3019 | Ga0395899_0079277 | |||
| 3020 | Ga0395899_0462873 | |||
| 3021 | Ga0395900_0000087 | |||
| 3022 | Ga0395900_0103484 | |||
| 3023 | Ga0395900_0104724 | |||
| 3024 | Ga0395900_0682800 | |||
| 3025 | Ga0395900_0699378 | |||
| 3026 | Ga0395900_1333168 | |||
| 3027 | Ga0395900_1707164 | |||
| 3028 | Ga0395898_0000448 | |||
| 3029 | Ga0395898_0004701 | |||
| 3030 | Ga0395898_0091559 | |||
| 3031 | Ga0395898_0139979 | |||
| 3032 | Ga0395898_1142440 | |||
| 3033 | Ga0395898_1218083 | |||
| 3034 | Ga0395905_0001371 | |||
| 3035 | Ga0395905_0002507 | |||
| 3036 | Ga0395905_0097862 | |||
| 3037 | Ga0395905_0173708 | |||
| 3038 | Ga0395905_0177460 | |||
| 3039 | Ga0395901_0000378 | |||
| 3040 | Ga0395901_0062325 | |||
| 3041 | Ga0395901_0207707 | |||
| 3042 | Ga0395901_0565724 | |||
| 3043 | Ga0395901_0798512 | |||
| 3044 | Ga0395901_1105207 | |||
| 3045 | Ga0395901_1341045 | |||
| 3046 | Ga0400490_00437 | |||
| 3047 | Ga0400490_03371 | |||
| 3048 | Ga0400490_46672 | |||
| 3049 | Ga0400491_08907 | |||
| 3050 | Ga0400488_51157 | |||
| 3051 | Ga0400486_01341 | |||
| 3052 | Ga0400486_03874 | |||
| 3053 | Ga0400486_32640 | |||
| 3054 | Ga0400483_035353 | |||
| 3055 | Ga0400483_062435 | |||
| 3056 | Ga0400483_071897 | |||
| 3057 | Ga0400483_074535 | |||
| 3058 | Ga0400483_080413 | |||
| 3059 | Ga0400483_131418 | |||
| 3060 | Ga0400483_159229 | |||
| 3061 | Ga0400483_205660 | |||
| 3062 | Ga0400489_88546 | |||
| 3063 | Ga0436365_1248808 | |||
| 3064 | Ga0436360_0476119 | |||
| 3065 | Ga0436361_0141197 | |||
| 3066 | Ga0436361_0378504 | |||
| 3067 | Ga0436361_0575526 | |||
| 3068 | Ga0436361_0830526 | |||
| 3069 | Ga0439436_0003093 | |||
| 3070 | Ga0439436_0101864 | |||
| 3071 | Ga0439439_0027171 | |||
| 3072 | Ga0439439_0087288 | |||
| 3073 | Ga0439439_0245793 | |||
| 3074 | Ga0439447_063185 | |||
| 3075 | Ga0439453_0009071 | |||
| 3076 | Ga0439466_0050203 | |||
| 3077 | Ga0439465_0010238 | |||
| 3078 | Ga0439465_0042679 | |||
| 3079 | Ga0439465_0098774 | |||
| 3080 | Ga0451791_0429238 | |||
| 3081 | Ga0451805_077998 | |||
| 3082 | Ga0451805_100255 | |||
| 3083 | Ga0451835_1143204 | |||
| 3084 | Ga0451841_0463776 | |||
| 3085 | Ga0451850_01102 | |||
| 3086 | Ga0451850_20986 | |||
| 3087 | Ga0451853_0562209 | |||
| 3088 | Ga0452271_59633 | |||
| 3089 | Ga0439431_0002191 | |||
| 3090 | Ga0439433_0000255 | |||
| 3091 | Ga0439437_001479 | |||
| 3092 | Ga0439442_017115 | |||
| 3093 | Ga0439442_047946 | |||
| 3094 | Ga0439445_0003892 | |||
| 3095 | Ga0439448_0000118 | |||
| 3096 | Ga0439448_0036301 | |||
| 3097 | Ga0439448_0044502 | |||
| 3098 | Ga0439448_0095964 | |||
| 3099 | Ga0439432_001484 | |||
| 3100 | Ga0439449_0008668 | |||
| 3101 | Ga0439449_0013168 | |||
| 3102 | Ga0439449_0098851 | |||
| 3103 | Ga0439452_030522 | |||
| 3104 | Ga0439452_091319 | |||
| 3105 | Ga0439454_011850 | |||
| 3106 | Ga0439454_022677 | |||
| 3107 | Ga0439455_0000425 | |||
| 3108 | Ga0439455_0026675 | |||
| 3109 | Ga0439455_0035150 | |||
| 3110 | Ga0439457_010422 | |||
| 3111 | Ga0450911_004506 | |||
| 3112 | Ga0450917_000001 | |||
| 3113 | Ga0450920_039592 | |||
| 3114 | Ga0450923_056631 | |||
| 3115 | Ga0450888_000936 | |||
| 3116 | Ga0450890_000549 | |||
| 3117 | Ga0450890_001085 | |||
| 3118 | Ga0450897_002592 | |||
| 3119 | Ga0450891_000655 | |||
| 3120 | Ga0450892_001248 | |||
| 3121 | Ga0450898_043606 | |||
| 3122 | Ga0450902_024020 | |||
| 3123 | Ga0450904_002765 | |||
| 3124 | Ga0450904_008721 | |||
| 3125 | Ga0450889_000161 | |||
| 3126 | Ga0450907_011958 | |||
| 3127 | Ga0450910_017596 | |||
| 3128 | Ga0439446_0029603 | |||
| 3129 | Ga0439446_0048229 | |||
| 3130 | Ga0439446_0056828 | |||
| 3131 | Ga0439458_0009491 | |||
| 3132 | Ga0450909_012865 | |||
| 3133 | Ga0450916_001782 | |||
| 3134 | Ga0450893_0002428 | |||
| 3135 | Ga0450893_0016245 | |||
| 3136 | Ga0450901_013383 | |||
| 3137 | Ga0451577_0000013 | |||
| 3138 | Ga0451577_0000191 | |||
| 3139 | Ga0451577_0056781 | |||
| 3140 | Ga0451577_0128321 | |||
| 3141 | Ga0451577_0218523 | |||
| 3142 | Ga0451577_0283539 | |||
| 3143 | Ga0451577_0286581 | |||
| 3144 | Ga0466969_0001722 | |||
| 3145 | Ga0466969_0004256 | |||
| 3146 | Ga0466969_0010770 | |||
| 3147 | Ga0466969_0011638 | |||
| 3148 | Ga0466969_0131244 | |||
| 3149 | Ga0466972_0060383 | |||
| 3150 | Ga0466972_0095863 | |||
| 3151 | Ga0466972_0154934 | |||
| 3152 | Ga0466972_0202782 | |||
| 3153 | Ga0466973_0049331 | |||
| 3154 | Ga0466981_0147961 | |||
| 3155 | Ga0453683_0000059 | |||
| 3156 | Ga0466965_0001145 | |||
| 3157 | Ga0466965_0015818 | |||
| 3158 | Ga0466965_0063634 | |||
| 3159 | Ga0466965_0071942 | |||
| 3160 | Ga0466965_0221193 | |||
| 3161 | Ga0466965_0321709 | |||
| 3162 | Ga0466965_0321710 | |||
| 3163 | Ga0466966_0003725 | |||
| 3164 | Ga0466966_0059810 | |||
| 3165 | Ga0466966_0062883 | |||
| 3166 | Ga0466966_0062980 | |||
| 3167 | Ga0466966_0067908 | |||
| 3168 | Ga0466966_0093495 | |||
| 3169 | Ga0466961_0000296 | |||
| 3170 | Ga0466961_0000649 | |||
| 3171 | Ga0466961_0036745 | |||
| 3172 | Ga0466961_0053995 | |||
| 3173 | Ga0466961_0072863 | |||
| 3174 | Ga0466961_0117187 | |||
| 3175 | Ga0466961_0118072 | |||
| 3176 | Ga0466961_0335951 | |||
| 3177 | Ga0466961_0391601 | |||
| 3178 | Ga0466961_0800640 | |||
| 3179 | Ga0466963_0047825 | |||
| 3180 | Ga0466963_0662781 | |||
| 3181 | Ga0466964_0015332 | |||
| 3182 | Ga0466964_0020973 | |||
| 3183 | Ga0466964_0105381 | |||
| 3184 | Ga0453684_0000585 | |||
| 3185 | Ga0453684_0000590 | |||
| 3186 | Ga0453684_0000989 | |||
| 3187 | Ga0453684_0035225 | |||
| 3188 | Ga0453684_0065104 | |||
| 3189 | Ga0453684_0239607 | |||
| 3190 | Ga0453684_0317486 | |||
| 3191 | Ga0453684_0456100 | |||
| 3192 | Ga0453684_0860212 | |||
| 3193 | Ga0453684_1755614 | |||
| 3194 | Ga0466971_0000181 | |||
| 3195 | Ga0466971_0035698 | |||
| 3196 | Ga0466971_0136841 | |||
| 3197 | Ga0466968_0242976 | |||
| 3198 | Ga0466968_0272311 | |||
| 3199 | Ga0466968_0282713 | |||
| 3200 | Ga0466970_0002988 | |||
| 3201 | Ga0466970_0015188 | |||
| 3202 | Ga0466970_0070556 | |||
| 3203 | Ga0466970_0178995 | |||
| 3204 | Ga0466957_0002562 | |||
| 3205 | Ga0466957_0014461 | |||
| 3206 | Ga0466957_0019611 | |||
| 3207 | Ga0466957_0027993 | |||
| 3208 | Ga0466957_0096700 | |||
| 3209 | Ga0466957_0197429 | |||
| 3210 | Ga0466957_0218243 | |||
| 3211 | Ga0466957_0379455 | |||
| 3212 | Ga0466959_0000926 | |||
| 3213 | Ga0466959_0005512 | |||
| 3214 | Ga0466959_0007380 | |||
| 3215 | Ga0466959_0071231 | |||
| 3216 | Ga0466959_0265929 | |||
| 3217 | Ga0451576_0000013 | |||
| 3218 | Ga0451576_0000018 | |||
| 3219 | Ga0451576_0005877 | |||
| 3220 | Ga0451576_0010036 | |||
| 3221 | Ga0451576_0025038 | |||
| 3222 | Ga0451576_0100286 | |||
| 3223 | Ga0451576_0193652 | |||
| 3224 | Ga0451576_0280918 | |||
| 3225 | Ga0451576_0999273 | |||
| 3226 | Ga0466958_0001887 | |||
| 3227 | Ga0466958_0019865 | |||
| 3228 | Ga0466958_0060303 | |||
| 3229 | Ga0466958_0065480 | |||
| 3230 | Ga0466958_0159333 | |||
| 3231 | Ga0466967_0187281 | |||
| 3232 | Ga0466967_0545245 | |||
| 3233 | Ga0466967_0746643 | |||
| 3234 | Ga0495617_000397 | |||
| 3235 | Ga0495617_000636 | |||
| 3236 | Ga0495617_000830 | |||
| 3237 | Ga0495617_007711 | |||
| 3238 | Ga0495617_009077 | |||
| 3239 | Ga0495617_107059 | |||
| 3240 | Ga0495627_004713 | |||
| 3241 | Ga0495627_008079 | |||
| 3242 | Ga0495592_0100631 | |||
| 3243 | Ga0495592_0205027 | |||
| 3244 | Ga0495603_0001612 | |||
| 3245 | Ga0495603_0009392 | |||
| 3246 | Ga0495603_0021343 | |||
| 3247 | Ga0495603_0036844 | |||
| 3248 | Ga0495603_0121153 | |||
| 3249 | Ga0495603_0344095 | |||
| 3250 | Ga0495603_0365634 | |||
| 3251 | Ga0495590_0000020 | |||
| 3252 | Ga0495590_0000632 | |||
| 3253 | Ga0495590_0001551 | |||
| 3254 | Ga0495590_0006208 | |||
| 3255 | Ga0495590_0018240 | |||
| 3256 | Ga0495590_0035656 | |||
| 3257 | Ga0495590_0084356 | |||
| 3258 | Ga0495590_0407092 | |||
| 3259 | Ga0495591_010774 | |||
| 3260 | Ga0495629_0008019 | |||
| 3261 | Ga0495629_0015926 | |||
| 3262 | Ga0495629_0143741 | |||
| 3263 | Ga0495629_0185132 | |||
| 3264 | Ga0495629_0248372 | |||
| 3265 | Ga0495629_0919744 | |||
| 3266 | Ga0495638_0000235 | |||
| 3267 | Ga0495638_0010507 | |||
| 3268 | Ga0495638_0016045 | |||
| 3269 | Ga0495638_0058891 | |||
| 3270 | Ga0495638_0066492 | |||
| 3271 | Ga0495638_0127888 | |||
| 3272 | Ga0495638_0138245 | |||
| 3273 | Ga0495638_0143356 | |||
| 3274 | Ga0495638_0175482 | |||
| 3275 | Ga0495638_0192509 | |||
| 3276 | Ga0495641_0049296 | |||
| 3277 | Ga0495653_0000067 | |||
| 3278 | Ga0495653_0004702 | |||
| 3279 | Ga0495653_0030611 | |||
| 3280 | Ga0495653_0071030 | |||
| 3281 | Ga0495653_0091071 | |||
| 3282 | Ga0495653_0300755 | |||
| 3283 | Ga0495650_0000200 | |||
| 3284 | Ga0495650_0000436 | |||
| 3285 | Ga0495650_0001809 | |||
| 3286 | Ga0495650_0007290 | |||
| 3287 | Ga0495650_0017593 | |||
| 3288 | Ga0495650_0020204 | |||
| 3289 | Ga0495650_0023276 | |||
| 3290 | Ga0495650_0025873 | |||
| 3291 | Ga0495650_0028055 | |||
| 3292 | Ga0495650_0046362 | |||
| 3293 | Ga0495650_0086014 | |||
| 3294 | Ga0495580_0006554 | |||
| 3295 | Ga0495580_0016805 | |||
| 3296 | Ga0495580_0020632 | |||
| 3297 | Ga0495580_0130646 | |||
| 3298 | Ga0495580_0295525 | |||
| 3299 | Ga0495580_0716936 | |||
| 3300 | Ga0495582_0005108 | |||
| 3301 | Ga0495582_0014415 | |||
| 3302 | Ga0495582_0033837 | |||
| 3303 | Ga0495582_0181417 | |||
| 3304 | Ga0495582_0545605 | |||
| 3305 | Ga0495605_0000061 | |||
| 3306 | Ga0495605_0001735 | |||
| 3307 | Ga0495605_0005449 | |||
| 3308 | Ga0495605_0009198 | |||
| 3309 | Ga0495605_0010393 | |||
| 3310 | Ga0495605_0012129 | |||
| 3311 | Ga0495605_0013819 | |||
| 3312 | Ga0495605_0014824 | |||
| 3313 | Ga0495605_0017339 | |||
| 3314 | Ga0495605_0066496 | |||
| 3315 | Ga0495605_0085995 | |||
| 3316 | Ga0495605_0125990 | |||
| 3317 | Ga0495605_0272644 | |||
| 3318 | Ga0495639_0038910 | |||
| 3319 | Ga0495639_0088103 | |||
| 3320 | Ga0495639_0088932 | |||
| 3321 | Ga0495639_0150524 | |||
| 3322 | Ga0495662_0024098 | |||
| 3323 | Ga0495662_0180757 | |||
| 3324 | Ga0495664_0006673 | |||
| 3325 | Ga0495664_0069337 | |||
| 3326 | Ga0495664_0072529 | |||
| 3327 | Ga0495664_0095229 | |||
| 3328 | Ga0495664_0097358 | |||
| 3329 | Ga0495664_0250066 | |||
| 3330 | Ga0495584_0000636 | |||
| 3331 | Ga0495584_0002002 | |||
| 3332 | Ga0495584_0011799 | |||
| 3333 | Ga0495584_0012155 | |||
| 3334 | Ga0495584_0021670 | |||
| 3335 | Ga0495584_0032055 | |||
| 3336 | Ga0495584_0033893 | |||
| 3337 | Ga0495584_0144920 | |||
| 3338 | Ga0495584_0190186 | |||
| 3339 | Ga0495584_0201597 | |||
| 3340 | Ga0495585_0000497 | |||
| 3341 | Ga0495585_0006666 | |||
| 3342 | Ga0495585_0037607 | |||
| 3343 | Ga0495585_0040726 | |||
| 3344 | Ga0495585_0041550 | |||
| 3345 | Ga0495585_0050808 | |||
| 3346 | Ga0495585_0053985 | |||
| 3347 | Ga0495585_0057251 | |||
| 3348 | Ga0495585_0067131 | |||
| 3349 | Ga0495594_0010435 | |||
| 3350 | Ga0495594_0017612 | |||
| 3351 | Ga0495594_0034748 | |||
| 3352 | Ga0495594_0073377 | |||
| 3353 | Ga0495594_0125027 | |||
| 3354 | Ga0495594_0244040 | |||
| 3355 | Ga0495596_0001745 | |||
| 3356 | Ga0495596_0001963 | |||
| 3357 | Ga0495596_0020643 | |||
| 3358 | Ga0495596_0142796 | |||
| 3359 | Ga0495596_0165675 | |||
| 3360 | Ga0495596_0199960 | |||
| 3361 | Ga0495596_0254795 | |||
| 3362 | Ga0495607_0009755 | |||
| 3363 | Ga0495607_0017761 | |||
| 3364 | Ga0495607_0021914 | |||
| 3365 | Ga0495607_0038368 | |||
| 3366 | Ga0495607_0042397 | |||
| 3367 | Ga0495607_0059953 | |||
| 3368 | Ga0495607_0062866 | |||
| 3369 | Ga0495607_0063124 | |||
| 3370 | Ga0495607_0100890 | |||
| 3371 | Ga0495607_0103502 | |||
| 3372 | Ga0495607_0159222 | |||
| 3373 | Ga0495607_0318419 | |||
| 3374 | Ga0495607_0319723 | |||
| 3375 | Ga0495583_0000317 | |||
| 3376 | Ga0495583_0002046 | |||
| 3377 | Ga0495583_0004594 | |||
| 3378 | Ga0495583_0004815 | |||
| 3379 | Ga0495583_0011949 | |||
| 3380 | Ga0495583_0016574 | |||
| 3381 | Ga0495583_0018545 | |||
| 3382 | Ga0495583_0019465 | |||
| 3383 | Ga0495583_0094359 | |||
| 3384 | Ga0495606_0009877 | |||
| 3385 | Ga0495606_0031882 | |||
| 3386 | Ga0495606_0035311 | |||
| 3387 | Ga0495606_0035595 | |||
| 3388 | Ga0495606_0037967 | |||
| 3389 | Ga0495606_0048233 | |||
| 3390 | Ga0495606_0054164 | |||
| 3391 | Ga0495606_0064595 | |||
| 3392 | Ga0495606_0066613 | |||
| 3393 | Ga0495606_0070973 | |||
| 3394 | Ga0495606_0080050 | |||
| 3395 | Ga0495606_0085615 | |||
| 3396 | Ga0495606_0109571 | |||
| 3397 | Ga0495606_0147485 | |||
| 3398 | Ga0495608_0188850 | |||
| 3399 | Ga0495608_0308495 | |||
| 3400 | Ga0495610_0000017 | |||
| 3401 | Ga0495610_0065030 | |||
| 3402 | Ga0495610_0125032 | |||
| 3403 | Ga0495616_0003800 | |||
| 3404 | Ga0495616_0011842 | |||
| 3405 | Ga0495616_0034996 | |||
| 3406 | Ga0495616_0072460 | |||
| 3407 | Ga0495616_0086533 | |||
| 3408 | Ga0495616_0102252 | |||
| 3409 | Ga0495616_0111084 | |||
| 3410 | Ga0495616_0117328 | |||
| 3411 | Ga0495616_0119592 | |||
| 3412 | Ga0495616_0163239 | |||
| 3413 | Ga0495616_0390385 | |||
| 3414 | Ga0495618_0018095 | |||
| 3415 | Ga0495618_0138514 | |||
| 3416 | Ga0495618_0469722 | |||
| 3417 | Ga0495620_0001543 | |||
| 3418 | Ga0495620_0014491 | |||
| 3419 | Ga0495620_0053647 | |||
| 3420 | Ga0495628_0006292 | |||
| 3421 | Ga0495628_0069084 | |||
| 3422 | Ga0495628_0075933 | |||
| 3423 | Ga0495628_0079554 | |||
| 3424 | Ga0495628_0109587 | |||
| 3425 | Ga0495628_0205693 | |||
| 3426 | Ga0495630_0038355 | |||
| 3427 | Ga0495630_0100382 | |||
| 3428 | Ga0495630_0109243 | |||
| 3429 | Ga0495630_0134360 | |||
| 3430 | Ga0495630_0207757 | |||
| 3431 | Ga0495631_0011063 | |||
| 3432 | Ga0495631_0011843 | |||
| 3433 | Ga0495631_0019480 | |||
| 3434 | Ga0495631_0030651 | |||
| 3435 | Ga0495631_0161756 | |||
| 3436 | Ga0495632_0016465 | |||
| 3437 | Ga0495632_0026864 | |||
| 3438 | Ga0495632_0089406 | |||
| 3439 | Ga0495632_0096913 | |||
| 3440 | Ga0495632_0172654 | |||
| 3441 | Ga0495637_0000053 | |||
| 3442 | Ga0495637_0002190 | |||
| 3443 | Ga0495637_0011543 | |||
| 3444 | Ga0495637_0012032 | |||
| 3445 | Ga0495637_0056898 | |||
| 3446 | Ga0495643_0012013 | |||
| 3447 | Ga0495643_0014375 | |||
| 3448 | Ga0495643_0019530 | |||
| 3449 | Ga0495643_0026159 | |||
| 3450 | Ga0495643_0040991 | |||
| 3451 | Ga0495643_0044520 | |||
| 3452 | Ga0495643_0048287 | |||
| 3453 | Ga0495643_0054593 | |||
| 3454 | Ga0495643_0104068 | |||
| 3455 | Ga0495644_0003110 | |||
| 3456 | Ga0495644_0013221 | |||
| 3457 | Ga0495644_0019769 | |||
| 3458 | Ga0495644_0053726 | |||
| 3459 | Ga0495644_0075233 | |||
| 3460 | Ga0495644_0218639 | |||
| 3461 | Ga0495648_0003167 | |||
| 3462 | Ga0495648_0015922 | |||
| 3463 | Ga0495648_0025782 | |||
| 3464 | Ga0495648_0026850 | |||
| 3465 | Ga0495648_0044310 | |||
| 3466 | Ga0495648_0046480 | |||
| 3467 | Ga0495648_0056197 | |||
| 3468 | Ga0495648_0087678 | |||
| 3469 | Ga0495648_0098552 | |||
| 3470 | Ga0495648_0100591 | |||
| 3471 | Ga0495648_0120126 | |||
| 3472 | Ga0495648_0150736 | |||
| 3473 | Ga0495648_0155108 | |||
| 3474 | Ga0495648_0209849 | |||
| 3475 | Ga0495648_0320024 | |||
| 3476 | Ga0495663_0006063 | |||
| 3477 | Ga0495663_0008461 | |||
| 3478 | Ga0495663_0012604 | |||
| 3479 | Ga0495663_0017530 | |||
| 3480 | Ga0495663_0065824 | |||
| 3481 | Ga0495663_0124763 | |||
| 3482 | Ga0495666_0002416 | |||
| 3483 | Ga0495666_0040638 | |||
| 3484 | Ga0495666_0049585 | |||
| 3485 | Ga0495666_0098357 | |||
| 3486 | Ga0495666_0105624 | |||
| 3487 | Ga0495666_0115943 | |||
| 3488 | Ga0495666_0162411 | |||
| 3489 | Ga0495666_0287216 | |||
| 3490 | Ga0495666_0391822 | |||
| 3491 | Ga0495666_0446510 | |||
| 3492 | Ga0495642_0005824 | |||
| 3493 | Ga0495642_0007577 | |||
| 3494 | Ga0495642_0008349 | |||
| 3495 | Ga0495642_0019574 | |||
| 3496 | Ga0495642_0026738 | |||
| 3497 | Ga0495642_0030583 | |||
| 3498 | Ga0495642_0048741 | |||
| 3499 | Ga0495642_0056434 | |||
| 3500 | Ga0495642_0075423 | |||
| 3501 | Ga0495642_0079432 | |||
| 3502 | Ga0495642_0168073 | |||
| 3503 | Ga0495642_0213337 | |||
| 3504 | Ga0495642_0231611 | |||
| 3505 | Ga0495652_0035356 | |||
| 3506 | Ga0495652_0115773 | |||
| 3507 | Ga0495652_0146004 | |||
| 3508 | Ga0495652_0151599 | |||
| 3509 | Ga0495654_0000060 | |||
| 3510 | Ga0495654_0030668 | |||
| 3511 | Ga0495654_0109550 | |||
| 3512 | Ga0495654_0176808 | |||
| 3513 | Ga0495654_0191212 | |||
| 3514 | Ga0495654_0247759 | |||
| 3515 | Ga0495665_0008466 | |||
| 3516 | Ga0495665_0018585 | |||
| 3517 | Ga0495665_0031045 | |||
| 3518 | Ga0495665_0034628 | |||
| 3519 | Ga0495665_0057876 | |||
| 3520 | Ga0495665_0069907 | |||
| 3521 | Ga0495665_0091889 | |||
| 3522 | Ga0495665_0221276 | |||
| 3523 | Ga0495640_0041811 | |||
| 3524 | Ga0495640_0475601 | |||
| 3525 | Ga0495586_0008133 | |||
| 3526 | Ga0495586_0018161 | |||
| 3527 | Ga0495586_0051587 | |||
| 3528 | Ga0495586_0070537 | |||
| 3529 | Ga0495586_0072077 | |||
| 3530 | Ga0495586_0106892 | |||
| 3531 | Ga0495587_0007790 | |||
| 3532 | Ga0495587_0037993 | |||
| 3533 | Ga0495587_0086906 | |||
| 3534 | Ga0495587_0263774 | |||
| 3535 | Ga0495587_0427665 | |||
| 3536 | Ga0495598_0027767 | |||
| 3537 | Ga0495609_0000007 | |||
| 3538 | Ga0495609_0000666 | |||
| 3539 | Ga0495609_0033507 | |||
| 3540 | Ga0495609_0046714 | |||
| 3541 | Ga0495609_0084127 | |||
| 3542 | Ga0495609_0085504 | |||
| 3543 | Ga0495609_0164311 | |||
| 3544 | Ga0495609_0211129 | |||
| 3545 | Ga0495621_0161107 | |||
| 3546 | Ga0495621_0161323 | |||
| 3547 | Ga0495621_0351269 | |||
| 3548 | Ga0495597_0007533 | |||
| 3549 | Ga0495597_0007961 | |||
| 3550 | Ga0495597_0014198 | |||
| 3551 | Ga0495597_0022360 | |||
| 3552 | Ga0495597_0023086 | |||
| 3553 | Ga0495597_0073396 | |||
| 3554 | Ga0495597_0073428 | |||
| 3555 | Ga0495597_0079026 | |||
| 3556 | Ga0495597_0125983 | |||
| 3557 | Ga0495597_0185257 | |||
| 3558 | Ga0495597_0232401 | |||
| 3559 | Ga0495597_0323992 | |||
| 3560 | Ga0495645_0009368 | |||
| 3561 | Ga0495645_0061503 | |||
| 3562 | Ga0495645_0102644 | |||
| 3563 | Ga0495645_0450145 | |||
| 3564 | Ga0495622_0002163 | |||
| 3565 | Ga0495622_0012942 | |||
| 3566 | Ga0495622_0014615 | |||
| 3567 | Ga0495622_0031049 | |||
| 3568 | Ga0495622_0031817 | |||
| 3569 | Ga0495622_0035080 | |||
| 3570 | Ga0495622_0041092 | |||
| 3571 | Ga0495622_0110653 | |||
| 3572 | Ga0495622_0192080 | |||
| 3573 | Ga0495622_0207613 | |||
| 3574 | Ga0495633_0006566 | |||
| 3575 | Ga0495633_0023121 | |||
| 3576 | Ga0495633_0025281 | |||
| 3577 | Ga0495633_0036777 | |||
| 3578 | Ga0495633_0062271 | |||
| 3579 | Ga0495633_0068032 | |||
| 3580 | Ga0495633_0097194 | |||
| 3581 | Ga0495633_0160994 | |||
| 3582 | Ga0495633_0171885 | |||
| 3583 | Ga0495633_0175653 | |||
| 3584 | Ga0495667_0043286 | |||
| 3585 | Ga0495667_0151288 | |||
| 3586 | Ga0495667_0555975 | |||
| 3587 | Ga0495656_0010416 | |||
| 3588 | Ga0495656_0081304 | |||
| 3589 | Ga0495656_0084934 | |||
| 3590 | Ga0495656_0099696 | |||
| 3591 | Ga0495656_0169174 | |||
| 3592 | Ga0495656_0267756 | |||
| 3593 | Ga0495668_0002640 | |||
| 3594 | Ga0495668_0005163 | |||
| 3595 | Ga0495668_0008733 | |||
| 3596 | Ga0495668_0011342 | |||
| 3597 | Ga0495668_0011816 | |||
| 3598 | Ga0495668_0018916 | |||
| 3599 | Ga0495668_0029452 | |||
| 3600 | Ga0495668_0051941 | |||
| 3601 | Ga0495668_0103355 | |||
| 3602 | Ga0495668_0120245 | |||
| 3603 | Ga0495668_0162205 | |||
| 3604 | Ga0495668_0311153 | |||
| 3605 | Ga0495668_0337344 | |||
| 3606 | Ga0495668_0395203 | |||
| 3607 | Ga0495634_0045859 | |||
| 3608 | Ga0495634_0121713 | |||
| 3609 | Ga0495634_0202784 | |||
| 3610 | Ga0495634_0211208 | |||
| 3611 | Ga0495611_0001662 | |||
| 3612 | Ga0495611_0002069 | |||
| 3613 | Ga0495611_0005909 | |||
| 3614 | Ga0495611_0011874 | |||
| 3615 | Ga0495611_0093136 | |||
| 3616 | Ga0495611_0182449 | |||
| 3617 | Ga0495611_0248659 | |||
| 3618 | Ga0495625_0011213 | |||
| 3619 | Ga0495625_0033151 | |||
| 3620 | Ga0495625_0034116 | |||
| 3621 | Ga0495625_0047734 | |||
| 3622 | Ga0495625_0087655 | |||
| 3623 | Ga0495625_0166164 | |||
| 3624 | Ga0495625_0167010 | |||
| 3625 | Ga0495625_0190370 | |||
| 3626 | Ga0495625_0199527 | |||
| 3627 | Ga0495625_0208462 | |||
| 3628 | Ga0495625_0265594 | |||
| 3629 | Ga0495635_0008977 | |||
| 3630 | Ga0495635_0078555 | |||
| 3631 | Ga0495635_0142420 | |||
| 3632 | Ga0495635_0200952 | |||
| 3633 | Ga0495659_0003686 | |||
| 3634 | Ga0495659_0004277 | |||
| 3635 | Ga0495659_0007839 | |||
| 3636 | Ga0495659_0025538 | |||
| 3637 | Ga0495659_0079281 | |||
| 3638 | Ga0495659_0093802 | |||
| 3639 | Ga0495659_0149661 | |||
| 3640 | Ga0495659_0558240 | |||
| 3641 | Ga0495661_0019060 | |||
| 3642 | Ga0495661_0022315 | |||
| 3643 | Ga0495661_0027641 | |||
| 3644 | Ga0495661_0036532 | |||
| 3645 | Ga0495661_0042541 | |||
| 3646 | Ga0495661_0062587 | |||
| 3647 | Ga0495661_0089042 | |||
| 3648 | Ga0495661_0119891 | |||
| 3649 | Ga0495661_0148229 | |||
| 3650 | Ga0495661_0188840 | |||
| 3651 | Ga0495661_0219532 | |||
| 3652 | Ga0495661_0293686 | |||
| 3653 | Ga0495661_0298181 | |||
| 3654 | Ga0495661_0421205 | |||
| 3655 | Ga0495588_0009027 | |||
| 3656 | Ga0495588_0011149 | |||
| 3657 | Ga0495588_0017870 | |||
| 3658 | Ga0495588_0018679 | |||
| 3659 | Ga0495588_0040525 | |||
| 3660 | Ga0495588_0046528 | |||
| 3661 | Ga0495588_0050054 | |||
| 3662 | Ga0495588_0230874 | |||
| 3663 | Ga0495657_0727578 | |||
| 3664 | Ga0495657_0736393 | |||
| 3665 | Ga0495599_0052585 | |||
| 3666 | Ga0495599_0060094 | |||
| 3667 | Ga0495599_0204471 | |||
| 3668 | Ga0495599_0222351 | |||
| 3669 | Ga0495623_0031929 | |||
| 3670 | Ga0495623_0100910 | |||
| 3671 | Ga0495623_0118836 | |||
| 3672 | Ga0495623_0154907 | |||
| 3673 | Ga0495623_0164039 | |||
| 3674 | Ga0495623_0164428 | |||
| 3675 | Ga0495623_0175824 | |||
| 3676 | Ga0495623_0178944 | |||
| 3677 | Ga0495646_0038676 | |||
| 3678 | Ga0495646_0043675 | |||
| 3679 | Ga0495646_0054683 | |||
| 3680 | Ga0495646_0076384 | |||
| 3681 | Ga0495646_0154791 | |||
| 3682 | Ga0495646_0158928 | |||
| 3683 | Ga0495646_0405134 | |||
| 3684 | Ga0495658_0114704 | |||
| 3685 | Ga0495658_0283936 | |||
| 3686 | Ga0495658_0289894 | |||
| 3687 | Ga0495658_0558190 | |||
| 3688 | Ga0495669_0001596 | |||
| 3689 | Ga0495669_0002717 | |||
| 3690 | Ga0495669_0031367 | |||
| 3691 | Ga0495669_0041852 | |||
| 3692 | Ga0495669_0086878 | |||
| 3693 | Ga0495669_0116277 | |||
| 3694 | Ga0495669_0350587 | |||
| 3695 | Ga0495613_0072609 | |||
| 3696 | Ga0495613_0082016 | |||
| 3697 | Ga0495613_0092389 | |||
| 3698 | Ga0495613_0130385 | |||
| 3699 | Ga0495613_0226145 | |||
| 3700 | Ga0495613_0566434 | |||
| 3701 | Ga0495624_0020482 | |||
| 3702 | Ga0495624_0039682 | |||
| 3703 | Ga0495624_0053509 | |||
| 3704 | Ga0495624_0069830 | |||
| 3705 | Ga0495624_0097562 | |||
| 3706 | Ga0495624_0149960 | |||
| 3707 | Ga0495624_0499649 | |||
| 3708 | Ga0495624_0599869 | |||
| 3709 | Ga0495670_0009867 | |||
| 3710 | Ga0495670_0028896 | |||
| 3711 | Ga0495670_0035188 | |||
| 3712 | Ga0495670_0067273 | |||
| 3713 | Ga0495670_0102977 | |||
| 3714 | Ga0495670_0119876 | |||
| 3715 | Ga0495670_0150687 | |||
| 3716 | Ga0495670_0166291 | |||
| 3717 | Ga0495670_0320214 | |||
| 3718 | Ga0495671_0000037 | |||
| 3719 | Ga0495671_0005005 | |||
| 3720 | Ga0495671_0012352 | |||
| 3721 | Ga0495671_0014262 | |||
| 3722 | Ga0495671_0387612 | |||
| 3723 | Ga0495671_0457852 | |||
| 3724 | Ga0495649_0007567 | |||
| 3725 | Ga0495649_0041099 | |||
| 3726 | Ga0495649_0055982 | |||
| 3727 | Ga0495649_0064779 | |||
| 3728 | Ga0495649_0088148 | |||
| 3729 | Ga0495649_0129516 | |||
| 3730 | Ga0495649_0136805 | |||
| 3731 | Ga0495649_0140298 | |||
| 3732 | Ga0495649_0152737 | |||
| 3733 | Ga0495649_0226406 | |||
| 3734 | Ga0495649_0246537 | |||
| 3735 | Ga0495589_0016595 | |||
| 3736 | Ga0495589_0021019 | |||
| 3737 | Ga0495589_0056788 | |||
| 3738 | Ga0495589_0063428 | |||
| 3739 | Ga0495589_0074703 | |||
| 3740 | Ga0495589_0140971 | |||
| 3741 | Ga0495589_0157145 | |||
| 3742 | Ga0495589_0232418 | |||
| 3743 | Ga0495589_0312150 | |||
| 3744 | Ga0495600_0004009 | |||
| 3745 | Ga0495600_0039828 | |||
| 3746 | Ga0495600_0178346 | |||
| 3747 | Ga0495600_0185571 | |||
| 3748 | Ga0495600_0198806 | |||
| 3749 | Ga0495600_0493571 | |||
| 3750 | Ga0495660_0010186 | |||
| 3751 | Ga0495660_0011018 | |||
| 3752 | Ga0495660_0012969 | |||
| 3753 | Ga0495660_0015683 | |||
| 3754 | Ga0495660_0034744 | |||
| 3755 | Ga0495660_0048108 | |||
| 3756 | Ga0495660_0051977 | |||
| 3757 | Ga0495660_0065924 | |||
| 3758 | Ga0495660_0084002 | |||
| 3759 | Ga0495660_0116780 | |||
| 3760 | Ga0495660_0119454 | |||
| 3761 | Ga0495660_0174053 | |||
| 3762 | Ga0495660_0208048 | |||
| 3763 | Ga0495660_0285985 | |||
| 3764 | Ga0495581_0003269 | |||
| 3765 | Ga0495581_0011615 | |||
| 3766 | Ga0495581_0027016 | |||
| 3767 | Ga0495581_0040802 | |||
| 3768 | Ga0495581_0078701 | |||
| 3769 | Ga0495581_0157473 | |||
| 3770 | Ga0495581_0176605 | |||
| 3771 | Ga0495604_0003421 | |||
| 3772 | Ga0495604_0010804 | |||
| 3773 | Ga0495604_0048599 | |||
| 3774 | Ga0495604_0096566 | |||
| 3775 | Ga0495604_0126319 | |||
| 3776 | Ga0495604_0290778 | |||
| 3777 | Ga0495604_0433131 | |||
| 3778 | Ga0495636_0001434 | |||
| 3779 | Ga0495636_0003890 | |||
| 3780 | Ga0495636_0006133 | |||
| 3781 | Ga0495636_0006316 | |||
| 3782 | Ga0495636_0018170 | |||
| 3783 | Ga0495636_0040864 | |||
| 3784 | Ga0495636_0106143 | |||
| 3785 | Ga0495636_0259312 | |||
| 3786 | Ga0495636_0337773 | |||
| 3787 | Ga0495674_0013576 | |||
| 3788 | Ga0495674_0022526 | |||
| 3789 | Ga0495674_0031660 | |||
| 3790 | Ga0495674_0046418 | |||
| 3791 | Ga0495674_0055008 | |||
| 3792 | Ga0495674_0102840 | |||
| 3793 | Ga0495674_0280785 | |||
| 3794 | Ga0495672_0000013 | |||
| 3795 | Ga0495672_0000157 | |||
| 3796 | Ga0495672_0007686 | |||
| 3797 | Ga0495672_0015499 | |||
| 3798 | Ga0495672_0029479 | |||
| 3799 | Ga0495672_0031965 | |||
| 3800 | Ga0495672_0033248 | |||
| 3801 | Ga0495672_0035691 | |||
| 3802 | Ga0495672_0045766 | |||
| 3803 | Ga0495672_0119798 | |||
| 3804 | Ga0495672_0161124 | |||
| 3805 | Ga0495672_0357737 | |||
| 3806 | Ga0495676_0010234 | |||
| 3807 | Ga0495676_0024323 | |||
| 3808 | Ga0495676_0026376 | |||
| 3809 | Ga0495676_0067455 | |||
| 3810 | Ga0495676_0077394 | |||
| 3811 | Ga0495676_0098301 | |||
| 3812 | Ga0495676_0113267 | |||
| 3813 | Ga0495676_0120830 | |||
| 3814 | Ga0495676_0275944 | |||
| 3815 | Ga0495680_0007818 | |||
| 3816 | Ga0495680_0074468 | |||
| 3817 | Ga0495680_0100796 | |||
| 3818 | Ga0495680_0134396 | |||
| 3819 | Ga0495680_0186233 | |||
| 3820 | Ga0495680_0232979 | |||
| 3821 | Ga0495680_0250054 | |||
| 3822 | Ga0495680_0404052 | |||
| 3823 | Ga0495680_1032052 | |||
| 3824 | Ga0495683_0001129 | |||
| 3825 | Ga0495683_0017957 | |||
| 3826 | Ga0495683_0022066 | |||
| 3827 | Ga0495683_0023372 | |||
| 3828 | Ga0495683_0032766 | |||
| 3829 | Ga0495683_0033028 | |||
| 3830 | Ga0495683_0044638 | |||
| 3831 | Ga0495683_0049847 | |||
| 3832 | Ga0495683_0059991 | |||
| 3833 | Ga0495683_0070031 | |||
| 3834 | Ga0495683_0093261 | |||
| 3835 | Ga0495683_0188735 | |||
| 3836 | Ga0495683_0275552 | |||
| 3837 | Ga0495687_000216 | |||
| 3838 | Ga0495687_000342 | |||
| 3839 | Ga0495687_001562 | |||
| 3840 | Ga0495687_002921 | |||
| 3841 | Ga0495687_007470 | |||
| 3842 | Ga0495687_013991 | |||
| 3843 | Ga0495687_027846 | |||
| 3844 | Ga0495687_062464 | |||
| 3845 | Ga0495687_084824 | |||
| 3846 | Ga0495687_095851 | |||
| 3847 | Ga0495687_171650 | |||
| 3848 | Ga0495675_0013567 | |||
| 3849 | Ga0495675_0021158 | |||
| 3850 | Ga0495675_0053131 | |||
| 3851 | Ga0495675_0072252 | |||
| 3852 | Ga0495675_0098979 | |||
| 3853 | Ga0495675_0191731 | |||
| 3854 | Ga0495677_0001866 | |||
| 3855 | Ga0495677_0005942 | |||
| 3856 | Ga0495677_0008079 | |||
| 3857 | Ga0495677_0009137 | |||
| 3858 | Ga0495677_0015597 | |||
| 3859 | Ga0495677_0044661 | |||
| 3860 | Ga0495677_0109477 | |||
| 3861 | Ga0495677_0176898 | |||
| 3862 | Ga0495677_0275635 | |||
| 3863 | Ga0495677_0289370 | |||
| 3864 | Ga0495679_008349 | |||
| 3865 | Ga0495679_012257 | |||
| 3866 | Ga0495679_017521 | |||
| 3867 | Ga0495679_017686 | |||
| 3868 | Ga0495679_023106 | |||
| 3869 | Ga0495679_041737 | |||
| 3870 | Ga0495685_000291 | |||
| 3871 | Ga0495685_001965 | |||
| 3872 | Ga0495685_014389 | |||
| 3873 | Ga0495685_019727 | |||
| 3874 | Ga0495685_034014 | |||
| 3875 | Ga0495685_071378 | |||
| 3876 | Ga0495685_079079 | |||
| 3877 | Ga0495685_108989 | |||
| 3878 | Ga0495685_138553 | |||
| 3879 | Ga0495673_0000248 | |||
| 3880 | Ga0495673_0019105 | |||
| 3881 | Ga0495673_0030733 | |||
| 3882 | Ga0495673_0067504 | |||
| 3883 | Ga0495673_0078261 | |||
| 3884 | Ga0495673_0132106 | |||
| 3885 | Ga0495673_0310455 | |||
| 3886 | Ga0495681_0009083 | |||
| 3887 | Ga0495681_0010756 | |||
| 3888 | Ga0495681_0011744 | |||
| 3889 | Ga0495681_0021475 | |||
| 3890 | Ga0495681_0043390 | |||
| 3891 | Ga0495681_0046827 | |||
| 3892 | Ga0495681_0086167 | |||
| 3893 | Ga0495681_0126902 | |||
| 3894 | Ga0495681_0249667 | |||
| 3895 | Ga0495681_0271015 | |||
| 3896 | Ga0495684_0068039 | |||
| 3897 | Ga0495686_0000214 | |||
| 3898 | Ga0495686_0000787 | |||
| 3899 | Ga0495686_0001126 | |||
| 3900 | Ga0495686_0007683 | |||
| 3901 | Ga0495686_0010875 | |||
| 3902 | Ga0495686_0057869 | |||
| 3903 | Ga0495686_0189431 | |||
| 3904 | Ga0495686_0290820 | |||
| 3905 | Ga0495686_0391768 | |||
| 3906 | Ga0495686_0458937 | |||
| 3907 | Ga0495686_0584168 | |||
| 3908 | Ga0495593_0002955 | |||
| 3909 | Ga0495593_0015413 | |||
| 3910 | Ga0495593_0018189 | |||
| 3911 | Ga0495593_0036990 | |||
| 3912 | Ga0495593_0185141 | |||
| 3913 | Ga0495593_0466381 | |||
| 3914 | Ga0495602_0036361 | |||
| 3915 | Ga0495602_0051607 | |||
| 3916 | Ga0495602_0075551 | |||
| 3917 | Ga0495602_0313649 | |||
| 3918 | Ga0495602_0783218 | |||
| 3919 | Ga0495614_0048811 | |||
| 3920 | Ga0495614_0048818 | |||
| 3921 | Ga0495614_0056437 | |||
| 3922 | Ga0495614_0320971 | |||
| 3923 | Ga0495615_0013648 | |||
| 3924 | Ga0495615_0100569 | |||
| 3925 | Ga0495626_0000227 | |||
| 3926 | Ga0495626_0010154 | |||
| 3927 | Ga0495626_0021350 | |||
| 3928 | Ga0495626_0022785 | |||
| 3929 | Ga0495626_0040841 | |||
| 3930 | Ga0495626_0044118 | |||
| 3931 | Ga0495626_0055982 | |||
| 3932 | Ga0495626_0060164 | |||
| 3933 | Ga0495626_0073481 | |||
| 3934 | Ga0495626_0073528 | |||
| 3935 | Ga0495626_0083647 | |||
| 3936 | Ga0495626_0084714 | |||
| 3937 | Ga0495626_0096000 | |||
| 3938 | Ga0495626_0097284 | |||
| 3939 | Ga0495626_0126416 | |||
| 3940 | Ga0495626_0202562 | |||
| 3941 | Ga0495626_0212790 | |||
| 3942 | Ga0495626_0290644 | |||
| 3943 | Ga0496100_0067106 | |||
| 3944 | Ga0496100_0111532 | |||
| 3945 | Ga0496100_0114800 | |||
| 3946 | Ga0496100_0275250 | |||
| 3947 | Ga0496100_0294264 | |||
| 3948 | Ga0496100_0641645 | |||
| 3949 | Ga0496101_0009727 | |||
| 3950 | Ga0496101_0046173 | |||
| 3951 | Ga0496101_0211964 | |||
| 3952 | Ga0496101_0560311 | |||
| 3953 | Ga0496101_0907796 | |||
| 3954 | Ga0496101_1140934 | |||
| 3955 | Ga0496102_0006537 | |||
| 3956 | Ga0496102_0039654 | |||
| 3957 | Ga0496102_0075112 | |||
| 3958 | Ga0496102_0092053 | |||
| 3959 | Ga0496102_0197397 | |||
| 3960 | Ga0496102_0214439 | |||
| 3961 | Ga0496102_0413289 | |||
| 3962 | Ga0496102_1758156 | |||
| 3963 | Ga0496103_0003318 | |||
| 3964 | Ga0496103_0017021 | |||
| 3965 | Ga0496103_0032288 | |||
| 3966 | Ga0496103_0038283 | |||
| 3967 | Ga0496103_0155309 | |||
| 3968 | Ga0496103_0210497 | |||
| 3969 | Ga0496103_0343097 | |||
| 3970 | Ga0496103_0426401 | |||
| 3971 | Ga0496104_0018044 | |||
| 3972 | Ga0496104_0336166 | |||
| 3973 | Ga0496104_0505298 | |||
| 3974 | Ga0496104_0651804 | |||
| 3975 | Ga0496104_0807072 | |||
| 3976 | Ga0496104_1163973 | |||
| 3977 | Ga0496105_0035800 | |||
| 3978 | Ga0496105_0223701 | |||
| 3979 | Ga0496105_0350800 | |||
| 3980 | Ga0496106_0006711 | |||
| 3981 | Ga0496106_0036102 | |||
| 3982 | Ga0496106_0042023 | |||
| 3983 | Ga0496106_0171980 | |||
| 3984 | Ga0496106_0691124 | |||
| 3985 | Ga0496107_0069085 | |||
| 3986 | Ga0496107_0088073 | |||
| 3987 | Ga0496107_0160774 | |||
| 3988 | Ga0496107_0222414 | |||
| 3989 | Ga0496107_0848596 | |||
| 3990 | Ga0496108_0409678 | |||
| 3991 | Ga0496108_1331530 | |||
| 3992 | Ga0496109_0042732 | |||
| 3993 | Ga0496109_0548480 | |||
| 3994 | Ga0496110_0032653 | |||
| 3995 | Ga0496110_0294723 | |||
| 3996 | Ga0496110_0456356 | |||
| 3997 | Ga0496110_0457031 | |||
| 3998 | Ga0496110_0794302 | |||
| 3999 | Ga0496110_1205357 | |||
| 4000 | Ga0496110_1261699 | |||
| 4001 | Ga0496111_0013924 | |||
| 4002 | Ga0496111_0408873 | |||
| 4003 | Ga0496111_0830563 | |||
| 4004 | Ga0496112_0014789 | |||
| 4005 | Ga0496112_0196015 | |||
| 4006 | Ga0496112_0529748 | |||
| 4007 | Ga0496113_0023586 | |||
| 4008 | Ga0496113_0027568 | |||
| 4009 | Ga0496113_0173984 | |||
| 4010 | Ga0496113_0274888 | |||
| 4011 | Ga0496113_0476254 | |||
| 4012 | Ga0496113_0757937 | |||
| 4013 | Ga0496114_0018505 | |||
| 4014 | Ga0496114_0091484 | |||
| 4015 | Ga0496114_0372797 | |||
| 4016 | Ga0496114_0845291 | |||
| 4017 | Ga0496115_0040092 | |||
| 4018 | Ga0496115_0062017 | |||
| 4019 | Ga0496115_0131007 | |||
| 4020 | Ga0496115_0131327 | |||
| 4021 | Ga0496115_0254757 | |||
| 4022 | Ga0496115_0376151 | |||
| 4023 | Ga0496115_0379901 | |||
| 4024 | Ga0496115_0431565 | |||
| 4025 | Ga0496115_0532444 | |||
| 4026 | Ga0496115_0572610 | |||
| 4027 | Ga0496115_0608123 | |||
| 4028 | Ga0496116_0006663 | |||
| 4029 | Ga0496116_0032654 | |||
| 4030 | Ga0496116_0054709 | |||
| 4031 | Ga0496116_0120515 | |||
| 4032 | Ga0496116_0122217 | |||
| 4033 | Ga0496116_0174618 | |||
| 4034 | Ga0496116_0226636 | |||
| 4035 | Ga0496116_0393203 | |||
| 4036 | Ga0496117_0002850 | |||
| 4037 | Ga0496117_0029031 | |||
| 4038 | Ga0496117_0104585 | |||
| 4039 | Ga0496118_0010366 | |||
| 4040 | Ga0496118_0027422 | |||
| 4041 | Ga0496118_0039741 | |||
| 4042 | Ga0496118_0100694 | |||
| 4043 | Ga0496118_0127248 | |||
| 4044 | Ga0496118_0201720 | |||
| 4045 | Ga0496118_0207405 | |||
| 4046 | Ga0496119_0006975 | |||
| 4047 | Ga0496119_0033005 | |||
| 4048 | Ga0496119_0151658 | |||
| 4049 | Ga0496119_0188727 | |||
| 4050 | Ga0496120_0152393 | |||
| 4051 | Ga0496120_0182412 | |||
| 4052 | Ga0496120_0264386 | |||
| 4053 | Ga0496121_0002928 | |||
| 4054 | Ga0496121_0015151 | |||
| 4055 | Ga0496121_0023493 | |||
| 4056 | Ga0496121_0031966 | |||
| 4057 | Ga0496121_0040564 | |||
| 4058 | Ga0496121_0060060 | |||
| 4059 | Ga0496121_0064627 | |||
| 4060 | Ga0496121_0233788 | |||
| 4061 | Ga0496121_0672503 | |||
| 4062 | Ga0496122_0002652 | |||
| 4063 | Ga0496122_0006384 | |||
| 4064 | Ga0496122_0045238 | |||
| 4065 | Ga0496122_0117785 | |||
| 4066 | Ga0496122_0241896 | |||
| 4067 | Ga0496123_0007601 | |||
| 4068 | Ga0496123_0011446 | |||
| 4069 | Ga0496123_0024316 | |||
| 4070 | Ga0496123_0031548 | |||
| 4071 | Ga0496123_0050572 | |||
| 4072 | Ga0496124_0035888 | |||
| 4073 | Ga0496124_0042938 | |||
| 4074 | Ga0496124_0052609 | |||
| 4075 | Ga0496124_0080875 | |||
| 4076 | Ga0496124_0083920 | |||
| 4077 | Ga0496124_0089738 | |||
| 4078 | Ga0496124_0235447 | |||
| 4079 | Ga0496124_0237303 | |||
| 4080 | Ga0496124_0317340 | |||
| 4081 | Ga0496124_0542713 | |||
| 4082 | Ga0496125_0001934 | |||
| 4083 | Ga0496125_0005068 | |||
| 4084 | Ga0496125_0134373 | |||
| 4085 | Ga0496125_0164527 | |||
| 4086 | Ga0496125_0177292 | |||
| 4087 | Ga0496125_0253014 | |||
| 4088 | Ga0496125_0412167 | |||
| 4089 | Ga0496126_0004622 | |||
| 4090 | Ga0496126_0005787 | |||
| 4091 | Ga0496126_0007973 | |||
| 4092 | Ga0496126_0031015 | |||
| 4093 | Ga0496126_0051319 | |||
| 4094 | Ga0496126_0090828 | |||
| 4095 | Ga0496126_0173352 | |||
| 4096 | Ga0496126_0763102 | |||
| 4097 | Ga0501306_000005 | |||
| 4098 | Ga0501306_000357 | |||
| 4099 | Ga0501306_000359 | |||
| 4100 | Ga0501306_002633 | |||
| 4101 | Ga0501306_006022 | |||
| 4102 | Ga0501306_051944 | |||
| 4103 | Ga0501306_104473 | |||
| 4104 | Ga0501308_000002 | |||
| 4105 | Ga0501308_000101 | |||
| 4106 | Ga0501308_001514 | |||
| 4107 | Ga0501308_005869 | |||
| 4108 | Ga0501309_000053 | |||
| 4109 | Ga0501309_000994 | |||
| 4110 | Ga0501309_008348 | |||
| 4111 | Ga0501309_018310 | |||
| 4112 | Ga0501310_000065 | |||
| 4113 | Ga0501310_000908 | |||
| 4114 | Ga0501310_001119 | |||
| 4115 | Ga0501310_001494 | |||
| 4116 | Ga0501310_005775 | |||
| 4117 | Ga0501310_006883 | |||
| 4118 | Ga0501343_001045 | |||
| 4119 | Ga0501343_003853 | |||
| 4120 | Ga0501304_000001 | |||
| 4121 | Ga0501304_000110 | |||
| 4122 | Ga0501305_000138 | |||
| 4123 | Ga0501305_001754 | |||
| 4124 | Ga0501305_002625 | |||
| 4125 | Ga0501307_000084 | |||
| 4126 | Ga0501307_000295 | |||
| 4127 | Ga0501307_000470 | |||
| 4128 | Ga0501307_000643 | |||
| 4129 | Ga0501307_008590 | |||
| 4130 | Ga0501307_027472 | |||
| 4131 | Ga0495678_000010 | |||
| 4132 | Ga0495678_006058 | |||
| 4133 | Ga0495678_006909 | |||
| 4134 | Ga0495678_008007 | |||
| 4135 | Ga0495678_016621 | |||
| 4136 | Ga0495678_016940 | |||
| 4137 | Ga0495678_021632 | |||
| 4138 | Ga0495678_031895 | |||
| 4139 | Ga0495678_052645 | |||
| 4140 | Ga0495678_058254 | |||
| 4141 | Ga0495678_093588 | |||
| 4142 | Ga0495678_172811 | |||
| 4143 | Ga0495678_187690 | |||
| 4144 | Ga0495682_0003087 | |||
| 4145 | Ga0495682_0003914 | |||
| 4146 | Ga0495682_0006686 | |||
| 4147 | Ga0495682_0015613 | |||
| 4148 | Ga0495682_0067593 | |||
| 4149 | Ga0495682_0128104 | |||
| 4150 | Ga0501292_002630 | |||
| 4151 | Ga0501298_064091 | |||
| 4152 | Ga0501303_013329 | |||
| 4153 | Ga0501311_000002 | |||
| 4154 | Ga0501311_002478 | |||
| 4155 | Ga0501311_024768 | |||
| 4156 | Ga0501312_000249 | |||
| 4157 | Ga0501312_004300 | |||
| 4158 | Ga0501312_006986 | |||
| 4159 | Ga0501312_009302 | |||
| 4160 | Ga0501313_000292 | |||
| 4161 | Ga0501313_000495 | |||
| 4162 | Ga0501313_000546 | |||
| 4163 | Ga0501313_031015 | |||
| 4164 | Ga0501314_001218 | |||
| 4165 | Ga0501314_002963 | |||
| 4166 | Ga0501314_015087 | |||
| 4167 | Ga0501315_000004 | |||
| 4168 | Ga0501315_000754 | |||
| 4169 | Ga0501315_003030 | |||
| 4170 | Ga0501315_005958 | |||
| 4171 | Ga0501315_012600 | |||
| 4172 | Ga0501315_045069 | |||
| 4173 | Ga0501315_051891 | |||
| 4174 | Ga0501316_000002 | |||
| 4175 | Ga0501316_001189 | |||
| 4176 | Ga0501316_001227 | |||
| 4177 | Ga0501316_026469 | |||
| 4178 | Ga0501317_000290 | |||
| 4179 | Ga0501317_002431 | |||
| 4180 | Ga0501317_007694 | |||
| 4181 | Ga0501318_000040 | |||
| 4182 | Ga0501318_001648 | |||
| 4183 | Ga0501319_000027 | |||
| 4184 | Ga0501319_025246 | |||
| 4185 | Ga0501320_001179 | |||
| 4186 | Ga0501320_001910 | |||
| 4187 | Ga0501320_003292 | |||
| 4188 | Ga0501320_009368 | |||
| 4189 | Ga0501321_001759 | |||
| 4190 | Ga0501321_005466 | |||
| 4191 | Ga0501321_005923 | |||
| 4192 | Ga0501322_010033 | |||
| 4193 | Ga0501322_012491 | |||
| 4194 | Ga0501323_000015 | |||
| 4195 | Ga0501323_000822 | |||
| 4196 | Ga0501323_001128 | |||
| 4197 | Ga0501323_002535 | |||
| 4198 | Ga0501323_006919 | |||
| 4199 | Ga0501323_012755 | |||
| 4200 | Ga0501323_017279 | |||
| 4201 | Ga0501324_015903 | |||
| 4202 | Ga0501324_021834 | |||
| 4203 | Ga0501325_005953 | |||
| 4204 | Ga0501326_05772 | |||
| 4205 | Ga0501327_00336 | |||
| 4206 | Ga0501330_000369 | |||
| 4207 | Ga0501334_11546 | |||
| 4208 | Ga0501335_003176 | |||
| 4209 | Ga0501335_022410 | |||
| 4210 | Ga0501336_000669 | |||
| 4211 | Ga0501336_001280 | |||
| 4212 | Ga0501337_000673 | |||
| 4213 | Ga0501337_024160 | |||
| 4214 | Ga0501340_003556 | |||
| 4215 | Ga0501032_0051651 | |||
| 4216 | Ga0501032_0244711 | |||
| 4217 | Ga0501033_0032115 | |||
| 4218 | Ga0501033_0187485 | |||
| 4219 | Ga0501034_0944157 | |||
| 4220 | Ga0501034_1182171 | |||
| 4221 | Ga0501036_0283908 | |||
| 4222 | Ga0501036_0375199 | |||
| 4223 | Ga0501037_0403748 | |||
| 4224 | Ga0501038_0184283 | |||
| 4225 | Ga0501038_0388532 | |||
| 4226 | Ga0501038_0681881 | |||
| 4227 | Ga0501043_0311069 | |||
| 4228 | Ga0501047_0017972 | |||
| 4229 | Ga0501047_0408279 | |||
| 4230 | Ga0501048_0110710 | |||
| 4231 | Ga0501207_010936 | |||
| 4232 | Ga0501210_004862 | |||
| 4233 | Ga0501211_006351 | |||
| 4234 | Ga0501217_133450 | |||
| 4235 | Ga0501222_005375 | |||
| 4236 | Ga0501230_002593 | |||
| 4237 | Ga0501233_077131 | |||
| 4238 | Ga0501238_000213 | |||
| 4239 | Ga0501249_002499 | |||
| 4240 | Ga0501257_034882 | |||
| 4241 | Ga0501221_018188 | |||
| 4242 | Ga0501263_018035 | |||
| 4243 | Ga0501269_000003 | |||
| 4244 | Ga0501279_001682 | |||
| 4245 | Ga0501279_019904 | |||
| 4246 | Ga0501035_0010452 | |||
| 4247 | Ga0501035_0010523 | |||
| 4248 | Ga0501035_0011202 | |||
| 4249 | Ga0501035_0314676 | |||
| 4250 | Ga0501044_0000210 | |||
| 4251 | Ga0501044_0024898 | |||
| 4252 | Ga0501044_0078211 | |||
| 4253 | Ga0501044_0358594 | |||
| 4254 | Ga0501044_0853919 | |||
| 4255 | Ga0501226_005181 | |||
| 4256 | nmdc:mga03683_216870_c1 | |||
| 4257 | nmdc:mga03n38_298936_c1 | |||
| 4258 | nmdc:mga03n38_4317_c1 | |||
| 4259 | nmdc:mga00v17_12098_c1 | |||
| 4260 | nmdc:mga00v17_184456_c1 | |||
| 4261 | nmdc:mga0k408_139838_c1 | |||
| 4262 | nmdc:mga0k408_43703_c1 | |||
| 4263 | nmdc:mga0k408_712_c1 | |||
| 4264 | nmdc:mga0k408_98510_c1 | |||
| 4265 | nmdc:mga06z11_1936_c1 | |||
| 4266 | nmdc:mga07m45_13904_c1 | |||
| 4267 | nmdc:mga07m45_45273_c1 | |||
| 4268 | nmdc:mga07m45_521668_c1 | |||
| 4269 | nmdc:mga07m45_6867_c1 | |||
| 4270 | nmdc:mga05p37_434571_c1 | |||
| 4271 | nmdc:mga05p37_750093_c1 | |||
| 4272 | nmdc:mga08y16_79438_c1 | |||
| 4273 | nmdc:mga0n895_56341_c1 | |||
| 4274 | nmdc:mga08x19_336538_c1 | |||
| 4275 | nmdc:mga0a205_171614_c1 | |||
| 4276 | nmdc:mga0sz30_439069_c1 | |||
| 4277 | Ga0495655_0104305 | |||
| 4278 | Ga0500644_0035969 | |||
| 4279 | Ga0500646_0009238 | |||
| 4280 | Ga0500641_0039435 | |||
| 4281 | Ga0500650_0075460 | |||
| 4282 | Ga0500555_069725 | |||
| 4283 | Ga0500618_003056 | |||
| 4284 | Ga0500628_002187 | |||
| 4285 | Ga0500655_002279 | |||
| 4286 | Ga0500559_0103340 | |||
| 4287 | Ga0500568_0055223 | |||
| 4288 | Ga0500573_0439913 | |||
| 4289 | Ga0500577_0289774 | |||
| 4290 | Ga0500586_017865 | |||
| 4291 | Ga0500600_0129045 | |||
| 4292 | Ga0500604_0000352 | |||
| 4293 | Ga0500616_0170867 | |||
| 4294 | Ga0500619_138164 | |||
| 4295 | Ga0500622_0000002 | |||
| 4296 | Ga0500622_0060471 | |||
| 4297 | Ga0500622_0103807 | |||
| 4298 | Ga0500645_035372 | |||
| 4299 | Ga0500645_191047 | |||
| 4300 | Ga0500565_012675 | |||
| 4301 | Ga0587084_000161 | |||
| 4302 | Ga0587084_001109 | |||
| 4303 | Ga0587084_002020 | |||
| 4304 | Ga0587084_098994 | |||
| 4305 | Ga0587093_081804 | |||
| 4306 | Ga0587066_000001 | |||
| 4307 | Ga0587070_000065 | |||
| 4308 | Ga0587070_075589 | |||
| 4309 | Ga0587070_092774 | |||
| 4310 | Ga0587073_0001671 | |||
| 4311 | Ga0587073_0129733 | |||
| 4312 | Ga0587077_001151 | |||
| 4313 | Ga0587077_020126 | |||
| 4314 | Ga0587080_002147 | |||
| 4315 | Ga0587080_077620 | |||
| 4316 | Ga0587082_000884 | |||
| 4317 | Ga0587083_0000094 | |||
| 4318 | Ga0587083_0000200 | |||
| 4319 | Ga0587083_0069435 | |||
| 4320 | Ga0587085_021468 | |||
| 4321 | Ga0587086_066732 | |||
| 4322 | Ga0587088_000001 | |||
| 4323 | Ga0587088_037690 | |||
| 4324 | Ga0587089_043032 | |||
| 4325 | Ga0587090_008198 | |||
| 4326 | Ga0587091_000335 | |||
| 4327 | Ga0587091_096258 | |||
| 4328 | Ga0587092_006055 | |||
| 4329 | Ga0587098_001373 | |||
| 4330 | Ga0587098_009967 | |||
| 4331 | Ga0587098_038216 | |||
| 4332 | Ga0587106_000819 | |||
| 4333 | Ga0587106_008375 | |||
| 4334 | Ga0587125_003092 | |||
| 4335 | Ga0587099_000096 | |||
| 4336 | Ga0587101_005751 | |||
| 4337 | Ga0587117_015850 | |||
| 4338 | Ga0587128_000098 | |||
| 4339 | Ga0587128_007622 | |||
| 4340 | Ga0587062_016401 | |||
| 4341 | Ga0587062_038847 | |||
| 4342 | Ga0587067_000303 | |||
| 4343 | Ga0587067_017051 | |||
| 4344 | Ga0587068_000002 | |||
| 4345 | Ga0587068_000145 | |||
| 4346 | Ga0587068_000228 | |||
| 4347 | Ga0587068_005731 | |||
| 4348 | Ga0587069_001414 | |||
| 4349 | Ga0587069_004834 | |||
| 4350 | Ga0587072_001765 | |||
| 4351 | Ga0587072_003430 | |||
| 4352 | Ga0587072_005754 | |||
| 4353 | Ga0587075_000434 | |||
| 4354 | Ga0587076_000914 | |||
| 4355 | Ga0587076_004751 | |||
| 4356 | Ga0587078_000693 | |||
| 4357 | Ga0587078_011692 | |||
| 4358 | Ga0587078_045061 | |||
| 4359 | Ga0587079_000913 | |||
| 4360 | Ga0587079_011093 | |||
| 4361 | Ga0587079_034989 | |||
| 4362 | Ga0587079_037199 | |||
| 4363 | Ga0587100_007975 | |||
| 4364 | Ga0587102_019683 | |||
| 4365 | Ga0587107_000137 | |||
| 4366 | Ga0587107_051316 | |||
| 4367 | Ga0587114_004063 | |||
| 4368 | Ga0587071_000116 | |||
| 4369 | Ga0587071_183420 | |||
| 4370 | Ga0587111_0000227 | |||
| 4371 | Ga0587111_0000229 | |||
| 4372 | Ga0587111_0002272 | |||
| 4373 | Ga0587111_0017972 | |||
| 4374 | Ga0466962_0001202 | |||
| 4375 | Ga0466962_0016232 | |||
| 4376 | Ga0466962_0029411 | |||
| 4377 | Ga0466962_0147138 | |||
| 4378 | Ga0466962_0464838 | |||
| 4379 | 2501074046 | |||
| 4380 | 2501084118 | |||
| 4381 | 2501414355 | |||
| 4382 | 2509132518 | |||
| 4383 | 2510252583 | |||
| 4384 | 2511093330 | |||
| 4385 | 2511099778 | |||
| 4386 | 2511102451 | |||
| 4387 | 2511245083 | |||
| 4388 | 2512348441 | |||
| 4389 | 2513556141 | |||
| 4390 | 2513564327 | |||
| 4391 | 2513962592 | |||
| 4392 | 2514050901 | |||
| 4393 | 2515684861 | |||
| 4394 | 2515690948 | |||
| 4395 | 2516022230 | |||
| 4396 | 2519457515 | |||
| 4397 | 2527080587 | |||
| 4398 | 2563061523 | |||
| 4399 | 2585294150 | |||
| 4400 | 2599741043 | |||
| 4401 | 2599748350 | |||
| 4402 | 2600210262 | |||
| 4403 | 2600813801 | |||
| 4404 | 2643792076 | |||
| 4405 | 2643799429 | |||
| 4406 | 2644123358 | |||
| 4407 | 2644216443 | |||
| 4408 | 2644254807 | |||
| 4409 | 2644360368 | |||
| 4410 | 2644471522 | |||
| 4411 | 2676745814 | |||
| 4412 | 2713478613 | |||
| 4413 | 2719641681 | |||
| 4414 | 2738738116 | |||
| 4415 | 2738824029 | |||
| 4416 | 2738826789 | |||
| 4417 | 2738836420 | |||
| 4418 | 2738843086 | |||
| 4419 | 2738877950 | |||
| 4420 | 2739150586 | |||
| 4421 | 2739189656 | |||
| 4422 | 2739192505 | |||
| 4423 | 2739224543 | |||
| 4424 | 2739273837 | |||
| 4425 | 2739318982 | |||
| 4426 | 2739337223 | |||
| 4427 | 2739342881 | |||
| 4428 | 2746087224 | |||
| 4429 | 2746093269 | |||
| 4430 | 2753566201 | |||
| 4431 | 2792837062 | |||
| 4432 | 2808972857 | |||
| 4433 | 2809007978 | |||
| 4434 | 2809015382 | |||
| 4435 | 2817259705 | |||
| 4436 | 2817277374 | |||
| 4437 | 2817453540 | |||
| 4438 | 2819624163 | |||
| 4439 | 2819636795 | |||
| 4440 | 2842332188 | |||
| 4441 | 2842356360 | |||
| 4442 | 2842461299 | |||
| 4443 | 2842712337 | |||
| 4444 | 2855735567 | |||
| 4445 | 2856289407 | |||
| 4446 | 2857362279 | |||
| 4447 | 2857556281 | |||
| 4448 | 2857560802 | |||
| 4449 | 2863426496 | |||
| 4450 | 2870069402 | |||
| 4451 | 2883091437 | |||
| 4452 | 2885272359 | |||
| 4453 | 2900637068 | |||
| 4454 | 2902686677 | |||
| 4455 | 2904428883 | |||
| 4456 | 2904438988 | |||
| 4457 | 2904490114 | |||
| 4458 | 2904569340 | |||
| 4459 | 2904576823 | |||
| 4460 | 2904624834 | |||
| 4461 | 2919476957 | |||
| 4462 | 2919533283 | |||
| 4463 | 2921651507 | |||
| 4464 | 2928114211 | |||
| 4465 | 2928141041 | |||
| 4466 | 2928163049 | |||
| 4467 | 2928170201 | |||
| 4468 | 2928176337 | |||
| 4469 | 2928509206 | |||
| 4470 | 2928542017 | |||
| 4471 | 2945934568 | |||
| 4472 | 2981996104 | |||
| 4473 | 2990704874 | |||
| 4474 | 642426538 | |||
| 4475 | 642417676 | |||
| 4476 | 642594616 | |||
| 4477 | 642623205 | |||
| 4478 | 8003956820 | |||
| 4479 | 8018847929 | |||
| 4480 | 8020813917 | |||
| 4481 | 8020939047 | |||
| 4482 | 8020947762 | |||
| 4483 | 8020953406 | |||
| 4484 | 8021127513 | |||
| 4485 | 8039099663 | |||
| 4486 | 8040171494 | |||
| 4487 | 8040174108 | |||
| 4488 | 8047676077 | |||
| 4489 | 8055269423 | |||
| 4490 | 8055307415 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4v5z-assembly1.cif.gz_Bo | structure of a mammalian 80s ribosome obtained by docking homology models of the rna and proteins into an 8.7 a cryo-em map | 0.8349 | 95 | 129 |
| 6hix-assembly1.cif.gz_AP | cryo-em structure of the trypanosoma brucei mitochondrial ribosome - this entry contains the large mitoribosomal subunit | 0.7791 | 61 | 129 |
| 1w2b-assembly1.cif.gz_N | trigger factor ribosome binding domain in complex with 50s | 0.7716 | 62 | 129 |
| 8c95-assembly1.cif.gz_L | cryo-em captures early ribosome assembly in action | 0.7482 | 40 | 131 |
| 4v48-assembly1.cif.gz_AJ | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.7312 | 62 | 130 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P02413_75_144_3.100.10.10 | Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; | 0.968 | 62 | 131 | 3.100.10.10 |
| af_P02413_75_144_3.100.10.10 | Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; | 0.9548 | 62 | 131 | 3.100.10.10 |
| af_Q6UUH5_140_226_3.100.10.10 | Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; | 0.8914 | 63 | 130 | 3.100.10.10 |
| 5v7qL01 | Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; | 0.8856 | 63 | 131 | 3.100.10.10 |
| 4qjsP01 | Alpha Beta;Ribosomal Protein L15; Chain: K; domain 2;Ribosomal Protein L15; Chain: K; domain 2; | 0.8841 | 63 | 129 | 3.100.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A661D962-F1-model_v4 | 50S ribosomal protein L15 | 0.9846 | 60 | 131 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A4Q3ZTU2-F1-model_v4 | deleted | 0.9813 | 60 | 130 |
|
| AF-A0A080LUN8-F1-model_v4 | 50S ribosomal protein L15 | 0.9711 | 56 | 131 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A1B5EQ26-F1-model_v4 | deleted | 0.9696 | 61 | 131 |
|
| AF-A7MPG9-F1-model_v4 | 50S ribosomal protein L15 | 0.9684 | 61 | 131 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |