F496598

General Info

Members Datasets Scaffolds Average Seq Length
2247 751 2117 66

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0728462|Ga0466961_0728462_244_471
Length 75
Sequence VRIEKPGVVVAQGTVKWFNAEKGYGFIAVDGGSDVFVHYSAIQMDGYKSLEEGQRVEFEVTQGQKGPQADAVRAV

Samples

Sample ID Description Type Environment
1 2527291627 Frankia casuarinae Thr Isolate Nodule
2 2527291629 Frankia sp. BMG5.23 Isolate Nodule
3 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
4 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
5 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
6 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
7 2576861822 Frankia sp. CeD Isolate Nodule
8 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
9 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
10 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
11 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
12 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
13 2619618881 Frankia sp. ACN1ag Isolate Unclassified
14 2619619003 Frankia sp. CpI1-P Isolate Nodule
15 2626541554 Frankia sp. AvcI.1 Isolate Nodule
16 2643221548 Streptomyces sp. Root55 Isolate Unclassified
17 2643221578 Streptomyces sp. Root63 Isolate Unclassified
18 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
19 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
20 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
21 2643221647 Streptomyces sp. Root369 Isolate Unclassified
22 2643221670 Streptomyces sp. Root431 Isolate Unclassified
23 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
24 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
25 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
26 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
27 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
28 2684623036 Frankia sp. CgIM4 Isolate Nodule
29 2710264753 Frankia sp. KB5 Isolate Nodule
30 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
31 2773857924 Frankia sp. CgIS1 Isolate Nodule
32 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
33 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
34 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
35 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
36 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
37 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
38 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
39 2808606448 Streptomyces sp. 193411 Isolate Unclassified
40 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
41 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
42 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
43 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
44 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
45 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
46 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
47 2847085930 Erwinia persicina B64 Isolate Bulb
48 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
49 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
50 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
51 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
52 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
53 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
54 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
55 2862574272 Streptomyces sp. AcE210 Isolate Nodule
56 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
57 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
58 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
59 2867369537 Streptomyces sp. Z26 Isolate Unclassified
60 2867428634 Streptomyces sp. RP5T Isolate Unclassified
61 2867475112 Streptomyces sp. TM32 Isolate Unclassified
62 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
63 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
64 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
65 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
66 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
67 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
68 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
69 2891562705 Microbispora tritici MT50 Isolate Unclassified
70 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
71 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
72 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
73 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
74 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
75 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
76 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
77 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
78 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
79 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
80 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
81 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
82 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
83 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
84 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
85 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
86 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
87 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
88 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
89 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
90 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
91 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
92 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
93 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
94 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
95 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
96 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
97 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
98 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
99 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
100 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
101 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
102 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
103 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
104 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
105 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
106 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
107 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
108 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
109 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
110 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
111 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
112 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
113 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
114 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
115 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
116 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
117 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
118 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
119 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
120 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
121 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
122 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
123 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
124 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
125 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
126 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
127 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
128 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
129 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
130 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
131 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
132 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
133 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
134 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
135 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
136 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
137 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
138 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
139 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
140 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
141 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
142 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
143 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
144 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
145 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
146 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
147 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
148 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
149 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
150 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
151 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
152 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
153 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
154 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
155 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
156 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
157 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
158 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
159 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
160 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
161 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
162 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
163 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
164 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
165 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
166 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
167 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
168 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
169 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
170 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
171 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
172 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
173 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
174 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
175 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
176 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
177 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
178 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
179 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
180 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
181 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
182 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
183 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
184 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
185 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
186 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
187 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
188 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
189 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
190 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
191 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
192 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
193 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
194 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
195 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
196 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
197 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
198 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
199 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
200 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
201 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
202 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
203 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
204 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
205 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
206 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
207 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
208 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
209 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
210 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
211 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
212 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
213 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
214 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
215 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
216 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
217 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
218 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
219 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
220 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
221 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
222 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
223 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
224 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
225 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
226 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
227 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
228 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
229 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
230 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
231 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
232 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
233 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
234 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
235 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
236 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
237 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
238 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
239 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
240 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
241 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
242 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
243 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
244 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
245 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
246 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
247 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
248 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
249 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
250 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
251 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
252 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
253 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
254 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
255 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
256 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
257 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
258 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
259 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
260 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
261 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
262 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
263 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
264 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
265 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
266 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
267 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
268 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
269 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
270 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
271 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
272 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
273 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
274 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
275 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
276 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
277 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
278 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
279 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
280 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
281 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
283 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
284 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
285 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
286 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
287 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
288 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
289 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
290 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
291 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
293 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
294 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
295 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
296 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
297 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300023680 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
299 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
300 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
301 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
302 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
303 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
304 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
305 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
306 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
307 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
308 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
309 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
378 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
382 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
383 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
384 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
385 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
386 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
387 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
388 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
389 3300029282 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 Metatranscriptome Rhizosphere
390 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
391 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
392 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
393 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300030889 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300031011 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
403 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
404 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
405 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
406 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
407 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
408 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
409 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
410 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
411 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
412 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
413 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
414 3300031615 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
415 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
416 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
417 3300031667 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
418 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
419 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
420 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
421 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
422 3300031810 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
423 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
424 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
425 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
426 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
427 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
428 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
429 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
430 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
431 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
432 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
433 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
434 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
435 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
436 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
437 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
438 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
439 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
440 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
441 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
442 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
443 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
444 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
445 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
446 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
447 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
448 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
449 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
450 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
451 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
452 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
453 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
454 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
455 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
456 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
457 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
458 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
459 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
460 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
461 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
462 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
463 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
464 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
465 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
466 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
467 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
468 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
469 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
470 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
472 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
473 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
474 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
475 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
476 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
477 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
478 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
479 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
480 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
481 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
482 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
483 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
484 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
485 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
486 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
487 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
488 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
489 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
490 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
491 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
492 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
493 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
494 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
495 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
496 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
497 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
498 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
499 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
500 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
501 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
502 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
503 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
504 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
505 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
506 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
507 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
508 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
509 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
510 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
511 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
512 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
513 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
514 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
515 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
516 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
517 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
518 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
519 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
520 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
521 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
522 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
523 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
524 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
525 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
526 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
527 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
528 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
529 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
530 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
531 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
532 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
533 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
534 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
535 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
536 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
537 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
538 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
539 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
540 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
541 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
542 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
543 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
544 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
545 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
546 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
547 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
548 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
549 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
550 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
551 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
552 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
553 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
554 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
555 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
556 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
557 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
558 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
559 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
560 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
561 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
562 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
563 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
564 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
565 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
566 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
567 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
568 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
569 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
570 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
571 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
572 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
573 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
574 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
575 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
576 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
577 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
578 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
579 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
580 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
581 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
582 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
583 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
584 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
585 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
586 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
587 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
588 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
589 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
590 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
591 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
592 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
593 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
594 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
595 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
596 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
597 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
598 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
599 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
600 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
601 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
602 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
603 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
604 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
605 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
606 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
607 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
608 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
609 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
610 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
611 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
612 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
613 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
614 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
615 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
616 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
617 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
618 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
619 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
620 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
621 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
622 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
623 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
624 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
625 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
626 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
627 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
628 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
629 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
630 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
631 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
632 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
633 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
634 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
635 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
636 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
637 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
638 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
639 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
640 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
641 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
642 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
643 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
644 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
645 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
646 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
647 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
648 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
649 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
650 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
651 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
652 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
653 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
654 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
655 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
656 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
657 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
658 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
659 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
660 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
661 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
662 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
663 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
664 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
665 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
666 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
667 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
668 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
669 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
670 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
671 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
672 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
673 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
674 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
675 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
676 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
677 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
678 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
679 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
680 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
681 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
682 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
683 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
684 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
685 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
686 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
687 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
688 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
689 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
690 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
691 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
692 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
693 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
694 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
695 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
696 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
697 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
698 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
699 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
700 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
701 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
702 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
703 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
704 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
705 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
706 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
707 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
708 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
709 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
710 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
711 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
712 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
713 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
714 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
715 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
716 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
717 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
718 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
719 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
720 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
721 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
722 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
723 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
724 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
725 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
726 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
727 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
728 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
729 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
730 637000116 Frankia casuarinae CcI3 Isolate Nodule
731 8007375930 Clostridium sp. YIM B02565 Isolate Unclassified
732 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
733 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
734 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
735 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
736 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
737 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
738 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
739 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
740 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
741 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
742 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
743 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
744 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
745 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
746 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
747 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
748 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
749 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
750 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
751 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.3
Metatranscriptomes 3.96
Isolates 5.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0.04
Endosphere 2.05
Nodule 0.58
Rhizoplane 3.78
Rhizosphere 88.07
Stem 0
Stem Tuber 0
Unclassified 5.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1068614 3300001915 Bacteria 525
2 JGI24752J21851_1053559 3300001976 Bacteria 550
3 JGI24747J21853_1048214 3300001978 Bacteria 515
4 JGI24740J21852_10144583 3300001979 Bacteria 591
5 JGI24743J22301_10063866 3300001991 Bacteria 761
6 JGI24745J21846_1054131 3300002073 Bacteria 512
7 JGI24033J26618_1075896 3300002155 Bacteria 510
8 JGI24751J29686_10011389 3300002459 Bacteria 1834
9 JGI25152J39213_1000431 3300002773 Bacteria 25240
10 Ga0006759J45824_1010939 3300003163 Bacteria 545
11 JGI25151J46595_10048603 3300003187 Bacteria 1464
12 rootH1_10054865 3300003316 Bacteria 1982
13 rootL2_10002354 3300003322 Bacteria 3195
14 rootH1_10077154 3300003323 Bacteria 1378
15 Ga0007417J51691_1031744 3300003544 Bacteria 541
16 Ga0007416J51690_1039243 3300003577 Bacteria 538
17 Ga0006562J51391_1013573 3300003578 Bacteria 2369
18 Ga0007429J51699_1029739 3300003579 Bacteria 514
19 JGI25404J52841_10004078 3300003659 Bacteria 2936
20 Ga0058859_11593662 3300004798 Bacteria 695
21 Ga0070658_10080675 3300005327 Bacteria 2672
22 Ga0070658_10109176 3300005327 Bacteria 2291
23 Ga0070658_10126206 3300005327 Bacteria 2130
24 Ga0070658_10384459 3300005327 Bacteria 1204
25 Ga0070658_10467407 3300005327 Bacteria 1088
26 Ga0070658_10489431 3300005327 Bacteria 1062
27 Ga0070658_10573142 3300005327 Bacteria 977
28 Ga0070658_11618769 3300005327 Bacteria 561
29 Ga0070676_10132525 3300005328 Bacteria 1578
30 Ga0070676_10199801 3300005328 Bacteria 1310
31 Ga0070683_100086548 3300005329 Bacteria 2938
32 Ga0070683_100236714 3300005329 Bacteria 1736
33 Ga0070683_100242651 3300005329 Bacteria 1714
34 Ga0070683_100319737 3300005329 Bacteria 1477
35 Ga0070683_100649829 3300005329 Bacteria 1010
36 Ga0070683_100769179 3300005329 Bacteria 923
37 Ga0070683_100933785 3300005329 Bacteria 832
38 Ga0070683_100993534 3300005329 Bacteria 806
39 Ga0070690_100074092 3300005330 Bacteria 2216
40 Ga0070690_100728694 3300005330 Bacteria 764
41 Ga0070670_100116948 3300005331 Bacteria 2299
42 Ga0070670_100304737 3300005331 Bacteria 1394
43 Ga0070670_100714487 3300005331 Bacteria 902
44 Ga0068869_100102951 3300005334 Bacteria 2162
45 Ga0068869_100415167 3300005334 Bacteria 1109
46 Ga0070666_10354187 3300005335 Bacteria 1051
47 Ga0070666_10956143 3300005335 Bacteria 634
48 Ga0070680_100046686 3300005336 Bacteria 3524
49 Ga0070680_100538264 3300005336 Bacteria 1000
50 Ga0070680_100606669 3300005336 Bacteria 939
51 Ga0070680_100610347 3300005336 Bacteria 936
52 Ga0070680_100698235 3300005336 Bacteria 873
53 Ga0070680_101025375 3300005336 Bacteria 713
54 Ga0070682_100156042 3300005337 Bacteria 1571
55 Ga0070682_100393943 3300005337 Bacteria 1045
56 Ga0070682_100538345 3300005337 Bacteria 912
57 Ga0068868_100047482 3300005338 Bacteria 3365
58 Ga0068868_100124661 3300005338 Bacteria 2103
59 Ga0068868_100147618 3300005338 Bacteria 1935
60 Ga0068868_100284076 3300005338 Bacteria 1401
61 Ga0068868_100542797 3300005338 Bacteria 1024
62 Ga0068868_100858346 3300005338 Bacteria 823
63 Ga0068868_102239428 3300005338 Bacteria 521
64 Ga0070660_100056154 3300005339 Bacteria 3045
65 Ga0070660_100205642 3300005339 Bacteria 1598
66 Ga0070660_100263905 3300005339 Bacteria 1406
67 Ga0070660_100354618 3300005339 Bacteria 1208
68 Ga0070660_100510441 3300005339 Bacteria 1000
69 Ga0070660_101554158 3300005339 Bacteria 563
70 Ga0070689_100023700 3300005340 Bacteria 4598
71 Ga0070689_100077283 3300005340 Bacteria 2608
72 Ga0070691_10011376 3300005341 Bacteria 4063
73 Ga0070691_10102607 3300005341 Bacteria 1422
74 Ga0070687_100030344 3300005343 Bacteria 2642
75 Ga0070687_100063632 3300005343 Bacteria 1957
76 Ga0070661_100021766 3300005344 Bacteria 4585
77 Ga0070661_100124775 3300005344 Bacteria 1931
78 Ga0070661_100334839 3300005344 Bacteria 1184
79 Ga0070661_101843976 3300005344 Bacteria 514
80 Ga0070692_10041379 3300005345 Bacteria 2360
81 Ga0070692_10055692 3300005345 Bacteria 2068
82 Ga0070692_10254029 3300005345 Bacteria 1053
83 Ga0070692_11110272 3300005345 Bacteria 559
84 Ga0070692_11233403 3300005345 Bacteria 534
85 Ga0070668_100125509 3300005347 Bacteria 2055
86 Ga0070668_101289281 3300005347 Bacteria 664
87 Ga0070669_100198950 3300005353 Bacteria 1576
88 Ga0070669_100614344 3300005353 Bacteria 912
89 Ga0070675_100014849 3300005354 Bacteria 6147
90 Ga0070675_100412316 3300005354 Bacteria 1207
91 Ga0070671_100079033 3300005355 Bacteria 2749
92 Ga0070671_100093054 3300005355 Bacteria 2526
93 Ga0070671_100984026 3300005355 Bacteria 739
94 Ga0070671_101505015 3300005355 Bacteria 596
95 Ga0070674_100106617 3300005356 Bacteria 2051
96 Ga0070674_100420697 3300005356 Bacteria 1096
97 Ga0070674_100474125 3300005356 Bacteria 1037
98 Ga0070674_100928262 3300005356 Bacteria 760
99 Ga0070673_100104251 3300005364 Bacteria 2341
100 Ga0070673_100154142 3300005364 Bacteria 1948
101 Ga0070673_100870359 3300005364 Bacteria 834
102 Ga0070673_102250448 3300005364 Bacteria 518
103 Ga0070688_100871259 3300005365 Bacteria 709
104 Ga0070659_100122200 3300005366 Bacteria 2110
105 Ga0070659_100498801 3300005366 Bacteria 1037
106 Ga0070659_102159688 3300005366 Bacteria 501
107 Ga0070667_100120475 3300005367 Bacteria 2282
108 Ga0070667_100600987 3300005367 Bacteria 1014
109 Ga0070667_101238485 3300005367 Bacteria 699
110 Ga0070667_101365278 3300005367 Bacteria 664
111 Ga0070667_101456044 3300005367 Bacteria 643
112 Ga0070703_10180095 3300005406 Bacteria 815
113 Ga0070709_10001280 3300005434 Bacteria 13735
114 Ga0070709_10006908 3300005434 Bacteria 6195
115 Ga0070709_10063516 3300005434 Bacteria 2359
116 Ga0070709_10087255 3300005434 Bacteria 2050
117 Ga0070709_10174334 3300005434 Bacteria 1505
118 Ga0070709_10202510 3300005434 Bacteria 1406
119 Ga0070709_10778168 3300005434 Bacteria 749
120 Ga0070714_100001940 3300005435 Bacteria 15105
121 Ga0070714_100034995 3300005435 Bacteria 4207
122 Ga0070714_100037342 3300005435 Bacteria 4081
123 Ga0070714_100095332 3300005435 Bacteria 2613
124 Ga0070714_100377177 3300005435 Bacteria 1336
125 Ga0070714_100988991 3300005435 Bacteria 818
126 Ga0070714_101171864 3300005435 Bacteria 749
127 Ga0070714_101177506 3300005435 Bacteria 747
128 Ga0070714_101715283 3300005435 Bacteria 613
129 Ga0070713_100004434 3300005436 Bacteria 9431
130 Ga0070713_100012635 3300005436 Bacteria 6204
131 Ga0070713_100013221 3300005436 Bacteria 6085
132 Ga0070713_100049348 3300005436 Bacteria 3472
133 Ga0070713_100088315 3300005436 Bacteria 2660
134 Ga0070713_100147071 3300005436 Bacteria 2092
135 Ga0070713_100649696 3300005436 Bacteria 1004
136 Ga0070713_100841886 3300005436 Bacteria 880
137 Ga0070713_100898909 3300005436 Bacteria 852
138 Ga0070713_101061230 3300005436 Bacteria 782
139 Ga0070713_101255139 3300005436 Bacteria 718
140 Ga0070713_101653296 3300005436 Bacteria 622
141 Ga0070713_101710907 3300005436 Bacteria 610
142 Ga0070713_102016839 3300005436 Bacteria 560
143 Ga0070710_10001003 3300005437 Bacteria 13427
144 Ga0070710_10023246 3300005437 Bacteria 3255
145 Ga0070710_10040445 3300005437 Bacteria 2570
146 Ga0070710_10092801 3300005437 Bacteria 1784
147 Ga0070710_10788568 3300005437 Bacteria 678
148 Ga0070701_10002382 3300005438 Bacteria 7225
149 Ga0070701_10017082 3300005438 Bacteria 3387
150 Ga0070701_10383669 3300005438 Bacteria 886
151 Ga0070711_100002980 3300005439 Bacteria 9778
152 Ga0070711_100012494 3300005439 Bacteria 5308
153 Ga0070711_100032246 3300005439 Bacteria 3482
154 Ga0070711_100047988 3300005439 Bacteria 2917
155 Ga0070711_100305332 3300005439 Bacteria 1267
156 Ga0070711_100360005 3300005439 Bacteria 1172
157 Ga0070711_100463276 3300005439 Bacteria 1039
158 Ga0070711_100914197 3300005439 Bacteria 749
159 Ga0070711_100989946 3300005439 Bacteria 721
160 Ga0070705_100117944 3300005440 Bacteria 1708
161 Ga0070705_100253250 3300005440 Bacteria 1237
162 Ga0070705_100676564 3300005440 Bacteria 808
163 Ga0070700_100084167 3300005441 Bacteria 2061
164 Ga0070700_100126695 3300005441 Bacteria 1718
165 Ga0070694_100159574 3300005444 Bacteria 1653
166 Ga0070694_101185010 3300005444 Bacteria 640
167 Ga0070708_100025343 3300005445 Bacteria 5069
168 Ga0070708_100224558 3300005445 Bacteria 1762
169 Ga0070708_100530524 3300005445 Bacteria 1110
170 Ga0070708_101258753 3300005445 Bacteria 691
171 Ga0070663_100054987 3300005455 Bacteria 2847
172 Ga0070663_100188437 3300005455 Bacteria 1604
173 Ga0070663_100257789 3300005455 Bacteria 1382
174 Ga0070663_100496541 3300005455 Bacteria 1013
175 Ga0070663_100524603 3300005455 Bacteria 986
176 Ga0070663_101374622 3300005455 Bacteria 625
177 Ga0070678_100001635 3300005456 Bacteria 11996
178 Ga0070678_100096431 3300005456 Bacteria 2281
179 Ga0070678_100977622 3300005456 Bacteria 777
180 Ga0070678_101473509 3300005456 Bacteria 637
181 Ga0070662_100222732 3300005457 Bacteria 1506
182 Ga0070662_101195085 3300005457 Bacteria 654
183 Ga0070662_101293285 3300005457 Bacteria 628
184 Ga0070681_10010877 3300005458 Bacteria 8995
185 Ga0070681_10108042 3300005458 Bacteria 2723
186 Ga0070681_10137321 3300005458 Bacteria 2375
187 Ga0070681_10196105 3300005458 Bacteria 1938
188 Ga0070681_10337063 3300005458 Bacteria 1417
189 Ga0070681_10553769 3300005458 Bacteria 1064
190 Ga0070681_11172480 3300005458 Bacteria 690
191 Ga0070681_11596470 3300005458 Bacteria 578
192 Ga0068867_100319689 3300005459 Bacteria 1285
193 Ga0068867_100732792 3300005459 Bacteria 875
194 Ga0068867_101855960 3300005459 Bacteria 568
195 Ga0070685_10035130 3300005466 Bacteria 2827
196 Ga0070706_100003283 3300005467 Bacteria 15999
197 Ga0070706_100057923 3300005467 Bacteria 3575
198 Ga0070706_100068689 3300005467 Bacteria 3277
199 Ga0070706_100122297 3300005467 Bacteria 2426
200 Ga0070706_100149776 3300005467 Bacteria 2178
201 Ga0070706_100176547 3300005467 Bacteria 1994
202 Ga0070706_100535921 3300005467 Bacteria 1089
203 Ga0070707_100000759 3300005468 Bacteria 31807
204 Ga0070707_100038811 3300005468 Bacteria 4549
205 Ga0070707_100365192 3300005468 Bacteria 1402
206 Ga0070707_100508407 3300005468 Bacteria 1166
207 Ga0070707_100591905 3300005468 Bacteria 1071
208 Ga0070698_100001019 3300005471 Bacteria 30816
209 Ga0070698_100002343 3300005471 Bacteria 20941
210 Ga0070698_100015778 3300005471 Bacteria 7979
211 Ga0070698_100061092 3300005471 Bacteria 3801
212 Ga0070698_100080895 3300005471 Bacteria 3243
213 Ga0070698_100120956 3300005471 Bacteria 2578
214 Ga0070698_100322503 3300005471 Bacteria 1475
215 Ga0070698_101133924 3300005471 Bacteria 731
216 Ga0070699_100145669 3300005518 Bacteria 2092
217 Ga0070679_100010387 3300005530 Bacteria 8830
218 Ga0070679_100025712 3300005530 Bacteria 5777
219 Ga0070679_100106370 3300005530 Bacteria 2791
220 Ga0070679_100271602 3300005530 Bacteria 1649
221 Ga0070679_100298098 3300005530 Bacteria 1563
222 Ga0070679_100345874 3300005530 Bacteria 1435
223 Ga0070679_101406517 3300005530 Bacteria 644
224 Ga0070684_100206692 3300005535 Bacteria 1789
225 Ga0070684_100212168 3300005535 Bacteria 1764
226 Ga0070684_100312069 3300005535 Bacteria 1444
227 Ga0070684_100443196 3300005535 Bacteria 1200
228 Ga0070684_100584887 3300005535 Bacteria 1037
229 Ga0070684_100729378 3300005535 Bacteria 924
230 Ga0070684_100984099 3300005535 Bacteria 791
231 Ga0070697_100004357 3300005536 Bacteria 10859
232 Ga0070697_100010938 3300005536 Bacteria 7089
233 Ga0070697_100190470 3300005536 Bacteria 1741
234 Ga0070697_100608698 3300005536 Bacteria 961
235 Ga0070697_101160348 3300005536 Bacteria 688
236 Ga0068853_100325991 3300005539 Bacteria 1424
237 Ga0068853_100600049 3300005539 Bacteria 1045
238 Ga0070672_100025168 3300005543 Bacteria 4411
239 Ga0070672_100264280 3300005543 Bacteria 1452
240 Ga0070672_100491634 3300005543 Bacteria 1060
241 Ga0070672_100668898 3300005543 Bacteria 908
242 Ga0070686_100908941 3300005544 Bacteria 717
243 Ga0070695_100050897 3300005545 Bacteria 2656
244 Ga0070695_100342472 3300005545 Bacteria 1118
245 Ga0070695_101709408 3300005545 Bacteria 527
246 Ga0070696_100060268 3300005546 Bacteria 2654
247 Ga0070696_100177283 3300005546 Bacteria 1579
248 Ga0070696_101169569 3300005546 Bacteria 649
249 Ga0070696_101407026 3300005546 Bacteria 595
250 Ga0070696_101819046 3300005546 Bacteria 527
251 Ga0070693_100005092 3300005547 Bacteria 6280
252 Ga0070693_100598680 3300005547 Bacteria 795
253 Ga0070693_101049708 3300005547 Bacteria 619
254 Ga0070665_100030159 3300005548 Bacteria 5457
255 Ga0070665_100260984 3300005548 Bacteria 1734
256 Ga0070665_100396212 3300005548 Bacteria 1388
257 Ga0070665_100447186 3300005548 Bacteria 1302
258 Ga0070704_100265991 3300005549 Bacteria 1414
259 Ga0070704_100874040 3300005549 Bacteria 807
260 Ga0070704_101940956 3300005549 Bacteria 546
261 Ga0068855_100121025 3300005563 Bacteria 2996
262 Ga0068855_100158059 3300005563 Bacteria 2574
263 Ga0068855_100678137 3300005563 Bacteria 1105
264 Ga0068855_100919154 3300005563 Bacteria 923
265 Ga0068855_101817696 3300005563 Bacteria 619
266 Ga0068855_102212485 3300005563 Bacteria 552
267 Ga0070664_100074926 3300005564 Bacteria 2905
268 Ga0070664_101325913 3300005564 Bacteria 680
269 Ga0070664_101414514 3300005564 Bacteria 658
270 Ga0070664_101589521 3300005564 Bacteria 619
271 Ga0068857_100272546 3300005577 Bacteria 1555
272 Ga0068857_100609823 3300005577 Bacteria 1032
273 Ga0068857_100728433 3300005577 Bacteria 943
274 Ga0068857_101054175 3300005577 Bacteria 784
275 Ga0068857_101174897 3300005577 Bacteria 742
276 Ga0068857_101876973 3300005577 Bacteria 587
277 Ga0068854_100056428 3300005578 Bacteria 2830
278 Ga0068854_100393090 3300005578 Bacteria 1145
279 Ga0068854_101826830 3300005578 Bacteria 557
280 Ga0068856_100105265 3300005614 Bacteria 2815
281 Ga0068856_101059653 3300005614 Bacteria 828
282 Ga0068856_101851418 3300005614 Bacteria 615
283 Ga0070702_100068800 3300005615 Bacteria 2084
284 Ga0070702_100213681 3300005615 Bacteria 1285
285 Ga0068852_100000497 3300005616 Bacteria 25765
286 Ga0068852_100075312 3300005616 Bacteria 2977
287 Ga0068852_100096999 3300005616 Bacteria 2651
288 Ga0068852_100340080 3300005616 Bacteria 1462
289 Ga0068852_100602885 3300005616 Bacteria 1103
290 Ga0068852_102172148 3300005616 Bacteria 577
291 Ga0068859_100246961 3300005617 Bacteria 1874
292 Ga0068859_100273218 3300005617 Bacteria 1782
293 Ga0068859_100889388 3300005617 Bacteria 976
294 Ga0068859_101870180 3300005617 Bacteria 663
295 Ga0068864_100003244 3300005618 Bacteria 13439
296 Ga0068864_100127348 3300005618 Bacteria 2283
297 Ga0068864_101623856 3300005618 Bacteria 651
298 Ga0068864_101662577 3300005618 Bacteria 643
299 Ga0068864_101764136 3300005618 Bacteria 624
300 Ga0068866_10032583 3300005718 Bacteria 2521
301 Ga0068866_10386663 3300005718 Bacteria 899
302 Ga0068861_100358099 3300005719 Bacteria 1282
303 Ga0068851_10081316 3300005834 Bacteria 1692
304 Ga0068851_10356563 3300005834 Bacteria 852
305 Ga0068870_10021137 3300005840 Bacteria 3179
306 Ga0068870_10563046 3300005840 Bacteria 769
307 Ga0068870_10732648 3300005840 Bacteria 685
308 Ga0068870_10906967 3300005840 Bacteria 623
309 Ga0068863_100003332 3300005841 Bacteria 15867
310 Ga0068863_100519231 3300005841 Bacteria 1174
311 Ga0068863_100565331 3300005841 Bacteria 1124
312 Ga0068863_100819907 3300005841 Bacteria 928
313 Ga0068858_100214839 3300005842 Bacteria 1820
314 Ga0068858_100246158 3300005842 Bacteria 1697
315 Ga0068858_100398373 3300005842 Bacteria 1322
316 Ga0068858_100422857 3300005842 Bacteria 1281
317 Ga0068858_100748928 3300005842 Bacteria 952
318 Ga0068860_100371807 3300005843 Bacteria 1410
319 Ga0068860_101451373 3300005843 Bacteria 707
320 Ga0068860_102725001 3300005843 Bacteria 513
321 Ga0068862_100020590 3300005844 Bacteria 5509
322 Ga0081455_10181061 3300005937 Bacteria 1595
323 Ga0081538_10035881 3300005981 Bacteria 3248
324 Ga0081540_1000193 3300005983 Bacteria 63248
325 Ga0081540_1000355 3300005983 Bacteria 46352
326 Ga0081540_1078394 3300005983 Bacteria 1498
327 Ga0081539_10389280 3300005985 Bacteria 581
328 Ga0070717_10017503 3300006028 Bacteria 5578
329 Ga0070717_10107833 3300006028 Bacteria 2372
330 Ga0070717_10156341 3300006028 Bacteria 1976
331 Ga0070717_10303179 3300006028 Bacteria 1420
332 Ga0070717_10314830 3300006028 Bacteria 1393
333 Ga0070717_10403326 3300006028 Bacteria 1228
334 Ga0070717_10608322 3300006028 Bacteria 991
335 Ga0070717_10761132 3300006028 Bacteria 880
336 Ga0070717_10812605 3300006028 Bacteria 851
337 Ga0070717_11141430 3300006028 Bacteria 709
338 Ga0070717_11528065 3300006028 Bacteria 605
339 Ga0070717_11741542 3300006028 Bacteria 563
340 Ga0075363_100138181 3300006048 Bacteria 1370
341 Ga0075363_100647093 3300006048 Bacteria 636
342 Ga0075432_10260394 3300006058 Bacteria 707
343 Ga0070715_10018614 3300006163 Bacteria 2650
344 Ga0070715_10083546 3300006163 Bacteria 1454
345 Ga0070715_10131122 3300006163 Bacteria 1206
346 Ga0070716_100003676 3300006173 Bacteria 7258
347 Ga0070716_100013747 3300006173 Bacteria 4133
348 Ga0070716_100018980 3300006173 Bacteria 3589
349 Ga0070716_100149237 3300006173 Bacteria 1501
350 Ga0070716_100575500 3300006173 Bacteria 843
351 Ga0070712_100001764 3300006175 Bacteria 13234
352 Ga0070712_100220805 3300006175 Bacteria 1500
353 Ga0070712_100330101 3300006175 Bacteria 1242
354 Ga0070712_100396209 3300006175 Bacteria 1139
355 Ga0070712_100808737 3300006175 Bacteria 804
356 Ga0070712_101487354 3300006175 Bacteria 592
357 Ga0070712_101693509 3300006175 Bacteria 553
358 Ga0097621_100028657 3300006237 Bacteria 4390
359 Ga0097621_100138272 3300006237 Bacteria 2079
360 Ga0097621_100467346 3300006237 Bacteria 1138
361 Ga0068871_100116304 3300006358 Bacteria 2254
362 Ga0068871_100192461 3300006358 Bacteria 1758
363 Ga0068871_100934828 3300006358 Bacteria 805
364 Ga0075428_100116954 3300006844 Bacteria 2904
365 Ga0075428_100248314 3300006844 Bacteria 1918
366 Ga0075428_100875814 3300006844 Bacteria 953
367 Ga0075433_10004667 3300006852 Bacteria 10683
368 Ga0075433_10058534 3300006852 Bacteria 3370
369 Ga0075433_10212584 3300006852 Bacteria 1718
370 Ga0075433_10302864 3300006852 Bacteria 1415
371 Ga0075433_10487249 3300006852 Bacteria 1086
372 Ga0075434_100004126 3300006871 Bacteria 13026
373 Ga0075434_100121257 3300006871 Bacteria 2630
374 Ga0075434_100295990 3300006871 Bacteria 1638
375 Ga0075434_100381904 3300006871 Bacteria 1429
376 Ga0075434_100509932 3300006871 Bacteria 1223
377 Ga0075429_100032855 3300006880 Bacteria 4509
378 Ga0075429_100995142 3300006880 Bacteria 733
379 Ga0068865_100197174 3300006881 Bacteria 1561
380 Ga0068865_100223398 3300006881 Bacteria 1473
381 Ga0068865_100226394 3300006881 Bacteria 1465
382 Ga0075436_100005351 3300006914 Bacteria 8832
383 Ga0075436_100130030 3300006914 Bacteria 1765
384 Ga0075436_100214031 3300006914 Bacteria 1366
385 Ga0075436_100370472 3300006914 Bacteria 1034
386 Ga0097620_100246968 3300006931 Bacteria 1874
387 Ga0097620_100273204 3300006931 Bacteria 1782
388 Ga0097620_100889376 3300006931 Bacteria 976
389 Ga0097620_101869838 3300006931 Bacteria 663
390 Ga0099826_10129515 3300006948 Bacteria 1473
391 Ga0075435_100008998 3300007076 Bacteria 7203
392 Ga0075435_100137120 3300007076 Bacteria 2050
393 Ga0075435_100184646 3300007076 Bacteria 1763
394 Ga0075435_100853002 3300007076 Bacteria 794
395 Ga0075435_101056291 3300007076 Bacteria 710
396 Ga0099794_10376727 3300007265 Bacteria 740
397 Ga0099794_10501751 3300007265 Bacteria 639
398 Ga0099795_10015129 3300007788 Bacteria 2409
399 Ga0099795_10346424 3300007788 Bacteria 664
400 Ga0105251_10009748 3300009011 Bacteria 5639
401 Ga0105251_10038963 3300009011 Bacteria 2324
402 Ga0105244_10227262 3300009036 Bacteria 874
403 Ga0105244_10254694 3300009036 Bacteria 818
404 Ga0105244_10362605 3300009036 Bacteria 668
405 Ga0105250_10114222 3300009092 Bacteria 1107
406 Ga0105250_10351630 3300009092 Bacteria 645
407 Ga0105250_10417671 3300009092 Bacteria 597
408 Ga0105240_10535477 3300009093 Bacteria 1298
409 Ga0105240_10639032 3300009093 Bacteria 1168
410 Ga0105240_10733600 3300009093 Bacteria 1075
411 Ga0105240_11127334 3300009093 Bacteria 834
412 Ga0111539_10088965 3300009094 Bacteria 3628
413 Ga0111539_10189764 3300009094 Bacteria 2398
414 Ga0111539_13273931 3300009094 Bacteria 522
415 Ga0105245_10001105 3300009098 Bacteria 24416
416 Ga0105245_10103611 3300009098 Bacteria 2637
417 Ga0105245_10251416 3300009098 Bacteria 1717
418 Ga0105245_10423434 3300009098 Bacteria 1335
419 Ga0105245_10443110 3300009098 Bacteria 1306
420 Ga0105245_10541536 3300009098 Bacteria 1185
421 Ga0105245_10784209 3300009098 Bacteria 990
422 Ga0105245_11488914 3300009098 Bacteria 728
423 Ga0105245_11818852 3300009098 Bacteria 662
424 Ga0105245_12683201 3300009098 Bacteria 551
425 Ga0105247_10000156 3300009101 Bacteria 67016
426 Ga0105247_10004622 3300009101 Bacteria 8774
427 Ga0105247_10212950 3300009101 Bacteria 1304
428 Ga0105247_10448552 3300009101 Bacteria 930
429 Ga0105247_10674909 3300009101 Bacteria 775
430 Ga0105247_10716612 3300009101 Bacteria 755
431 Ga0114129_10003727 3300009147 Bacteria 21488
432 Ga0114129_10176253 3300009147 Unclassified 2912
433 Ga0114129_10672238 3300009147 Bacteria 1334
434 Ga0114129_10818495 3300009147 Unclassified 1187
435 Ga0114129_10905906 3300009147 Bacteria 1117
436 Ga0114129_11140280 3300009147 Bacteria 974
437 Ga0114129_11520112 3300009147 Bacteria 822
438 Ga0114129_13415871 3300009147 Bacteria 510
439 Ga0105243_10011592 3300009148 Bacteria 6669
440 Ga0105243_10081732 3300009148 Bacteria 2639
441 Ga0105243_10132867 3300009148 Bacteria 2114
442 Ga0105243_10329695 3300009148 Bacteria 1394
443 Ga0105243_10641639 3300009148 Bacteria 1028
444 Ga0105243_11886270 3300009148 Bacteria 630
445 Ga0105241_10131584 3300009174 Bacteria 2026
446 Ga0105241_10185322 3300009174 Bacteria 1729
447 Ga0105241_10687614 3300009174 Bacteria 933
448 Ga0105241_10793881 3300009174 Bacteria 872
449 Ga0105241_10989007 3300009174 Bacteria 786
450 Ga0105242_10103963 3300009176 Bacteria 2410
451 Ga0105242_10222383 3300009176 Bacteria 1688
452 Ga0105242_10410322 3300009176 Bacteria 1266
453 Ga0105242_11683134 3300009176 Bacteria 670
454 Ga0105242_12045705 3300009176 Bacteria 616
455 Ga0105242_12307653 3300009176 Bacteria 584
456 Ga0105248_10001256 3300009177 Bacteria 28350
457 Ga0105248_10039623 3300009177 Bacteria 5279
458 Ga0105248_10184254 3300009177 Bacteria 2353
459 Ga0105248_10288636 3300009177 Bacteria 1847
460 Ga0105248_11215465 3300009177 Bacteria 852
461 Ga0105248_12343562 3300009177 Bacteria 608
462 Ga0105237_10365688 3300009545 Bacteria 1447
463 Ga0105237_10426969 3300009545 Bacteria 1331
464 Ga0105237_10591198 3300009545 Bacteria 1117
465 Ga0105237_10797391 3300009545 Bacteria 951
466 Ga0105237_11081608 3300009545 Bacteria 809
467 Ga0105237_11224797 3300009545 Bacteria 757
468 Ga0105237_11985958 3300009545 Bacteria 590
469 Ga0105238_10044356 3300009551 Bacteria 4496
470 Ga0105238_10378578 3300009551 Bacteria 1406
471 Ga0105238_10997556 3300009551 Bacteria 858
472 Ga0105238_11087337 3300009551 Bacteria 822
473 Ga0105238_12227639 3300009551 Bacteria 583
474 Ga0105238_12423355 3300009551 Bacteria 560
475 Ga0105238_12909923 3300009551 Bacteria 515
476 Ga0105249_10040745 3300009553 Bacteria 4219
477 Ga0105249_10329162 3300009553 Bacteria 1541
478 Ga0105249_10330115 3300009553 Bacteria 1539
479 Ga0105249_10453128 3300009553 Bacteria 1322
480 Ga0105249_11166391 3300009553 Bacteria 841
481 Ga0105249_11469127 3300009553 Bacteria 754
482 Ga0105249_11973888 3300009553 Bacteria 656
483 Ga0105249_12291228 3300009553 Bacteria 613
484 Ga0105249_12308920 3300009553 Bacteria 611
485 Ga0105249_12353397 3300009553 Bacteria 605
486 Ga0105249_12421697 3300009553 Bacteria 597
487 Ga0105249_12560354 3300009553 Bacteria 582
488 Ga0099796_10023887 3300010159 Bacteria 1913
489 Ga0099796_10275871 3300010159 Bacteria 706
490 Ga0105239_10131095 3300010375 Bacteria 2789
491 Ga0105239_10244856 3300010375 Bacteria 2013
492 Ga0105239_10424269 3300010375 Bacteria 1507
493 Ga0105239_10738877 3300010375 Bacteria 1126
494 Ga0105239_10824069 3300010375 Bacteria 1063
495 Ga0105239_11055172 3300010375 Bacteria 935
496 Ga0105239_11296739 3300010375 Bacteria 840
497 Ga0105239_11681072 3300010375 Bacteria 735
498 Ga0105239_11843541 3300010375 Bacteria 701
499 Ga0105239_12626434 3300010375 Bacteria 587
500 Ga0105246_10000677 3300011119 Bacteria 19120
501 Ga0105246_10043815 3300011119 Bacteria 3038
502 Ga0105246_10246314 3300011119 Bacteria 1416
503 Ga0105246_10264562 3300011119 Bacteria 1372
504 Ga0105246_10271422 3300011119 Bacteria 1356
505 Ga0105246_10685213 3300011119 Bacteria 896
506 Ga0105246_10696760 3300011119 Bacteria 890
507 Ga0105246_10865976 3300011119 Bacteria 807
508 Ga0157340_1029428 3300012473 Bacteria 506
509 Ga0157336_1017202 3300012477 Bacteria 621
510 Ga0157346_1000486 3300012480 Bacteria 1672
511 Ga0157337_1006266 3300012483 Bacteria 818
512 Ga0157325_1018162 3300012485 Bacteria 602
513 Ga0157329_1021702 3300012491 Bacteria 607
514 Ga0157335_1009023 3300012492 Bacteria 776
515 Ga0157341_1041648 3300012494 Bacteria 534
516 Ga0157319_1010846 3300012497 Bacteria 742
517 Ga0157345_1002512 3300012498 Bacteria 1299
518 Ga0157314_1012932 3300012500 Bacteria 758
519 Ga0157347_1005321 3300012502 Bacteria 1226
520 Ga0157313_1014030 3300012503 Bacteria 735
521 Ga0157339_1010108 3300012505 Bacteria 847
522 Ga0157342_1002674 3300012507 Bacteria 1467
523 Ga0157315_1007234 3300012508 Bacteria 894
524 Ga0157327_1068898 3300012512 Bacteria 545
525 Ga0157326_1029780 3300012513 Bacteria 717
526 Ga0157326_1032110 3300012513 Bacteria 700
527 Ga0157338_1005803 3300012515 Bacteria 1121
528 Ga0157373_10080116 3300013100 Bacteria 2303
529 Ga0157373_10094196 3300013100 Bacteria 2109
530 Ga0157373_10128644 3300013100 Bacteria 1781
531 Ga0157373_10481267 3300013100 Bacteria 895
532 Ga0157373_10832202 3300013100 Bacteria 682
533 Ga0157373_11468612 3300013100 Bacteria 520
534 Ga0157371_10018435 3300013102 Bacteria 5161
535 Ga0157371_10042438 3300013102 Bacteria 3242
536 Ga0157371_10055988 3300013102 Bacteria 2797
537 Ga0157371_10165197 3300013102 Bacteria 1581
538 Ga0157371_11540194 3300013102 Bacteria 519
539 Ga0157370_10045055 3300013104 Bacteria 4234
540 Ga0157370_10282438 3300013104 Bacteria 1534
541 Ga0157370_10389342 3300013104 Bacteria 1283
542 Ga0157370_10684486 3300013104 Bacteria 936
543 Ga0157370_10927128 3300013104 Bacteria 790
544 Ga0157370_11139673 3300013104 Bacteria 704
545 Ga0157369_10001226 3300013105 Bacteria 31968
546 Ga0157369_10045005 3300013105 Bacteria 4802
547 Ga0157369_10174634 3300013105 Bacteria 2262
548 Ga0157369_10177656 3300013105 Bacteria 2241
549 Ga0157369_10226639 3300013105 Bacteria 1955
550 Ga0157369_10553907 3300013105 Bacteria 1188
551 Ga0157369_10615632 3300013105 Bacteria 1120
552 Ga0157369_10884227 3300013105 Bacteria 916
553 Ga0157369_11113725 3300013105 Bacteria 807
554 Ga0157369_11332328 3300013105 Bacteria 731
555 Ga0157369_11579337 3300013105 Bacteria 667
556 Ga0157374_10007839 3300013296 Bacteria 9116
557 Ga0157374_10551488 3300013296 Bacteria 1160
558 Ga0157374_10660329 3300013296 Bacteria 1058
559 Ga0157374_11068011 3300013296 Bacteria 827
560 Ga0157374_11379621 3300013296 Bacteria 727
561 Ga0157374_12592194 3300013296 Bacteria 535
562 Ga0157374_12615690 3300013296 Bacteria 532
563 Ga0157374_12967956 3300013296 Bacteria 501
564 Ga0157378_10143210 3300013297 Bacteria 2221
565 Ga0157378_10188750 3300013297 Bacteria 1943
566 Ga0157378_10340383 3300013297 Bacteria 1463
567 Ga0157378_10874525 3300013297 Bacteria 928
568 Ga0157378_10926671 3300013297 Bacteria 903
569 Ga0157378_12965929 3300013297 Bacteria 526
570 Ga0163162_10224162 3300013306 Bacteria 2009
571 Ga0163162_10544828 3300013306 Bacteria 1289
572 Ga0163162_10595887 3300013306 Bacteria 1232
573 Ga0163162_10666633 3300013306 Bacteria 1163
574 Ga0163162_11226593 3300013306 Bacteria 851
575 Ga0163162_11237422 3300013306 Bacteria 848
576 Ga0163162_11347230 3300013306 Bacteria 811
577 Ga0163162_11666999 3300013306 Bacteria 728
578 Ga0163162_12154867 3300013306 Bacteria 640
579 Ga0163162_12432619 3300013306 Bacteria 602
580 Ga0163162_13038927 3300013306 Bacteria 539
581 Ga0157372_10023978 3300013307 Bacteria 6620
582 Ga0157372_10089347 3300013307 Bacteria 3500
583 Ga0157372_10340463 3300013307 Bacteria 1747
584 Ga0157372_10372037 3300013307 Bacteria 1665
585 Ga0157372_10472225 3300013307 Bacteria 1462
586 Ga0157372_10639515 3300013307 Bacteria 1239
587 Ga0157372_11103280 3300013307 Bacteria 918
588 Ga0157372_11261359 3300013307 Bacteria 853
589 Ga0157372_11286038 3300013307 Bacteria 844
590 Ga0157372_11845359 3300013307 Bacteria 695
591 Ga0157372_11846959 3300013307 Bacteria 695
592 Ga0157372_11938749 3300013307 Bacteria 677
593 Ga0157372_12355373 3300013307 Bacteria 611
594 Ga0157372_13386755 3300013307 Bacteria 507
595 Ga0157375_10298048 3300013308 Bacteria 1776
596 Ga0157375_10313841 3300013308 Bacteria 1732
597 Ga0157375_10445668 3300013308 Bacteria 1460
598 Ga0157375_10513284 3300013308 Bacteria 1362
599 Ga0157375_10691200 3300013308 Bacteria 1174
600 Ga0157375_11036968 3300013308 Bacteria 958
601 Ga0157375_11240915 3300013308 Bacteria 875
602 Ga0157375_11395859 3300013308 Bacteria 825
603 Ga0157375_11580698 3300013308 Bacteria 775
604 Ga0163163_10086319 3300014325 Bacteria 3147
605 Ga0163163_10134524 3300014325 Bacteria 2513
606 Ga0163163_10294750 3300014325 Bacteria 1674
607 Ga0163163_10513046 3300014325 Bacteria 1261
608 Ga0163163_11440644 3300014325 Bacteria 750
609 Ga0157380_10419005 3300014326 Bacteria 1276
610 Ga0157380_10572085 3300014326 Bacteria 1112
611 Ga0157380_11041806 3300014326 Bacteria 854
612 Ga0157380_11204456 3300014326 Bacteria 801
613 Ga0182008_10001280 3300014497 Bacteria 17261
614 Ga0182008_10063733 3300014497 Bacteria 1815
615 Ga0182008_10154693 3300014497 Bacteria 1151
616 Ga0182008_10771580 3300014497 Bacteria 555
617 Ga0157377_10099503 3300014745 Bacteria 1730
618 Ga0157377_10297683 3300014745 Bacteria 1063
619 Ga0157377_11014908 3300014745 Bacteria 629
620 Ga0157377_11740804 3300014745 Bacteria 504
621 Ga0157379_10017316 3300014968 Bacteria 6349
622 Ga0157379_10245301 3300014968 Bacteria 1625
623 Ga0157379_10580398 3300014968 Bacteria 1045
624 Ga0157379_11580780 3300014968 Bacteria 640
625 Ga0157376_10149208 3300014969 Bacteria 2107
626 Ga0157376_10176007 3300014969 Bacteria 1952
627 Ga0157376_10289769 3300014969 Bacteria 1545
628 Ga0157376_10743029 3300014969 Bacteria 990
629 Ga0157376_11141997 3300014969 Bacteria 806
630 Ga0157376_11854885 3300014969 Bacteria 639
631 Ga0182006_1239719 3300015261 Bacteria 596
632 Ga0182007_10000582 3300015262 Bacteria 21489
633 Ga0182007_10271434 3300015262 Bacteria 614
634 Ga0182005_1100806 3300015265 Bacteria 809
635 Ga0183367_1005 3300015688 Bacteria 652063
636 Ga0163161_10159234 3300017792 Bacteria 1721
637 Ga0163161_10283976 3300017792 Bacteria 1299
638 Ga0163161_10463463 3300017792 Bacteria 1026
639 Ga0163161_11057483 3300017792 Bacteria 696
640 Ga0163161_11283187 3300017792 Bacteria 636
641 Ga0184601_106011 3300019183 Bacteria 558
642 Ga0197907_10000430 3300020069 Bacteria 518
643 Ga0197907_10288082 3300020069 Bacteria 792
644 Ga0197907_10328527 3300020069 Bacteria 734
645 Ga0197907_10376985 3300020069 Bacteria 656
646 Ga0197907_11094604 3300020069 Bacteria 763
647 Ga0197907_11205039 3300020069 Bacteria 1306
648 Ga0197907_11225079 3300020069 Bacteria 531
649 Ga0206356_10944536 3300020070 Bacteria 1193
650 Ga0206356_11038323 3300020070 Bacteria 553
651 Ga0206356_11717365 3300020070 Bacteria 1159
652 Ga0206349_1677274 3300020075 Bacteria 606
653 Ga0206355_1500362 3300020076 Bacteria 1339
654 Ga0206355_1718134 3300020076 Bacteria 503
655 Ga0206351_10722143 3300020077 Bacteria 1581
656 Ga0206351_10773125 3300020077 Bacteria 599
657 Ga0206352_10254953 3300020078 Bacteria 561
658 Ga0206352_10791224 3300020078 Bacteria 570
659 Ga0206352_11198618 3300020078 Bacteria 791
660 Ga0206352_11221252 3300020078 Bacteria 829
661 Ga0206350_10374030 3300020080 Bacteria 613
662 Ga0206350_11294616 3300020080 Bacteria 1328
663 Ga0206350_11421611 3300020080 Bacteria 521
664 Ga0206354_10431806 3300020081 Bacteria 2764
665 Ga0206354_10445256 3300020081 Bacteria 654
666 Ga0206354_10750047 3300020081 Bacteria 2724
667 Ga0206354_11141536 3300020081 Bacteria 1702
668 Ga0206354_11265793 3300020081 Bacteria 763
669 Ga0206354_11381198 3300020081 Bacteria 920
670 Ga0206354_11660386 3300020081 Bacteria 608
671 Ga0206353_10158060 3300020082 Bacteria 601
672 Ga0206353_10211368 3300020082 Bacteria 684
673 Ga0206353_10224648 3300020082 Bacteria 2949
674 Ga0206353_11402443 3300020082 Bacteria 1159
675 Ga0206353_11571215 3300020082 Bacteria 659
676 Ga0206353_11776395 3300020082 Bacteria 632
677 Ga0154015_1173053 3300020610 Bacteria 596
678 Ga0154015_1285698 3300020610 Bacteria 1042
679 Ga0213873_10048000 3300021358 Bacteria 1122
680 Ga0213872_10363985 3300021361 Bacteria 591
681 Ga0213874_10109716 3300021377 Bacteria 926
682 Ga0213875_10001074 3300021388 Bacteria 19149
683 Ga0213875_10134582 3300021388 Bacteria 1156
684 Ga0213875_10180928 3300021388 Bacteria 990
685 Ga0224712_10018811 3300022467 Bacteria 2317
686 Ga0224712_10033439 3300022467 Bacteria 1882
687 Ga0224712_10038218 3300022467 Bacteria 1791
688 Ga0224712_10038848 3300022467 Bacteria 1781
689 Ga0224712_10154823 3300022467 Bacteria 1018
690 Ga0224712_10169541 3300022467 Bacteria 978
691 Ga0224712_10539998 3300022467 Bacteria 566
692 Ga0224712_10580348 3300022467 Bacteria 546
693 Ga0247551_104776 3300023552 Bacteria 550
694 Ga0247528_111965 3300023680 Bacteria 586
695 Ga0224572_1016890 3300024225 Bacteria 1400
696 Ga0224572_1039710 3300024225 Bacteria 889
697 Ga0228598_1006679 3300024227 Bacteria 2379
698 Ga0207425_1040092 3300025245 Bacteria 895
699 Ga0209759_1041554 3300025256 Bacteria 786
700 Ga0209129_1000109 3300025258 Bacteria 153068
701 Ga0209673_1075826 3300025273 Bacteria 785
702 Ga0209025_1001288 3300025294 Bacteria 34293
703 Ga0209758_1004710 3300025297 Bacteria 11130
704 Ga0207426_1010098 3300025302 Bacteria 3689
705 Ga0207426_1021647 3300025302 Bacteria 2220
706 Ga0207426_1035840 3300025302 Bacteria 1581
707 Ga0209051_1022745 3300025303 Bacteria 2629
708 Ga0207656_10002744 3300025321 Bacteria 5973
709 Ga0207656_10317020 3300025321 Bacteria 774
710 Ga0207696_1089907 3300025711 Bacteria 842
711 Ga0207713_1015813 3300025735 Bacteria 3856
712 Ga0207713_1069261 3300025735 Bacteria 1308
713 Ga0207713_1187793 3300025735 Bacteria 641
714 Ga0207713_1208068 3300025735 Bacteria 596
715 Ga0207653_10010290 3300025885 Bacteria 2917
716 Ga0207682_10434243 3300025893 Bacteria 621
717 Ga0207692_10003532 3300025898 Bacteria 6114
718 Ga0207692_10061982 3300025898 Bacteria 1940
719 Ga0207692_10283443 3300025898 Bacteria 1003
720 Ga0207692_10435207 3300025898 Bacteria 823
721 Ga0207692_11113518 3300025898 Bacteria 523
722 Ga0207710_10048418 3300025900 Bacteria 1902
723 Ga0207710_10148245 3300025900 Bacteria 1137
724 Ga0207710_10285787 3300025900 Bacteria 831
725 Ga0207688_10005845 3300025901 Bacteria 6696
726 Ga0207688_10202007 3300025901 Bacteria 1192
727 Ga0207680_10092482 3300025903 Bacteria 1927
728 Ga0207680_10990028 3300025903 Bacteria 602
729 Ga0207647_10129790 3300025904 Bacteria 1482
730 Ga0207647_10180858 3300025904 Bacteria 1225
731 Ga0207647_10337524 3300025904 Bacteria 854
732 Ga0207685_10029674 3300025905 Bacteria 1938
733 Ga0207685_10106860 3300025905 Bacteria 1206
734 Ga0207685_10128805 3300025905 Bacteria 1121
735 Ga0207699_10005247 3300025906 Bacteria 6201
736 Ga0207699_10008388 3300025906 Bacteria 5097
737 Ga0207699_10019950 3300025906 Bacteria 3584
738 Ga0207699_10052519 3300025906 Bacteria 2413
739 Ga0207699_10057858 3300025906 Bacteria 2317
740 Ga0207699_10127567 3300025906 Bacteria 1654
741 Ga0207699_11421641 3300025906 Bacteria 513
742 Ga0207645_10125468 3300025907 Bacteria 1668
743 Ga0207645_10140421 3300025907 Bacteria 1574
744 Ga0207643_10000785 3300025908 Bacteria 19366
745 Ga0207643_10097704 3300025908 Bacteria 1719
746 Ga0207705_10008895 3300025909 Bacteria 7318
747 Ga0207705_10330599 3300025909 Bacteria 1172
748 Ga0207705_10462458 3300025909 Bacteria 984
749 Ga0207705_10665820 3300025909 Bacteria 809
750 Ga0207684_10001971 3300025910 Bacteria 21203
751 Ga0207684_10033328 3300025910 Bacteria 4380
752 Ga0207684_10053609 3300025910 Bacteria 3423
753 Ga0207684_10152406 3300025910 Bacteria 1989
754 Ga0207684_10169825 3300025910 Bacteria 1880
755 Ga0207684_10190164 3300025910 Bacteria 1771
756 Ga0207684_10339361 3300025910 Bacteria 1294
757 Ga0207684_11239355 3300025910 Bacteria 616
758 Ga0207684_11326226 3300025910 Bacteria 592
759 Ga0207654_10011556 3300025911 Bacteria 4505
760 Ga0207654_11072503 3300025911 Bacteria 587
761 Ga0207707_10000257 3300025912 Bacteria 57640
762 Ga0207707_10070531 3300025912 Bacteria 3045
763 Ga0207707_10083004 3300025912 Bacteria 2798
764 Ga0207707_10085902 3300025912 Bacteria 2749
765 Ga0207707_10239879 3300025912 Bacteria 1576
766 Ga0207707_10761002 3300025912 Bacteria 809
767 Ga0207707_10961448 3300025912 Bacteria 703
768 Ga0207707_11543701 3300025912 Bacteria 525
769 Ga0207695_10204898 3300025913 Bacteria 1885
770 Ga0207695_10522574 3300025913 Bacteria 1069
771 Ga0207671_10032194 3300025914 Bacteria 3903
772 Ga0207671_10706685 3300025914 Bacteria 802
773 Ga0207693_10049363 3300025915 Bacteria 3305
774 Ga0207693_10140509 3300025915 Bacteria 1899
775 Ga0207693_10245271 3300025915 Bacteria 1406
776 Ga0207693_10880097 3300025915 Bacteria 688
777 Ga0207693_10967246 3300025915 Bacteria 651
778 Ga0207663_10004352 3300025916 Bacteria 7031
779 Ga0207663_10065057 3300025916 Bacteria 2329
780 Ga0207663_10219811 3300025916 Bacteria 1382
781 Ga0207663_10321391 3300025916 Bacteria 1163
782 Ga0207663_10899073 3300025916 Bacteria 708
783 Ga0207660_10000443 3300025917 Bacteria 27313
784 Ga0207660_10010834 3300025917 Bacteria 5925
785 Ga0207660_10032108 3300025917 Bacteria 3622
786 Ga0207660_10271016 3300025917 Bacteria 1345
787 Ga0207660_10294724 3300025917 Bacteria 1290
788 Ga0207660_10681717 3300025917 Bacteria 838
789 Ga0207660_11615416 3300025917 Bacteria 522
790 Ga0207662_10026955 3300025918 Bacteria 3317
791 Ga0207662_10088442 3300025918 Bacteria 1902
792 Ga0207657_10009895 3300025919 Bacteria 9545
793 Ga0207657_10029438 3300025919 Bacteria 4999
794 Ga0207657_10090094 3300025919 Bacteria 2560
795 Ga0207657_10104721 3300025919 Bacteria 2343
796 Ga0207657_10149661 3300025919 Bacteria 1902
797 Ga0207657_10641272 3300025919 Bacteria 827
798 Ga0207649_10007710 3300025920 Bacteria 5853
799 Ga0207649_10280483 3300025920 Bacteria 1211
800 Ga0207652_10000070 3300025921 Bacteria 109705
801 Ga0207652_10006407 3300025921 Bacteria 9495
802 Ga0207652_10013800 3300025921 Bacteria 6535
803 Ga0207652_10039314 3300025921 Bacteria 4014
804 Ga0207652_10292989 3300025921 Bacteria 1468
805 Ga0207652_10411397 3300025921 Bacteria 1220
806 Ga0207652_10412404 3300025921 Bacteria 1218
807 Ga0207652_10670105 3300025921 Bacteria 927
808 Ga0207652_11499633 3300025921 Bacteria 578
809 Ga0207652_11760923 3300025921 Bacteria 524
810 Ga0207646_10000180 3300025922 Bacteria 86389
811 Ga0207646_10003225 3300025922 Bacteria 18622
812 Ga0207646_10072175 3300025922 Bacteria 3083
813 Ga0207646_10170346 3300025922 Bacteria 1966
814 Ga0207646_10410649 3300025922 Bacteria 1223
815 Ga0207646_10639852 3300025922 Bacteria 953
816 Ga0207646_11344708 3300025922 Bacteria 623
817 Ga0207694_10263491 3300025924 Bacteria 1412
818 Ga0207694_10815868 3300025924 Bacteria 788
819 Ga0207694_11368813 3300025924 Bacteria 598
820 Ga0207650_10007339 3300025925 Bacteria 7505
821 Ga0207650_10301782 3300025925 Bacteria 1308
822 Ga0207650_10792471 3300025925 Bacteria 803
823 Ga0207659_10076357 3300025926 Bacteria 2462
824 Ga0207659_10538630 3300025926 Bacteria 991
825 Ga0207659_11045978 3300025926 Bacteria 702
826 Ga0207687_10004699 3300025927 Bacteria 9083
827 Ga0207687_10085074 3300025927 Bacteria 2294
828 Ga0207687_10145689 3300025927 Bacteria 1802
829 Ga0207687_10253750 3300025927 Bacteria 1399
830 Ga0207687_10430985 3300025927 Bacteria 1090
831 Ga0207700_10002172 3300025928 Bacteria 11238
832 Ga0207700_10004822 3300025928 Bacteria 8005
833 Ga0207700_10053681 3300025928 Bacteria 3021
834 Ga0207700_10078649 3300025928 Bacteria 2566
835 Ga0207700_10110485 3300025928 Bacteria 2211
836 Ga0207700_10138114 3300025928 Bacteria 1999
837 Ga0207700_10218242 3300025928 Bacteria 1615
838 Ga0207700_10377698 3300025928 Bacteria 1239
839 Ga0207700_10447459 3300025928 Bacteria 1138
840 Ga0207700_10631391 3300025928 Bacteria 954
841 Ga0207664_10000298 3300025929 Bacteria 37109
842 Ga0207664_10001524 3300025929 Bacteria 15198
843 Ga0207664_10001845 3300025929 Bacteria 13970
844 Ga0207664_10003186 3300025929 Bacteria 10906
845 Ga0207664_10009124 3300025929 Bacteria 6948
846 Ga0207664_10145876 3300025929 Bacteria 2007
847 Ga0207664_10178957 3300025929 Bacteria 1819
848 Ga0207664_10184829 3300025929 Bacteria 1791
849 Ga0207664_10185885 3300025929 Bacteria 1786
850 Ga0207664_10391912 3300025929 Bacteria 1234
851 Ga0207664_10432426 3300025929 Bacteria 1173
852 Ga0207664_10482268 3300025929 Bacteria 1109
853 Ga0207664_10555525 3300025929 Bacteria 1030
854 Ga0207664_10624254 3300025929 Bacteria 968
855 Ga0207664_10709886 3300025929 Bacteria 904
856 Ga0207664_10758987 3300025929 Bacteria 872
857 Ga0207644_10330883 3300025931 Bacteria 1233
858 Ga0207644_10472008 3300025931 Bacteria 1032
859 Ga0207644_10670477 3300025931 Bacteria 864
860 Ga0207644_11566601 3300025931 Bacteria 553
861 Ga0207644_11571817 3300025931 Bacteria 552
862 Ga0207690_10000219 3300025932 Bacteria 43461
863 Ga0207690_10016824 3300025932 Bacteria 4456
864 Ga0207690_10184443 3300025932 Bacteria 1573
865 Ga0207690_10916477 3300025932 Bacteria 727
866 Ga0207706_10072026 3300025933 Bacteria 3040
867 Ga0207706_10103797 3300025933 Bacteria 2501
868 Ga0207686_10070926 3300025934 Bacteria 2240
869 Ga0207686_10085700 3300025934 Bacteria 2067
870 Ga0207686_10182120 3300025934 Bacteria 1490
871 Ga0207686_10396874 3300025934 Bacteria 1050
872 Ga0207686_11003919 3300025934 Bacteria 677
873 Ga0207709_10051993 3300025935 Bacteria 2513
874 Ga0207709_10149879 3300025935 Bacteria 1614
875 Ga0207709_10260330 3300025935 Bacteria 1272
876 Ga0207709_10683302 3300025935 Bacteria 820
877 Ga0207670_10280515 3300025936 Bacteria 1298
878 Ga0207670_10404127 3300025936 Bacteria 1092
879 Ga0207669_10138738 3300025937 Bacteria 1684
880 Ga0207669_11108928 3300025937 Bacteria 668
881 Ga0207669_11368232 3300025937 Bacteria 602
882 Ga0207704_10694076 3300025938 Bacteria 842
883 Ga0207704_10800144 3300025938 Bacteria 787
884 Ga0207704_11471486 3300025938 Bacteria 584
885 Ga0207665_10000657 3300025939 Bacteria 23270
886 Ga0207665_10023462 3300025939 Bacteria 4065
887 Ga0207665_10064239 3300025939 Bacteria 2494
888 Ga0207665_10229302 3300025939 Bacteria 1364
889 Ga0207691_10006993 3300025940 Bacteria 10888
890 Ga0207691_10292907 3300025940 Bacteria 1399
891 Ga0207691_10978209 3300025940 Bacteria 707
892 Ga0207711_10247142 3300025941 Bacteria 1637
893 Ga0207711_10355742 3300025941 Bacteria 1356
894 Ga0207711_11487377 3300025941 Bacteria 620
895 Ga0207689_10006217 3300025942 Bacteria 10576
896 Ga0207689_10038661 3300025942 Bacteria 3951
897 Ga0207689_10796465 3300025942 Bacteria 798
898 Ga0207661_10000336 3300025944 Bacteria 29965
899 Ga0207661_10182423 3300025944 Bacteria 1834
900 Ga0207661_10215294 3300025944 Bacteria 1695
901 Ga0207661_10669166 3300025944 Bacteria 954
902 Ga0207661_11065429 3300025944 Bacteria 744
903 Ga0207661_11118335 3300025944 Bacteria 725
904 Ga0207679_10001066 3300025945 Bacteria 17442
905 Ga0207679_10322244 3300025945 Bacteria 1339
906 Ga0207679_10612563 3300025945 Bacteria 982
907 Ga0207679_11558178 3300025945 Bacteria 606
908 Ga0207667_10274291 3300025949 Bacteria 1724
909 Ga0207667_10426342 3300025949 Bacteria 1349
910 Ga0207667_10787716 3300025949 Bacteria 948
911 Ga0207667_11077547 3300025949 Bacteria 788
912 Ga0207667_11743916 3300025949 Bacteria 588
913 Ga0207651_10091623 3300025960 Bacteria 2226
914 Ga0207651_10212793 3300025960 Bacteria 1557
915 Ga0207712_10486292 3300025961 Bacteria 1053
916 Ga0207712_10509532 3300025961 Bacteria 1030
917 Ga0207712_10919774 3300025961 Bacteria 774
918 Ga0207668_11605737 3300025972 Bacteria 587
919 Ga0207640_10031537 3300025981 Bacteria 3276
920 Ga0207640_11383406 3300025981 Bacteria 630
921 Ga0207658_10012955 3300025986 Bacteria 5696
922 Ga0207658_10147132 3300025986 Bacteria 1915
923 Ga0207658_10928694 3300025986 Bacteria 793
924 Ga0207658_11503540 3300025986 Bacteria 616
925 Ga0207658_11610945 3300025986 Bacteria 593
926 Ga0207677_10019593 3300026023 Bacteria 4090
927 Ga0207677_10251985 3300026023 Bacteria 1434
928 Ga0207677_10592148 3300026023 Bacteria 972
929 Ga0207677_10721886 3300026023 Bacteria 886
930 Ga0207677_11523031 3300026023 Bacteria 618
931 Ga0207703_10234602 3300026035 Bacteria 1646
932 Ga0207703_10395638 3300026035 Bacteria 1281
933 Ga0207703_10852492 3300026035 Bacteria 871
934 Ga0207703_10981002 3300026035 Bacteria 810
935 Ga0207703_11790484 3300026035 Bacteria 590
936 Ga0207639_10056849 3300026041 Bacteria 3000
937 Ga0207639_11183784 3300026041 Bacteria 717
938 Ga0207678_10001106 3300026067 Bacteria 24706
939 Ga0207678_10070312 3300026067 Bacteria 3001
940 Ga0207678_10085601 3300026067 Bacteria 2694
941 Ga0207678_10880553 3300026067 Bacteria 791
942 Ga0207678_11050358 3300026067 Bacteria 721
943 Ga0207708_10009638 3300026075 Bacteria 7162
944 Ga0207708_10102554 3300026075 Bacteria 2215
945 Ga0207708_10516949 3300026075 Bacteria 1003
946 Ga0207708_12014051 3300026075 Bacteria 505
947 Ga0207702_10041776 3300026078 Bacteria 3845
948 Ga0207702_10373661 3300026078 Bacteria 1369
949 Ga0207702_10569475 3300026078 Bacteria 1109
950 Ga0207702_10738716 3300026078 Bacteria 971
951 Ga0207702_10940286 3300026078 Bacteria 857
952 Ga0207702_11012825 3300026078 Bacteria 824
953 Ga0207702_11229571 3300026078 Bacteria 743
954 Ga0207641_10138939 3300026088 Bacteria 2189
955 Ga0207641_10464178 3300026088 Bacteria 1225
956 Ga0207641_10666830 3300026088 Bacteria 1022
957 Ga0207641_11228017 3300026088 Bacteria 749
958 Ga0207641_12122744 3300026088 Bacteria 562
959 Ga0207648_10100745 3300026089 Bacteria 2531
960 Ga0207648_10902268 3300026089 Bacteria 826
961 Ga0207648_11117755 3300026089 Bacteria 739
962 Ga0207648_11203373 3300026089 Bacteria 712
963 Ga0207648_11784803 3300026089 Bacteria 577
964 Ga0207676_10000648 3300026095 Bacteria 27886
965 Ga0207676_10998509 3300026095 Bacteria 824
966 Ga0207676_11928961 3300026095 Bacteria 589
967 Ga0207676_11935980 3300026095 Bacteria 588
968 Ga0207674_10011766 3300026116 Bacteria 9818
969 Ga0207674_10132094 3300026116 Bacteria 2459
970 Ga0207674_10627488 3300026116 Bacteria 1038
971 Ga0207674_11452112 3300026116 Bacteria 655
972 Ga0207675_100021849 3300026118 Bacteria 5957
973 Ga0207675_100359039 3300026118 Bacteria 1429
974 Ga0207675_100397646 3300026118 Bacteria 1357
975 Ga0207675_100700662 3300026118 Bacteria 1022
976 Ga0207675_101174281 3300026118 Bacteria 788
977 Ga0207683_10001393 3300026121 Bacteria 21815
978 Ga0207683_10028516 3300026121 Bacteria 4827
979 Ga0207683_10608142 3300026121 Bacteria 1012
980 Ga0207683_11309190 3300026121 Bacteria 671
981 Ga0207698_10607498 3300026142 Bacteria 1079
982 Ga0207698_10714364 3300026142 Bacteria 998
983 Ga0209179_1125150 3300027512 Bacteria 574
984 Ga0207428_10003435 3300027907 Bacteria 15399
985 Ga0207428_10264295 3300027907 Bacteria 1281
986 Ga0268266_10132557 3300028379 Bacteria 2230
987 Ga0268266_10244148 3300028379 Bacteria 1658
988 Ga0268266_11156271 3300028379 Bacteria 748
989 Ga0268265_10109619 3300028380 Bacteria 2251
990 Ga0268265_10769483 3300028380 Bacteria 936
991 Ga0268264_10346751 3300028381 Bacteria 1412
992 Ga0268264_12003302 3300028381 Bacteria 588
993 Ga0265337_1000015 3300028556 Bacteria 80871
994 Ga0265326_10017844 3300028558 Bacteria 2044
995 Ga0265319_1001246 3300028563 Bacteria 15553
996 Ga0265334_10000373 3300028573 Bacteria 23956
997 Ga0265322_10012472 3300028654 Bacteria 2459
998 Ga0265336_10004317 3300028666 Bacteria 5394
999 Ga0307517_10008703 3300028786 Bacteria 14521
1000 Ga0307517_10576044 3300028786 Bacteria 558
1001 Ga0265338_10003873 3300028800 Bacteria 20722
1002 Ga0265338_10007479 3300028800 Bacteria 13536
1003 Ga0265338_10014640 3300028800 Bacteria 8701
1004 Ga0265338_11166024 3300028800 Bacteria 517
1005 Ga0311003_101840 3300029282 Bacteria 545
1006 Ga0265324_10002740 3300029957 Bacteria 8757
1007 Ga0268256_1018028 3300030500 Bacteria 1973
1008 Ga0307511_10136404 3300030521 Bacteria 1459
1009 Ga0307511_10142565 3300030521 Bacteria 1402
1010 Ga0307511_10276720 3300030521 Bacteria 780
1011 Ga0265762_1085621 3300030760 Bacteria 681
1012 Ga0265762_1087115 3300030760 Bacteria 676
1013 Ga0265766_1022293 3300030863 Bacteria 528
1014 Ga0265770_1039554 3300030878 Bacteria 820
1015 Ga0265764_111591 3300030882 Bacteria 571
1016 Ga0265761_110884 3300030889 Bacteria 532
1017 Ga0265768_109562 3300030963 Bacteria 614
1018 Ga0265771_1002017 3300031010 Bacteria 1042
1019 Ga0265771_1013123 3300031010 Bacteria 640
1020 Ga0265774_103887 3300031011 Bacteria 605
1021 Ga0265760_10006434 3300031090 Bacteria 3360
1022 Ga0265760_10069611 3300031090 Bacteria 1078
1023 Ga0265760_10113006 3300031090 Bacteria 866
1024 Ga0265330_10212907 3300031235 Bacteria 816
1025 Ga0265332_10001675 3300031238 Bacteria 12103
1026 Ga0265332_10058380 3300031238 Bacteria 1651
1027 Ga0265332_10474348 3300031238 Bacteria 518
1028 Ga0265320_10001898 3300031240 Bacteria 14748
1029 Ga0265320_10041316 3300031240 Bacteria 2293
1030 Ga0265325_10015321 3300031241 Bacteria 4312
1031 Ga0265325_10060617 3300031241 Bacteria 1921
1032 Ga0265340_10003540 3300031247 Bacteria 8788
1033 Ga0265340_10004519 3300031247 Bacteria 7758
1034 Ga0265340_10082220 3300031247 Bacteria 1515
1035 Ga0265339_10000762 3300031249 Bacteria 24924
1036 Ga0265339_10014234 3300031249 Bacteria 4799
1037 Ga0265331_10028427 3300031250 Bacteria 2796
1038 Ga0265331_10246008 3300031250 Bacteria 802
1039 Ga0265316_10006862 3300031344 Bacteria 10811
1040 Ga0265316_10154230 3300031344 Bacteria 1719
1041 Ga0307509_10009190 3300031507 Bacteria 12410
1042 Ga0307408_100053565 3300031548 Bacteria 2914
1043 Ga0307408_100437564 3300031548 Bacteria 1131
1044 Ga0307408_101472446 3300031548 Bacteria 643
1045 Ga0310117_121880 3300031592 Bacteria 636
1046 Ga0265313_10090959 3300031595 Bacteria 1370
1047 Ga0310107_133548 3300031615 Bacteria 562
1048 Ga0307508_10042905 3300031616 Bacteria 4054
1049 Ga0307508_10049088 3300031616 Bacteria 3758
1050 Ga0307508_10436673 3300031616 Bacteria 901
1051 Ga0307514_10175696 3300031649 Bacteria 1390
1052 Ga0310111_125385 3300031667 Bacteria 704
1053 Ga0310111_140077 3300031667 Bacteria 525
1054 Ga0265314_10005562 3300031711 Bacteria 11331
1055 Ga0265314_10016664 3300031711 Bacteria 5794
1056 Ga0265314_10048633 3300031711 Bacteria 2974
1057 Ga0265342_10006989 3300031712 Bacteria 8336
1058 Ga0265342_10033693 3300031712 Bacteria 3146
1059 Ga0265342_10036408 3300031712 Bacteria 3007
1060 Ga0307516_10056359 3300031730 Bacteria 3832
1061 Ga0307516_10068332 3300031730 Bacteria 3422
1062 Ga0307405_10583633 3300031731 Bacteria 909
1063 Ga0316044_123521 3300031810 Bacteria 619
1064 Ga0307413_10154461 3300031824 Bacteria 1603
1065 Ga0307413_10239047 3300031824 Bacteria 1340
1066 Ga0307413_10428832 3300031824 Bacteria 1043
1067 Ga0307413_10783646 3300031824 Bacteria 800
1068 Ga0307410_10018684 3300031852 Bacteria 4194
1069 Ga0307410_10041314 3300031852 Bacteria 3040
1070 Ga0307410_10461216 3300031852 Bacteria 1038
1071 Ga0307410_10517336 3300031852 Bacteria 984
1072 Ga0307410_10585933 3300031852 Bacteria 929
1073 Ga0307406_10061971 3300031901 Bacteria 2418
1074 Ga0307406_10091864 3300031901 Bacteria 2045
1075 Ga0307406_10326390 3300031901 Bacteria 1189
1076 Ga0307407_10270552 3300031903 Bacteria 1172
1077 Ga0307407_10272626 3300031903 Bacteria 1168
1078 Ga0307412_11657115 3300031911 Bacteria 585
1079 Ga0307409_100251429 3300031995 Bacteria 1616
1080 Ga0307409_100316575 3300031995 Bacteria 1458
1081 Ga0307409_100568728 3300031995 Bacteria 1115
1082 Ga0307409_100586607 3300031995 Bacteria 1099
1083 Ga0307409_100767361 3300031995 Bacteria 969
1084 Ga0307409_100778866 3300031995 Bacteria 962
1085 Ga0307409_100997431 3300031995 Bacteria 855
1086 Ga0307409_102105659 3300031995 Bacteria 594
1087 Ga0307416_100035506 3300032002 Bacteria 3808
1088 Ga0307416_100229736 3300032002 Bacteria 1787
1089 Ga0307416_100482859 3300032002 Bacteria 1299
1090 Ga0307416_101073035 3300032002 Bacteria 909
1091 Ga0307416_101966629 3300032002 Bacteria 687
1092 Ga0307416_103054440 3300032002 Bacteria 560
1093 Ga0307414_10157413 3300032004 Bacteria 1800
1094 Ga0307411_10046422 3300032005 Bacteria 2800
1095 Ga0307411_11889445 3300032005 Bacteria 556
1096 Ga0307411_12002959 3300032005 Bacteria 540
1097 Ga0307507_10000013 3300033179 Bacteria 242708
1098 Ga0307507_10331584 3300033179 Bacteria 908
1099 Ga0307507_10620089 3300033179 Bacteria 555
1100 Ga0307510_10144369 3300033180 Bacteria 2016
1101 Ga0316214_1000482 3300033545 Bacteria 4073
1102 Ga0316214_1003948 3300033545 Bacteria 1892
1103 Ga0316212_1003331 3300033547 Bacteria 2316
1104 Ga0373930_0109559 3300034816 Bacteria 663
1105 Ga0373948_0041310 3300034817 Bacteria 966
1106 Ga0373950_0090347 3300034818 Bacteria 650
1107 Ga0373958_0006992 3300034819 Bacteria 1781
1108 Ga0373959_0005926 3300034820 Bacteria 2014
1109 Ga0373926_0024276 3300035083 Bacteria 2110
1110 Ga0373926_0038845 3300035083 Bacteria 1696
1111 Ga0373929_0074912 3300035085 Bacteria 815
1112 Ga0373934_0006708 3300035086 Bacteria 4277
1113 Ga0373934_0016099 3300035086 Bacteria 2840
1114 Ga0373934_0020722 3300035086 Bacteria 2528
1115 Ga0373934_0065600 3300035086 Bacteria 1449
1116 Ga0373934_0077028 3300035086 Bacteria 1337
1117 Ga0373934_0326016 3300035086 Bacteria 638
1118 Ga0373940_0162500 3300035088 Bacteria 717
1119 Ga0373944_0054981 3300035089 Bacteria 1263
1120 Ga0373944_0266351 3300035089 Bacteria 636
1121 Ga0373951_0015579 3300035091 Bacteria 1713
1122 Ga0373951_0162768 3300035091 Bacteria 632
1123 Ga0373952_0255440 3300035092 Bacteria 532
1124 Ga0373923_0014721 3300035111 Bacteria 2943
1125 Ga0373923_0188582 3300035111 Bacteria 949
1126 Ga0373923_0222494 3300035111 Bacteria 877
1127 Ga0373923_0423120 3300035111 Bacteria 643
1128 Ga0373932_0349125 3300035112 Bacteria 562
1129 Ga0373936_0001178 3300035113 Bacteria 9397
1130 Ga0373936_0063067 3300035113 Bacteria 1516
1131 Ga0373936_0199673 3300035113 Bacteria 882
1132 Ga0373936_0311106 3300035113 Bacteria 712
1133 Ga0373941_0100267 3300035115 Bacteria 1007
1134 Ga0373941_0324149 3300035115 Bacteria 620
1135 Ga0373945_0157682 3300035116 Bacteria 923
1136 Ga0373945_0167148 3300035116 Bacteria 899
1137 Ga0373945_0296159 3300035116 Bacteria 692
1138 Ga0373945_0423426 3300035116 Bacteria 586
1139 Ga0373945_0465205 3300035116 Bacteria 560
1140 Ga0373953_0001772 3300035117 Bacteria 6373
1141 Ga0373953_0043953 3300035117 Bacteria 1785
1142 Ga0373953_0079348 3300035117 Bacteria 1362
1143 Ga0373953_0421401 3300035117 Bacteria 588
1144 Ga0373954_0027830 3300035118 Bacteria 2597
1145 Ga0373954_0048362 3300035118 Bacteria 1992
1146 Ga0373954_0097558 3300035118 Bacteria 1416
1147 Ga0373954_0194369 3300035118 Bacteria 996
1148 Ga0373956_0000844 3300035119 Bacteria 12743
1149 Ga0373956_0031323 3300035119 Bacteria 2330
1150 Ga0373956_0034924 3300035119 Bacteria 2215
1151 Ga0373956_0050919 3300035119 Bacteria 1860
1152 Ga0373957_0000011 3300035120 Bacteria 47051
1153 Ga0373957_0037568 3300035120 Bacteria 1809
1154 Ga0373957_0101528 3300035120 Bacteria 1152
1155 Ga0373957_0171550 3300035120 Bacteria 896
1156 Ga0373957_0200007 3300035120 Bacteria 832
1157 Ga0373960_0091762 3300035121 Bacteria 972
1158 Ga0373960_0137114 3300035121 Bacteria 825
1159 Ga0373943_0081332 3300035170 Bacteria 1661
1160 Ga0373943_0151010 3300035170 Bacteria 1258
1161 Ga0373943_0221704 3300035170 Bacteria 1053
1162 Ga0373943_0535043 3300035170 Bacteria 687
1163 Ga0373946_0066712 3300035171 Bacteria 1543
1164 Ga0373946_0071884 3300035171 Bacteria 1496
1165 Ga0373946_0289756 3300035171 Bacteria 807
1166 Ga0373946_0410365 3300035171 Bacteria 685
1167 Ga0373955_0000060 3300035172 Bacteria 42697
1168 Ga0373955_0014764 3300035172 Bacteria 3809
1169 Ga0373955_0140143 3300035172 Bacteria 1417
1170 Ga0373955_0325507 3300035172 Bacteria 929
1171 Ga0373955_0486184 3300035172 Bacteria 753
1172 Ga0373942_0047227 3300035207 Bacteria 1195
1173 Ga0373942_0272647 3300035207 Bacteria 580
1174 Ga0373924_0000672 3300035410 Bacteria 10628
1175 Ga0373924_0019378 3300035410 Bacteria 2636
1176 Ga0373924_0021188 3300035410 Bacteria 2534
1177 Ga0373924_0066473 3300035410 Bacteria 1515
1178 Ga0373924_0585618 3300035410 Bacteria 503
1179 Ga0373931_0091826 3300035691 Bacteria 1693
1180 Ga0373931_0098523 3300035691 Bacteria 1641
1181 Ga0373931_0142313 3300035691 Bacteria 1390
1182 Ga0373931_0836462 3300035691 Bacteria 615
1183 Ga0373935_0004616 3300035692 Bacteria 8095
1184 Ga0373935_0016967 3300035692 Bacteria 4409
1185 Ga0373935_0305980 3300035692 Bacteria 1124
1186 Ga0373935_0338594 3300035692 Bacteria 1071
1187 Ga0373927_0024730 3300035695 Bacteria 3924
1188 Ga0373927_0108817 3300035695 Bacteria 1805
1189 Ga0373927_0157259 3300035695 Bacteria 1489
1190 Ga0373927_0579698 3300035695 Bacteria 741
1191 Ga0373933_0014325 3300035724 Bacteria 4409
1192 Ga0373933_0016385 3300035724 Bacteria 4143
1193 Ga0373933_0133630 3300035724 Bacteria 1561
1194 Ga0373933_0248337 3300035724 Bacteria 1145
1195 Ga0373933_0463129 3300035724 Bacteria 829
1196 Ga0373947_0061727 3300035725 Bacteria 2278
1197 Ga0373947_0093287 3300035725 Bacteria 1881
1198 Ga0373947_0336826 3300035725 Bacteria 1010
1199 Ga0373947_0528508 3300035725 Bacteria 802
1200 Ga0310104_20196 3300036242 Bacteria 502
1201 Ga0373937_0000110 3300036401 Bacteria 77832
1202 Ga0373937_0030844 3300036401 Bacteria 4855
1203 Ga0373937_0037069 3300036401 Bacteria 4444
1204 Ga0373937_0269908 3300036401 Bacteria 1605
1205 Ga0373937_0271984 3300036401 Bacteria 1599
1206 Ga0373937_0366169 3300036401 Bacteria 1366
1207 Ga0373937_0808561 3300036401 Bacteria 885
1208 Ga0265778_024529 3300036457 Bacteria 758
1209 Ga0373925_0000540 3300037068 Bacteria 37332
1210 Ga0373925_0005130 3300037068 Bacteria 9813
1211 Ga0373925_0019497 3300037068 Bacteria 4934
1212 Ga0373925_0108373 3300037068 Bacteria 2143
1213 Ga0373925_0188311 3300037068 Bacteria 1636
1214 Ga0373925_0357750 3300037068 Bacteria 1186
1215 Ga0373925_0466959 3300037068 Bacteria 1034
1216 Ga0373925_1196327 3300037068 Bacteria 624
1217 Ga0395900_0186888 3300037418 Bacteria 2103
1218 Ga0395898_0408457 3300037466 Bacteria 1294
1219 Ga0395898_0550320 3300037466 Bacteria 1096
1220 Ga0395898_0955662 3300037466 Bacteria 794
1221 Ga0395905_0441340 3300037471 Bacteria 1199
1222 Ga0436364_0081229 3300037853 Bacteria 3392
1223 Ga0436364_0098049 3300037853 Bacteria 1373
1224 Ga0436364_0243023 3300037853 Bacteria 1549
1225 Ga0436364_0479741 3300037853 Bacteria 5755
1226 Ga0436364_0718628 3300037853 Bacteria 574
1227 Ga0436364_1098280 3300037853 Bacteria 1651
1228 Ga0436364_1174043 3300037853 Bacteria 9620
1229 Ga0436364_1263484 3300037853 Bacteria 906
1230 Ga0436364_1272150 3300037853 Bacteria 787
1231 Ga0436364_1381350 3300037853 Bacteria 44948
1232 Ga0436364_1527719 3300037853 Bacteria 1958
1233 Ga0395901_0368107 3300038443 Bacteria 1481
1234 Ga0395901_1522668 3300038443 Bacteria 624
1235 Ga0436365_0207903 3300039437 Bacteria 1140
1236 Ga0436365_0456440 3300039437 Bacteria 871
1237 Ga0436360_0519033 3300039438 Bacteria 806
1238 Ga0436360_0800473 3300039438 Bacteria 814
1239 Ga0436361_0083233 3300039447 Bacteria 533
1240 Ga0436361_0085148 3300039447 Bacteria 503
1241 Ga0436361_0592735 3300039447 Bacteria 564
1242 Ga0436361_0739507 3300039447 Bacteria 1466
1243 Ga0436361_1089145 3300039447 Bacteria 639
1244 Ga0436363_0129145 3300039450 Bacteria 1069
1245 Ga0436363_0216045 3300039450 Bacteria 2348
1246 Ga0436363_0287803 3300039450 Bacteria 617
1247 Ga0436363_1231403 3300039450 Bacteria 1275
1248 Ga0436363_1481670 3300039450 Bacteria 589
1249 Ga0436363_1578490 3300039450 Bacteria 1361
1250 Ga0436363_1583483 3300039450 Bacteria 943
1251 Ga0436362_0324614 3300039453 Bacteria 676
1252 Ga0436362_0452318 3300039453 Bacteria 664
1253 Ga0436362_1221077 3300039453 Bacteria 686
1254 Ga0436362_1298483 3300039453 Bacteria 752
1255 Ga0436362_1301744 3300039453 Bacteria 957
1256 Ga0439436_0000524 3300041404 Bacteria 10046
1257 Ga0439436_0006412 3300041404 Bacteria 3612
1258 Ga0439436_0017389 3300041404 Bacteria 2151
1259 Ga0439436_0080170 3300041404 Bacteria 908
1260 Ga0439436_0194399 3300041404 Bacteria 579
1261 Ga0439438_041185 3300041405 Bacteria 1198
1262 Ga0439439_0010113 3300041406 Bacteria 2253
1263 Ga0439439_0068353 3300041406 Bacteria 949
1264 Ga0439439_0082194 3300041406 Bacteria 872
1265 Ga0439461_0001303 3300041410 Bacteria 3832
1266 Ga0439466_0006342 3300041411 Bacteria 4501
1267 Ga0439466_0166992 3300041411 Bacteria 672
1268 Ga0451789_0026674 3300041443 Bacteria 782
1269 Ga0451793_1135109 3300041452 Bacteria 1895
1270 Ga0451797_1112463 3300041453 Bacteria 550
1271 Ga0451805_068977 3300041461 Bacteria 503
1272 Ga0451804_0477614 3300041463 Bacteria 869
1273 Ga0451839_0225412 3300041496 Bacteria 575
1274 Ga0451839_0572827 3300041496 Bacteria 869
1275 Ga0451841_0311264 3300041498 Bacteria 923
1276 Ga0451845_0003149 3300041501 Bacteria 638
1277 Ga0451843_1278596 3300041509 Bacteria 769
1278 Ga0451853_3555550 3300041512 Bacteria 856
1279 Ga0451853_3556725 3300041512 Bacteria 759
1280 Ga0439431_0021633 3300041997 Bacteria 1545
1281 Ga0439433_0001892 3300041999 Bacteria 4378
1282 Ga0439442_016934 3300042002 Bacteria 1503
1283 Ga0439442_071616 3300042002 Bacteria 738
1284 Ga0439448_0001950 3300042005 Bacteria 5504
1285 Ga0439448_0076419 3300042005 Bacteria 1120
1286 Ga0439448_0319083 3300042005 Bacteria 553
1287 Ga0439432_091108 3300042006 Bacteria 917
1288 Ga0439449_0011654 3300042007 Bacteria 3306
1289 Ga0439449_0019562 3300042007 Bacteria 2538
1290 Ga0439449_0032403 3300042007 Bacteria 1948
1291 Ga0439449_0055906 3300042007 Bacteria 1457
1292 Ga0439449_0298946 3300042007 Bacteria 607
1293 Ga0439452_002242 3300042010 Bacteria 7252
1294 Ga0439455_0009521 3300042012 Bacteria 2111
1295 Ga0439455_0076718 3300042012 Bacteria 904
1296 Ga0439456_043895 3300042013 Bacteria 972
1297 Ga0439457_001024 3300042014 Bacteria 8432
1298 Ga0439457_001614 3300042014 Bacteria 6720
1299 Ga0439457_004463 3300042014 Bacteria 3638
1300 Ga0439462_0004876 3300042015 Bacteria 3292
1301 Ga0439462_0051833 3300042015 Bacteria 1103
1302 Ga0439462_0111836 3300042015 Bacteria 756
1303 Ga0439462_0113673 3300042015 Bacteria 750
1304 Ga0439463_179444 3300042016 Bacteria 549
1305 Ga0450911_011083 3300042115 Bacteria 1238
1306 Ga0450914_065157 3300042118 Bacteria 500
1307 Ga0450919_000085 3300042121 Bacteria 9080
1308 Ga0450920_039778 3300042122 Bacteria 936
1309 Ga0450890_071893 3300042127 Bacteria 554
1310 Ga0450894_000035 3300042131 Bacteria 19542
1311 Ga0450896_002593 3300042133 Bacteria 2349
1312 Ga0450898_078105 3300042134 Bacteria 670
1313 Ga0450899_000138 3300042135 Bacteria 6978
1314 Ga0450902_032410 3300042137 Bacteria 881
1315 Ga0450903_000067 3300042138 Bacteria 20805
1316 Ga0450906_002005 3300042145 Bacteria 4446
1317 Ga0450907_018490 3300042146 Bacteria 1166
1318 Ga0450907_064767 3300042146 Bacteria 632
1319 Ga0439446_0020862 3300042156 Bacteria 1849
1320 Ga0439458_0005318 3300042157 Bacteria 2896
1321 Ga0439458_0050659 3300042157 Bacteria 1024
1322 Ga0450908_008452 3300042184 Bacteria 1929
1323 Ga0450909_002630 3300042185 Bacteria 2545
1324 Ga0439434_0065435 3300042435 Bacteria 1140
1325 Ga0439459_0004735 3300042438 Bacteria 2203
1326 Ga0439459_0042938 3300042438 Bacteria 967
1327 Ga0439459_0176540 3300042438 Bacteria 572
1328 Ga0439464_0169427 3300042439 Bacteria 688
1329 Ga0450918_016419 3300042531 Bacteria 1286
1330 Ga0450901_006724 3300042533 Bacteria 1185
1331 Ga0466969_0001305 3300044656 Bacteria 13440
1332 Ga0466969_0006155 3300044656 Bacteria 6389
1333 Ga0466972_0031457 3300044658 Bacteria 2609
1334 Ga0466972_0252403 3300044658 Bacteria 824
1335 Ga0466966_0001016 3300044684 Bacteria 17896
1336 Ga0466966_0002663 3300044684 Bacteria 11700
1337 Ga0466966_0009462 3300044684 Bacteria 6455
1338 Ga0466966_0012013 3300044684 Bacteria 5739
1339 Ga0466966_0019210 3300044684 Bacteria 4497
1340 Ga0466966_0213373 3300044684 Bacteria 1166
1341 Ga0466966_0255491 3300044684 Bacteria 1055
1342 Ga0466966_0271706 3300044684 Bacteria 1020
1343 Ga0466961_0003691 3300044693 Bacteria 9556
1344 Ga0466961_0006277 3300044693 Bacteria 7549
1345 Ga0466961_0007449 3300044693 Bacteria 6967
1346 Ga0466961_0018930 3300044693 Bacteria 4430
1347 Ga0466961_0023269 3300044693 Bacteria 3986
1348 Ga0466961_0032959 3300044693 Bacteria 3329
1349 Ga0466961_0094041 3300044693 Bacteria 1891
1350 Ga0466961_0160266 3300044693 Bacteria 1402
1351 Ga0466961_0728462 3300044693 Bacteria 593
1352 Ga0466961_0806876 3300044693 Bacteria 560
1353 Ga0466963_0028158 3300044694 Bacteria 3605
1354 Ga0466963_0035906 3300044694 Bacteria 3230
1355 Ga0466963_0060997 3300044694 Bacteria 2520
1356 Ga0466963_0069338 3300044694 Bacteria 2370
1357 Ga0466963_0406126 3300044694 Bacteria 961
1358 Ga0466963_0553184 3300044694 Bacteria 813
1359 Ga0466963_0890380 3300044694 Bacteria 627
1360 Ga0466963_0942863 3300044694 Bacteria 608
1361 Ga0466963_1101807 3300044694 Bacteria 558
1362 Ga0466964_0112830 3300044706 Bacteria 1215
1363 Ga0466964_0562917 3300044706 Bacteria 620
1364 Ga0466964_0668844 3300044706 Bacteria 576
1365 Ga0466971_0000730 3300044719 Bacteria 13160
1366 Ga0466971_0005155 3300044719 Bacteria 5656
1367 Ga0466971_0005390 3300044719 Bacteria 5549
1368 Ga0466971_0011377 3300044719 Bacteria 3897
1369 Ga0466971_0031674 3300044719 Bacteria 2368
1370 Ga0466968_0315931 3300044735 Bacteria 754
1371 Ga0466968_0375624 3300044735 Bacteria 694
1372 Ga0466968_0496860 3300044735 Bacteria 607
1373 Ga0466970_0002624 3300044765 Bacteria 8668
1374 Ga0466970_0062185 3300044765 Bacteria 2001
1375 Ga0466970_0310853 3300044765 Bacteria 890
1376 Ga0466970_0354333 3300044765 Bacteria 833
1377 Ga0466970_0410163 3300044765 Bacteria 774
1378 Ga0466970_0611728 3300044765 Bacteria 632
1379 Ga0466970_0720331 3300044765 Bacteria 582
1380 Ga0466957_0008107 3300044842 Bacteria 5960
1381 Ga0466957_0228107 3300044842 Bacteria 1232
1382 Ga0466957_0629040 3300044842 Bacteria 753
1383 Ga0466957_0664502 3300044842 Bacteria 733
1384 Ga0466957_0737721 3300044842 Bacteria 697
1385 Ga0466960_0028068 3300044901 Bacteria 2573
1386 Ga0466959_0000507 3300045049 Bacteria 22618
1387 Ga0466959_0007332 3300045049 Bacteria 7729
1388 Ga0466959_0011863 3300045049 Bacteria 6275
1389 Ga0466959_0036329 3300045049 Bacteria 3640
1390 Ga0466959_0048336 3300045049 Bacteria 3126
1391 Ga0466959_0060117 3300045049 Bacteria 2765
1392 Ga0466959_0141200 3300045049 Bacteria 1702
1393 Ga0466959_0355270 3300045049 Bacteria 999
1394 Ga0466959_0524937 3300045049 Bacteria 799
1395 Ga0451576_0227272 3300045051 Bacteria 1948
1396 Ga0466958_0004494 3300045836 Bacteria 7366
1397 Ga0466958_0010466 3300045836 Bacteria 5196
1398 Ga0466958_0028068 3300045836 Bacteria 3334
1399 Ga0466958_0034351 3300045836 Bacteria 3025
1400 Ga0466958_0192525 3300045836 Bacteria 1296
1401 Ga0466967_0007787 3300045976 Bacteria 7778
1402 Ga0466967_0101495 3300045976 Bacteria 2630
1403 Ga0466967_0525765 3300045976 Bacteria 1163
1404 Ga0466967_0628538 3300045976 Bacteria 1061
1405 Ga0466967_0665844 3300045976 Bacteria 1030
1406 Ga0466967_0725842 3300045976 Bacteria 985
1407 Ga0466967_1271460 3300045976 Bacteria 733
1408 Ga0466967_1419345 3300045976 Bacteria 691
1409 Ga0466967_1642962 3300045976 Bacteria 640
1410 Ga0466967_1916326 3300045976 Bacteria 589
1411 Ga0466967_2527919 3300045976 Bacteria 508
1412 Ga0495627_107445 3300046453 Bacteria 793
1413 Ga0495592_0000049 3300046454 Bacteria 113704
1414 Ga0495592_0011895 3300046454 Bacteria 6596
1415 Ga0495592_0041774 3300046454 Bacteria 3435
1416 Ga0495592_0127909 3300046454 Bacteria 1779
1417 Ga0495592_0149061 3300046454 Bacteria 1619
1418 Ga0495592_0183636 3300046454 Bacteria 1423
1419 Ga0495592_0485817 3300046454 Bacteria 768
1420 Ga0495603_0010028 3300046455 Bacteria 5731
1421 Ga0495603_0024116 3300046455 Bacteria 3679
1422 Ga0495603_0026170 3300046455 Bacteria 3525
1423 Ga0495603_0047280 3300046455 Bacteria 2563
1424 Ga0495603_0049435 3300046455 Bacteria 2503
1425 Ga0495603_0072963 3300046455 Bacteria 2016
1426 Ga0495629_0009686 3300046459 Bacteria 7038
1427 Ga0495629_0010230 3300046459 Bacteria 6833
1428 Ga0495629_0102424 3300046459 Bacteria 1997
1429 Ga0495629_0102605 3300046459 Bacteria 1995
1430 Ga0495629_0105404 3300046459 Bacteria 1966
1431 Ga0495629_0261125 3300046459 Bacteria 1190
1432 Ga0495629_0695599 3300046459 Bacteria 675
1433 Ga0495638_0049888 3300046460 Bacteria 2615
1434 Ga0495638_0118662 3300046460 Bacteria 1565
1435 Ga0495638_0251119 3300046460 Bacteria 975
1436 Ga0495641_0008332 3300046461 Bacteria 6337
1437 Ga0495641_0013098 3300046461 Bacteria 4583
1438 Ga0495641_0027940 3300046461 Bacteria 2735
1439 Ga0495651_0000007 3300046462 Bacteria 158577
1440 Ga0495651_0000079 3300046462 Bacteria 71581
1441 Ga0495651_0034997 3300046462 Bacteria 3913
1442 Ga0495651_0044140 3300046462 Bacteria 3455
1443 Ga0495651_0047991 3300046462 Bacteria 3298
1444 Ga0495651_0105233 3300046462 Bacteria 2093
1445 Ga0495651_0235360 3300046462 Bacteria 1259
1446 Ga0495651_0408707 3300046462 Bacteria 884
1447 Ga0495651_0446451 3300046462 Bacteria 836
1448 Ga0495651_0452362 3300046462 Bacteria 829
1449 Ga0495651_0552354 3300046462 Bacteria 731
1450 Ga0495653_0046082 3300046463 Bacteria 3376
1451 Ga0495653_0046578 3300046463 Bacteria 3357
1452 Ga0495653_0066610 3300046463 Bacteria 2708
1453 Ga0495653_0090526 3300046463 Bacteria 2238
1454 Ga0495653_0239989 3300046463 Bacteria 1208
1455 Ga0495653_0247654 3300046463 Bacteria 1184
1456 Ga0495653_0352192 3300046463 Bacteria 946
1457 Ga0495653_0769772 3300046463 Bacteria 580
1458 Ga0495580_0015098 3300046472 Bacteria 5844
1459 Ga0495580_0154805 3300046472 Bacteria 1587
1460 Ga0495580_0169758 3300046472 Bacteria 1508
1461 Ga0495580_0303167 3300046472 Bacteria 1087
1462 Ga0495582_0002158 3300046473 Bacteria 11007
1463 Ga0495582_0005432 3300046473 Bacteria 7111
1464 Ga0495582_0085008 3300046473 Bacteria 1759
1465 Ga0495582_0319741 3300046473 Bacteria 893
1466 Ga0495639_0010968 3300046475 Bacteria 3902
1467 Ga0495639_0081464 3300046475 Bacteria 1508
1468 Ga0495639_0143354 3300046475 Bacteria 1149
1469 Ga0495662_0002989 3300046476 Bacteria 8533
1470 Ga0495662_0008805 3300046476 Bacteria 4962
1471 Ga0495662_0020179 3300046476 Bacteria 3223
1472 Ga0495662_0020438 3300046476 Bacteria 3202
1473 Ga0495662_0035526 3300046476 Bacteria 2404
1474 Ga0495662_0179222 3300046476 Bacteria 1044
1475 Ga0495664_0003530 3300046477 Bacteria 8528
1476 Ga0495664_0020885 3300046477 Bacteria 3780
1477 Ga0495664_0091512 3300046477 Bacteria 1828
1478 Ga0495664_0117975 3300046477 Bacteria 1604
1479 Ga0495664_0134953 3300046477 Bacteria 1495
1480 Ga0495664_0194739 3300046477 Bacteria 1228
1481 Ga0495664_0422355 3300046477 Bacteria 800
1482 Ga0495585_0013695 3300046492 Bacteria 4740
1483 Ga0495585_0042588 3300046492 Bacteria 2542
1484 Ga0495585_0059459 3300046492 Bacteria 2106
1485 Ga0495585_0202801 3300046492 Bacteria 1009
1486 Ga0495594_0012305 3300046499 Bacteria 4458
1487 Ga0495594_0013501 3300046499 Bacteria 4267
1488 Ga0495594_0019227 3300046499 Bacteria 3628
1489 Ga0495594_0055542 3300046499 Bacteria 2183
1490 Ga0495594_0140826 3300046499 Bacteria 1368
1491 Ga0495594_0471433 3300046499 Bacteria 714
1492 Ga0495594_0783896 3300046499 Bacteria 537
1493 Ga0495607_0042933 3300046501 Bacteria 2677
1494 Ga0495608_0000076 3300046511 Bacteria 74854
1495 Ga0495608_0009966 3300046511 Bacteria 6634
1496 Ga0495608_0040008 3300046511 Bacteria 3141
1497 Ga0495608_0067448 3300046511 Bacteria 2340
1498 Ga0495608_0157894 3300046511 Bacteria 1443
1499 Ga0495608_0208708 3300046511 Bacteria 1228
1500 Ga0495608_0447957 3300046511 Bacteria 786
1501 Ga0495608_0627494 3300046511 Bacteria 643
1502 Ga0495618_0007856 3300046514 Bacteria 6457
1503 Ga0495618_0022729 3300046514 Bacteria 3873
1504 Ga0495618_0106122 3300046514 Bacteria 1798
1505 Ga0495618_0255728 3300046514 Bacteria 1098
1506 Ga0495618_0387054 3300046514 Bacteria 857
1507 Ga0495618_0569619 3300046514 Bacteria 676
1508 Ga0495620_0110578 3300046515 Bacteria 1089
1509 Ga0495628_0001215 3300046516 Bacteria 23569
1510 Ga0495628_0005605 3300046516 Bacteria 10993
1511 Ga0495628_0010042 3300046516 Bacteria 8055
1512 Ga0495628_0021216 3300046516 Bacteria 5347
1513 Ga0495628_0103086 3300046516 Bacteria 2200
1514 Ga0495628_0137701 3300046516 Bacteria 1864
1515 Ga0495628_0156972 3300046516 Bacteria 1730
1516 Ga0495628_0584191 3300046516 Bacteria 799
1517 Ga0495630_0008315 3300046517 Bacteria 7449
1518 Ga0495630_0025191 3300046517 Bacteria 4397
1519 Ga0495630_0032183 3300046517 Bacteria 3906
1520 Ga0495630_0217395 3300046517 Bacteria 1459
1521 Ga0495630_0307930 3300046517 Bacteria 1210
1522 Ga0495630_0844286 3300046517 Bacteria 698
1523 Ga0495630_1402619 3300046517 Bacteria 525
1524 Ga0495631_0139636 3300046518 Bacteria 1040
1525 Ga0495631_0219806 3300046518 Bacteria 811
1526 Ga0495631_0260618 3300046518 Bacteria 739
1527 Ga0495637_0105712 3300046520 Bacteria 1096
1528 Ga0495643_0211792 3300046522 Bacteria 924
1529 Ga0495666_0003384 3300046526 Bacteria 8041
1530 Ga0495666_0058823 3300046526 Bacteria 1838
1531 Ga0495666_0129992 3300046526 Bacteria 1177
1532 Ga0495666_0149655 3300046526 Bacteria 1085
1533 Ga0495666_0313549 3300046526 Bacteria 708
1534 Ga0495666_0374085 3300046526 Bacteria 641
1535 Ga0495652_0000168 3300046529 Bacteria 74913
1536 Ga0495652_0003588 3300046529 Bacteria 15221
1537 Ga0495652_0040527 3300046529 Bacteria 4025
1538 Ga0495652_0059422 3300046529 Bacteria 3234
1539 Ga0495652_0083184 3300046529 Bacteria 2635
1540 Ga0495652_0146356 3300046529 Bacteria 1851
1541 Ga0495652_0273460 3300046529 Bacteria 1240
1542 Ga0495652_0352690 3300046529 Bacteria 1053
1543 Ga0495652_0399634 3300046529 Bacteria 973
1544 Ga0495652_0559306 3300046529 Bacteria 785
1545 Ga0495652_0597782 3300046529 Bacteria 753
1546 Ga0495665_0002190 3300046531 Bacteria 10572
1547 Ga0495665_0004007 3300046531 Bacteria 7943
1548 Ga0495665_0055065 3300046531 Bacteria 2101
1549 Ga0495665_0173646 3300046531 Bacteria 1121
1550 Ga0495665_0634612 3300046531 Bacteria 532
1551 Ga0495640_0017135 3300046533 Bacteria 5406
1552 Ga0495640_0029098 3300046533 Bacteria 3970
1553 Ga0495640_0054496 3300046533 Bacteria 2738
1554 Ga0495640_0054695 3300046533 Bacteria 2732
1555 Ga0495640_0206494 3300046533 Bacteria 1243
1556 Ga0495586_0005311 3300046535 Bacteria 6889
1557 Ga0495586_0008958 3300046535 Bacteria 5327
1558 Ga0495586_0030648 3300046535 Bacteria 2879
1559 Ga0495586_0053081 3300046535 Bacteria 2195
1560 Ga0495586_0082387 3300046535 Bacteria 1769
1561 Ga0495586_0257410 3300046535 Bacteria 996
1562 Ga0495586_0355569 3300046535 Bacteria 841
1563 Ga0495586_0472462 3300046535 Bacteria 723
1564 Ga0495586_0881121 3300046535 Bacteria 516
1565 Ga0495587_0006741 3300046536 Bacteria 7476
1566 Ga0495587_0025931 3300046536 Bacteria 3577
1567 Ga0495587_0077239 3300046536 Bacteria 1933
1568 Ga0495587_0109041 3300046536 Bacteria 1591
1569 Ga0495587_0210367 3300046536 Bacteria 1098
1570 Ga0495587_0742135 3300046536 Bacteria 537
1571 Ga0495645_0013097 3300046543 Bacteria 5860
1572 Ga0495645_0022878 3300046543 Bacteria 4523
1573 Ga0495645_0059107 3300046543 Bacteria 2780
1574 Ga0495645_0368563 3300046543 Bacteria 921
1575 Ga0495645_0384113 3300046543 Bacteria 898
1576 Ga0495645_0395575 3300046543 Bacteria 881
1577 Ga0495622_0022827 3300046557 Bacteria 2916
1578 Ga0495622_0170550 3300046557 Bacteria 978
1579 Ga0495622_0443017 3300046557 Bacteria 557
1580 Ga0495667_0000072 3300046559 Bacteria 75080
1581 Ga0495667_0015012 3300046559 Bacteria 5230
1582 Ga0495667_0018766 3300046559 Bacteria 4668
1583 Ga0495667_0029452 3300046559 Bacteria 3696
1584 Ga0495667_0041818 3300046559 Bacteria 3038
1585 Ga0495667_0068317 3300046559 Bacteria 2320
1586 Ga0495667_0121316 3300046559 Bacteria 1687
1587 Ga0495656_0193205 3300046615 Bacteria 1006
1588 Ga0495656_0509219 3300046615 Bacteria 639
1589 Ga0495634_0020030 3300046642 Bacteria 4746
1590 Ga0495634_0026954 3300046642 Bacteria 4004
1591 Ga0495634_0027278 3300046642 Bacteria 3974
1592 Ga0495634_0033758 3300046642 Bacteria 3514
1593 Ga0495634_0179627 3300046642 Bacteria 1325
1594 Ga0495634_0189762 3300046642 Bacteria 1282
1595 Ga0495611_0033087 3300046648 Bacteria 2281
1596 Ga0495625_0222544 3300046660 Bacteria 1236
1597 Ga0495635_0002665 3300046663 Bacteria 12199
1598 Ga0495635_0020890 3300046663 Bacteria 4561
1599 Ga0495635_0112703 3300046663 Bacteria 1857
1600 Ga0495635_0124402 3300046663 Bacteria 1758
1601 Ga0495635_0180933 3300046663 Bacteria 1433
1602 Ga0495635_0204784 3300046663 Bacteria 1337
1603 Ga0495635_0962288 3300046663 Bacteria 544
1604 Ga0495661_0170131 3300046665 Bacteria 1163
1605 Ga0495588_0067287 3300046674 Bacteria 1859
1606 Ga0495588_0078571 3300046674 Bacteria 1721
1607 Ga0495588_0451689 3300046674 Bacteria 674
1608 Ga0495588_0645247 3300046674 Bacteria 554
1609 Ga0495588_0684305 3300046674 Bacteria 536
1610 Ga0495657_0000424 3300046675 Bacteria 39370
1611 Ga0495657_0002584 3300046675 Bacteria 15156
1612 Ga0495657_0020458 3300046675 Bacteria 4755
1613 Ga0495657_0028016 3300046675 Bacteria 3966
1614 Ga0495657_0042001 3300046675 Bacteria 3125
1615 Ga0495657_0046215 3300046675 Bacteria 2949
1616 Ga0495657_0115442 3300046675 Bacteria 1696
1617 Ga0495657_0314532 3300046675 Bacteria 931
1618 Ga0495657_0320965 3300046675 Bacteria 920
1619 Ga0495599_0000062 3300046678 Bacteria 74940
1620 Ga0495599_0021197 3300046678 Bacteria 4053
1621 Ga0495599_0022810 3300046678 Bacteria 3909
1622 Ga0495599_0026841 3300046678 Bacteria 3610
1623 Ga0495599_0035257 3300046678 Bacteria 3140
1624 Ga0495599_0074779 3300046678 Bacteria 2115
1625 Ga0495599_0276693 3300046678 Bacteria 1017
1626 Ga0495599_0869618 3300046678 Bacteria 512
1627 Ga0495623_0000777 3300046679 Bacteria 21383
1628 Ga0495623_0003796 3300046679 Bacteria 9951
1629 Ga0495623_0048459 3300046679 Bacteria 2694
1630 Ga0495623_0059079 3300046679 Bacteria 2409
1631 Ga0495623_0061932 3300046679 Bacteria 2345
1632 Ga0495623_0083855 3300046679 Bacteria 1967
1633 Ga0495623_0104972 3300046679 Bacteria 1718
1634 Ga0495623_0290995 3300046679 Bacteria 905
1635 Ga0495623_0379528 3300046679 Bacteria 764
1636 Ga0495623_0435910 3300046679 Bacteria 700
1637 Ga0495646_0007097 3300046680 Bacteria 7118
1638 Ga0495646_0059352 3300046680 Bacteria 2284
1639 Ga0495646_0078693 3300046680 Bacteria 1926
1640 Ga0495646_0158769 3300046680 Bacteria 1253
1641 Ga0495646_0188431 3300046680 Bacteria 1129
1642 Ga0495646_0193027 3300046680 Bacteria 1112
1643 Ga0495646_0196394 3300046680 Bacteria 1100
1644 Ga0495646_0357357 3300046680 Bacteria 764
1645 Ga0495647_0356750 3300046681 Bacteria 666
1646 Ga0495647_0569406 3300046681 Bacteria 530
1647 Ga0495658_0069348 3300046683 Bacteria 2043
1648 Ga0495658_0157765 3300046683 Bacteria 1397
1649 Ga0495658_0415133 3300046683 Bacteria 858
1650 Ga0495613_0009407 3300046689 Bacteria 7249
1651 Ga0495613_0011441 3300046689 Bacteria 6596
1652 Ga0495613_0034690 3300046689 Bacteria 3746
1653 Ga0495613_0084477 3300046689 Bacteria 2304
1654 Ga0495613_0129270 3300046689 Bacteria 1809
1655 Ga0495613_0138981 3300046689 Bacteria 1736
1656 Ga0495613_0237480 3300046689 Bacteria 1275
1657 Ga0495613_0645089 3300046689 Bacteria 701
1658 Ga0495624_0006967 3300046690 Bacteria 7972
1659 Ga0495624_0006974 3300046690 Bacteria 7970
1660 Ga0495624_0017325 3300046690 Bacteria 4838
1661 Ga0495624_0027762 3300046690 Bacteria 3703
1662 Ga0495624_0146888 3300046690 Bacteria 1443
1663 Ga0495624_0563981 3300046690 Bacteria 680
1664 Ga0495670_0013056 3300046691 Bacteria 4084
1665 Ga0495670_0020026 3300046691 Bacteria 3297
1666 Ga0495671_0161446 3300046692 Bacteria 1090
1667 Ga0495649_0402218 3300046694 Bacteria 687
1668 Ga0495589_0221108 3300046794 Bacteria 889
1669 Ga0495589_0335128 3300046794 Bacteria 698
1670 Ga0495589_0521254 3300046794 Bacteria 542
1671 Ga0495600_0008443 3300046809 Bacteria 6327
1672 Ga0495600_0010085 3300046809 Bacteria 5856
1673 Ga0495600_0024163 3300046809 Bacteria 3910
1674 Ga0495600_0043077 3300046809 Bacteria 2943
1675 Ga0495600_0045437 3300046809 Bacteria 2865
1676 Ga0495600_0236626 3300046809 Bacteria 1164
1677 Ga0495600_0244884 3300046809 Bacteria 1141
1678 Ga0495600_0280645 3300046809 Bacteria 1054
1679 Ga0495660_0322596 3300046810 Bacteria 693
1680 Ga0495581_0010953 3300047315 Bacteria 5240
1681 Ga0495581_0027064 3300047315 Bacteria 3325
1682 Ga0495581_0121582 3300047315 Bacteria 1519
1683 Ga0495581_0428420 3300047315 Bacteria 771
1684 Ga0495604_0000062 3300047317 Bacteria 93264
1685 Ga0495604_0011814 3300047317 Bacteria 6946
1686 Ga0495604_0022655 3300047317 Bacteria 5015
1687 Ga0495604_0062529 3300047317 Bacteria 2843
1688 Ga0495604_0175014 3300047317 Bacteria 1505
1689 Ga0495604_0216151 3300047317 Bacteria 1322
1690 Ga0495604_0242504 3300047317 Bacteria 1231
1691 Ga0495604_0544271 3300047317 Bacteria 749
1692 Ga0495636_0085601 3300047318 Bacteria 1362
1693 Ga0495636_0256394 3300047318 Bacteria 810
1694 Ga0495674_0007071 3300047319 Bacteria 10735
1695 Ga0495674_0028482 3300047319 Bacteria 5091
1696 Ga0495674_0113536 3300047319 Bacteria 2294
1697 Ga0495674_0134153 3300047319 Bacteria 2084
1698 Ga0495674_0174539 3300047319 Bacteria 1792
1699 Ga0495674_0302329 3300047319 Bacteria 1306
1700 Ga0495674_0379116 3300047319 Bacteria 1144
1701 Ga0495676_0029254 3300047321 Bacteria 4692
1702 Ga0495676_0038718 3300047321 Bacteria 3957
1703 Ga0495676_0090636 3300047321 Bacteria 2287
1704 Ga0495676_0509018 3300047321 Bacteria 789
1705 Ga0495676_0811775 3300047321 Bacteria 602
1706 Ga0495676_0838847 3300047321 Bacteria 590
1707 Ga0495676_0959964 3300047321 Bacteria 546
1708 Ga0495680_0000101 3300047322 Bacteria 78550
1709 Ga0495680_0012972 3300047322 Bacteria 7296
1710 Ga0495680_0030458 3300047322 Bacteria 4405
1711 Ga0495680_0066746 3300047322 Bacteria 2752
1712 Ga0495680_0158901 3300047322 Bacteria 1642
1713 Ga0495680_0357554 3300047322 Bacteria 1015
1714 Ga0495680_0453200 3300047322 Bacteria 877
1715 Ga0495683_0127665 3300047323 Bacteria 1202
1716 Ga0495683_0226451 3300047323 Bacteria 831
1717 Ga0495687_014847 3300047443 Bacteria 3982
1718 Ga0495687_044422 3300047443 Bacteria 1931
1719 Ga0495675_0001304 3300047444 Bacteria 15104
1720 Ga0495675_0009960 3300047444 Bacteria 5927
1721 Ga0495675_0021462 3300047444 Bacteria 4112
1722 Ga0495675_0022793 3300047444 Bacteria 3992
1723 Ga0495675_0028408 3300047444 Bacteria 3565
1724 Ga0495675_0033104 3300047444 Bacteria 3298
1725 Ga0495675_0064305 3300047444 Bacteria 2320
1726 Ga0495675_0423473 3300047444 Bacteria 773
1727 Ga0495685_005390 3300047447 Bacteria 4174
1728 Ga0495685_022256 3300047447 Bacteria 2181
1729 Ga0495685_138526 3300047447 Bacteria 793
1730 Ga0495685_211284 3300047447 Bacteria 620
1731 Ga0495681_0211603 3300047470 Bacteria 781
1732 Ga0495684_0010492 3300047471 Bacteria 7165
1733 Ga0495684_0022686 3300047471 Bacteria 4828
1734 Ga0495684_0100367 3300047471 Bacteria 2188
1735 Ga0495684_0168641 3300047471 Bacteria 1629
1736 Ga0495684_0391701 3300047471 Bacteria 977
1737 Ga0495684_0412100 3300047471 Bacteria 946
1738 Ga0495686_0024806 3300047472 Bacteria 3935
1739 Ga0495593_0005748 3300047673 Bacteria 7320
1740 Ga0495593_0008680 3300047673 Bacteria 5907
1741 Ga0495593_0019207 3300047673 Bacteria 3833
1742 Ga0495593_0112896 3300047673 Bacteria 1386
1743 Ga0495602_0000115 3300048088 Bacteria 75982
1744 Ga0495602_0013494 3300048088 Bacteria 8348
1745 Ga0495602_0078195 3300048088 Bacteria 2794
1746 Ga0495602_0085778 3300048088 Bacteria 2630
1747 Ga0495602_0169551 3300048088 Bacteria 1695
1748 Ga0495602_0636795 3300048088 Bacteria 729
1749 Ga0495602_0648191 3300048088 Bacteria 721
1750 Ga0495602_0779261 3300048088 Bacteria 643
1751 Ga0495614_0016031 3300048089 Bacteria 3263
1752 Ga0495614_0075784 3300048089 Bacteria 1454
1753 Ga0495614_0106237 3300048089 Bacteria 1230
1754 Ga0495614_0165911 3300048089 Bacteria 989
1755 Ga0495614_0395590 3300048089 Bacteria 649
1756 Ga0495626_0395030 3300048091 Bacteria 535
1757 Ga0496100_0225359 3300048903 Bacteria 1377
1758 Ga0496100_0267539 3300048903 Bacteria 1270
1759 Ga0496100_0418829 3300048903 Bacteria 1022
1760 Ga0496100_0498592 3300048903 Bacteria 938
1761 Ga0496101_0133559 3300048904 Bacteria 1886
1762 Ga0496101_0253562 3300048904 Bacteria 1371
1763 Ga0496101_0552835 3300048904 Bacteria 910
1764 Ga0496101_0977712 3300048904 Bacteria 666
1765 Ga0496102_0008136 3300048905 Bacteria 8974
1766 Ga0496102_0144707 3300048905 Bacteria 2230
1767 Ga0496102_0190191 3300048905 Bacteria 1934
1768 Ga0496102_0666327 3300048905 Bacteria 963
1769 Ga0496102_0755743 3300048905 Bacteria 895
1770 Ga0496102_0947438 3300048905 Bacteria 782
1771 Ga0496102_1210177 3300048905 Bacteria 675
1772 Ga0496103_0058025 3300048906 Bacteria 2404
1773 Ga0496103_0171518 3300048906 Bacteria 1393
1774 Ga0496103_0545441 3300048906 Bacteria 740
1775 Ga0496103_0954846 3300048906 Bacteria 535
1776 Ga0496104_0193546 3300048907 Bacteria 1945
1777 Ga0496104_0256480 3300048907 Bacteria 1661
1778 Ga0496104_0268139 3300048907 Bacteria 1620
1779 Ga0496104_0307286 3300048907 Bacteria 1498
1780 Ga0496104_1876195 3300048907 Bacteria 501
1781 Ga0496105_0001951 3300048908 Bacteria 14812
1782 Ga0496105_0067234 3300048908 Bacteria 2959
1783 Ga0496105_0685997 3300048908 Bacteria 787
1784 Ga0496105_1059263 3300048908 Bacteria 604
1785 Ga0496106_0044619 3300048909 Bacteria 3328
1786 Ga0496106_0058655 3300048909 Bacteria 2914
1787 Ga0496106_0059467 3300048909 Bacteria 2895
1788 Ga0496106_0131596 3300048909 Bacteria 1962
1789 Ga0496106_0718939 3300048909 Bacteria 795
1790 Ga0496106_0842165 3300048909 Bacteria 726
1791 Ga0496107_0153111 3300048910 Bacteria 1706
1792 Ga0496107_0176672 3300048910 Bacteria 1585
1793 Ga0496107_0294675 3300048910 Bacteria 1207
1794 Ga0496108_0016852 3300048911 Bacteria 5971
1795 Ga0496108_0046337 3300048911 Bacteria 3632
1796 Ga0496108_0071716 3300048911 Bacteria 2923
1797 Ga0496108_1121815 3300048911 Bacteria 667
1798 Ga0496108_1381098 3300048911 Bacteria 590
1799 Ga0496109_0014763 3300048912 Bacteria 6796
1800 Ga0496109_0078823 3300048912 Bacteria 3033
1801 Ga0496109_0106641 3300048912 Bacteria 2602
1802 Ga0496109_0418089 3300048912 Bacteria 1266
1803 Ga0496109_0923171 3300048912 Bacteria 811
1804 Ga0496109_1261090 3300048912 Bacteria 675
1805 Ga0496109_1489189 3300048912 Bacteria 612
1806 Ga0496110_0130544 3300048913 Bacteria 2268
1807 Ga0496110_0256284 3300048913 Bacteria 1592
1808 Ga0496110_0452662 3300048913 Bacteria 1170
1809 Ga0496110_0915618 3300048913 Bacteria 783
1810 Ga0496111_0000966 3300048914 Bacteria 15698
1811 Ga0496111_0047485 3300048914 Bacteria 3092
1812 Ga0496111_0638406 3300048914 Bacteria 777
1813 Ga0496111_1110594 3300048914 Bacteria 563
1814 Ga0496112_0029297 3300048915 Bacteria 5323
1815 Ga0496112_0201674 3300048915 Bacteria 1948
1816 Ga0496112_0668870 3300048915 Bacteria 967
1817 Ga0496112_1346837 3300048915 Bacteria 629
1818 Ga0496112_1394456 3300048915 Bacteria 615
1819 Ga0496112_1901542 3300048915 Bacteria 506
1820 Ga0496113_0103401 3300048916 Bacteria 2209
1821 Ga0496113_0246203 3300048916 Bacteria 1427
1822 Ga0496113_0412533 3300048916 Bacteria 1084
1823 Ga0496113_0470773 3300048916 Bacteria 1009
1824 Ga0496113_1002278 3300048916 Bacteria 658
1825 Ga0496114_0237928 3300048917 Bacteria 1600
1826 Ga0496114_0337413 3300048917 Bacteria 1332
1827 Ga0496114_0685415 3300048917 Bacteria 899
1828 Ga0496114_0866278 3300048917 Bacteria 784
1829 Ga0496114_1531513 3300048917 Bacteria 555
1830 Ga0496115_0030212 3300048918 Bacteria 4261
1831 Ga0496115_0143568 3300048918 Bacteria 1969
1832 Ga0496115_0441847 3300048918 Bacteria 1052
1833 Ga0496115_0589125 3300048918 Bacteria 885
1834 Ga0496126_0021509 3300048929 Bacteria 6299
1835 Ga0496126_0044968 3300048929 Bacteria 4061
1836 Ga0496126_0810372 3300048929 Bacteria 717
1837 Ga0496126_0976717 3300048929 Bacteria 637
1838 Ga0501306_082899 3300049127 Bacteria 555
1839 Ga0501291_064155 3300049514 Bacteria 698
1840 Ga0501311_084530 3300049527 Bacteria 544
1841 Ga0501312_040992 3300049528 Bacteria 757
1842 Ga0501315_082529 3300049531 Bacteria 548
1843 Ga0501317_035088 3300049533 Bacteria 745
1844 Ga0501318_044439 3300049534 Bacteria 644
1845 Ga0501031_0002572 3300049568 Bacteria 11555
1846 Ga0501031_0085553 3300049568 Bacteria 2056
1847 Ga0501031_0196816 3300049568 Bacteria 1315
1848 Ga0501031_0342624 3300049568 Bacteria 967
1849 Ga0501031_0721815 3300049568 Bacteria 639
1850 Ga0501032_0001212 3300049569 Bacteria 20635
1851 Ga0501032_0004014 3300049569 Bacteria 11159
1852 Ga0501032_0061569 3300049569 Bacteria 2515
1853 Ga0501032_0083428 3300049569 Bacteria 2125
1854 Ga0501032_0216319 3300049569 Bacteria 1248
1855 Ga0501032_0292527 3300049569 Bacteria 1054
1856 Ga0501032_0731608 3300049569 Bacteria 626
1857 Ga0501033_0008061 3300049570 Bacteria 8158
1858 Ga0501033_0038694 3300049570 Bacteria 3563
1859 Ga0501033_0043629 3300049570 Bacteria 3339
1860 Ga0501033_0102595 3300049570 Bacteria 2086
1861 Ga0501033_0121268 3300049570 Bacteria 1897
1862 Ga0501033_0487639 3300049570 Bacteria 853
1863 Ga0501033_0608994 3300049570 Bacteria 748
1864 Ga0501033_1028924 3300049570 Bacteria 550
1865 Ga0501034_0006278 3300049571 Bacteria 12789
1866 Ga0501034_0035629 3300049571 Bacteria 5044
1867 Ga0501034_0092435 3300049571 Bacteria 3022
1868 Ga0501034_0135532 3300049571 Bacteria 2443
1869 Ga0501034_0204269 3300049571 Bacteria 1932
1870 Ga0501034_0770472 3300049571 Bacteria 856
1871 Ga0501036_0008586 3300049572 Bacteria 8379
1872 Ga0501036_0026259 3300049572 Bacteria 4914
1873 Ga0501036_0070822 3300049572 Bacteria 2948
1874 Ga0501036_0136997 3300049572 Bacteria 2066
1875 Ga0501036_0287623 3300049572 Bacteria 1375
1876 Ga0501036_0404226 3300049572 Bacteria 1139
1877 Ga0501036_0636340 3300049572 Bacteria 883
1878 Ga0501036_0771568 3300049572 Bacteria 792
1879 Ga0501036_1290684 3300049572 Bacteria 593
1880 Ga0501037_0000836 3300049573 Bacteria 23004
1881 Ga0501037_0028438 3300049573 Bacteria 4129
1882 Ga0501037_0038085 3300049573 Bacteria 3544
1883 Ga0501037_0047762 3300049573 Bacteria 3136
1884 Ga0501038_0012780 3300049574 Bacteria 7668
1885 Ga0501038_0038303 3300049574 Bacteria 4199
1886 Ga0501038_0098123 3300049574 Bacteria 2443
1887 Ga0501038_0202701 3300049574 Bacteria 1591
1888 Ga0501038_0381674 3300049574 Bacteria 1093
1889 Ga0501038_0432279 3300049574 Bacteria 1014
1890 Ga0501039_0007687 3300049575 Bacteria 8228
1891 Ga0501039_0186535 3300049575 Bacteria 1631
1892 Ga0501039_0356373 3300049575 Bacteria 1149
1893 Ga0501039_0373550 3300049575 Bacteria 1120
1894 Ga0501039_0409181 3300049575 Bacteria 1065
1895 Ga0501039_0720933 3300049575 Bacteria 779
1896 Ga0501039_0774360 3300049575 Bacteria 749
1897 Ga0501040_0007931 3300049576 Bacteria 6886
1898 Ga0501040_0029885 3300049576 Bacteria 3678
1899 Ga0501040_0057922 3300049576 Bacteria 2661
1900 Ga0501041_0001518 3300049577 Bacteria 12874
1901 Ga0501041_0254296 3300049577 Bacteria 1104
1902 Ga0501042_0015097 3300049578 Bacteria 5281
1903 Ga0501042_0121418 3300049578 Bacteria 1881
1904 Ga0501042_0140483 3300049578 Bacteria 1741
1905 Ga0501042_0312857 3300049578 Bacteria 1134
1906 Ga0501043_0005580 3300049579 Bacteria 10135
1907 Ga0501043_0032328 3300049579 Bacteria 4113
1908 Ga0501043_0062990 3300049579 Bacteria 2912
1909 Ga0501043_0176885 3300049579 Bacteria 1663
1910 Ga0501043_0252718 3300049579 Bacteria 1357
1911 Ga0501043_0314179 3300049579 Bacteria 1195
1912 Ga0501043_0412595 3300049579 Bacteria 1019
1913 Ga0501046_0037516 3300049580 Bacteria 3893
1914 Ga0501046_0119453 3300049580 Bacteria 2007
1915 Ga0501046_0143575 3300049580 Bacteria 1804
1916 Ga0501046_0494625 3300049580 Bacteria 876
1917 Ga0501047_0000072 3300049581 Bacteria 126542
1918 Ga0501047_0001607 3300049581 Bacteria 22028
1919 Ga0501047_0070941 3300049581 Bacteria 3353
1920 Ga0501047_0152655 3300049581 Bacteria 2184
1921 Ga0501047_0169702 3300049581 Bacteria 2051
1922 Ga0501047_0384844 3300049581 Bacteria 1237
1923 Ga0501048_0011519 3300049582 Bacteria 6593
1924 Ga0501048_0015295 3300049582 Bacteria 5666
1925 Ga0501048_0037211 3300049582 Bacteria 3494
1926 Ga0501048_0704370 3300049582 Bacteria 725
1927 Ga0501067_0013763 3300049583 Bacteria 4479
1928 Ga0501068_0003236 3300049584 Bacteria 8730
1929 Ga0501068_0333682 3300049584 Bacteria 973
1930 Ga0501068_0493369 3300049584 Bacteria 794
1931 Ga0501069_0017860 3300049585 Bacteria 3825
1932 Ga0501069_0031481 3300049585 Bacteria 2917
1933 Ga0501069_0305289 3300049585 Bacteria 934
1934 Ga0501070_0005040 3300049586 Bacteria 11267
1935 Ga0501070_0008482 3300049586 Bacteria 8684
1936 Ga0501070_0009153 3300049586 Bacteria 8375
1937 Ga0501070_0012340 3300049586 Bacteria 7208
1938 Ga0501070_0012975 3300049586 Bacteria 7023
1939 Ga0501070_0031412 3300049586 Bacteria 4450
1940 Ga0501070_0845307 3300049586 Bacteria 716
1941 Ga0501070_1474102 3300049586 Bacteria 515
1942 Ga0501071_0006687 3300049587 Bacteria 7492
1943 Ga0501071_0205182 3300049587 Bacteria 1481
1944 Ga0501071_0244047 3300049587 Bacteria 1355
1945 Ga0501071_0689739 3300049587 Bacteria 786
1946 Ga0501072_0001898 3300049588 Bacteria 15570
1947 Ga0501072_0267605 3300049588 Bacteria 1360
1948 Ga0501072_0333566 3300049588 Bacteria 1205
1949 Ga0501073_0009415 3300049589 Bacteria 7213
1950 Ga0501073_0015567 3300049589 Bacteria 5517
1951 Ga0501073_0771727 3300049589 Bacteria 663
1952 Ga0501074_0000607 3300049590 Bacteria 22272
1953 Ga0501074_0006705 3300049590 Bacteria 8310
1954 Ga0501074_0016000 3300049590 Bacteria 5452
1955 Ga0501074_0076631 3300049590 Bacteria 2400
1956 Ga0501074_0080253 3300049590 Bacteria 2341
1957 Ga0501075_0011003 3300049591 Bacteria 6384
1958 Ga0501075_0020072 3300049591 Bacteria 4854
1959 Ga0501076_0003333 3300049592 Bacteria 11268
1960 Ga0501076_0035235 3300049592 Bacteria 3916
1961 Ga0501076_0424529 3300049592 Bacteria 1094
1962 Ga0501076_0549399 3300049592 Bacteria 952
1963 Ga0501076_0644736 3300049592 Bacteria 874
1964 Ga0501077_0019671 3300049593 Bacteria 4271
1965 Ga0501077_0023052 3300049593 Bacteria 3948
1966 Ga0501235_008627 3300049669 Bacteria 2225
1967 Ga0501251_022715 3300049681 Bacteria 845
1968 Ga0501261_034512 3300049690 Bacteria 777
1969 Ga0501079_0000029 3300049741 Bacteria 60538
1970 Ga0501079_0007167 3300049741 Bacteria 8417
1971 Ga0501079_0328774 3300049741 Bacteria 1197
1972 Ga0501080_0006601 3300049742 Bacteria 10427
1973 Ga0501080_0013816 3300049742 Bacteria 7434
1974 Ga0501080_0121371 3300049742 Bacteria 2421
1975 Ga0501080_0193663 3300049742 Bacteria 1867
1976 Ga0501080_0639037 3300049742 Bacteria 942
1977 Ga0501080_1383399 3300049742 Bacteria 601
1978 Ga0501080_1407600 3300049742 Bacteria 595
1979 Ga0501081_0076315 3300049743 Bacteria 2340
1980 Ga0501083_0383782 3300049744 Bacteria 914
1981 Ga0501282_001694 3300049778 Bacteria 2435
1982 Ga0501035_0005086 3300049822 Bacteria 12462
1983 Ga0501035_0012487 3300049822 Bacteria 7847
1984 Ga0501035_0024124 3300049822 Bacteria 5579
1985 Ga0501035_0111057 3300049822 Bacteria 2403
1986 Ga0501035_0132132 3300049822 Bacteria 2175
1987 Ga0501035_0298983 3300049822 Bacteria 1356
1988 Ga0501035_0479587 3300049822 Bacteria 1026
1989 Ga0501044_0005927 3300049823 Bacteria 13541
1990 Ga0501044_0007860 3300049823 Bacteria 11729
1991 Ga0501044_0050036 3300049823 Bacteria 4313
1992 Ga0501044_0059401 3300049823 Bacteria 3918
1993 Ga0501044_0065905 3300049823 Bacteria 3693
1994 Ga0501044_0091036 3300049823 Bacteria 3076
1995 Ga0501044_0092812 3300049823 Bacteria 3044
1996 Ga0501044_0203538 3300049823 Bacteria 1937
1997 Ga0501044_0210357 3300049823 Bacteria 1899
1998 Ga0501044_0237979 3300049823 Bacteria 1765
1999 Ga0501044_0777924 3300049823 Bacteria 838
2000 Ga0501045_0014996 3300049824 Bacteria 5499
2001 Ga0501045_0037572 3300049824 Bacteria 3520
2002 Ga0501045_0348642 3300049824 Bacteria 1102
2003 Ga0501045_0553357 3300049824 Bacteria 853
2004 Ga0501045_0801738 3300049824 Bacteria 693
2005 nmdc:mga03683_331178_c1 3300050489 Bacteria 718
2006 nmdc:mga03n38_71279_c1 3300050490 Bacteria 1609
2007 nmdc:mga0yw44_371395_c1 3300050492 Bacteria 965
2008 nmdc:mga05p37_1302285_c1 3300050507 Bacteria 741
2009 nmdc:mga05p37_1677414_c1 3300050507 Bacteria 621
2010 nmdc:mga05p37_2012723_c1 3300050507 Bacteria 546
2011 nmdc:mga05p37_425422_c1 3300050507 Unclassified 1544
2012 nmdc:mga05p37_4279_c1 3300050507 Bacteria 16672
2013 nmdc:mga05p37_728152_c1 3300050507 Bacteria 1097
2014 nmdc:mga09592_21197_c1 3300050508 Bacteria 5354
2015 nmdc:mga09592_326452_c1 3300050508 Bacteria 1329
2016 nmdc:mga08y16_142507_c1 3300050511 Bacteria 2491
2017 nmdc:mga08y16_52073_c1 3300050511 Bacteria 4284
2018 nmdc:mga08y16_735505_c1 3300050511 Bacteria 984
2019 nmdc:mga0n895_1080559_c1 3300050512 Bacteria 780
2020 nmdc:mga0n895_1231098_c1 3300050512 Bacteria 722
2021 nmdc:mga0n895_149115_c1 3300050512 Bacteria 2368
2022 nmdc:mga0n895_347695_c1 3300050512 Bacteria 1502
2023 nmdc:mga0n895_63544_c1 3300050512 Bacteria 3651
2024 nmdc:mga0n895_7764_c1 3300050512 Bacteria 9243
2025 nmdc:mga0rr50_103846_c1 3300050513 Bacteria 2238
2026 nmdc:mga0rr50_1174000_c1 3300050513 Bacteria 652
2027 nmdc:mga0rr50_1483984_c1 3300050513 Bacteria 573
2028 nmdc:mga0rr50_1831282_c1 3300050513 Bacteria 511
2029 nmdc:mga0rr50_4305_c1 3300050513 Bacteria 8339
2030 nmdc:mga0rr50_9965_c1 3300050513 Bacteria 6007
2031 nmdc:mga08x19_107348_c1 3300050514 Bacteria 1859
2032 nmdc:mga08x19_15062_c1 3300050514 Bacteria 4697
2033 nmdc:mga08x19_16720_c1 3300050514 Bacteria 4479
2034 nmdc:mga08x19_308513_c1 3300050514 Bacteria 1100
2035 nmdc:mga08x19_382382_c1 3300050514 Bacteria 986
2036 nmdc:mga0a205_306282_c1 3300050515 Bacteria 1461
2037 nmdc:mga0a205_312603_c1 3300050515 Bacteria 1443
2038 nmdc:mga0a205_362154_c1 3300050515 Bacteria 1317
2039 nmdc:mga0a205_618_c1 3300050515 Bacteria 28265
2040 nmdc:mga0a205_81627_c1 3300050515 Bacteria 3123
2041 Ga0495601_0039256 3300053077 Bacteria 2964
2042 Ga0495601_0053846 3300053077 Bacteria 2544
2043 Ga0495601_0151747 3300053077 Bacteria 1512
2044 Ga0495601_0264047 3300053077 Bacteria 1123
2045 Ga0495601_0734996 3300053077 Bacteria 628
2046 Ga0495601_0802431 3300053077 Bacteria 597
2047 Ga0495612_0001654 3300053078 Bacteria 9176
2048 Ga0495612_0003302 3300053078 Bacteria 6687
2049 Ga0495612_0028326 3300053078 Bacteria 2255
2050 Ga0495612_0095192 3300053078 Bacteria 1264
2051 Ga0495612_0228164 3300053078 Bacteria 825
2052 Ga0495655_0020718 3300053083 Bacteria 1479
2053 Ga0495655_0176416 3300053083 Bacteria 687
2054 Ga0495595_0003935 3300053084 Bacteria 5933
2055 Ga0495595_0087318 3300053084 Bacteria 1493
2056 Ga0495619_0007135 3300053085 Bacteria 7074
2057 Ga0495619_0014045 3300053085 Bacteria 5052
2058 Ga0495619_0067820 3300053085 Bacteria 2382
2059 Ga0495619_0092261 3300053085 Bacteria 2051
2060 Ga0495619_0245604 3300053085 Bacteria 1240
2061 Ga0495619_0699125 3300053085 Bacteria 689
2062 Ga0500583_0271553 3300053092 Bacteria 834
2063 Ga0500651_0403077 3300053093 Bacteria 768
2064 Ga0500566_0137313 3300053094 Bacteria 1301
2065 Ga0500641_0084013 3300053096 Bacteria 1354
2066 Ga0500641_0381705 3300053096 Bacteria 559
2067 Ga0500654_064920 3300053099 Bacteria 1833
2068 Ga0500553_118913 3300053101 Bacteria 1093
2069 Ga0500556_0401583 3300053104 Bacteria 526
2070 Ga0500558_067368 3300053106 Bacteria 1484
2071 Ga0500560_127497 3300053107 Bacteria 852
2072 Ga0500569_004143 3300053109 Bacteria 3026
2073 Ga0500594_0022448 3300053118 Bacteria 1592
2074 Ga0500614_017862 3300053123 Bacteria 1608
2075 Ga0500628_012677 3300053129 Bacteria 1557
2076 Ga0500652_008937 3300053131 Bacteria 3365
2077 Ga0500655_147778 3300053133 Bacteria 507
2078 Ga0500658_0003343 3300053134 Bacteria 6078
2079 Ga0500573_0065287 3300053140 Bacteria 2081
2080 Ga0500573_0137513 3300053140 Bacteria 1348
2081 Ga0500573_0320426 3300053140 Bacteria 766
2082 Ga0500579_018317 3300053143 Bacteria 4535
2083 Ga0500589_207773 3300053147 Bacteria 747
2084 Ga0500600_0032935 3300053149 Bacteria 3033
2085 Ga0500600_0295193 3300053149 Bacteria 697
2086 Ga0500603_105497 3300053150 Bacteria 842
2087 Ga0500616_0256946 3300053153 Bacteria 743
2088 Ga0500633_0000825 3300053160 Bacteria 5333
2089 Ga0500634_0050937 3300053161 Bacteria 2228
2090 Ga0500656_001561 3300053732 Bacteria 1992
2091 Ga0500587_002484 3300053739 Bacteria 2620
2092 Ga0501084_0004130 3300054114 Bacteria 11829
2093 Ga0501084_0048010 3300054114 Bacteria 3575
2094 Ga0501084_0110758 3300054114 Bacteria 2307
2095 Ga0501084_0284950 3300054114 Bacteria 1395
2096 Ga0501084_0891695 3300054114 Bacteria 748
2097 Ga0590075_003626 3300059424 Bacteria 3662
2098 Ga0587066_125493 3300059490 Bacteria 611
2099 Ga0587072_046729 3300059643 Bacteria 857
2100 Ga0587078_075059 3300059646 Bacteria 534
2101 Ga0587114_108277 3300059655 Bacteria 549
2102 Ga0587071_085205 3300060344 Bacteria 710
2103 Ga0587111_0019558 3300060346 Bacteria 1286
2104 Ga0501082_0008254 3300060353 Bacteria 8980
2105 Ga0501082_0188578 3300060353 Bacteria 1794
2106 Ga0501082_0689082 3300060353 Bacteria 894
2107 Ga0466962_0001597 3300061719 Bacteria 10609
2108 Ga0466962_0003215 3300061719 Bacteria 7762
2109 Ga0466962_0019804 3300061719 Bacteria 3233
2110 Ga0466962_0024928 3300061719 Bacteria 2871
2111 Ga0466962_0035029 3300061719 Bacteria 2403
2112 Ga0466962_0209981 3300061719 Bacteria 952
2113 Ga0466962_0567793 3300061719 Bacteria 577
2114 Ga0530510_0056005 3300061734 Bacteria 2848
2115 Ga0530510_0241313 3300061734 Bacteria 1345
2116 Ga0530510_1109580 3300061734 Bacteria 606
2117 Ga0530510_1135254 3300061734 Bacteria 599

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300004798 Ga0058859_11593662 Ga0058859_115936622 61
2 3300005367 Ga0070667_101456044 Ga0070667_1014560441 61
3 3300005842 Ga0068858_100398373 Ga0068858_1003983733 61
4 3300006880 Ga0075429_100995142 Ga0075429_1009951422 61
5 3300009011 Ga0105251_10009748 Ga0105251_100097482 61
6 3300009098 Ga0105245_10001105 Ga0105245_1000110516 61
7 3300009101 Ga0105247_10000156 Ga0105247_1000015661 61
8 3300009101 Ga0105247_10674909 Ga0105247_106749092 61
9 3300009147 Ga0114129_10672238 Ga0114129_106722382 61
10 3300009147 Ga0114129_11520112 Ga0114129_115201122 61
11 3300009148 Ga0105243_11886270 Ga0105243_118862702 61
12 3300009174 Ga0105241_10687614 Ga0105241_106876141 61
13 3300009176 Ga0105242_11683134 Ga0105242_116831342 61
14 3300009177 Ga0105248_10001256 Ga0105248_1000125612 61
15 3300009177 Ga0105248_12343562 Ga0105248_123435621 61
16 3300009551 Ga0105238_10378578 Ga0105238_103785782 61
17 3300009553 Ga0105249_12291228 Ga0105249_122912282 61
18 3300009553 Ga0105249_12308920 Ga0105249_123089202 61
19 3300009553 Ga0105249_12560354 Ga0105249_125603541 61
20 3300013296 Ga0157374_10551488 Ga0157374_105514882 61
21 3300013306 Ga0163162_10595887 Ga0163162_105958872 61
22 3300013306 Ga0163162_11226593 Ga0163162_112265932 61
23 3300013306 Ga0163162_12154867 Ga0163162_121548672 61
24 3300013308 Ga0157375_11036968 Ga0157375_110369682 61
25 3300014325 Ga0163163_10134524 Ga0163163_101345242 61
26 3300014745 Ga0157377_11014908 Ga0157377_110149081 61
27 3300014968 Ga0157379_10017316 Ga0157379_100173163 61
28 3300014969 Ga0157376_11854885 Ga0157376_118548851 61
29 3300025986 Ga0207658_10928694 Ga0207658_109286942 61
30 3300044694 Ga0466963_0553184 Ga0466963_0553184_319_504 61
31 3300044706 Ga0466964_0668844 Ga0466964_0668844_153_338 61
32 3300045976 Ga0466967_1916326 Ga0466967_1916326_330_515 61
33 3300048089 Ga0495614_0395590 Ga0495614_0395590_443_628 61
34 3300048905 Ga0496102_0947438 Ga0496102_0947438_54_239 61
35 3300048913 Ga0496110_0452662 Ga0496110_0452662_229_414 61
36 3300048915 Ga0496112_1346837 Ga0496112_1346837_170_355 61
37 3300049568 Ga0501031_0085553 Ga0501031_0085553_34_219 61
38 3300049572 Ga0501036_0404226 Ga0501036_0404226_720_905 61
39 3300049575 Ga0501039_0409181 Ga0501039_0409181_26_211 61
40 3300049576 Ga0501040_0057922 Ga0501040_0057922_1110_1295 61
41 3300049578 Ga0501042_0121418 Ga0501042_0121418_1662_1847 61
42 3300049584 Ga0501068_0333682 Ga0501068_0333682_383_568 61
43 3300049587 Ga0501071_0205182 Ga0501071_0205182_292_477 61
44 3300049588 Ga0501072_0333566 Ga0501072_0333566_555_740 61
45 3300049590 Ga0501074_0076631 Ga0501074_0076631_1247_1432 61
46 3300049591 Ga0501075_0011003 Ga0501075_0011003_290_475 61
47 3300049592 Ga0501076_0549399 Ga0501076_0549399_383_568 61
48 3300049742 Ga0501080_1407600 Ga0501080_1407600_158_343 61
49 3300050489 nmdc:mga03683_331178_c1 nmdc:mga03683_331178_c1_418_603 61
50 3300050507 nmdc:mga05p37_1677414_c1 nmdc:mga05p37_1677414_c1_306_491 61
51 3300050511 nmdc:mga08y16_142507_c1 nmdc:mga08y16_142507_c1_1556_1741 61
52 3300050512 nmdc:mga0n895_1080559_c1 nmdc:mga0n895_1080559_c1_55_240 61
53 3300050513 nmdc:mga0rr50_1483984_c1 nmdc:mga0rr50_1483984_c1_279_464 61
54 3300054114 Ga0501084_0048010 Ga0501084_0048010_296_481 61
55 3300059655 Ga0587114_108277 Ga0587114_108277_316_501 61
56 3300061734 Ga0530510_1135254 Ga0530510_1135254_267_452 61
57 iso_pu_bacteria 8007375930 8007377605 61
58 3300005329 Ga0070683_100242651 Ga0070683_1002426512 62
59 3300009147 Ga0114129_11140280 Ga0114129_111402802 62
60 3300013100 Ga0157373_10080116 Ga0157373_100801163 62
61 3300025912 Ga0207707_10000257 Ga0207707_1000025712 62
62 3300025912 Ga0207707_10961448 Ga0207707_109614481 62
63 3300025917 Ga0207660_10000443 Ga0207660_100004437 62
64 3300025921 Ga0207652_10000070 Ga0207652_1000007074 62
65 3300025944 Ga0207661_10215294 Ga0207661_102152942 62
66 3300035086 Ga0373934_0326016 Ga0373934_0326016_40_228 62
67 3300044693 Ga0466961_0806876 Ga0466961_0806876_115_303 62
68 3300045049 Ga0466959_0355270 Ga0466959_0355270_218_406 62
69 3300050507 nmdc:mga05p37_2012723_c1 nmdc:mga05p37_2012723_c1_212_400 62
70 iso_pu_bacteria 2527291627 2528202875 62
71 iso_pu_bacteria 2527291629 2528213253 62
72 iso_pu_bacteria 2537561592 2537898779 62
73 iso_pu_bacteria 2546825537 2546947610 62
74 iso_pu_bacteria 2576861822 2579748402 62
75 iso_pu_bacteria 2579778521 2579857875 62
76 iso_pu_bacteria 2599185353 2600198837 62
77 iso_pu_bacteria 2619618881 2619858529 62
78 iso_pu_bacteria 2619619003 2620353764 62
79 iso_pu_bacteria 2626541554 2626634477 62
80 iso_pu_bacteria 2675903060 2676497096 62
81 iso_pu_bacteria 2684623035 2686534371 62
82 iso_pu_bacteria 2684623036 2686543749 62
83 iso_pu_bacteria 2710264753 2710604303 62
84 iso_pu_bacteria 2773857924 2774864285 62
85 iso_pu_bacteria 2788500588 2791213414 62
86 iso_pu_bacteria 2818991451 2819627478 62
87 iso_pu_bacteria 2844849076 2844851709 62
88 iso_pu_bacteria 2856741275 2856744598 62
89 iso_pu_bacteria 2873314349 2873316372 62
90 iso_pu_bacteria 2884693830 2884703590 62
91 iso_pu_bacteria 2891395885 2891398903 62
92 iso_pu_bacteria 2891554331 2891559113 62
93 iso_pu_bacteria 2891562705 2891569556 62
94 iso_pu_bacteria 2895427314 2895438539 62
95 iso_pu_bacteria 2895442618 2895443382 62
96 iso_pu_bacteria 2895880812 2895883767 62
97 iso_pu_bacteria 2904497146 2904501520 62
98 iso_pu_bacteria 2904606771 2904608559 62
99 iso_pu_bacteria 2919034639 2919035526 62
100 iso_pu_bacteria 3002998708 3003004870 62
101 iso_pu_bacteria 637000116 637877588 62
102 iso_pu_bacteria 8055066027 8055074387 62
103 iso_pu_bacteria 8055172936 8055173924 62
104 3300013308 Ga0157375_11240915 Ga0157375_112409152 63
105 iso_pu_bacteria 2547132111 2547408185 63
106 iso_pu_bacteria 2554235005 2554257760 63
107 iso_pu_bacteria 2582581312 2585299224 63
108 iso_pu_bacteria 2582581313 2585308877 63
109 iso_pu_bacteria 2616644941 2616904550 63
110 iso_pu_bacteria 2643221548 2643765030 63
111 iso_pu_bacteria 2643221578 2643900764 63
112 iso_pu_bacteria 2643221587 2643942346 63
113 iso_pu_bacteria 2643221601 2644017133 63
114 iso_pu_bacteria 2643221631 2644173906 63
115 iso_pu_bacteria 2643221647 2644262368 63
116 iso_pu_bacteria 2643221670 2644389982 63
117 iso_pu_bacteria 2643221673 2644405015 63
118 iso_pu_bacteria 2643221677 2644429426 63
119 iso_pu_bacteria 2643221682 2644461131 63
120 iso_pu_bacteria 2767802112 2768643512 63
121 iso_pu_bacteria 2784132148 2784588645 63
122 iso_pu_bacteria 2784746763 2785343206 63
123 iso_pu_bacteria 2784746768 2785369589 63
124 iso_pu_bacteria 2786546132 2786670679 63
125 iso_pu_bacteria 2791355406 2793984432 63
126 iso_pu_bacteria 2802429296 2804846910 63
127 iso_pu_bacteria 2808606448 2809232255 63
128 iso_pu_bacteria 2808606982 2811849127 63
129 iso_pu_bacteria 2811994879 2812358008 63
130 iso_pu_bacteria 2811994917 2812480452 63
131 iso_pu_bacteria 2818991463 2819695484 63
132 iso_pu_bacteria 2818991472 2819741196 63
133 iso_pu_bacteria 2847085930 2847088829 63
134 iso_pu_bacteria 2852635781 2852636577 63
135 iso_pu_bacteria 2862178590 2862179398 63
136 iso_pu_bacteria 2862281513 2862285734 63
137 iso_pu_bacteria 2862290372 2862294834 63
138 iso_pu_bacteria 2862382967 2862391572 63
139 iso_pu_bacteria 2862507626 2862511733 63
140 iso_pu_bacteria 2862574272 2862579180 63
141 iso_pu_bacteria 2862705112 2862709359 63
142 iso_pu_bacteria 2863404153 2863404518 63
143 iso_pu_bacteria 2867346516 2867348898 63
144 iso_pu_bacteria 2867369537 2867371955 63
145 iso_pu_bacteria 2867428634 2867434852 63
146 iso_pu_bacteria 2867475112 2867479902 63
147 iso_pu_bacteria 2873151551 2873155656 63
148 iso_pu_bacteria 2875391855 2875395639 63
149 iso_pu_bacteria 2877676314 2877681039 63
150 iso_pu_bacteria 2912723979 2912724285 63
151 iso_pu_bacteria 2912757875 2912760859 63
152 iso_pu_bacteria 2918501144 2918505511 63
153 iso_pu_bacteria 2935390628 2935393340 63
154 iso_pu_bacteria 2946045630 2946049000 63
155 iso_pu_bacteria 2946064051 2946067835 63
156 iso_pu_bacteria 2946072368 2946075977 63
157 iso_pu_bacteria 2947224130 2947229160 63
158 iso_pu_bacteria 2954380949 2954386148 63
159 iso_pu_bacteria 2954673503 2954677002 63
160 iso_pu_bacteria 2954682443 2954687155 63
161 iso_pu_bacteria 2954691527 2954696786 63
162 iso_pu_bacteria 2954701450 2954705352 63
163 iso_pu_bacteria 2954711539 2954716165 63
164 iso_pu_bacteria 2954721474 2954726108 63
165 iso_pu_bacteria 2954731030 2954735702 63
166 iso_pu_bacteria 2954740390 2954745034 63
167 iso_pu_bacteria 2954749733 2954754558 63
168 iso_pu_bacteria 2954759201 2954764006 63
169 iso_pu_bacteria 2966598605 2966601722 63
170 iso_pu_bacteria 2990044586 2990048080 63
171 iso_pu_bacteria 2990059506 2990063166 63
172 iso_pu_bacteria 2995463766 2995465892 63
173 iso_pu_bacteria 2995463766 2995466746 63
174 iso_pu_bacteria 2997451912 2997457774 63
175 iso_pu_bacteria 2997600082 2997600354 63
176 iso_pu_bacteria 3006321560 3006324990 63
177 iso_pu_bacteria 3006393351 3006399692 63
178 iso_pu_bacteria 3006425503 3006428769 63
179 iso_pu_bacteria 3006486233 3006487457 63
180 iso_pu_bacteria 3006493962 3006500827 63
181 iso_pu_bacteria 8008485437 8008488623 63
182 iso_pu_bacteria 8008558824 8008567201 63
183 iso_pu_bacteria 8008574985 8008578821 63
184 iso_pu_bacteria 8023623736 8023629810 63
185 iso_pu_bacteria 8025413630 8025417821 63
186 iso_pu_bacteria 8025478263 8025481844 63
187 iso_pu_bacteria 8025524527 8025527399 63
188 iso_pu_bacteria 8025530807 8025537943 63
189 iso_pu_bacteria 8033684223 8033686962 63
190 iso_pu_bacteria 8047893842 8047898044 63
191 iso_pu_bacteria 8048127548 8048128019 63
192 iso_pu_bacteria 8048356638 8048360849 63
193 iso_pu_bacteria 8048369669 8048375007 63
194 iso_pu_bacteria 8048379754 8048383199 63
195 iso_pu_bacteria 8048406513 8048412667 63
196 iso_pu_bacteria 8054160619 8054167024 63
197 iso_pu_bacteria 8056447290 8056449183 63
198 iso_pu_bacteria 8056667051 8056671188 63
199 3300002773 JGI25152J39213_1000431 JGI25152J39213_100043121 66
200 3300003187 JGI25151J46595_10048603 JGI25151J46595_100486031 66
201 3300005327 Ga0070658_10080675 Ga0070658_100806752 66
202 3300005327 Ga0070658_10384459 Ga0070658_103844592 66
203 3300005327 Ga0070658_10467407 Ga0070658_104674072 66
204 3300005329 Ga0070683_100086548 Ga0070683_1000865482 66
205 3300005329 Ga0070683_100649829 Ga0070683_1006498292 66
206 3300005329 Ga0070683_100769179 Ga0070683_1007691791 66
207 3300005329 Ga0070683_100933785 Ga0070683_1009337851 66
208 3300005330 Ga0070690_100728694 Ga0070690_1007286942 66
209 3300005331 Ga0070670_100304737 Ga0070670_1003047372 66
210 3300005336 Ga0070680_100610347 Ga0070680_1006103472 66
211 3300005336 Ga0070680_100698235 Ga0070680_1006982351 66
212 3300005337 Ga0070682_100538345 Ga0070682_1005383451 66
213 3300005338 Ga0068868_100147618 Ga0068868_1001476183 66
214 3300005338 Ga0068868_100542797 Ga0068868_1005427971 66
215 3300005338 Ga0068868_100858346 Ga0068868_1008583461 66
216 3300005338 Ga0068868_102239428 Ga0068868_1022394281 66
217 3300005339 Ga0070660_100205642 Ga0070660_1002056422 66
218 3300005339 Ga0070660_100263905 Ga0070660_1002639052 66
219 3300005339 Ga0070660_100510441 Ga0070660_1005104412 66
220 3300005344 Ga0070661_101843976 Ga0070661_1018439761 66
221 3300005345 Ga0070692_10055692 Ga0070692_100556923 66
222 3300005345 Ga0070692_11233403 Ga0070692_112334032 66
223 3300005355 Ga0070671_101505015 Ga0070671_1015050151 66
224 3300005356 Ga0070674_100474125 Ga0070674_1004741251 66
225 3300005364 Ga0070673_102250448 Ga0070673_1022504481 66
226 3300005365 Ga0070688_100871259 Ga0070688_1008712592 66
227 3300005367 Ga0070667_100120475 Ga0070667_1001204752 66
228 3300005434 Ga0070709_10001280 Ga0070709_1000128014 66
229 3300005434 Ga0070709_10006908 Ga0070709_100069082 66
230 3300005434 Ga0070709_10087255 Ga0070709_100872553 66
231 3300005434 Ga0070709_10778168 Ga0070709_107781681 66
232 3300005435 Ga0070714_100034995 Ga0070714_1000349953 66
233 3300005435 Ga0070714_100037342 Ga0070714_1000373423 66
234 3300005435 Ga0070714_100377177 Ga0070714_1003771772 66
235 3300005435 Ga0070714_100988991 Ga0070714_1009889911 66
236 3300005435 Ga0070714_101715283 Ga0070714_1017152831 66
237 3300005436 Ga0070713_100013221 Ga0070713_1000132212 66
238 3300005436 Ga0070713_100049348 Ga0070713_1000493483 66
239 3300005436 Ga0070713_100088315 Ga0070713_1000883151 66
240 3300005436 Ga0070713_100147071 Ga0070713_1001470713 66
241 3300005436 Ga0070713_100649696 Ga0070713_1006496963 66
242 3300005436 Ga0070713_102016839 Ga0070713_1020168392 66
243 3300005437 Ga0070710_10001003 Ga0070710_100010033 66
244 3300005437 Ga0070710_10023246 Ga0070710_100232463 66
245 3300005437 Ga0070710_10788568 Ga0070710_107885682 66
246 3300005438 Ga0070701_10383669 Ga0070701_103836691 66
247 3300005439 Ga0070711_100002980 Ga0070711_1000029804 66
248 3300005439 Ga0070711_100032246 Ga0070711_1000322465 66
249 3300005439 Ga0070711_100305332 Ga0070711_1003053321 66
250 3300005439 Ga0070711_100914197 Ga0070711_1009141972 66
251 3300005440 Ga0070705_100676564 Ga0070705_1006765641 66
252 3300005444 Ga0070694_101185010 Ga0070694_1011850102 66
253 3300005445 Ga0070708_100025343 Ga0070708_1000253434 66
254 3300005445 Ga0070708_100224558 Ga0070708_1002245583 66
255 3300005455 Ga0070663_100496541 Ga0070663_1004965411 66
256 3300005455 Ga0070663_100524603 Ga0070663_1005246032 66
257 3300005456 Ga0070678_100977622 Ga0070678_1009776222 66
258 3300005456 Ga0070678_101473509 Ga0070678_1014735091 66
259 3300005458 Ga0070681_10108042 Ga0070681_101080422 66
260 3300005458 Ga0070681_10137321 Ga0070681_101373212 66
261 3300005458 Ga0070681_10553769 Ga0070681_105537692 66
262 3300005459 Ga0068867_100732792 Ga0068867_1007327921 66
263 3300005467 Ga0070706_100003283 Ga0070706_10000328313 66
264 3300005467 Ga0070706_100057923 Ga0070706_1000579234 66
265 3300005467 Ga0070706_100149776 Ga0070706_1001497763 66
266 3300005468 Ga0070707_100000759 Ga0070707_1000007592 66
267 3300005468 Ga0070707_100038811 Ga0070707_1000388115 66
268 3300005471 Ga0070698_100001019 Ga0070698_1000010192 66
269 3300005471 Ga0070698_100002343 Ga0070698_10000234311 66
270 3300005471 Ga0070698_100015778 Ga0070698_1000157788 66
271 3300005471 Ga0070698_100080895 Ga0070698_1000808954 66
272 3300005518 Ga0070699_100145669 Ga0070699_1001456694 66
273 3300005530 Ga0070679_100010387 Ga0070679_10001038710 66
274 3300005530 Ga0070679_100298098 Ga0070679_1002980982 66
275 3300005530 Ga0070679_100345874 Ga0070679_1003458742 66
276 3300005530 Ga0070679_101406517 Ga0070679_1014065171 66
277 3300005535 Ga0070684_100206692 Ga0070684_1002066922 66
278 3300005535 Ga0070684_100443196 Ga0070684_1004431961 66
279 3300005535 Ga0070684_100584887 Ga0070684_1005848871 66
280 3300005536 Ga0070697_100010938 Ga0070697_1000109383 66
281 3300005536 Ga0070697_100608698 Ga0070697_1006086982 66
282 3300005536 Ga0070697_101160348 Ga0070697_1011603482 66
283 3300005545 Ga0070695_100342472 Ga0070695_1003424722 66
284 3300005546 Ga0070696_100060268 Ga0070696_1000602682 66
285 3300005546 Ga0070696_101169569 Ga0070696_1011695692 66
286 3300005546 Ga0070696_101407026 Ga0070696_1014070261 66
287 3300005548 Ga0070665_100447186 Ga0070665_1004471862 66
288 3300005549 Ga0070704_100265991 Ga0070704_1002659911 66
289 3300005549 Ga0070704_100874040 Ga0070704_1008740401 66
290 3300005563 Ga0068855_100121025 Ga0068855_1001210254 66
291 3300005563 Ga0068855_101817696 Ga0068855_1018176962 66
292 3300005563 Ga0068855_102212485 Ga0068855_1022124851 66
293 3300005564 Ga0070664_101325913 Ga0070664_1013259132 66
294 3300005564 Ga0070664_101589521 Ga0070664_1015895212 66
295 3300005577 Ga0068857_100609823 Ga0068857_1006098231 66
296 3300005577 Ga0068857_101876973 Ga0068857_1018769731 66
297 3300005578 Ga0068854_101826830 Ga0068854_1018268302 66
298 3300005614 Ga0068856_100105265 Ga0068856_1001052653 66
299 3300005614 Ga0068856_101851418 Ga0068856_1018514182 66
300 3300005616 Ga0068852_100075312 Ga0068852_1000753123 66
301 3300005616 Ga0068852_100602885 Ga0068852_1006028852 66
302 3300005616 Ga0068852_102172148 Ga0068852_1021721481 66
303 3300005617 Ga0068859_101870180 Ga0068859_1018701802 66
304 3300005618 Ga0068864_101662577 Ga0068864_1016625772 66
305 3300005718 Ga0068866_10386663 Ga0068866_103866633 66
306 3300005719 Ga0068861_100358099 Ga0068861_1003580993 66
307 3300005840 Ga0068870_10563046 Ga0068870_105630462 66
308 3300005840 Ga0068870_10906967 Ga0068870_109069673 66
309 3300005841 Ga0068863_100519231 Ga0068863_1005192312 66
310 3300005842 Ga0068858_100422857 Ga0068858_1004228572 66
311 3300005842 Ga0068858_100748928 Ga0068858_1007489282 66
312 3300005981 Ga0081538_10035881 Ga0081538_100358814 66
313 3300005983 Ga0081540_1000355 Ga0081540_100035522 66
314 3300006028 Ga0070717_10017503 Ga0070717_100175033 66
315 3300006028 Ga0070717_10107833 Ga0070717_101078333 66
316 3300006028 Ga0070717_10156341 Ga0070717_101563413 66
317 3300006028 Ga0070717_10314830 Ga0070717_103148302 66
318 3300006028 Ga0070717_10403326 Ga0070717_104033263 66
319 3300006028 Ga0070717_10608322 Ga0070717_106083223 66
320 3300006028 Ga0070717_10761132 Ga0070717_107611323 66
321 3300006028 Ga0070717_11741542 Ga0070717_117415421 66
322 3300006163 Ga0070715_10018614 Ga0070715_100186143 66
323 3300006163 Ga0070715_10083546 Ga0070715_100835462 66
324 3300006173 Ga0070716_100003676 Ga0070716_1000036763 66
325 3300006173 Ga0070716_100013747 Ga0070716_1000137475 66
326 3300006175 Ga0070712_100001764 Ga0070712_1000017644 66
327 3300006175 Ga0070712_100330101 Ga0070712_1003301011 66
328 3300006175 Ga0070712_100396209 Ga0070712_1003962093 66
329 3300006175 Ga0070712_100808737 Ga0070712_1008087372 66
330 3300006175 Ga0070712_101693509 Ga0070712_1016935091 66
331 3300006844 Ga0075428_100116954 Ga0075428_1001169543 66
332 3300006844 Ga0075428_100875814 Ga0075428_1008758141 66
333 3300006852 Ga0075433_10058534 Ga0075433_100585344 66
334 3300006852 Ga0075433_10212584 Ga0075433_102125841 66
335 3300006852 Ga0075433_10302864 Ga0075433_103028642 66
336 3300006871 Ga0075434_100121257 Ga0075434_1001212573 66
337 3300006871 Ga0075434_100295990 Ga0075434_1002959901 66
338 3300006881 Ga0068865_100226394 Ga0068865_1002263942 66
339 3300006914 Ga0075436_100130030 Ga0075436_1001300301 66
340 3300006914 Ga0075436_100370472 Ga0075436_1003704721 66
341 3300006931 Ga0097620_101869838 Ga0097620_1018698381 66
342 3300007076 Ga0075435_100137120 Ga0075435_1001371204 66
343 3300007076 Ga0075435_101056291 Ga0075435_1010562912 66
344 3300007788 Ga0099795_10346424 Ga0099795_103464242 66
345 3300009036 Ga0105244_10254694 Ga0105244_102546942 66
346 3300009093 Ga0105240_10733600 Ga0105240_107336002 66
347 3300009094 Ga0111539_10088965 Ga0111539_100889654 66
348 3300009094 Ga0111539_13273931 Ga0111539_132739312 66
349 3300009098 Ga0105245_10103611 Ga0105245_101036112 66
350 3300009098 Ga0105245_10251416 Ga0105245_102514162 66
351 3300009098 Ga0105245_10423434 Ga0105245_104234343 66
352 3300009098 Ga0105245_10541536 Ga0105245_105415362 66
353 3300009101 Ga0105247_10212950 Ga0105247_102129501 66
354 3300009147 Ga0114129_10003727 Ga0114129_1000372717 66
355 3300009147 Ga0114129_10176253 Ga0114129_101762533 66
356 3300009147 Ga0114129_10818495 Ga0114129_108184952 66
357 3300009148 Ga0105243_10011592 Ga0105243_100115927 66
358 3300009148 Ga0105243_10132867 Ga0105243_101328672 66
359 3300009148 Ga0105243_10641639 Ga0105243_106416392 66
360 3300009176 Ga0105242_10222383 Ga0105242_102223832 66
361 3300009176 Ga0105242_10410322 Ga0105242_104103222 66
362 3300009176 Ga0105242_12045705 Ga0105242_120457051 66
363 3300009177 Ga0105248_11215465 Ga0105248_112154652 66
364 3300009545 Ga0105237_10365688 Ga0105237_103656883 66
365 3300009545 Ga0105237_10591198 Ga0105237_105911982 66
366 3300009551 Ga0105238_11087337 Ga0105238_110873371 66
367 3300009551 Ga0105238_12227639 Ga0105238_122276391 66
368 3300009551 Ga0105238_12909923 Ga0105238_129099231 66
369 3300009553 Ga0105249_10329162 Ga0105249_103291624 66
370 3300009553 Ga0105249_10330115 Ga0105249_103301151 66
371 3300009553 Ga0105249_11469127 Ga0105249_114691272 66
372 3300009553 Ga0105249_12421697 Ga0105249_124216971 66
373 3300010375 Ga0105239_10244856 Ga0105239_102448562 66
374 3300010375 Ga0105239_10424269 Ga0105239_104242694 66
375 3300010375 Ga0105239_11055172 Ga0105239_110551722 66
376 3300010375 Ga0105239_11681072 Ga0105239_116810722 66
377 3300010375 Ga0105239_11843541 Ga0105239_118435411 66
378 3300011119 Ga0105246_10000677 Ga0105246_1000067715 66
379 3300011119 Ga0105246_10271422 Ga0105246_102714222 66
380 3300011119 Ga0105246_10685213 Ga0105246_106852131 66
381 3300012473 Ga0157340_1029428 Ga0157340_10294281 66
382 3300012513 Ga0157326_1029780 Ga0157326_10297801 66
383 3300013102 Ga0157371_10055988 Ga0157371_100559883 66
384 3300013102 Ga0157371_11540194 Ga0157371_115401942 66
385 3300013104 Ga0157370_10684486 Ga0157370_106844862 66
386 3300013104 Ga0157370_11139673 Ga0157370_111396732 66
387 3300013105 Ga0157369_10001226 Ga0157369_100012268 66
388 3300013105 Ga0157369_10174634 Ga0157369_101746343 66
389 3300013105 Ga0157369_10226639 Ga0157369_102266391 66
390 3300013105 Ga0157369_10553907 Ga0157369_105539072 66
391 3300013105 Ga0157369_11113725 Ga0157369_111137252 66
392 3300013296 Ga0157374_11068011 Ga0157374_110680112 66
393 3300013296 Ga0157374_12592194 Ga0157374_125921941 66
394 3300013296 Ga0157374_12615690 Ga0157374_126156901 66
395 3300013296 Ga0157374_12967956 Ga0157374_129679562 66
396 3300013297 Ga0157378_10188750 Ga0157378_101887504 66
397 3300013297 Ga0157378_10340383 Ga0157378_103403832 66
398 3300013297 Ga0157378_10926671 Ga0157378_109266712 66
399 3300013297 Ga0157378_12965929 Ga0157378_129659292 66
400 3300013306 Ga0163162_10224162 Ga0163162_102241622 66
401 3300013306 Ga0163162_10544828 Ga0163162_105448283 66
402 3300013306 Ga0163162_11237422 Ga0163162_112374221 66
403 3300013306 Ga0163162_11347230 Ga0163162_113472301 66
404 3300013307 Ga0157372_10372037 Ga0157372_103720372 66
405 3300013307 Ga0157372_10639515 Ga0157372_106395152 66
406 3300013307 Ga0157372_11845359 Ga0157372_118453592 66
407 3300013307 Ga0157372_11938749 Ga0157372_119387492 66
408 3300013308 Ga0157375_10298048 Ga0157375_102980482 66
409 3300013308 Ga0157375_10513284 Ga0157375_105132842 66
410 3300013308 Ga0157375_10691200 Ga0157375_106912002 66
411 3300013308 Ga0157375_11580698 Ga0157375_115806982 66
412 3300014325 Ga0163163_10294750 Ga0163163_102947502 66
413 3300014325 Ga0163163_10513046 Ga0163163_105130462 66
414 3300014326 Ga0157380_10419005 Ga0157380_104190052 66
415 3300014326 Ga0157380_11204456 Ga0157380_112044561 66
416 3300014968 Ga0157379_10580398 Ga0157379_105803981 66
417 3300014968 Ga0157379_11580780 Ga0157379_115807801 66
418 3300014969 Ga0157376_10289769 Ga0157376_102897692 66
419 3300014969 Ga0157376_11141997 Ga0157376_111419971 66
420 3300017792 Ga0163161_10159234 Ga0163161_101592342 66
421 3300017792 Ga0163161_10283976 Ga0163161_102839762 66
422 3300020069 Ga0197907_10328527 Ga0197907_103285271 66
423 3300020069 Ga0197907_11094604 Ga0197907_110946041 66
424 3300020070 Ga0206356_11038323 Ga0206356_110383231 66
425 3300020076 Ga0206355_1500362 Ga0206355_15003621 66
426 3300020077 Ga0206351_10773125 Ga0206351_107731252 66
427 3300020078 Ga0206352_11221252 Ga0206352_112212522 66
428 3300020081 Ga0206354_10431806 Ga0206354_104318061 66
429 3300020081 Ga0206354_11265793 Ga0206354_112657931 66
430 3300020082 Ga0206353_10224648 Ga0206353_102246483 66
431 3300020082 Ga0206353_11571215 Ga0206353_115712151 66
432 3300022467 Ga0224712_10033439 Ga0224712_100334392 66
433 3300022467 Ga0224712_10038848 Ga0224712_100388482 66
434 3300022467 Ga0224712_10154823 Ga0224712_101548232 66
435 3300022467 Ga0224712_10169541 Ga0224712_101695411 66
436 3300022467 Ga0224712_10539998 Ga0224712_105399981 66
437 3300025245 Ga0207425_1040092 Ga0207425_10400921 66
438 3300025256 Ga0209759_1041554 Ga0209759_10415542 66
439 3300025258 Ga0209129_1000109 Ga0209129_100010981 66
440 3300025294 Ga0209025_1001288 Ga0209025_100128810 66
441 3300025303 Ga0209051_1022745 Ga0209051_10227452 66
442 3300025735 Ga0207713_1208068 Ga0207713_12080681 66
443 3300025898 Ga0207692_10003532 Ga0207692_100035324 66
444 3300025898 Ga0207692_10435207 Ga0207692_104352071 66
445 3300025905 Ga0207685_10029674 Ga0207685_100296744 66
446 3300025905 Ga0207685_10128805 Ga0207685_101288052 66
447 3300025906 Ga0207699_10005247 Ga0207699_100052472 66
448 3300025906 Ga0207699_10008388 Ga0207699_100083885 66
449 3300025906 Ga0207699_10052519 Ga0207699_100525193 66
450 3300025909 Ga0207705_10330599 Ga0207705_103305992 66
451 3300025909 Ga0207705_10462458 Ga0207705_104624582 66
452 3300025910 Ga0207684_10001971 Ga0207684_100019719 66
453 3300025910 Ga0207684_10053609 Ga0207684_100536093 66
454 3300025910 Ga0207684_10152406 Ga0207684_101524063 66
455 3300025910 Ga0207684_11239355 Ga0207684_112393551 66
456 3300025912 Ga0207707_10070531 Ga0207707_100705314 66
457 3300025912 Ga0207707_10083004 Ga0207707_100830042 66
458 3300025912 Ga0207707_10761002 Ga0207707_107610022 66
459 3300025912 Ga0207707_11543701 Ga0207707_115437012 66
460 3300025914 Ga0207671_10032194 Ga0207671_100321945 66
461 3300025915 Ga0207693_10049363 Ga0207693_100493632 66
462 3300025915 Ga0207693_10140509 Ga0207693_101405093 66
463 3300025915 Ga0207693_10245271 Ga0207693_102452711 66
464 3300025915 Ga0207693_10880097 Ga0207693_108800972 66
465 3300025916 Ga0207663_10004352 Ga0207663_100043523 66
466 3300025916 Ga0207663_10065057 Ga0207663_100650573 66
467 3300025916 Ga0207663_10219811 Ga0207663_102198112 66
468 3300025917 Ga0207660_10032108 Ga0207660_100321082 66
469 3300025917 Ga0207660_10271016 Ga0207660_102710162 66
470 3300025917 Ga0207660_10294724 Ga0207660_102947241 66
471 3300025919 Ga0207657_10090094 Ga0207657_100900942 66
472 3300025919 Ga0207657_10104721 Ga0207657_101047213 66
473 3300025919 Ga0207657_10149661 Ga0207657_101496612 66
474 3300025921 Ga0207652_10039314 Ga0207652_100393142 66
475 3300025921 Ga0207652_10292989 Ga0207652_102929892 66
476 3300025921 Ga0207652_10412404 Ga0207652_104124041 66
477 3300025922 Ga0207646_10000180 Ga0207646_1000018059 66
478 3300025922 Ga0207646_10003225 Ga0207646_1000322513 66
479 3300025922 Ga0207646_10072175 Ga0207646_100721753 66
480 3300025922 Ga0207646_10410649 Ga0207646_104106493 66
481 3300025925 Ga0207650_10301782 Ga0207650_103017822 66
482 3300025926 Ga0207659_11045978 Ga0207659_110459781 66
483 3300025927 Ga0207687_10145689 Ga0207687_101456892 66
484 3300025927 Ga0207687_10253750 Ga0207687_102537502 66
485 3300025928 Ga0207700_10002172 Ga0207700_1000217212 66
486 3300025928 Ga0207700_10004822 Ga0207700_100048224 66
487 3300025928 Ga0207700_10053681 Ga0207700_100536814 66
488 3300025929 Ga0207664_10000298 Ga0207664_1000029829 66
489 3300025929 Ga0207664_10001845 Ga0207664_100018456 66
490 3300025929 Ga0207664_10145876 Ga0207664_101458762 66
491 3300025929 Ga0207664_10178957 Ga0207664_101789573 66
492 3300025929 Ga0207664_10184829 Ga0207664_101848293 66
493 3300025929 Ga0207664_10432426 Ga0207664_104324262 66
494 3300025929 Ga0207664_10624254 Ga0207664_106242542 66
495 3300025929 Ga0207664_10758987 Ga0207664_107589872 66
496 3300025931 Ga0207644_11571817 Ga0207644_115718171 66
497 3300025932 Ga0207690_10000219 Ga0207690_1000021917 66
498 3300025932 Ga0207690_10016824 Ga0207690_100168245 66
499 3300025934 Ga0207686_10085700 Ga0207686_100857002 66
500 3300025934 Ga0207686_10182120 Ga0207686_101821201 66
501 3300025934 Ga0207686_10396874 Ga0207686_103968741 66
502 3300025935 Ga0207709_10051993 Ga0207709_100519932 66
503 3300025937 Ga0207669_11368232 Ga0207669_113682321 66
504 3300025938 Ga0207704_10694076 Ga0207704_106940762 66
505 3300025939 Ga0207665_10000657 Ga0207665_100006573 66
506 3300025939 Ga0207665_10023462 Ga0207665_100234624 66
507 3300025939 Ga0207665_10064239 Ga0207665_100642392 66
508 3300025942 Ga0207689_10796465 Ga0207689_107964652 66
509 3300025944 Ga0207661_10669166 Ga0207661_106691662 66
510 3300025944 Ga0207661_11118335 Ga0207661_111183352 66
511 3300025945 Ga0207679_11558178 Ga0207679_115581781 66
512 3300025949 Ga0207667_10274291 Ga0207667_102742912 66
513 3300025949 Ga0207667_10426342 Ga0207667_104263421 66
514 3300025949 Ga0207667_11743916 Ga0207667_117439161 66
515 3300025961 Ga0207712_10486292 Ga0207712_104862922 66
516 3300025986 Ga0207658_10012955 Ga0207658_100129554 66
517 3300025986 Ga0207658_11503540 Ga0207658_115035401 66
518 3300026023 Ga0207677_10592148 Ga0207677_105921482 66
519 3300026023 Ga0207677_10721886 Ga0207677_107218862 66
520 3300026023 Ga0207677_11523031 Ga0207677_115230312 66
521 3300026035 Ga0207703_10395638 Ga0207703_103956382 66
522 3300026035 Ga0207703_10852492 Ga0207703_108524921 66
523 3300026067 Ga0207678_10880553 Ga0207678_108805531 66
524 3300026075 Ga0207708_10516949 Ga0207708_105169493 66
525 3300026078 Ga0207702_10569475 Ga0207702_105694752 66
526 3300026078 Ga0207702_10738716 Ga0207702_107387163 66
527 3300026078 Ga0207702_11012825 Ga0207702_110128252 66
528 3300026088 Ga0207641_10464178 Ga0207641_104641781 66
529 3300026089 Ga0207648_11117755 Ga0207648_111177552 66
530 3300026089 Ga0207648_11203373 Ga0207648_112033731 66
531 3300026095 Ga0207676_11935980 Ga0207676_119359802 66
532 3300026116 Ga0207674_11452112 Ga0207674_114521121 66
533 3300026118 Ga0207675_100397646 Ga0207675_1003976462 66
534 3300026118 Ga0207675_100700662 Ga0207675_1007006622 66
535 3300026121 Ga0207683_10608142 Ga0207683_106081422 66
536 3300026142 Ga0207698_10607498 Ga0207698_106074982 66
537 3300027907 Ga0207428_10264295 Ga0207428_102642953 66
538 3300028666 Ga0265336_10004317 Ga0265336_100043175 66
539 3300028800 Ga0265338_10003873 Ga0265338_1000387317 66
540 3300031235 Ga0265330_10212907 Ga0265330_102129072 66
541 3300031238 Ga0265332_10001675 Ga0265332_100016756 66
542 3300031238 Ga0265332_10474348 Ga0265332_104743482 66
543 3300031249 Ga0265339_10000762 Ga0265339_100007622 66
544 3300031250 Ga0265331_10028427 Ga0265331_100284272 66
545 3300031548 Ga0307408_100437564 Ga0307408_1004375642 66
546 3300031592 Ga0310117_121880 Ga0310117_1218802 66
547 3300031667 Ga0310111_140077 Ga0310111_1400771 66
548 3300031711 Ga0265314_10005562 Ga0265314_100055624 66
549 3300031712 Ga0265342_10006989 Ga0265342_100069892 66
550 3300031731 Ga0307405_10583633 Ga0307405_105836331 66
551 3300031824 Ga0307413_10154461 Ga0307413_101544612 66
552 3300031852 Ga0307410_10041314 Ga0307410_100413143 66
553 3300031852 Ga0307410_10461216 Ga0307410_104612162 66
554 3300031852 Ga0307410_10585933 Ga0307410_105859331 66
555 3300031901 Ga0307406_10091864 Ga0307406_100918643 66
556 3300031901 Ga0307406_10326390 Ga0307406_103263901 66
557 3300031903 Ga0307407_10270552 Ga0307407_102705522 66
558 3300031903 Ga0307407_10272626 Ga0307407_102726261 66
559 3300031995 Ga0307409_100251429 Ga0307409_1002514292 66
560 3300031995 Ga0307409_100316575 Ga0307409_1003165751 66
561 3300031995 Ga0307409_100568728 Ga0307409_1005687281 66
562 3300031995 Ga0307409_100586607 Ga0307409_1005866072 66
563 3300031995 Ga0307409_100778866 Ga0307409_1007788662 66
564 3300031995 Ga0307409_102105659 Ga0307409_1021056591 66
565 3300032002 Ga0307416_100229736 Ga0307416_1002297361 66
566 3300032002 Ga0307416_101073035 Ga0307416_1010730351 66
567 3300032002 Ga0307416_101966629 Ga0307416_1019666291 66
568 3300032002 Ga0307416_103054440 Ga0307416_1030544401 66
569 3300032004 Ga0307414_10157413 Ga0307414_101574132 66
570 3300032005 Ga0307411_10046422 Ga0307411_100464221 66
571 3300032005 Ga0307411_12002959 Ga0307411_120029591 66
572 3300033179 Ga0307507_10000013 Ga0307507_10000013114 66
573 3300033179 Ga0307507_10331584 Ga0307507_103315841 66
574 3300034819 Ga0373958_0006992 Ga0373958_0006992_839_1039 66
575 3300034820 Ga0373959_0005926 Ga0373959_0005926_150_350 66
576 3300035083 Ga0373926_0038845 Ga0373926_0038845_922_1122 66
577 3300035086 Ga0373934_0006708 Ga0373934_0006708_1897_2097 66
578 3300035086 Ga0373934_0020722 Ga0373934_0020722_734_934 66
579 3300035086 Ga0373934_0077028 Ga0373934_0077028_191_391 66
580 3300035089 Ga0373944_0266351 Ga0373944_0266351_25_225 66
581 3300035091 Ga0373951_0015579 Ga0373951_0015579_902_1102 66
582 3300035111 Ga0373923_0014721 Ga0373923_0014721_1669_1869 66
583 3300035111 Ga0373923_0188582 Ga0373923_0188582_153_353 66
584 3300035111 Ga0373923_0423120 Ga0373923_0423120_57_257 66
585 3300035112 Ga0373932_0349125 Ga0373932_0349125_112_312 66
586 3300035113 Ga0373936_0001178 Ga0373936_0001178_2280_2480 66
587 3300035116 Ga0373945_0157682 Ga0373945_0157682_249_449 66
588 3300035116 Ga0373945_0296159 Ga0373945_0296159_458_658 66
589 3300035116 Ga0373945_0423426 Ga0373945_0423426_39_242 66
590 3300035117 Ga0373953_0001772 Ga0373953_0001772_4542_4742 66
591 3300035117 Ga0373953_0079348 Ga0373953_0079348_658_858 66
592 3300035118 Ga0373954_0027830 Ga0373954_0027830_2002_2202 66
593 3300035118 Ga0373954_0048362 Ga0373954_0048362_1652_1852 66
594 3300035118 Ga0373954_0194369 Ga0373954_0194369_192_392 66
595 3300035119 Ga0373956_0000844 Ga0373956_0000844_961_1161 66
596 3300035119 Ga0373956_0031323 Ga0373956_0031323_1992_2192 66
597 3300035119 Ga0373956_0034924 Ga0373956_0034924_1489_1689 66
598 3300035120 Ga0373957_0000011 Ga0373957_0000011_42218_42418 66
599 3300035120 Ga0373957_0171550 Ga0373957_0171550_505_705 66
600 3300035121 Ga0373960_0091762 Ga0373960_0091762_429_629 66
601 3300035170 Ga0373943_0151010 Ga0373943_0151010_75_275 66
602 3300035170 Ga0373943_0221704 Ga0373943_0221704_342_542 66
603 3300035170 Ga0373943_0535043 Ga0373943_0535043_434_634 66
604 3300035171 Ga0373946_0071884 Ga0373946_0071884_123_323 66
605 3300035171 Ga0373946_0289756 Ga0373946_0289756_570_770 66
606 3300035172 Ga0373955_0000060 Ga0373955_0000060_2310_2510 66
607 3300035172 Ga0373955_0014764 Ga0373955_0014764_3086_3286 66
608 3300035172 Ga0373955_0486184 Ga0373955_0486184_456_656 66
609 3300035207 Ga0373942_0272647 Ga0373942_0272647_150_350 66
610 3300035410 Ga0373924_0000672 Ga0373924_0000672_8435_8635 66
611 3300035410 Ga0373924_0019378 Ga0373924_0019378_1352_1552 66
612 3300035410 Ga0373924_0021188 Ga0373924_0021188_110_310 66
613 3300035410 Ga0373924_0585618 Ga0373924_0585618_279_479 66
614 3300035691 Ga0373931_0091826 Ga0373931_0091826_438_638 66
615 3300035691 Ga0373931_0142313 Ga0373931_0142313_491_691 66
616 3300035692 Ga0373935_0004616 Ga0373935_0004616_1999_2199 66
617 3300035692 Ga0373935_0305980 Ga0373935_0305980_719_919 66
618 3300035692 Ga0373935_0338594 Ga0373935_0338594_323_523 66
619 3300035695 Ga0373927_0157259 Ga0373927_0157259_724_924 66
620 3300035695 Ga0373927_0579698 Ga0373927_0579698_258_458 66
621 3300035724 Ga0373933_0014325 Ga0373933_0014325_3814_4014 66
622 3300035724 Ga0373933_0248337 Ga0373933_0248337_934_1134 66
623 3300035725 Ga0373947_0061727 Ga0373947_0061727_1411_1611 66
624 3300035725 Ga0373947_0528508 Ga0373947_0528508_54_254 66
625 3300036401 Ga0373937_0000110 Ga0373937_0000110_3863_4063 66
626 3300036401 Ga0373937_0030844 Ga0373937_0030844_64_264 66
627 3300036401 Ga0373937_0037069 Ga0373937_0037069_3467_3667 66
628 3300037068 Ga0373925_0019497 Ga0373925_0019497_2790_2990 66
629 3300037068 Ga0373925_0108373 Ga0373925_0108373_198_398 66
630 3300037068 Ga0373925_0466959 Ga0373925_0466959_240_440 66
631 3300037068 Ga0373925_1196327 Ga0373925_1196327_252_452 66
632 3300037853 Ga0436364_0098049 Ga0436364_0098049_228_428 66
633 3300037853 Ga0436364_0718628 Ga0436364_0718628_197_397 66
634 3300037853 Ga0436364_1272150 Ga0436364_1272150_218_418 66
635 3300039437 Ga0436365_0456440 Ga0436365_0456440_409_609 66
636 3300039438 Ga0436360_0800473 Ga0436360_0800473_316_516 66
637 3300039450 Ga0436363_0287803 Ga0436363_0287803_252_452 66
638 3300039453 Ga0436362_0452318 Ga0436362_0452318_355_555 66
639 3300041404 Ga0439436_0017389 Ga0439436_0017389_658_861 66
640 3300041404 Ga0439436_0080170 Ga0439436_0080170_658_870 66
641 3300041404 Ga0439436_0194399 Ga0439436_0194399_105_308 66
642 3300041405 Ga0439438_041185 Ga0439438_041185_504_707 66
643 3300041406 Ga0439439_0082194 Ga0439439_0082194_300_512 66
644 3300041410 Ga0439461_0001303 Ga0439461_0001303_1336_1548 66
645 3300041411 Ga0439466_0006342 Ga0439466_0006342_314_517 66
646 3300041443 Ga0451789_0026674 Ga0451789_0026674_365_565 66
647 3300041452 Ga0451793_1135109 Ga0451793_1135109_670_870 66
648 3300041453 Ga0451797_1112463 Ga0451797_1112463_198_398 66
649 3300041461 Ga0451805_068977 Ga0451805_068977_97_297 66
650 3300041463 Ga0451804_0477614 Ga0451804_0477614_551_751 66
651 3300041496 Ga0451839_0225412 Ga0451839_0225412_273_473 66
652 3300041498 Ga0451841_0311264 Ga0451841_0311264_563_763 66
653 3300041997 Ga0439431_0021633 Ga0439431_0021633_446_649 66
654 3300042002 Ga0439442_016934 Ga0439442_016934_658_861 66
655 3300042006 Ga0439432_091108 Ga0439432_091108_173_376 66
656 3300042007 Ga0439449_0019562 Ga0439449_0019562_658_870 66
657 3300042007 Ga0439449_0032403 Ga0439449_0032403_411_614 66
658 3300042007 Ga0439449_0055906 Ga0439449_0055906_597_800 66
659 3300042010 Ga0439452_002242 Ga0439452_002242_6669_6881 66
660 3300042014 Ga0439457_004463 Ga0439457_004463_76_279 66
661 3300042015 Ga0439462_0051833 Ga0439462_0051833_48_251 66
662 3300042015 Ga0439462_0111836 Ga0439462_0111836_39_251 66
663 3300042015 Ga0439462_0113673 Ga0439462_0113673_278_481 66
664 3300042115 Ga0450911_011083 Ga0450911_011083_504_707 66
665 3300042121 Ga0450919_000085 Ga0450919_000085_6628_6831 66
666 3300042122 Ga0450920_039778 Ga0450920_039778_48_251 66
667 3300042146 Ga0450907_018490 Ga0450907_018490_658_861 66
668 3300042156 Ga0439446_0020862 Ga0439446_0020862_948_1160 66
669 3300042184 Ga0450908_008452 Ga0450908_008452_1630_1833 66
670 3300042185 Ga0450909_002630 Ga0450909_002630_196_399 66
671 3300042435 Ga0439434_0065435 Ga0439434_0065435_311_523 66
672 3300042531 Ga0450918_016419 Ga0450918_016419_423_626 66
673 3300044656 Ga0466969_0001305 Ga0466969_0001305_926_1126 66
674 3300044684 Ga0466966_0002663 Ga0466966_0002663_8367_8567 66
675 3300044684 Ga0466966_0019210 Ga0466966_0019210_1738_1938 66
676 3300044684 Ga0466966_0213373 Ga0466966_0213373_275_475 66
677 3300044684 Ga0466966_0255491 Ga0466966_0255491_198_398 66
678 3300044684 Ga0466966_0271706 Ga0466966_0271706_121_321 66
679 3300044693 Ga0466961_0003691 Ga0466961_0003691_379_579 66
680 3300044693 Ga0466961_0007449 Ga0466961_0007449_852_1052 66
681 3300044693 Ga0466961_0032959 Ga0466961_0032959_1223_1423 66
682 3300044693 Ga0466961_0728462 Ga0466961_0728462_244_471 66
683 3300044694 Ga0466963_0028158 Ga0466963_0028158_400_600 66
684 3300044694 Ga0466963_0035906 Ga0466963_0035906_1072_1272 66
685 3300044694 Ga0466963_0060997 Ga0466963_0060997_329_529 66
686 3300044694 Ga0466963_0069338 Ga0466963_0069338_1099_1299 66
687 3300044694 Ga0466963_0890380 Ga0466963_0890380_331_531 66
688 3300044694 Ga0466963_0942863 Ga0466963_0942863_359_559 66
689 3300044719 Ga0466971_0005155 Ga0466971_0005155_5109_5309 66
690 3300044719 Ga0466971_0005390 Ga0466971_0005390_4543_4743 66
691 3300044719 Ga0466971_0031674 Ga0466971_0031674_267_467 66
692 3300044735 Ga0466968_0315931 Ga0466968_0315931_356_556 66
693 3300044735 Ga0466968_0375624 Ga0466968_0375624_339_566 66
694 3300044735 Ga0466968_0496860 Ga0466968_0496860_19_222 66
695 3300044765 Ga0466970_0062185 Ga0466970_0062185_34_234 66
696 3300044765 Ga0466970_0354333 Ga0466970_0354333_17_217 66
697 3300044765 Ga0466970_0410163 Ga0466970_0410163_83_283 66
698 3300044765 Ga0466970_0611728 Ga0466970_0611728_13_213 66
699 3300044842 Ga0466957_0008107 Ga0466957_0008107_3571_3771 66
700 3300044842 Ga0466957_0228107 Ga0466957_0228107_199_399 66
701 3300044842 Ga0466957_0664502 Ga0466957_0664502_327_527 66
702 3300045049 Ga0466959_0036329 Ga0466959_0036329_1803_2003 66
703 3300045049 Ga0466959_0048336 Ga0466959_0048336_2519_2719 66
704 3300045049 Ga0466959_0060117 Ga0466959_0060117_685_885 66
705 3300045049 Ga0466959_0141200 Ga0466959_0141200_1139_1339 66
706 3300045049 Ga0466959_0524937 Ga0466959_0524937_444_644 66
707 3300045051 Ga0451576_0227272 Ga0451576_0227272_143_346 66
708 3300045836 Ga0466958_0004494 Ga0466958_0004494_2110_2310 66
709 3300045836 Ga0466958_0028068 Ga0466958_0028068_236_436 66
710 3300045836 Ga0466958_0034351 Ga0466958_0034351_1102_1302 66
711 3300045976 Ga0466967_0007787 Ga0466967_0007787_3889_4089 66
712 3300045976 Ga0466967_0101495 Ga0466967_0101495_1965_2165 66
713 3300045976 Ga0466967_0628538 Ga0466967_0628538_413_613 66
714 3300045976 Ga0466967_0665844 Ga0466967_0665844_284_484 66
715 3300045976 Ga0466967_0725842 Ga0466967_0725842_279_479 66
716 3300045976 Ga0466967_1271460 Ga0466967_1271460_17_217 66
717 3300045976 Ga0466967_2527919 Ga0466967_2527919_196_396 66
718 3300046454 Ga0495592_0000049 Ga0495592_0000049_112571_112771 66
719 3300046454 Ga0495592_0011895 Ga0495592_0011895_6122_6322 66
720 3300046454 Ga0495592_0485817 Ga0495592_0485817_505_705 66
721 3300046455 Ga0495603_0024116 Ga0495603_0024116_2045_2245 66
722 3300046459 Ga0495629_0009686 Ga0495629_0009686_2247_2447 66
723 3300046459 Ga0495629_0102605 Ga0495629_0102605_1380_1580 66
724 3300046461 Ga0495641_0008332 Ga0495641_0008332_4592_4792 66
725 3300046461 Ga0495641_0027940 Ga0495641_0027940_1144_1344 66
726 3300046462 Ga0495651_0000007 Ga0495651_0000007_4649_4849 66
727 3300046462 Ga0495651_0034997 Ga0495651_0034997_527_727 66
728 3300046462 Ga0495651_0044140 Ga0495651_0044140_2881_3081 66
729 3300046462 Ga0495651_0047991 Ga0495651_0047991_2824_3024 66
730 3300046462 Ga0495651_0408707 Ga0495651_0408707_234_434 66
731 3300046463 Ga0495653_0046082 Ga0495653_0046082_2070_2270 66
732 3300046463 Ga0495653_0046578 Ga0495653_0046578_1669_1869 66
733 3300046463 Ga0495653_0066610 Ga0495653_0066610_1883_2083 66
734 3300046463 Ga0495653_0090526 Ga0495653_0090526_912_1112 66
735 3300046472 Ga0495580_0015098 Ga0495580_0015098_1151_1351 66
736 3300046472 Ga0495580_0154805 Ga0495580_0154805_873_1076 66
737 3300046472 Ga0495580_0303167 Ga0495580_0303167_411_611 66
738 3300046473 Ga0495582_0005432 Ga0495582_0005432_4170_4370 66
739 3300046473 Ga0495582_0085008 Ga0495582_0085008_1144_1344 66
740 3300046475 Ga0495639_0010968 Ga0495639_0010968_2018_2218 66
741 3300046475 Ga0495639_0081464 Ga0495639_0081464_230_430 66
742 3300046476 Ga0495662_0002989 Ga0495662_0002989_2438_2638 66
743 3300046476 Ga0495662_0008805 Ga0495662_0008805_2821_3021 66
744 3300046476 Ga0495662_0035526 Ga0495662_0035526_1292_1492 66
745 3300046476 Ga0495662_0179222 Ga0495662_0179222_746_946 66
746 3300046477 Ga0495664_0003530 Ga0495664_0003530_540_740 66
747 3300046477 Ga0495664_0020885 Ga0495664_0020885_2827_3027 66
748 3300046477 Ga0495664_0194739 Ga0495664_0194739_633_833 66
749 3300046499 Ga0495594_0471433 Ga0495594_0471433_211_411 66
750 3300046499 Ga0495594_0783896 Ga0495594_0783896_279_479 66
751 3300046511 Ga0495608_0000076 Ga0495608_0000076_909_1109 66
752 3300046511 Ga0495608_0009966 Ga0495608_0009966_4829_5029 66
753 3300046511 Ga0495608_0067448 Ga0495608_0067448_1568_1768 66
754 3300046511 Ga0495608_0208708 Ga0495608_0208708_633_833 66
755 3300046514 Ga0495618_0106122 Ga0495618_0106122_524_724 66
756 3300046514 Ga0495618_0569619 Ga0495618_0569619_412_612 66
757 3300046516 Ga0495628_0001215 Ga0495628_0001215_16714_16914 66
758 3300046516 Ga0495628_0005605 Ga0495628_0005605_8956_9156 66
759 3300046516 Ga0495628_0021216 Ga0495628_0021216_981_1181 66
760 3300046516 Ga0495628_0103086 Ga0495628_0103086_375_575 66
761 3300046517 Ga0495630_0025191 Ga0495630_0025191_2837_3037 66
762 3300046517 Ga0495630_0032183 Ga0495630_0032183_1942_2142 66
763 3300046517 Ga0495630_0307930 Ga0495630_0307930_223_423 66
764 3300046518 Ga0495631_0260618 Ga0495631_0260618_499_699 66
765 3300046526 Ga0495666_0003384 Ga0495666_0003384_4118_4318 66
766 3300046526 Ga0495666_0058823 Ga0495666_0058823_77_277 66
767 3300046526 Ga0495666_0149655 Ga0495666_0149655_411_611 66
768 3300046526 Ga0495666_0374085 Ga0495666_0374085_413_613 66
769 3300046529 Ga0495652_0000168 Ga0495652_0000168_934_1134 66
770 3300046529 Ga0495652_0040527 Ga0495652_0040527_1606_1806 66
771 3300046529 Ga0495652_0083184 Ga0495652_0083184_1803_2003 66
772 3300046529 Ga0495652_0146356 Ga0495652_0146356_1464_1664 66
773 3300046529 Ga0495652_0273460 Ga0495652_0273460_791_991 66
774 3300046529 Ga0495652_0597782 Ga0495652_0597782_432_632 66
775 3300046531 Ga0495665_0002190 Ga0495665_0002190_2260_2460 66
776 3300046531 Ga0495665_0004007 Ga0495665_0004007_28_228 66
777 3300046531 Ga0495665_0055065 Ga0495665_0055065_222_422 66
778 3300046533 Ga0495640_0017135 Ga0495640_0017135_2406_2606 66
779 3300046533 Ga0495640_0029098 Ga0495640_0029098_3138_3338 66
780 3300046535 Ga0495586_0005311 Ga0495586_0005311_6613_6813 66
781 3300046535 Ga0495586_0008958 Ga0495586_0008958_3836_4036 66
782 3300046535 Ga0495586_0030648 Ga0495586_0030648_535_735 66
783 3300046535 Ga0495586_0355569 Ga0495586_0355569_49_249 66
784 3300046535 Ga0495586_0881121 Ga0495586_0881121_192_395 66
785 3300046536 Ga0495587_0006741 Ga0495587_0006741_6363_6563 66
786 3300046536 Ga0495587_0025931 Ga0495587_0025931_1158_1358 66
787 3300046536 Ga0495587_0210367 Ga0495587_0210367_266_466 66
788 3300046543 Ga0495645_0013097 Ga0495645_0013097_722_922 66
789 3300046543 Ga0495645_0022878 Ga0495645_0022878_2127_2327 66
790 3300046543 Ga0495645_0384113 Ga0495645_0384113_136_339 66
791 3300046543 Ga0495645_0395575 Ga0495645_0395575_345_545 66
792 3300046559 Ga0495667_0000072 Ga0495667_0000072_73960_74160 66
793 3300046559 Ga0495667_0015012 Ga0495667_0015012_3736_3936 66
794 3300046559 Ga0495667_0018766 Ga0495667_0018766_3942_4142 66
795 3300046559 Ga0495667_0121316 Ga0495667_0121316_150_350 66
796 3300046615 Ga0495656_0509219 Ga0495656_0509219_421_621 66
797 3300046642 Ga0495634_0020030 Ga0495634_0020030_3517_3717 66
798 3300046642 Ga0495634_0026954 Ga0495634_0026954_2002_2202 66
799 3300046642 Ga0495634_0189762 Ga0495634_0189762_201_401 66
800 3300046663 Ga0495635_0020890 Ga0495635_0020890_1893_2093 66
801 3300046663 Ga0495635_0112703 Ga0495635_0112703_222_422 66
802 3300046663 Ga0495635_0180933 Ga0495635_0180933_801_1001 66
803 3300046663 Ga0495635_0204784 Ga0495635_0204784_191_391 66
804 3300046674 Ga0495588_0684305 Ga0495588_0684305_48_251 66
805 3300046675 Ga0495657_0000424 Ga0495657_0000424_38127_38327 66
806 3300046675 Ga0495657_0020458 Ga0495657_0020458_1734_1934 66
807 3300046675 Ga0495657_0028016 Ga0495657_0028016_2672_2872 66
808 3300046675 Ga0495657_0046215 Ga0495657_0046215_947_1147 66
809 3300046678 Ga0495599_0000062 Ga0495599_0000062_934_1134 66
810 3300046678 Ga0495599_0021197 Ga0495599_0021197_2824_3024 66
811 3300046678 Ga0495599_0026841 Ga0495599_0026841_1259_1459 66
812 3300046678 Ga0495599_0035257 Ga0495599_0035257_633_833 66
813 3300046678 Ga0495599_0276693 Ga0495599_0276693_35_235 66
814 3300046679 Ga0495623_0000777 Ga0495623_0000777_16567_16767 66
815 3300046679 Ga0495623_0048459 Ga0495623_0048459_275_475 66
816 3300046679 Ga0495623_0061932 Ga0495623_0061932_227_427 66
817 3300046679 Ga0495623_0290995 Ga0495623_0290995_73_273 66
818 3300046680 Ga0495646_0007097 Ga0495646_0007097_4876_5076 66
819 3300046680 Ga0495646_0078693 Ga0495646_0078693_1608_1808 66
820 3300046680 Ga0495646_0188431 Ga0495646_0188431_265_465 66
821 3300046680 Ga0495646_0193027 Ga0495646_0193027_33_233 66
822 3300046680 Ga0495646_0196394 Ga0495646_0196394_505_705 66
823 3300046681 Ga0495647_0356750 Ga0495647_0356750_249_449 66
824 3300046683 Ga0495658_0069348 Ga0495658_0069348_1428_1628 66
825 3300046683 Ga0495658_0157765 Ga0495658_0157765_379_579 66
826 3300046689 Ga0495613_0009407 Ga0495613_0009407_4273_4473 66
827 3300046689 Ga0495613_0034690 Ga0495613_0034690_1941_2141 66
828 3300046689 Ga0495613_0129270 Ga0495613_0129270_1360_1560 66
829 3300046689 Ga0495613_0645089 Ga0495613_0645089_399_599 66
830 3300046690 Ga0495624_0006974 Ga0495624_0006974_2816_3016 66
831 3300046690 Ga0495624_0017325 Ga0495624_0017325_2886_3086 66
832 3300046809 Ga0495600_0010085 Ga0495600_0010085_1158_1358 66
833 3300046809 Ga0495600_0024163 Ga0495600_0024163_524_724 66
834 3300046809 Ga0495600_0043077 Ga0495600_0043077_26_226 66
835 3300046809 Ga0495600_0236626 Ga0495600_0236626_933_1133 66
836 3300047315 Ga0495581_0010953 Ga0495581_0010953_2181_2381 66
837 3300047315 Ga0495581_0121582 Ga0495581_0121582_1264_1464 66
838 3300047317 Ga0495604_0000062 Ga0495604_0000062_934_1134 66
839 3300047317 Ga0495604_0011814 Ga0495604_0011814_6111_6311 66
840 3300047317 Ga0495604_0062529 Ga0495604_0062529_1438_1638 66
841 3300047317 Ga0495604_0242504 Ga0495604_0242504_505_705 66
842 3300047319 Ga0495674_0007071 Ga0495674_0007071_7680_7880 66
843 3300047319 Ga0495674_0028482 Ga0495674_0028482_1158_1358 66
844 3300047319 Ga0495674_0113536 Ga0495674_0113536_223_423 66
845 3300047319 Ga0495674_0134153 Ga0495674_0134153_1361_1561 66
846 3300047321 Ga0495676_0811775 Ga0495676_0811775_143_343 66
847 3300047321 Ga0495676_0838847 Ga0495676_0838847_300_500 66
848 3300047321 Ga0495676_0959964 Ga0495676_0959964_29_229 66
849 3300047322 Ga0495680_0000101 Ga0495680_0000101_73736_73936 66
850 3300047322 Ga0495680_0012972 Ga0495680_0012972_3558_3758 66
851 3300047322 Ga0495680_0030458 Ga0495680_0030458_571_771 66
852 3300047322 Ga0495680_0066746 Ga0495680_0066746_577_777 66
853 3300047444 Ga0495675_0001304 Ga0495675_0001304_4632_4832 66
854 3300047444 Ga0495675_0021462 Ga0495675_0021462_99_299 66
855 3300047444 Ga0495675_0033104 Ga0495675_0033104_1158_1358 66
856 3300047471 Ga0495684_0010492 Ga0495684_0010492_3942_4142 66
857 3300047471 Ga0495684_0022686 Ga0495684_0022686_2070_2270 66
858 3300047471 Ga0495684_0100367 Ga0495684_0100367_388_588 66
859 3300047673 Ga0495593_0005748 Ga0495593_0005748_2277_2477 66
860 3300047673 Ga0495593_0008680 Ga0495593_0008680_4895_5095 66
861 3300047673 Ga0495593_0112896 Ga0495593_0112896_101_301 66
862 3300048088 Ga0495602_0000115 Ga0495602_0000115_73766_73966 66
863 3300048088 Ga0495602_0013494 Ga0495602_0013494_2746_2946 66
864 3300048088 Ga0495602_0078195 Ga0495602_0078195_505_705 66
865 3300048088 Ga0495602_0085778 Ga0495602_0085778_1658_1858 66
866 3300048088 Ga0495602_0169551 Ga0495602_0169551_687_887 66
867 3300048089 Ga0495614_0016031 Ga0495614_0016031_1374_1574 66
868 3300048089 Ga0495614_0165911 Ga0495614_0165911_108_308 66
869 3300048903 Ga0496100_0498592 Ga0496100_0498592_273_476 66
870 3300048904 Ga0496101_0552835 Ga0496101_0552835_354_557 66
871 3300048904 Ga0496101_0977712 Ga0496101_0977712_44_244 66
872 3300048905 Ga0496102_0144707 Ga0496102_0144707_983_1186 66
873 3300048905 Ga0496102_0190191 Ga0496102_0190191_182_382 66
874 3300048905 Ga0496102_0755743 Ga0496102_0755743_263_463 66
875 3300048905 Ga0496102_1210177 Ga0496102_1210177_267_467 66
876 3300048906 Ga0496103_0171518 Ga0496103_0171518_903_1106 66
877 3300048906 Ga0496103_0954846 Ga0496103_0954846_284_484 66
878 3300048907 Ga0496104_0256480 Ga0496104_0256480_979_1179 66
879 3300048907 Ga0496104_0268139 Ga0496104_0268139_891_1091 66
880 3300048907 Ga0496104_1876195 Ga0496104_1876195_196_396 66
881 3300048908 Ga0496105_0067234 Ga0496105_0067234_176_376 66
882 3300048909 Ga0496106_0044619 Ga0496106_0044619_585_785 66
883 3300048909 Ga0496106_0718939 Ga0496106_0718939_197_397 66
884 3300048909 Ga0496106_0842165 Ga0496106_0842165_34_234 66
885 3300048910 Ga0496107_0294675 Ga0496107_0294675_878_1078 66
886 3300048911 Ga0496108_0046337 Ga0496108_0046337_1301_1501 66
887 3300048911 Ga0496108_0071716 Ga0496108_0071716_1660_1860 66
888 3300048911 Ga0496108_1381098 Ga0496108_1381098_239_439 66
889 3300048912 Ga0496109_0418089 Ga0496109_0418089_1001_1201 66
890 3300048912 Ga0496109_0923171 Ga0496109_0923171_511_711 66
891 3300048912 Ga0496109_1261090 Ga0496109_1261090_161_361 66
892 3300048914 Ga0496111_0047485 Ga0496111_0047485_65_265 66
893 3300048914 Ga0496111_1110594 Ga0496111_1110594_88_288 66
894 3300048915 Ga0496112_0029297 Ga0496112_0029297_2966_3169 66
895 3300048915 Ga0496112_0201674 Ga0496112_0201674_87_287 66
896 3300048915 Ga0496112_0668870 Ga0496112_0668870_198_398 66
897 3300048916 Ga0496113_0103401 Ga0496113_0103401_1558_1758 66
898 3300048916 Ga0496113_0246203 Ga0496113_0246203_881_1084 66
899 3300048917 Ga0496114_0337413 Ga0496114_0337413_677_877 66
900 3300048917 Ga0496114_0685415 Ga0496114_0685415_375_575 66
901 3300048917 Ga0496114_0866278 Ga0496114_0866278_161_361 66
902 3300048918 Ga0496115_0441847 Ga0496115_0441847_465_665 66
903 3300049527 Ga0501311_084530 Ga0501311_084530_290_490 66
904 3300049531 Ga0501315_082529 Ga0501315_082529_334_534 66
905 3300049533 Ga0501317_035088 Ga0501317_035088_148_348 66
906 3300049534 Ga0501318_044439 Ga0501318_044439_391_591 66
907 3300049568 Ga0501031_0196816 Ga0501031_0196816_1073_1273 66
908 3300049569 Ga0501032_0292527 Ga0501032_0292527_475_675 66
909 3300049570 Ga0501033_1028924 Ga0501033_1028924_316_516 66
910 3300049572 Ga0501036_0136997 Ga0501036_0136997_1449_1649 66
911 3300049573 Ga0501037_0047762 Ga0501037_0047762_28_228 66
912 3300049575 Ga0501039_0186535 Ga0501039_0186535_1092_1292 66
913 3300049575 Ga0501039_0774360 Ga0501039_0774360_163_363 66
914 3300049576 Ga0501040_0029885 Ga0501040_0029885_3061_3261 66
915 3300049577 Ga0501041_0254296 Ga0501041_0254296_274_474 66
916 3300049578 Ga0501042_0312857 Ga0501042_0312857_856_1056 66
917 3300049579 Ga0501043_0412595 Ga0501043_0412595_799_999 66
918 3300049580 Ga0501046_0119453 Ga0501046_0119453_1405_1605 66
919 3300049582 Ga0501048_0011519 Ga0501048_0011519_2381_2581 66
920 3300049582 Ga0501048_0704370 Ga0501048_0704370_236_436 66
921 3300049584 Ga0501068_0493369 Ga0501068_0493369_300_500 66
922 3300049585 Ga0501069_0305289 Ga0501069_0305289_268_468 66
923 3300049587 Ga0501071_0689739 Ga0501071_0689739_558_758 66
924 3300049589 Ga0501073_0771727 Ga0501073_0771727_80_283 66
925 3300049590 Ga0501074_0080253 Ga0501074_0080253_1426_1626 66
926 3300049591 Ga0501075_0020072 Ga0501075_0020072_3904_4104 66
927 3300049592 Ga0501076_0035235 Ga0501076_0035235_2036_2236 66
928 3300049592 Ga0501076_0424529 Ga0501076_0424529_202_402 66
929 3300049592 Ga0501076_0644736 Ga0501076_0644736_333_533 66
930 3300049593 Ga0501077_0019671 Ga0501077_0019671_1809_2009 66
931 3300049690 Ga0501261_034512 Ga0501261_034512_208_408 66
932 3300049741 Ga0501079_0328774 Ga0501079_0328774_745_945 66
933 3300049742 Ga0501080_1383399 Ga0501080_1383399_225_425 66
934 3300049743 Ga0501081_0076315 Ga0501081_0076315_989_1189 66
935 3300049744 Ga0501083_0383782 Ga0501083_0383782_59_259 66
936 3300049822 Ga0501035_0111057 Ga0501035_0111057_1726_1926 66
937 3300049823 Ga0501044_0777924 Ga0501044_0777924_233_433 66
938 3300049824 Ga0501045_0037572 Ga0501045_0037572_1916_2116 66
939 3300049824 Ga0501045_0348642 Ga0501045_0348642_369_569 66
940 3300050492 nmdc:mga0yw44_371395_c1 nmdc:mga0yw44_371395_c1_562_762 66
941 3300050507 nmdc:mga05p37_425422_c1 nmdc:mga05p37_425422_c1_398_601 66
942 3300050507 nmdc:mga05p37_4279_c1 nmdc:mga05p37_4279_c1_12790_12990 66
943 3300050507 nmdc:mga05p37_728152_c1 nmdc:mga05p37_728152_c1_404_607 66
944 3300050508 nmdc:mga09592_326452_c1 nmdc:mga09592_326452_c1_920_1120 66
945 3300050511 nmdc:mga08y16_735505_c1 nmdc:mga08y16_735505_c1_122_322 66
946 3300050512 nmdc:mga0n895_1231098_c1 nmdc:mga0n895_1231098_c1_333_533 66
947 3300050512 nmdc:mga0n895_149115_c1 nmdc:mga0n895_149115_c1_276_479 66
948 3300050512 nmdc:mga0n895_63544_c1 nmdc:mga0n895_63544_c1_18_218 66
949 3300050513 nmdc:mga0rr50_103846_c1 nmdc:mga0rr50_103846_c1_2021_2221 66
950 3300050513 nmdc:mga0rr50_1174000_c1 nmdc:mga0rr50_1174000_c1_405_608 66
951 3300050513 nmdc:mga0rr50_9965_c1 nmdc:mga0rr50_9965_c1_1722_1922 66
952 3300050514 nmdc:mga08x19_16720_c1 nmdc:mga08x19_16720_c1_360_560 66
953 3300050514 nmdc:mga08x19_382382_c1 nmdc:mga08x19_382382_c1_738_938 66
954 3300050515 nmdc:mga0a205_306282_c1 nmdc:mga0a205_306282_c1_1017_1217 66
955 3300050515 nmdc:mga0a205_362154_c1 nmdc:mga0a205_362154_c1_1100_1300 66
956 3300050515 nmdc:mga0a205_81627_c1 nmdc:mga0a205_81627_c1_651_854 66
957 3300053077 Ga0495601_0053846 Ga0495601_0053846_275_475 66
958 3300053077 Ga0495601_0151747 Ga0495601_0151747_1091_1291 66
959 3300053077 Ga0495601_0802431 Ga0495601_0802431_51_251 66
960 3300053078 Ga0495612_0001654 Ga0495612_0001654_6288_6488 66
961 3300053078 Ga0495612_0095192 Ga0495612_0095192_502_702 66
962 3300053078 Ga0495612_0228164 Ga0495612_0228164_607_807 66
963 3300053084 Ga0495595_0003935 Ga0495595_0003935_1784_1984 66
964 3300053085 Ga0495619_0007135 Ga0495619_0007135_6348_6548 66
965 3300053085 Ga0495619_0067820 Ga0495619_0067820_609_809 66
966 3300053085 Ga0495619_0245604 Ga0495619_0245604_931_1131 66
967 3300053085 Ga0495619_0699125 Ga0495619_0699125_419_619 66
968 3300054114 Ga0501084_0891695 Ga0501084_0891695_514_714 66
969 3300059424 Ga0590075_003626 Ga0590075_003626_232_432 66
970 3300059643 Ga0587072_046729 Ga0587072_046729_426_638 66
971 3300059646 Ga0587078_075059 Ga0587078_075059_310_510 66
972 3300060353 Ga0501082_0188578 Ga0501082_0188578_619_819 66
973 3300061719 Ga0466962_0019804 Ga0466962_0019804_434_634 66
974 3300061719 Ga0466962_0024928 Ga0466962_0024928_1128_1328 66
975 3300061719 Ga0466962_0035029 Ga0466962_0035029_230_430 66
976 3300061719 Ga0466962_0209981 Ga0466962_0209981_679_879 66
977 3300061719 Ga0466962_0567793 Ga0466962_0567793_70_270 66
978 3300061734 Ga0530510_0056005 Ga0530510_0056005_2199_2399 66
979 3300061734 Ga0530510_0241313 Ga0530510_0241313_1096_1296 66
980 3300061734 Ga0530510_1109580 Ga0530510_1109580_117_317 66
981 3300001915 JGI24741J21665_1068614 JGI24741J21665_10686142 67
982 3300001976 JGI24752J21851_1053559 JGI24752J21851_10535592 67
983 3300001978 JGI24747J21853_1048214 JGI24747J21853_10482141 67
984 3300001979 JGI24740J21852_10144583 JGI24740J21852_101445832 67
985 3300001991 JGI24743J22301_10063866 JGI24743J22301_100638662 67
986 3300002073 JGI24745J21846_1054131 JGI24745J21846_10541312 67
987 3300002155 JGI24033J26618_1075896 JGI24033J26618_10758961 67
988 3300002459 JGI24751J29686_10011389 JGI24751J29686_100113893 67
989 3300003163 Ga0006759J45824_1010939 Ga0006759J45824_10109391 67
990 3300003316 rootH1_10054865 rootH1_100548653 67
991 3300003322 rootL2_10002354 rootL2_100023544 67
992 3300003323 rootH1_10077154 rootH1_100771541 67
993 3300003544 Ga0007417J51691_1031744 Ga0007417J51691_10317441 67
994 3300003577 Ga0007416J51690_1039243 Ga0007416J51690_10392431 67
995 3300003578 Ga0006562J51391_1013573 Ga0006562J51391_10135731 67
996 3300003579 Ga0007429J51699_1029739 Ga0007429J51699_10297391 67
997 3300003659 JGI25404J52841_10004078 JGI25404J52841_100040783 67
998 3300005327 Ga0070658_10109176 Ga0070658_101091762 67
999 3300005327 Ga0070658_10126206 Ga0070658_101262063 67
1000 3300005327 Ga0070658_10489431 Ga0070658_104894311 67
1001 3300005327 Ga0070658_10573142 Ga0070658_105731422 67
1002 3300005327 Ga0070658_11618769 Ga0070658_116187691 67
1003 3300005328 Ga0070676_10132525 Ga0070676_101325252 67
1004 3300005328 Ga0070676_10199801 Ga0070676_101998011 67
1005 3300005329 Ga0070683_100236714 Ga0070683_1002367142 67
1006 3300005329 Ga0070683_100319737 Ga0070683_1003197372 67
1007 3300005329 Ga0070683_100993534 Ga0070683_1009935342 67
1008 3300005330 Ga0070690_100074092 Ga0070690_1000740921 67
1009 3300005331 Ga0070670_100116948 Ga0070670_1001169483 67
1010 3300005331 Ga0070670_100714487 Ga0070670_1007144871 67
1011 3300005334 Ga0068869_100102951 Ga0068869_1001029511 67
1012 3300005334 Ga0068869_100415167 Ga0068869_1004151671 67
1013 3300005335 Ga0070666_10354187 Ga0070666_103541872 67
1014 3300005335 Ga0070666_10956143 Ga0070666_109561431 67
1015 3300005336 Ga0070680_100046686 Ga0070680_1000466864 67
1016 3300005336 Ga0070680_100538264 Ga0070680_1005382642 67
1017 3300005336 Ga0070680_100606669 Ga0070680_1006066692 67
1018 3300005336 Ga0070680_101025375 Ga0070680_1010253751 67
1019 3300005337 Ga0070682_100156042 Ga0070682_1001560423 67
1020 3300005337 Ga0070682_100393943 Ga0070682_1003939432 67
1021 3300005338 Ga0068868_100047482 Ga0068868_1000474821 67
1022 3300005338 Ga0068868_100124661 Ga0068868_1001246613 67
1023 3300005338 Ga0068868_100284076 Ga0068868_1002840763 67
1024 3300005339 Ga0070660_100056154 Ga0070660_1000561541 67
1025 3300005339 Ga0070660_100354618 Ga0070660_1003546182 67
1026 3300005339 Ga0070660_101554158 Ga0070660_1015541581 67
1027 3300005340 Ga0070689_100023700 Ga0070689_1000237005 67
1028 3300005340 Ga0070689_100077283 Ga0070689_1000772833 67
1029 3300005341 Ga0070691_10011376 Ga0070691_100113762 67
1030 3300005341 Ga0070691_10102607 Ga0070691_101026071 67
1031 3300005343 Ga0070687_100030344 Ga0070687_1000303444 67
1032 3300005343 Ga0070687_100063632 Ga0070687_1000636322 67
1033 3300005344 Ga0070661_100021766 Ga0070661_1000217662 67
1034 3300005344 Ga0070661_100124775 Ga0070661_1001247751 67
1035 3300005344 Ga0070661_100334839 Ga0070661_1003348391 67
1036 3300005345 Ga0070692_10041379 Ga0070692_100413793 67
1037 3300005345 Ga0070692_10254029 Ga0070692_102540292 67
1038 3300005345 Ga0070692_11110272 Ga0070692_111102721 67
1039 3300005347 Ga0070668_100125509 Ga0070668_1001255093 67
1040 3300005347 Ga0070668_101289281 Ga0070668_1012892811 67
1041 3300005353 Ga0070669_100198950 Ga0070669_1001989501 67
1042 3300005353 Ga0070669_100614344 Ga0070669_1006143441 67
1043 3300005354 Ga0070675_100014849 Ga0070675_1000148492 67
1044 3300005354 Ga0070675_100412316 Ga0070675_1004123161 67
1045 3300005355 Ga0070671_100079033 Ga0070671_1000790332 67
1046 3300005355 Ga0070671_100093054 Ga0070671_1000930543 67
1047 3300005355 Ga0070671_100984026 Ga0070671_1009840261 67
1048 3300005356 Ga0070674_100106617 Ga0070674_1001066173 67
1049 3300005356 Ga0070674_100420697 Ga0070674_1004206972 67
1050 3300005356 Ga0070674_100928262 Ga0070674_1009282622 67
1051 3300005364 Ga0070673_100104251 Ga0070673_1001042513 67
1052 3300005364 Ga0070673_100154142 Ga0070673_1001541421 67
1053 3300005364 Ga0070673_100870359 Ga0070673_1008703591 67
1054 3300005366 Ga0070659_100122200 Ga0070659_1001222003 67
1055 3300005366 Ga0070659_100498801 Ga0070659_1004988011 67
1056 3300005366 Ga0070659_102159688 Ga0070659_1021596881 67
1057 3300005367 Ga0070667_100600987 Ga0070667_1006009872 67
1058 3300005367 Ga0070667_101238485 Ga0070667_1012384852 67
1059 3300005367 Ga0070667_101365278 Ga0070667_1013652782 67
1060 3300005406 Ga0070703_10180095 Ga0070703_101800951 67
1061 3300005434 Ga0070709_10063516 Ga0070709_100635163 67
1062 3300005434 Ga0070709_10174334 Ga0070709_101743342 67
1063 3300005434 Ga0070709_10202510 Ga0070709_102025102 67
1064 3300005435 Ga0070714_100001940 Ga0070714_1000019401 67
1065 3300005435 Ga0070714_100095332 Ga0070714_1000953322 67
1066 3300005435 Ga0070714_101171864 Ga0070714_1011718641 67
1067 3300005435 Ga0070714_101177506 Ga0070714_1011775062 67
1068 3300005436 Ga0070713_100004434 Ga0070713_1000044348 67
1069 3300005436 Ga0070713_100012635 Ga0070713_1000126355 67
1070 3300005436 Ga0070713_100841886 Ga0070713_1008418862 67
1071 3300005436 Ga0070713_100898909 Ga0070713_1008989092 67
1072 3300005436 Ga0070713_101061230 Ga0070713_1010612301 67
1073 3300005436 Ga0070713_101255139 Ga0070713_1012551392 67
1074 3300005436 Ga0070713_101653296 Ga0070713_1016532961 67
1075 3300005436 Ga0070713_101710907 Ga0070713_1017109071 67
1076 3300005437 Ga0070710_10040445 Ga0070710_100404451 67
1077 3300005437 Ga0070710_10092801 Ga0070710_100928012 67
1078 3300005438 Ga0070701_10002382 Ga0070701_100023828 67
1079 3300005438 Ga0070701_10017082 Ga0070701_100170823 67
1080 3300005439 Ga0070711_100012494 Ga0070711_1000124943 67
1081 3300005439 Ga0070711_100047988 Ga0070711_1000479883 67
1082 3300005439 Ga0070711_100360005 Ga0070711_1003600052 67
1083 3300005439 Ga0070711_100463276 Ga0070711_1004632761 67
1084 3300005439 Ga0070711_100989946 Ga0070711_1009899461 67
1085 3300005440 Ga0070705_100117944 Ga0070705_1001179443 67
1086 3300005440 Ga0070705_100253250 Ga0070705_1002532502 67
1087 3300005441 Ga0070700_100084167 Ga0070700_1000841672 67
1088 3300005441 Ga0070700_100126695 Ga0070700_1001266952 67
1089 3300005444 Ga0070694_100159574 Ga0070694_1001595741 67
1090 3300005445 Ga0070708_100530524 Ga0070708_1005305242 67
1091 3300005445 Ga0070708_101258753 Ga0070708_1012587532 67
1092 3300005455 Ga0070663_100054987 Ga0070663_1000549874 67
1093 3300005455 Ga0070663_100188437 Ga0070663_1001884371 67
1094 3300005455 Ga0070663_100257789 Ga0070663_1002577892 67
1095 3300005455 Ga0070663_101374622 Ga0070663_1013746221 67
1096 3300005456 Ga0070678_100001635 Ga0070678_1000016354 67
1097 3300005456 Ga0070678_100096431 Ga0070678_1000964311 67
1098 3300005457 Ga0070662_100222732 Ga0070662_1002227321 67
1099 3300005457 Ga0070662_101195085 Ga0070662_1011950852 67
1100 3300005457 Ga0070662_101293285 Ga0070662_1012932852 67
1101 3300005458 Ga0070681_10010877 Ga0070681_100108774 67
1102 3300005458 Ga0070681_10196105 Ga0070681_101961052 67
1103 3300005458 Ga0070681_10337063 Ga0070681_103370631 67
1104 3300005458 Ga0070681_11172480 Ga0070681_111724801 67
1105 3300005458 Ga0070681_11596470 Ga0070681_115964701 67
1106 3300005459 Ga0068867_100319689 Ga0068867_1003196891 67
1107 3300005459 Ga0068867_101855960 Ga0068867_1018559602 67
1108 3300005466 Ga0070685_10035130 Ga0070685_100351301 67
1109 3300005467 Ga0070706_100068689 Ga0070706_1000686895 67
1110 3300005467 Ga0070706_100122297 Ga0070706_1001222973 67
1111 3300005467 Ga0070706_100176547 Ga0070706_1001765473 67
1112 3300005467 Ga0070706_100535921 Ga0070706_1005359212 67
1113 3300005468 Ga0070707_100365192 Ga0070707_1003651921 67
1114 3300005468 Ga0070707_100508407 Ga0070707_1005084072 67
1115 3300005468 Ga0070707_100591905 Ga0070707_1005919052 67
1116 3300005471 Ga0070698_100061092 Ga0070698_1000610922 67
1117 3300005471 Ga0070698_100120956 Ga0070698_1001209562 67
1118 3300005471 Ga0070698_100322503 Ga0070698_1003225033 67
1119 3300005471 Ga0070698_101133924 Ga0070698_1011339241 67
1120 3300005530 Ga0070679_100025712 Ga0070679_1000257127 67
1121 3300005530 Ga0070679_100106370 Ga0070679_1001063701 67
1122 3300005530 Ga0070679_100271602 Ga0070679_1002716023 67
1123 3300005535 Ga0070684_100212168 Ga0070684_1002121682 67
1124 3300005535 Ga0070684_100312069 Ga0070684_1003120692 67
1125 3300005535 Ga0070684_100729378 Ga0070684_1007293782 67
1126 3300005535 Ga0070684_100984099 Ga0070684_1009840991 67
1127 3300005536 Ga0070697_100004357 Ga0070697_1000043578 67
1128 3300005536 Ga0070697_100190470 Ga0070697_1001904704 67
1129 3300005539 Ga0068853_100325991 Ga0068853_1003259913 67
1130 3300005539 Ga0068853_100600049 Ga0068853_1006000491 67
1131 3300005543 Ga0070672_100025168 Ga0070672_1000251684 67
1132 3300005543 Ga0070672_100264280 Ga0070672_1002642801 67
1133 3300005543 Ga0070672_100491634 Ga0070672_1004916342 67
1134 3300005543 Ga0070672_100668898 Ga0070672_1006688982 67
1135 3300005544 Ga0070686_100908941 Ga0070686_1009089411 67
1136 3300005545 Ga0070695_100050897 Ga0070695_1000508972 67
1137 3300005545 Ga0070695_101709408 Ga0070695_1017094081 67
1138 3300005546 Ga0070696_100177283 Ga0070696_1001772831 67
1139 3300005546 Ga0070696_101819046 Ga0070696_1018190461 67
1140 3300005547 Ga0070693_100005092 Ga0070693_1000050924 67
1141 3300005547 Ga0070693_100598680 Ga0070693_1005986801 67
1142 3300005547 Ga0070693_101049708 Ga0070693_1010497082 67
1143 3300005548 Ga0070665_100030159 Ga0070665_1000301595 67
1144 3300005548 Ga0070665_100260984 Ga0070665_1002609843 67
1145 3300005548 Ga0070665_100396212 Ga0070665_1003962121 67
1146 3300005549 Ga0070704_101940956 Ga0070704_1019409561 67
1147 3300005563 Ga0068855_100158059 Ga0068855_1001580593 67
1148 3300005563 Ga0068855_100678137 Ga0068855_1006781372 67
1149 3300005563 Ga0068855_100919154 Ga0068855_1009191541 67
1150 3300005564 Ga0070664_100074926 Ga0070664_1000749264 67
1151 3300005564 Ga0070664_101414514 Ga0070664_1014145141 67
1152 3300005577 Ga0068857_100272546 Ga0068857_1002725461 67
1153 3300005577 Ga0068857_100728433 Ga0068857_1007284331 67
1154 3300005577 Ga0068857_101054175 Ga0068857_1010541752 67
1155 3300005577 Ga0068857_101174897 Ga0068857_1011748971 67
1156 3300005578 Ga0068854_100056428 Ga0068854_1000564281 67
1157 3300005578 Ga0068854_100393090 Ga0068854_1003930902 67
1158 3300005614 Ga0068856_101059653 Ga0068856_1010596531 67
1159 3300005615 Ga0070702_100068800 Ga0070702_1000688002 67
1160 3300005615 Ga0070702_100213681 Ga0070702_1002136811 67
1161 3300005616 Ga0068852_100000497 Ga0068852_10000049724 67
1162 3300005616 Ga0068852_100096999 Ga0068852_1000969992 67
1163 3300005616 Ga0068852_100340080 Ga0068852_1003400802 67
1164 3300005617 Ga0068859_100246961 Ga0068859_1002469613 67
1165 3300005617 Ga0068859_100273218 Ga0068859_1002732183 67
1166 3300005617 Ga0068859_100889388 Ga0068859_1008893881 67
1167 3300005618 Ga0068864_100003244 Ga0068864_1000032441 67
1168 3300005618 Ga0068864_100127348 Ga0068864_1001273483 67
1169 3300005618 Ga0068864_101623856 Ga0068864_1016238561 67
1170 3300005618 Ga0068864_101764136 Ga0068864_1017641362 67
1171 3300005718 Ga0068866_10032583 Ga0068866_100325833 67
1172 3300005834 Ga0068851_10081316 Ga0068851_100813163 67
1173 3300005834 Ga0068851_10356563 Ga0068851_103565631 67
1174 3300005840 Ga0068870_10021137 Ga0068870_100211371 67
1175 3300005840 Ga0068870_10732648 Ga0068870_107326481 67
1176 3300005841 Ga0068863_100003332 Ga0068863_1000033323 67
1177 3300005841 Ga0068863_100565331 Ga0068863_1005653312 67
1178 3300005841 Ga0068863_100819907 Ga0068863_1008199072 67
1179 3300005842 Ga0068858_100214839 Ga0068858_1002148393 67
1180 3300005842 Ga0068858_100246158 Ga0068858_1002461581 67
1181 3300005843 Ga0068860_100371807 Ga0068860_1003718073 67
1182 3300005843 Ga0068860_101451373 Ga0068860_1014513731 67
1183 3300005843 Ga0068860_102725001 Ga0068860_1027250011 67
1184 3300005844 Ga0068862_100020590 Ga0068862_1000205907 67
1185 3300005937 Ga0081455_10181061 Ga0081455_101810612 67
1186 3300005983 Ga0081540_1000193 Ga0081540_100019335 67
1187 3300005983 Ga0081540_1078394 Ga0081540_10783942 67
1188 3300005985 Ga0081539_10389280 Ga0081539_103892801 67
1189 3300006028 Ga0070717_10303179 Ga0070717_103031792 67
1190 3300006028 Ga0070717_10812605 Ga0070717_108126052 67
1191 3300006028 Ga0070717_11141430 Ga0070717_111414302 67
1192 3300006028 Ga0070717_11528065 Ga0070717_115280651 67
1193 3300006048 Ga0075363_100138181 Ga0075363_1001381811 67
1194 3300006048 Ga0075363_100647093 Ga0075363_1006470931 67
1195 3300006058 Ga0075432_10260394 Ga0075432_102603942 67
1196 3300006163 Ga0070715_10131122 Ga0070715_101311222 67
1197 3300006173 Ga0070716_100018980 Ga0070716_1000189804 67
1198 3300006173 Ga0070716_100149237 Ga0070716_1001492371 67
1199 3300006173 Ga0070716_100575500 Ga0070716_1005755001 67
1200 3300006175 Ga0070712_100220805 Ga0070712_1002208052 67
1201 3300006175 Ga0070712_101487354 Ga0070712_1014873541 67
1202 3300006237 Ga0097621_100028657 Ga0097621_1000286573 67
1203 3300006237 Ga0097621_100138272 Ga0097621_1001382722 67
1204 3300006237 Ga0097621_100467346 Ga0097621_1004673462 67
1205 3300006358 Ga0068871_100116304 Ga0068871_1001163042 67
1206 3300006358 Ga0068871_100192461 Ga0068871_1001924612 67
1207 3300006358 Ga0068871_100934828 Ga0068871_1009348282 67
1208 3300006844 Ga0075428_100248314 Ga0075428_1002483143 67
1209 3300006852 Ga0075433_10004667 Ga0075433_1000466710 67
1210 3300006852 Ga0075433_10487249 Ga0075433_104872493 67
1211 3300006871 Ga0075434_100004126 Ga0075434_1000041262 67
1212 3300006871 Ga0075434_100381904 Ga0075434_1003819042 67
1213 3300006871 Ga0075434_100509932 Ga0075434_1005099323 67
1214 3300006880 Ga0075429_100032855 Ga0075429_1000328553 67
1215 3300006881 Ga0068865_100197174 Ga0068865_1001971742 67
1216 3300006881 Ga0068865_100223398 Ga0068865_1002233982 67
1217 3300006914 Ga0075436_100005351 Ga0075436_1000053519 67
1218 3300006914 Ga0075436_100214031 Ga0075436_1002140311 67
1219 3300006931 Ga0097620_100246968 Ga0097620_1002469683 67
1220 3300006931 Ga0097620_100273204 Ga0097620_1002732041 67
1221 3300006931 Ga0097620_100889376 Ga0097620_1008893762 67
1222 3300006948 Ga0099826_10129515 Ga0099826_101295153 67
1223 3300007076 Ga0075435_100008998 Ga0075435_1000089983 67
1224 3300007076 Ga0075435_100184646 Ga0075435_1001846462 67
1225 3300007076 Ga0075435_100853002 Ga0075435_1008530022 67
1226 3300007265 Ga0099794_10376727 Ga0099794_103767272 67
1227 3300007265 Ga0099794_10501751 Ga0099794_105017512 67
1228 3300007788 Ga0099795_10015129 Ga0099795_100151293 67
1229 3300009011 Ga0105251_10038963 Ga0105251_100389632 67
1230 3300009036 Ga0105244_10227262 Ga0105244_102272621 67
1231 3300009036 Ga0105244_10362605 Ga0105244_103626052 67
1232 3300009092 Ga0105250_10114222 Ga0105250_101142222 67
1233 3300009092 Ga0105250_10351630 Ga0105250_103516301 67
1234 3300009092 Ga0105250_10417671 Ga0105250_104176711 67
1235 3300009093 Ga0105240_10535477 Ga0105240_105354771 67
1236 3300009093 Ga0105240_10639032 Ga0105240_106390322 67
1237 3300009093 Ga0105240_11127334 Ga0105240_111273341 67
1238 3300009094 Ga0111539_10189764 Ga0111539_101897643 67
1239 3300009098 Ga0105245_10443110 Ga0105245_104431102 67
1240 3300009098 Ga0105245_10784209 Ga0105245_107842092 67
1241 3300009098 Ga0105245_11488914 Ga0105245_114889142 67
1242 3300009098 Ga0105245_11818852 Ga0105245_118188522 67
1243 3300009098 Ga0105245_12683201 Ga0105245_126832011 67
1244 3300009101 Ga0105247_10004622 Ga0105247_100046229 67
1245 3300009101 Ga0105247_10448552 Ga0105247_104485521 67
1246 3300009101 Ga0105247_10716612 Ga0105247_107166122 67
1247 3300009147 Ga0114129_10905906 Ga0114129_109059062 67
1248 3300009147 Ga0114129_13415871 Ga0114129_134158711 67
1249 3300009148 Ga0105243_10081732 Ga0105243_100817322 67
1250 3300009148 Ga0105243_10329695 Ga0105243_103296952 67
1251 3300009174 Ga0105241_10131584 Ga0105241_101315843 67
1252 3300009174 Ga0105241_10185322 Ga0105241_101853222 67
1253 3300009174 Ga0105241_10793881 Ga0105241_107938812 67
1254 3300009174 Ga0105241_10989007 Ga0105241_109890072 67
1255 3300009176 Ga0105242_10103963 Ga0105242_101039634 67
1256 3300009176 Ga0105242_12307653 Ga0105242_123076532 67
1257 3300009177 Ga0105248_10039623 Ga0105248_100396235 67
1258 3300009177 Ga0105248_10184254 Ga0105248_101842543 67
1259 3300009177 Ga0105248_10288636 Ga0105248_102886362 67
1260 3300009545 Ga0105237_10426969 Ga0105237_104269692 67
1261 3300009545 Ga0105237_10797391 Ga0105237_107973912 67
1262 3300009545 Ga0105237_11081608 Ga0105237_110816082 67
1263 3300009545 Ga0105237_11224797 Ga0105237_112247972 67
1264 3300009545 Ga0105237_11985958 Ga0105237_119859581 67
1265 3300009551 Ga0105238_10044356 Ga0105238_100443564 67
1266 3300009551 Ga0105238_10997556 Ga0105238_109975561 67
1267 3300009551 Ga0105238_12423355 Ga0105238_124233551 67
1268 3300009553 Ga0105249_10040745 Ga0105249_100407451 67
1269 3300009553 Ga0105249_10453128 Ga0105249_104531281 67
1270 3300009553 Ga0105249_11166391 Ga0105249_111663912 67
1271 3300009553 Ga0105249_11973888 Ga0105249_119738881 67
1272 3300009553 Ga0105249_12353397 Ga0105249_123533971 67
1273 3300010159 Ga0099796_10023887 Ga0099796_100238871 67
1274 3300010159 Ga0099796_10275871 Ga0099796_102758712 67
1275 3300010375 Ga0105239_10131095 Ga0105239_101310953 67
1276 3300010375 Ga0105239_10738877 Ga0105239_107388772 67
1277 3300010375 Ga0105239_10824069 Ga0105239_108240691 67
1278 3300010375 Ga0105239_11296739 Ga0105239_112967391 67
1279 3300010375 Ga0105239_12626434 Ga0105239_126264341 67
1280 3300011119 Ga0105246_10043815 Ga0105246_100438153 67
1281 3300011119 Ga0105246_10246314 Ga0105246_102463142 67
1282 3300011119 Ga0105246_10264562 Ga0105246_102645621 67
1283 3300011119 Ga0105246_10696760 Ga0105246_106967602 67
1284 3300011119 Ga0105246_10865976 Ga0105246_108659762 67
1285 3300012477 Ga0157336_1017202 Ga0157336_10172022 67
1286 3300012480 Ga0157346_1000486 Ga0157346_10004862 67
1287 3300012483 Ga0157337_1006266 Ga0157337_10062662 67
1288 3300012485 Ga0157325_1018162 Ga0157325_10181621 67
1289 3300012491 Ga0157329_1021702 Ga0157329_10217022 67
1290 3300012492 Ga0157335_1009023 Ga0157335_10090231 67
1291 3300012494 Ga0157341_1041648 Ga0157341_10416482 67
1292 3300012497 Ga0157319_1010846 Ga0157319_10108461 67
1293 3300012498 Ga0157345_1002512 Ga0157345_10025122 67
1294 3300012500 Ga0157314_1012932 Ga0157314_10129322 67
1295 3300012502 Ga0157347_1005321 Ga0157347_10053213 67
1296 3300012503 Ga0157313_1014030 Ga0157313_10140301 67
1297 3300012505 Ga0157339_1010108 Ga0157339_10101082 67
1298 3300012507 Ga0157342_1002674 Ga0157342_10026743 67
1299 3300012508 Ga0157315_1007234 Ga0157315_10072342 67
1300 3300012512 Ga0157327_1068898 Ga0157327_10688981 67
1301 3300012513 Ga0157326_1032110 Ga0157326_10321101 67
1302 3300012515 Ga0157338_1005803 Ga0157338_10058032 67
1303 3300013100 Ga0157373_10094196 Ga0157373_100941963 67
1304 3300013100 Ga0157373_10128644 Ga0157373_101286443 67
1305 3300013100 Ga0157373_10481267 Ga0157373_104812672 67
1306 3300013100 Ga0157373_10832202 Ga0157373_108322022 67
1307 3300013100 Ga0157373_11468612 Ga0157373_114686121 67
1308 3300013102 Ga0157371_10018435 Ga0157371_100184353 67
1309 3300013102 Ga0157371_10042438 Ga0157371_100424383 67
1310 3300013102 Ga0157371_10165197 Ga0157371_101651972 67
1311 3300013104 Ga0157370_10045055 Ga0157370_100450554 67
1312 3300013104 Ga0157370_10282438 Ga0157370_102824382 67
1313 3300013104 Ga0157370_10389342 Ga0157370_103893423 67
1314 3300013104 Ga0157370_10927128 Ga0157370_109271282 67
1315 3300013105 Ga0157369_10045005 Ga0157369_100450053 67
1316 3300013105 Ga0157369_10177656 Ga0157369_101776562 67
1317 3300013105 Ga0157369_10615632 Ga0157369_106156321 67
1318 3300013105 Ga0157369_10884227 Ga0157369_108842271 67
1319 3300013105 Ga0157369_11332328 Ga0157369_113323282 67
1320 3300013105 Ga0157369_11579337 Ga0157369_115793371 67
1321 3300013296 Ga0157374_10007839 Ga0157374_100078398 67
1322 3300013296 Ga0157374_10660329 Ga0157374_106603292 67
1323 3300013296 Ga0157374_11379621 Ga0157374_113796212 67
1324 3300013297 Ga0157378_10143210 Ga0157378_101432102 67
1325 3300013297 Ga0157378_10874525 Ga0157378_108745252 67
1326 3300013306 Ga0163162_10666633 Ga0163162_106666333 67
1327 3300013306 Ga0163162_11666999 Ga0163162_116669992 67
1328 3300013306 Ga0163162_12432619 Ga0163162_124326192 67
1329 3300013306 Ga0163162_13038927 Ga0163162_130389271 67
1330 3300013307 Ga0157372_10023978 Ga0157372_100239786 67
1331 3300013307 Ga0157372_10089347 Ga0157372_100893473 67
1332 3300013307 Ga0157372_10340463 Ga0157372_103404631 67
1333 3300013307 Ga0157372_10472225 Ga0157372_104722252 67
1334 3300013307 Ga0157372_11103280 Ga0157372_111032802 67
1335 3300013307 Ga0157372_11261359 Ga0157372_112613591 67
1336 3300013307 Ga0157372_11286038 Ga0157372_112860382 67
1337 3300013307 Ga0157372_11846959 Ga0157372_118469592 67
1338 3300013307 Ga0157372_12355373 Ga0157372_123553731 67
1339 3300013307 Ga0157372_13386755 Ga0157372_133867551 67
1340 3300013308 Ga0157375_10313841 Ga0157375_103138411 67
1341 3300013308 Ga0157375_10445668 Ga0157375_104456682 67
1342 3300013308 Ga0157375_11395859 Ga0157375_113958591 67
1343 3300014325 Ga0163163_10086319 Ga0163163_100863192 67
1344 3300014325 Ga0163163_11440644 Ga0163163_114406441 67
1345 3300014326 Ga0157380_10572085 Ga0157380_105720851 67
1346 3300014326 Ga0157380_11041806 Ga0157380_110418061 67
1347 3300014497 Ga0182008_10001280 Ga0182008_100012803 67
1348 3300014497 Ga0182008_10063733 Ga0182008_100637332 67
1349 3300014497 Ga0182008_10154693 Ga0182008_101546932 67
1350 3300014497 Ga0182008_10771580 Ga0182008_107715802 67
1351 3300014745 Ga0157377_10099503 Ga0157377_100995032 67
1352 3300014745 Ga0157377_10297683 Ga0157377_102976832 67
1353 3300014745 Ga0157377_11740804 Ga0157377_117408041 67
1354 3300014968 Ga0157379_10245301 Ga0157379_102453012 67
1355 3300014969 Ga0157376_10149208 Ga0157376_101492083 67
1356 3300014969 Ga0157376_10176007 Ga0157376_101760073 67
1357 3300014969 Ga0157376_10743029 Ga0157376_107430291 67
1358 3300015261 Ga0182006_1239719 Ga0182006_12397191 67
1359 3300015262 Ga0182007_10000582 Ga0182007_1000058213 67
1360 3300015262 Ga0182007_10271434 Ga0182007_102714342 67
1361 3300015265 Ga0182005_1100806 Ga0182005_11008061 67
1362 3300015688 Ga0183367_1005 Ga0183367_1005158 67
1363 3300017792 Ga0163161_10463463 Ga0163161_104634632 67
1364 3300017792 Ga0163161_11057483 Ga0163161_110574831 67
1365 3300017792 Ga0163161_11283187 Ga0163161_112831871 67
1366 3300019183 Ga0184601_106011 Ga0184601_1060112 67
1367 3300020069 Ga0197907_10000430 Ga0197907_100004301 67
1368 3300020069 Ga0197907_10288082 Ga0197907_102880822 67
1369 3300020069 Ga0197907_10376985 Ga0197907_103769852 67
1370 3300020069 Ga0197907_11205039 Ga0197907_112050392 67
1371 3300020069 Ga0197907_11225079 Ga0197907_112250792 67
1372 3300020070 Ga0206356_10944536 Ga0206356_109445362 67
1373 3300020070 Ga0206356_11717365 Ga0206356_117173652 67
1374 3300020075 Ga0206349_1677274 Ga0206349_16772742 67
1375 3300020076 Ga0206355_1718134 Ga0206355_17181341 67
1376 3300020077 Ga0206351_10722143 Ga0206351_107221431 67
1377 3300020078 Ga0206352_10254953 Ga0206352_102549531 67
1378 3300020078 Ga0206352_10791224 Ga0206352_107912242 67
1379 3300020078 Ga0206352_11198618 Ga0206352_111986182 67
1380 3300020080 Ga0206350_10374030 Ga0206350_103740302 67
1381 3300020080 Ga0206350_11294616 Ga0206350_112946162 67
1382 3300020080 Ga0206350_11421611 Ga0206350_114216111 67
1383 3300020081 Ga0206354_10445256 Ga0206354_104452562 67
1384 3300020081 Ga0206354_10750047 Ga0206354_107500474 67
1385 3300020081 Ga0206354_11141536 Ga0206354_111415361 67
1386 3300020081 Ga0206354_11381198 Ga0206354_113811982 67
1387 3300020081 Ga0206354_11660386 Ga0206354_116603862 67
1388 3300020082 Ga0206353_10158060 Ga0206353_101580601 67
1389 3300020082 Ga0206353_10211368 Ga0206353_102113682 67
1390 3300020082 Ga0206353_11402443 Ga0206353_114024432 67
1391 3300020082 Ga0206353_11776395 Ga0206353_117763951 67
1392 3300020610 Ga0154015_1173053 Ga0154015_11730531 67
1393 3300020610 Ga0154015_1285698 Ga0154015_12856982 67
1394 3300021358 Ga0213873_10048000 Ga0213873_100480003 67
1395 3300021361 Ga0213872_10363985 Ga0213872_103639851 67
1396 3300021377 Ga0213874_10109716 Ga0213874_101097161 67
1397 3300021388 Ga0213875_10001074 Ga0213875_1000107420 67
1398 3300021388 Ga0213875_10134582 Ga0213875_101345821 67
1399 3300021388 Ga0213875_10180928 Ga0213875_101809283 67
1400 3300022467 Ga0224712_10018811 Ga0224712_100188112 67
1401 3300022467 Ga0224712_10038218 Ga0224712_100382182 67
1402 3300022467 Ga0224712_10580348 Ga0224712_105803481 67
1403 3300023552 Ga0247551_104776 Ga0247551_1047761 67
1404 3300023680 Ga0247528_111965 Ga0247528_1119652 67
1405 3300024225 Ga0224572_1016890 Ga0224572_10168902 67
1406 3300024225 Ga0224572_1039710 Ga0224572_10397101 67
1407 3300024227 Ga0228598_1006679 Ga0228598_10066792 67
1408 3300025273 Ga0209673_1075826 Ga0209673_10758262 67
1409 3300025297 Ga0209758_1004710 Ga0209758_10047109 67
1410 3300025302 Ga0207426_1010098 Ga0207426_10100982 67
1411 3300025302 Ga0207426_1021647 Ga0207426_10216472 67
1412 3300025302 Ga0207426_1035840 Ga0207426_10358403 67
1413 3300025321 Ga0207656_10002744 Ga0207656_100027448 67
1414 3300025321 Ga0207656_10317020 Ga0207656_103170202 67
1415 3300025711 Ga0207696_1089907 Ga0207696_10899071 67
1416 3300025735 Ga0207713_1015813 Ga0207713_10158134 67
1417 3300025735 Ga0207713_1069261 Ga0207713_10692613 67
1418 3300025735 Ga0207713_1187793 Ga0207713_11877931 67
1419 3300025885 Ga0207653_10010290 Ga0207653_100102904 67
1420 3300025893 Ga0207682_10434243 Ga0207682_104342431 67
1421 3300025898 Ga0207692_10061982 Ga0207692_100619823 67
1422 3300025898 Ga0207692_10283443 Ga0207692_102834432 67
1423 3300025898 Ga0207692_11113518 Ga0207692_111135181 67
1424 3300025900 Ga0207710_10048418 Ga0207710_100484181 67
1425 3300025900 Ga0207710_10148245 Ga0207710_101482452 67
1426 3300025900 Ga0207710_10285787 Ga0207710_102857872 67
1427 3300025901 Ga0207688_10005845 Ga0207688_100058457 67
1428 3300025901 Ga0207688_10202007 Ga0207688_102020071 67
1429 3300025903 Ga0207680_10092482 Ga0207680_100924822 67
1430 3300025903 Ga0207680_10990028 Ga0207680_109900281 67
1431 3300025904 Ga0207647_10129790 Ga0207647_101297902 67
1432 3300025904 Ga0207647_10180858 Ga0207647_101808583 67
1433 3300025904 Ga0207647_10337524 Ga0207647_103375242 67
1434 3300025905 Ga0207685_10106860 Ga0207685_101068602 67
1435 3300025906 Ga0207699_10019950 Ga0207699_100199503 67
1436 3300025906 Ga0207699_10057858 Ga0207699_100578582 67
1437 3300025906 Ga0207699_10127567 Ga0207699_101275673 67
1438 3300025906 Ga0207699_11421641 Ga0207699_114216412 67
1439 3300025907 Ga0207645_10125468 Ga0207645_101254682 67
1440 3300025907 Ga0207645_10140421 Ga0207645_101404211 67
1441 3300025908 Ga0207643_10000785 Ga0207643_1000078517 67
1442 3300025908 Ga0207643_10097704 Ga0207643_100977042 67
1443 3300025909 Ga0207705_10008895 Ga0207705_100088953 67
1444 3300025909 Ga0207705_10665820 Ga0207705_106658201 67
1445 3300025910 Ga0207684_10033328 Ga0207684_100333282 67
1446 3300025910 Ga0207684_10169825 Ga0207684_101698252 67
1447 3300025910 Ga0207684_10190164 Ga0207684_101901643 67
1448 3300025910 Ga0207684_10339361 Ga0207684_103393611 67
1449 3300025910 Ga0207684_11326226 Ga0207684_113262261 67
1450 3300025911 Ga0207654_10011556 Ga0207654_100115562 67
1451 3300025911 Ga0207654_11072503 Ga0207654_110725031 67
1452 3300025912 Ga0207707_10085902 Ga0207707_100859023 67
1453 3300025912 Ga0207707_10239879 Ga0207707_102398792 67
1454 3300025913 Ga0207695_10204898 Ga0207695_102048983 67
1455 3300025913 Ga0207695_10522574 Ga0207695_105225741 67
1456 3300025914 Ga0207671_10706685 Ga0207671_107066852 67
1457 3300025915 Ga0207693_10967246 Ga0207693_109672461 67
1458 3300025916 Ga0207663_10321391 Ga0207663_103213911 67
1459 3300025916 Ga0207663_10899073 Ga0207663_108990732 67
1460 3300025917 Ga0207660_10010834 Ga0207660_100108346 67
1461 3300025917 Ga0207660_10681717 Ga0207660_106817172 67
1462 3300025917 Ga0207660_11615416 Ga0207660_116154162 67
1463 3300025918 Ga0207662_10026955 Ga0207662_100269552 67
1464 3300025918 Ga0207662_10088442 Ga0207662_100884422 67
1465 3300025919 Ga0207657_10009895 Ga0207657_100098959 67
1466 3300025919 Ga0207657_10029438 Ga0207657_100294382 67
1467 3300025919 Ga0207657_10641272 Ga0207657_106412722 67
1468 3300025920 Ga0207649_10007710 Ga0207649_100077105 67
1469 3300025920 Ga0207649_10280483 Ga0207649_102804831 67
1470 3300025921 Ga0207652_10006407 Ga0207652_100064077 67
1471 3300025921 Ga0207652_10013800 Ga0207652_100138006 67
1472 3300025921 Ga0207652_10411397 Ga0207652_104113972 67
1473 3300025921 Ga0207652_10670105 Ga0207652_106701052 67
1474 3300025921 Ga0207652_11499633 Ga0207652_114996331 67
1475 3300025921 Ga0207652_11760923 Ga0207652_117609231 67
1476 3300025922 Ga0207646_10170346 Ga0207646_101703462 67
1477 3300025922 Ga0207646_10639852 Ga0207646_106398521 67
1478 3300025922 Ga0207646_11344708 Ga0207646_113447082 67
1479 3300025924 Ga0207694_10263491 Ga0207694_102634912 67
1480 3300025924 Ga0207694_10815868 Ga0207694_108158681 67
1481 3300025924 Ga0207694_11368813 Ga0207694_113688131 67
1482 3300025925 Ga0207650_10007339 Ga0207650_100073395 67
1483 3300025925 Ga0207650_10792471 Ga0207650_107924711 67
1484 3300025926 Ga0207659_10076357 Ga0207659_100763573 67
1485 3300025926 Ga0207659_10538630 Ga0207659_105386301 67
1486 3300025927 Ga0207687_10004699 Ga0207687_100046992 67
1487 3300025927 Ga0207687_10085074 Ga0207687_100850742 67
1488 3300025927 Ga0207687_10430985 Ga0207687_104309852 67
1489 3300025928 Ga0207700_10078649 Ga0207700_100786493 67
1490 3300025928 Ga0207700_10110485 Ga0207700_101104852 67
1491 3300025928 Ga0207700_10138114 Ga0207700_101381143 67
1492 3300025928 Ga0207700_10218242 Ga0207700_102182422 67
1493 3300025928 Ga0207700_10377698 Ga0207700_103776981 67
1494 3300025928 Ga0207700_10447459 Ga0207700_104474591 67
1495 3300025928 Ga0207700_10631391 Ga0207700_106313912 67
1496 3300025929 Ga0207664_10001524 Ga0207664_100015241 67
1497 3300025929 Ga0207664_10003186 Ga0207664_100031864 67
1498 3300025929 Ga0207664_10009124 Ga0207664_100091244 67
1499 3300025929 Ga0207664_10185885 Ga0207664_101858853 67
1500 3300025929 Ga0207664_10391912 Ga0207664_103919123 67
1501 3300025929 Ga0207664_10482268 Ga0207664_104822682 67
1502 3300025929 Ga0207664_10555525 Ga0207664_105555251 67
1503 3300025929 Ga0207664_10709886 Ga0207664_107098862 67
1504 3300025931 Ga0207644_10330883 Ga0207644_103308832 67
1505 3300025931 Ga0207644_10472008 Ga0207644_104720083 67
1506 3300025931 Ga0207644_10670477 Ga0207644_106704772 67
1507 3300025931 Ga0207644_11566601 Ga0207644_115666011 67
1508 3300025932 Ga0207690_10184443 Ga0207690_101844432 67
1509 3300025932 Ga0207690_10916477 Ga0207690_109164771 67
1510 3300025933 Ga0207706_10072026 Ga0207706_100720263 67
1511 3300025933 Ga0207706_10103797 Ga0207706_101037973 67
1512 3300025934 Ga0207686_10070926 Ga0207686_100709261 67
1513 3300025934 Ga0207686_11003919 Ga0207686_110039191 67
1514 3300025935 Ga0207709_10149879 Ga0207709_101498793 67
1515 3300025935 Ga0207709_10260330 Ga0207709_102603301 67
1516 3300025935 Ga0207709_10683302 Ga0207709_106833022 67
1517 3300025936 Ga0207670_10280515 Ga0207670_102805151 67
1518 3300025936 Ga0207670_10404127 Ga0207670_104041272 67
1519 3300025937 Ga0207669_10138738 Ga0207669_101387381 67
1520 3300025937 Ga0207669_11108928 Ga0207669_111089282 67
1521 3300025938 Ga0207704_10800144 Ga0207704_108001441 67
1522 3300025938 Ga0207704_11471486 Ga0207704_114714861 67
1523 3300025939 Ga0207665_10229302 Ga0207665_102293023 67
1524 3300025940 Ga0207691_10006993 Ga0207691_1000699310 67
1525 3300025940 Ga0207691_10292907 Ga0207691_102929073 67
1526 3300025940 Ga0207691_10978209 Ga0207691_109782091 67
1527 3300025941 Ga0207711_10247142 Ga0207711_102471422 67
1528 3300025941 Ga0207711_10355742 Ga0207711_103557421 67
1529 3300025941 Ga0207711_11487377 Ga0207711_114873772 67
1530 3300025942 Ga0207689_10006217 Ga0207689_100062173 67
1531 3300025942 Ga0207689_10038661 Ga0207689_100386612 67
1532 3300025944 Ga0207661_10000336 Ga0207661_1000033622 67
1533 3300025944 Ga0207661_10182423 Ga0207661_101824232 67
1534 3300025944 Ga0207661_11065429 Ga0207661_110654291 67
1535 3300025945 Ga0207679_10001066 Ga0207679_100010662 67
1536 3300025945 Ga0207679_10322244 Ga0207679_103222442 67
1537 3300025945 Ga0207679_10612563 Ga0207679_106125631 67
1538 3300025949 Ga0207667_10787716 Ga0207667_107877162 67
1539 3300025949 Ga0207667_11077547 Ga0207667_110775471 67
1540 3300025960 Ga0207651_10091623 Ga0207651_100916233 67
1541 3300025960 Ga0207651_10212793 Ga0207651_102127932 67
1542 3300025961 Ga0207712_10509532 Ga0207712_105095321 67
1543 3300025961 Ga0207712_10919774 Ga0207712_109197741 67
1544 3300025972 Ga0207668_11605737 Ga0207668_116057371 67
1545 3300025981 Ga0207640_10031537 Ga0207640_100315373 67
1546 3300025981 Ga0207640_11383406 Ga0207640_113834061 67
1547 3300025986 Ga0207658_10147132 Ga0207658_101471323 67
1548 3300025986 Ga0207658_11610945 Ga0207658_116109451 67
1549 3300026023 Ga0207677_10019593 Ga0207677_100195932 67
1550 3300026023 Ga0207677_10251985 Ga0207677_102519851 67
1551 3300026035 Ga0207703_10234602 Ga0207703_102346021 67
1552 3300026035 Ga0207703_10981002 Ga0207703_109810021 67
1553 3300026035 Ga0207703_11790484 Ga0207703_117904842 67
1554 3300026041 Ga0207639_10056849 Ga0207639_100568493 67
1555 3300026041 Ga0207639_11183784 Ga0207639_111837841 67
1556 3300026067 Ga0207678_10001106 Ga0207678_100011061 67
1557 3300026067 Ga0207678_10070312 Ga0207678_100703123 67
1558 3300026067 Ga0207678_10085601 Ga0207678_100856013 67
1559 3300026067 Ga0207678_11050358 Ga0207678_110503582 67
1560 3300026075 Ga0207708_10009638 Ga0207708_100096388 67
1561 3300026075 Ga0207708_10102554 Ga0207708_101025542 67
1562 3300026075 Ga0207708_12014051 Ga0207708_120140511 67
1563 3300026078 Ga0207702_10041776 Ga0207702_100417762 67
1564 3300026078 Ga0207702_10373661 Ga0207702_103736613 67
1565 3300026078 Ga0207702_10940286 Ga0207702_109402861 67
1566 3300026078 Ga0207702_11229571 Ga0207702_112295711 67
1567 3300026088 Ga0207641_10138939 Ga0207641_101389392 67
1568 3300026088 Ga0207641_10666830 Ga0207641_106668302 67
1569 3300026088 Ga0207641_11228017 Ga0207641_112280171 67
1570 3300026088 Ga0207641_12122744 Ga0207641_121227442 67
1571 3300026089 Ga0207648_10100745 Ga0207648_101007452 67
1572 3300026089 Ga0207648_10902268 Ga0207648_109022682 67
1573 3300026089 Ga0207648_11784803 Ga0207648_117848032 67
1574 3300026095 Ga0207676_10000648 Ga0207676_1000064813 67
1575 3300026095 Ga0207676_10998509 Ga0207676_109985092 67
1576 3300026095 Ga0207676_11928961 Ga0207676_119289611 67
1577 3300026116 Ga0207674_10011766 Ga0207674_100117662 67
1578 3300026116 Ga0207674_10132094 Ga0207674_101320942 67
1579 3300026116 Ga0207674_10627488 Ga0207674_106274882 67
1580 3300026118 Ga0207675_100021849 Ga0207675_1000218496 67
1581 3300026118 Ga0207675_100359039 Ga0207675_1003590393 67
1582 3300026118 Ga0207675_101174281 Ga0207675_1011742812 67
1583 3300026121 Ga0207683_10001393 Ga0207683_1000139321 67
1584 3300026121 Ga0207683_10028516 Ga0207683_100285165 67
1585 3300026121 Ga0207683_11309190 Ga0207683_113091901 67
1586 3300026142 Ga0207698_10714364 Ga0207698_107143641 67
1587 3300027512 Ga0209179_1125150 Ga0209179_11251501 67
1588 3300027907 Ga0207428_10003435 Ga0207428_100034359 67
1589 3300028379 Ga0268266_10132557 Ga0268266_101325573 67
1590 3300028379 Ga0268266_10244148 Ga0268266_102441483 67
1591 3300028379 Ga0268266_11156271 Ga0268266_111562711 67
1592 3300028380 Ga0268265_10109619 Ga0268265_101096193 67
1593 3300028380 Ga0268265_10769483 Ga0268265_107694832 67
1594 3300028381 Ga0268264_10346751 Ga0268264_103467512 67
1595 3300028381 Ga0268264_12003302 Ga0268264_120033021 67
1596 3300028556 Ga0265337_1000015 Ga0265337_100001567 67
1597 3300028558 Ga0265326_10017844 Ga0265326_100178441 67
1598 3300028563 Ga0265319_1001246 Ga0265319_10012462 67
1599 3300028573 Ga0265334_10000373 Ga0265334_1000037311 67
1600 3300028654 Ga0265322_10012472 Ga0265322_100124722 67
1601 3300028786 Ga0307517_10008703 Ga0307517_1000870311 67
1602 3300028786 Ga0307517_10576044 Ga0307517_105760441 67
1603 3300028800 Ga0265338_10007479 Ga0265338_100074791 67
1604 3300028800 Ga0265338_10014640 Ga0265338_100146403 67
1605 3300028800 Ga0265338_11166024 Ga0265338_111660242 67
1606 3300029282 Ga0311003_101840 Ga0311003_1018401 67
1607 3300029957 Ga0265324_10002740 Ga0265324_100027401 67
1608 3300030500 Ga0268256_1018028 Ga0268256_10180281 67
1609 3300030521 Ga0307511_10136404 Ga0307511_101364043 67
1610 3300030521 Ga0307511_10142565 Ga0307511_101425652 67
1611 3300030521 Ga0307511_10276720 Ga0307511_102767202 67
1612 3300030760 Ga0265762_1085621 Ga0265762_10856211 67
1613 3300030760 Ga0265762_1087115 Ga0265762_10871152 67
1614 3300030863 Ga0265766_1022293 Ga0265766_10222931 67
1615 3300030878 Ga0265770_1039554 Ga0265770_10395541 67
1616 3300030882 Ga0265764_111591 Ga0265764_1115911 67
1617 3300030889 Ga0265761_110884 Ga0265761_1108841 67
1618 3300030963 Ga0265768_109562 Ga0265768_1095621 67
1619 3300031010 Ga0265771_1002017 Ga0265771_10020172 67
1620 3300031010 Ga0265771_1013123 Ga0265771_10131232 67
1621 3300031011 Ga0265774_103887 Ga0265774_1038871 67
1622 3300031090 Ga0265760_10006434 Ga0265760_100064343 67
1623 3300031090 Ga0265760_10069611 Ga0265760_100696111 67
1624 3300031090 Ga0265760_10113006 Ga0265760_101130062 67
1625 3300031238 Ga0265332_10058380 Ga0265332_100583802 67
1626 3300031240 Ga0265320_10001898 Ga0265320_100018981 67
1627 3300031240 Ga0265320_10041316 Ga0265320_100413162 67
1628 3300031241 Ga0265325_10015321 Ga0265325_100153214 67
1629 3300031241 Ga0265325_10060617 Ga0265325_100606171 67
1630 3300031247 Ga0265340_10003540 Ga0265340_100035407 67
1631 3300031247 Ga0265340_10004519 Ga0265340_100045193 67
1632 3300031247 Ga0265340_10082220 Ga0265340_100822202 67
1633 3300031249 Ga0265339_10014234 Ga0265339_100142344 67
1634 3300031250 Ga0265331_10246008 Ga0265331_102460081 67
1635 3300031344 Ga0265316_10006862 Ga0265316_100068621 67
1636 3300031344 Ga0265316_10154230 Ga0265316_101542302 67
1637 3300031507 Ga0307509_10009190 Ga0307509_100091908 67
1638 3300031548 Ga0307408_100053565 Ga0307408_1000535653 67
1639 3300031548 Ga0307408_101472446 Ga0307408_1014724462 67
1640 3300031595 Ga0265313_10090959 Ga0265313_100909592 67
1641 3300031615 Ga0310107_133548 Ga0310107_1335482 67
1642 3300031616 Ga0307508_10042905 Ga0307508_100429054 67
1643 3300031616 Ga0307508_10049088 Ga0307508_100490881 67
1644 3300031616 Ga0307508_10436673 Ga0307508_104366731 67
1645 3300031649 Ga0307514_10175696 Ga0307514_101756962 67
1646 3300031667 Ga0310111_125385 Ga0310111_1253852 67
1647 3300031711 Ga0265314_10016664 Ga0265314_100166644 67
1648 3300031711 Ga0265314_10048633 Ga0265314_100486332 67
1649 3300031712 Ga0265342_10033693 Ga0265342_100336933 67
1650 3300031712 Ga0265342_10036408 Ga0265342_100364083 67
1651 3300031730 Ga0307516_10056359 Ga0307516_100563593 67
1652 3300031730 Ga0307516_10068332 Ga0307516_100683324 67
1653 3300031810 Ga0316044_123521 Ga0316044_1235211 67
1654 3300031824 Ga0307413_10239047 Ga0307413_102390472 67
1655 3300031824 Ga0307413_10428832 Ga0307413_104288322 67
1656 3300031824 Ga0307413_10783646 Ga0307413_107836462 67
1657 3300031852 Ga0307410_10018684 Ga0307410_100186844 67
1658 3300031852 Ga0307410_10517336 Ga0307410_105173362 67
1659 3300031901 Ga0307406_10061971 Ga0307406_100619713 67
1660 3300031911 Ga0307412_11657115 Ga0307412_116571151 67
1661 3300031995 Ga0307409_100767361 Ga0307409_1007673611 67
1662 3300031995 Ga0307409_100997431 Ga0307409_1009974312 67
1663 3300032002 Ga0307416_100035506 Ga0307416_1000355063 67
1664 3300032002 Ga0307416_100482859 Ga0307416_1004828592 67
1665 3300032005 Ga0307411_11889445 Ga0307411_118894452 67
1666 3300033179 Ga0307507_10620089 Ga0307507_106200891 67
1667 3300033180 Ga0307510_10144369 Ga0307510_101443692 67
1668 3300033545 Ga0316214_1000482 Ga0316214_10004823 67
1669 3300033545 Ga0316214_1003948 Ga0316214_10039481 67
1670 3300033547 Ga0316212_1003331 Ga0316212_10033313 67
1671 3300034816 Ga0373930_0109559 Ga0373930_0109559_234_437 67
1672 3300034817 Ga0373948_0041310 Ga0373948_0041310_732_935 67
1673 3300034818 Ga0373950_0090347 Ga0373950_0090347_139_348 67
1674 3300035083 Ga0373926_0024276 Ga0373926_0024276_1742_1945 67
1675 3300035085 Ga0373929_0074912 Ga0373929_0074912_462_665 67
1676 3300035086 Ga0373934_0016099 Ga0373934_0016099_1521_1724 67
1677 3300035086 Ga0373934_0065600 Ga0373934_0065600_850_1053 67
1678 3300035088 Ga0373940_0162500 Ga0373940_0162500_23_226 67
1679 3300035089 Ga0373944_0054981 Ga0373944_0054981_766_969 67
1680 3300035091 Ga0373951_0162768 Ga0373951_0162768_390_593 67
1681 3300035092 Ga0373952_0255440 Ga0373952_0255440_225_428 67
1682 3300035111 Ga0373923_0222494 Ga0373923_0222494_643_846 67
1683 3300035113 Ga0373936_0063067 Ga0373936_0063067_630_833 67
1684 3300035113 Ga0373936_0199673 Ga0373936_0199673_525_728 67
1685 3300035113 Ga0373936_0311106 Ga0373936_0311106_328_531 67
1686 3300035115 Ga0373941_0100267 Ga0373941_0100267_460_669 67
1687 3300035115 Ga0373941_0324149 Ga0373941_0324149_95_298 67
1688 3300035116 Ga0373945_0167148 Ga0373945_0167148_288_491 67
1689 3300035116 Ga0373945_0465205 Ga0373945_0465205_341_544 67
1690 3300035117 Ga0373953_0043953 Ga0373953_0043953_554_757 67
1691 3300035117 Ga0373953_0421401 Ga0373953_0421401_210_413 67
1692 3300035118 Ga0373954_0097558 Ga0373954_0097558_633_836 67
1693 3300035119 Ga0373956_0050919 Ga0373956_0050919_709_912 67
1694 3300035120 Ga0373957_0037568 Ga0373957_0037568_338_541 67
1695 3300035120 Ga0373957_0101528 Ga0373957_0101528_856_1059 67
1696 3300035120 Ga0373957_0200007 Ga0373957_0200007_131_334 67
1697 3300035121 Ga0373960_0137114 Ga0373960_0137114_135_338 67
1698 3300035170 Ga0373943_0081332 Ga0373943_0081332_609_812 67
1699 3300035171 Ga0373946_0066712 Ga0373946_0066712_932_1135 67
1700 3300035171 Ga0373946_0410365 Ga0373946_0410365_275_484 67
1701 3300035172 Ga0373955_0140143 Ga0373955_0140143_1087_1290 67
1702 3300035172 Ga0373955_0325507 Ga0373955_0325507_559_762 67
1703 3300035207 Ga0373942_0047227 Ga0373942_0047227_457_660 67
1704 3300035410 Ga0373924_0066473 Ga0373924_0066473_718_921 67
1705 3300035691 Ga0373931_0098523 Ga0373931_0098523_764_973 67
1706 3300035691 Ga0373931_0836462 Ga0373931_0836462_17_220 67
1707 3300035692 Ga0373935_0016967 Ga0373935_0016967_3831_4034 67
1708 3300035695 Ga0373927_0024730 Ga0373927_0024730_134_337 67
1709 3300035695 Ga0373927_0108817 Ga0373927_0108817_546_749 67
1710 3300035724 Ga0373933_0016385 Ga0373933_0016385_3009_3212 67
1711 3300035724 Ga0373933_0133630 Ga0373933_0133630_145_348 67
1712 3300035724 Ga0373933_0463129 Ga0373933_0463129_32_235 67
1713 3300035725 Ga0373947_0093287 Ga0373947_0093287_1461_1664 67
1714 3300035725 Ga0373947_0336826 Ga0373947_0336826_409_612 67
1715 3300036242 Ga0310104_20196 Ga0310104_20196_62_265 67
1716 3300036401 Ga0373937_0269908 Ga0373937_0269908_1365_1568 67
1717 3300036401 Ga0373937_0271984 Ga0373937_0271984_518_721 67
1718 3300036401 Ga0373937_0366169 Ga0373937_0366169_422_625 67
1719 3300036401 Ga0373937_0808561 Ga0373937_0808561_117_320 67
1720 3300036457 Ga0265778_024529 Ga0265778_024529_120_323 67
1721 3300036457 Ga0265778_024529 Ga0265778_024529_444_647 67
1722 3300037068 Ga0373925_0000540 Ga0373925_0000540_13082_13285 67
1723 3300037068 Ga0373925_0005130 Ga0373925_0005130_9092_9295 67
1724 3300037068 Ga0373925_0188311 Ga0373925_0188311_32_235 67
1725 3300037068 Ga0373925_0357750 Ga0373925_0357750_807_1016 67
1726 3300037418 Ga0395900_0186888 Ga0395900_0186888_582_788 67
1727 3300037466 Ga0395898_0408457 Ga0395898_0408457_32_235 67
1728 3300037466 Ga0395898_0550320 Ga0395898_0550320_548_754 67
1729 3300037466 Ga0395898_0955662 Ga0395898_0955662_433_642 67
1730 3300037471 Ga0395905_0441340 Ga0395905_0441340_62_268 67
1731 3300037853 Ga0436364_0081229 Ga0436364_0081229_317_520 67
1732 3300037853 Ga0436364_0243023 Ga0436364_0243023_1029_1232 67
1733 3300037853 Ga0436364_0479741 Ga0436364_0479741_5400_5603 67
1734 3300037853 Ga0436364_1098280 Ga0436364_1098280_994_1197 67
1735 3300037853 Ga0436364_1174043 Ga0436364_1174043_6426_6629 67
1736 3300037853 Ga0436364_1263484 Ga0436364_1263484_372_575 67
1737 3300037853 Ga0436364_1381350 Ga0436364_1381350_18886_19089 67
1738 3300037853 Ga0436364_1527719 Ga0436364_1527719_662_865 67
1739 3300038443 Ga0395901_0368107 Ga0395901_0368107_623_832 67
1740 3300038443 Ga0395901_1522668 Ga0395901_1522668_342_548 67
1741 3300039437 Ga0436365_0207903 Ga0436365_0207903_784_987 67
1742 3300039438 Ga0436360_0519033 Ga0436360_0519033_264_467 67
1743 3300039447 Ga0436361_0083233 Ga0436361_0083233_167_370 67
1744 3300039447 Ga0436361_0085148 Ga0436361_0085148_137_340 67
1745 3300039447 Ga0436361_0592735 Ga0436361_0592735_246_449 67
1746 3300039447 Ga0436361_0739507 Ga0436361_0739507_299_502 67
1747 3300039447 Ga0436361_1089145 Ga0436361_1089145_314_517 67
1748 3300039450 Ga0436363_0129145 Ga0436363_0129145_167_370 67
1749 3300039450 Ga0436363_0216045 Ga0436363_0216045_1231_1434 67
1750 3300039450 Ga0436363_1231403 Ga0436363_1231403_885_1088 67
1751 3300039450 Ga0436363_1481670 Ga0436363_1481670_211_414 67
1752 3300039450 Ga0436363_1578490 Ga0436363_1578490_479_682 67
1753 3300039450 Ga0436363_1583483 Ga0436363_1583483_327_530 67
1754 3300039453 Ga0436362_0324614 Ga0436362_0324614_325_528 67
1755 3300039453 Ga0436362_1221077 Ga0436362_1221077_220_423 67
1756 3300039453 Ga0436362_1298483 Ga0436362_1298483_369_572 67
1757 3300039453 Ga0436362_1301744 Ga0436362_1301744_363_566 67
1758 3300041404 Ga0439436_0000524 Ga0439436_0000524_9355_9558 67
1759 3300041404 Ga0439436_0006412 Ga0439436_0006412_2955_3158 67
1760 3300041406 Ga0439439_0010113 Ga0439439_0010113_1866_2069 67
1761 3300041406 Ga0439439_0068353 Ga0439439_0068353_129_332 67
1762 3300041411 Ga0439466_0166992 Ga0439466_0166992_166_369 67
1763 3300041496 Ga0451839_0572827 Ga0451839_0572827_16_219 67
1764 3300041501 Ga0451845_0003149 Ga0451845_0003149_80_286 67
1765 3300041509 Ga0451843_1278596 Ga0451843_1278596_254_460 67
1766 3300041512 Ga0451853_3555550 Ga0451853_3555550_20_226 67
1767 3300041512 Ga0451853_3556725 Ga0451853_3556725_20_226 67
1768 3300041999 Ga0439433_0001892 Ga0439433_0001892_488_691 67
1769 3300042002 Ga0439442_071616 Ga0439442_071616_101_304 67
1770 3300042005 Ga0439448_0001950 Ga0439448_0001950_5277_5483 67
1771 3300042005 Ga0439448_0076419 Ga0439448_0076419_314_523 67
1772 3300042005 Ga0439448_0319083 Ga0439448_0319083_100_303 67
1773 3300042007 Ga0439449_0011654 Ga0439449_0011654_1209_1412 67
1774 3300042007 Ga0439449_0298946 Ga0439449_0298946_54_257 67
1775 3300042012 Ga0439455_0009521 Ga0439455_0009521_424_630 67
1776 3300042012 Ga0439455_0076718 Ga0439455_0076718_204_413 67
1777 3300042013 Ga0439456_043895 Ga0439456_043895_724_930 67
1778 3300042014 Ga0439457_001024 Ga0439457_001024_5114_5317 67
1779 3300042014 Ga0439457_001614 Ga0439457_001614_6467_6670 67
1780 3300042015 Ga0439462_0004876 Ga0439462_0004876_67_270 67
1781 3300042016 Ga0439463_179444 Ga0439463_179444_163_372 67
1782 3300042118 Ga0450914_065157 Ga0450914_065157_271_480 67
1783 3300042127 Ga0450890_071893 Ga0450890_071893_116_325 67
1784 3300042131 Ga0450894_000035 Ga0450894_000035_1417_1623 67
1785 3300042133 Ga0450896_002593 Ga0450896_002593_48_254 67
1786 3300042134 Ga0450898_078105 Ga0450898_078105_401_607 67
1787 3300042135 Ga0450899_000138 Ga0450899_000138_2992_3198 67
1788 3300042137 Ga0450902_032410 Ga0450902_032410_264_473 67
1789 3300042138 Ga0450903_000067 Ga0450903_000067_20131_20337 67
1790 3300042145 Ga0450906_002005 Ga0450906_002005_4101_4307 67
1791 3300042146 Ga0450907_064767 Ga0450907_064767_203_406 67
1792 3300042157 Ga0439458_0005318 Ga0439458_0005318_1988_2194 67
1793 3300042157 Ga0439458_0050659 Ga0439458_0050659_248_457 67
1794 3300042438 Ga0439459_0004735 Ga0439459_0004735_1089_1298 67
1795 3300042438 Ga0439459_0042938 Ga0439459_0042938_90_299 67
1796 3300042438 Ga0439459_0176540 Ga0439459_0176540_352_558 67
1797 3300042439 Ga0439464_0169427 Ga0439464_0169427_99_308 67
1798 3300042533 Ga0450901_006724 Ga0450901_006724_595_801 67
1799 3300044656 Ga0466969_0006155 Ga0466969_0006155_5595_5798 67
1800 3300044658 Ga0466972_0031457 Ga0466972_0031457_1135_1338 67
1801 3300044658 Ga0466972_0252403 Ga0466972_0252403_592_795 67
1802 3300044684 Ga0466966_0001016 Ga0466966_0001016_8605_8808 67
1803 3300044684 Ga0466966_0009462 Ga0466966_0009462_1559_1762 67
1804 3300044684 Ga0466966_0012013 Ga0466966_0012013_2677_2880 67
1805 3300044693 Ga0466961_0006277 Ga0466961_0006277_6915_7118 67
1806 3300044693 Ga0466961_0018930 Ga0466961_0018930_3157_3360 67
1807 3300044693 Ga0466961_0023269 Ga0466961_0023269_2783_2986 67
1808 3300044693 Ga0466961_0094041 Ga0466961_0094041_791_997 67
1809 3300044693 Ga0466961_0160266 Ga0466961_0160266_88_291 67
1810 3300044694 Ga0466963_0406126 Ga0466963_0406126_64_270 67
1811 3300044694 Ga0466963_1101807 Ga0466963_1101807_204_410 67
1812 3300044706 Ga0466964_0112830 Ga0466964_0112830_49_252 67
1813 3300044706 Ga0466964_0562917 Ga0466964_0562917_394_600 67
1814 3300044719 Ga0466971_0000730 Ga0466971_0000730_11893_12096 67
1815 3300044719 Ga0466971_0011377 Ga0466971_0011377_1584_1787 67
1816 3300044765 Ga0466970_0002624 Ga0466970_0002624_7655_7858 67
1817 3300044765 Ga0466970_0310853 Ga0466970_0310853_556_759 67
1818 3300044765 Ga0466970_0720331 Ga0466970_0720331_21_224 67
1819 3300044842 Ga0466957_0629040 Ga0466957_0629040_337_543 67
1820 3300044842 Ga0466957_0737721 Ga0466957_0737721_359_562 67
1821 3300044901 Ga0466960_0028068 Ga0466960_0028068_82_285 67
1822 3300045049 Ga0466959_0000507 Ga0466959_0000507_1047_1250 67
1823 3300045049 Ga0466959_0007332 Ga0466959_0007332_3401_3604 67
1824 3300045049 Ga0466959_0011863 Ga0466959_0011863_5487_5690 67
1825 3300045836 Ga0466958_0010466 Ga0466958_0010466_2526_2729 67
1826 3300045836 Ga0466958_0192525 Ga0466958_0192525_567_773 67
1827 3300045976 Ga0466967_0525765 Ga0466967_0525765_750_956 67
1828 3300045976 Ga0466967_1419345 Ga0466967_1419345_225_431 67
1829 3300045976 Ga0466967_1642962 Ga0466967_1642962_85_288 67
1830 3300046453 Ga0495627_107445 Ga0495627_107445_463_666 67
1831 3300046454 Ga0495592_0041774 Ga0495592_0041774_2913_3116 67
1832 3300046454 Ga0495592_0127909 Ga0495592_0127909_699_902 67
1833 3300046454 Ga0495592_0149061 Ga0495592_0149061_1219_1425 67
1834 3300046454 Ga0495592_0183636 Ga0495592_0183636_1163_1366 67
1835 3300046455 Ga0495603_0010028 Ga0495603_0010028_5207_5413 67
1836 3300046455 Ga0495603_0026170 Ga0495603_0026170_659_862 67
1837 3300046455 Ga0495603_0047280 Ga0495603_0047280_2322_2525 67
1838 3300046455 Ga0495603_0049435 Ga0495603_0049435_1027_1230 67
1839 3300046455 Ga0495603_0072963 Ga0495603_0072963_612_815 67
1840 3300046459 Ga0495629_0010230 Ga0495629_0010230_3619_3822 67
1841 3300046459 Ga0495629_0102424 Ga0495629_0102424_721_924 67
1842 3300046459 Ga0495629_0105404 Ga0495629_0105404_990_1196 67
1843 3300046459 Ga0495629_0261125 Ga0495629_0261125_955_1158 67
1844 3300046459 Ga0495629_0695599 Ga0495629_0695599_104_307 67
1845 3300046460 Ga0495638_0049888 Ga0495638_0049888_943_1146 67
1846 3300046460 Ga0495638_0118662 Ga0495638_0118662_1249_1455 67
1847 3300046460 Ga0495638_0251119 Ga0495638_0251119_21_224 67
1848 3300046461 Ga0495641_0013098 Ga0495641_0013098_1058_1261 67
1849 3300046462 Ga0495651_0000079 Ga0495651_0000079_46875_47081 67
1850 3300046462 Ga0495651_0105233 Ga0495651_0105233_570_773 67
1851 3300046462 Ga0495651_0235360 Ga0495651_0235360_470_673 67
1852 3300046462 Ga0495651_0446451 Ga0495651_0446451_128_331 67
1853 3300046462 Ga0495651_0452362 Ga0495651_0452362_478_681 67
1854 3300046462 Ga0495651_0552354 Ga0495651_0552354_518_721 67
1855 3300046463 Ga0495653_0239989 Ga0495653_0239989_296_499 67
1856 3300046463 Ga0495653_0247654 Ga0495653_0247654_841_1044 67
1857 3300046463 Ga0495653_0352192 Ga0495653_0352192_149_352 67
1858 3300046463 Ga0495653_0769772 Ga0495653_0769772_52_255 67
1859 3300046472 Ga0495580_0169758 Ga0495580_0169758_937_1140 67
1860 3300046473 Ga0495582_0002158 Ga0495582_0002158_824_1027 67
1861 3300046473 Ga0495582_0319741 Ga0495582_0319741_377_580 67
1862 3300046475 Ga0495639_0143354 Ga0495639_0143354_888_1091 67
1863 3300046476 Ga0495662_0020179 Ga0495662_0020179_2980_3183 67
1864 3300046476 Ga0495662_0020438 Ga0495662_0020438_1665_1868 67
1865 3300046477 Ga0495664_0091512 Ga0495664_0091512_409_612 67
1866 3300046477 Ga0495664_0117975 Ga0495664_0117975_517_723 67
1867 3300046477 Ga0495664_0134953 Ga0495664_0134953_47_250 67
1868 3300046477 Ga0495664_0422355 Ga0495664_0422355_580_783 67
1869 3300046492 Ga0495585_0013695 Ga0495585_0013695_1230_1433 67
1870 3300046492 Ga0495585_0042588 Ga0495585_0042588_1570_1773 67
1871 3300046492 Ga0495585_0059459 Ga0495585_0059459_1446_1652 67
1872 3300046492 Ga0495585_0202801 Ga0495585_0202801_325_528 67
1873 3300046499 Ga0495594_0012305 Ga0495594_0012305_3980_4183 67
1874 3300046499 Ga0495594_0013501 Ga0495594_0013501_3499_3702 67
1875 3300046499 Ga0495594_0019227 Ga0495594_0019227_2495_2698 67
1876 3300046499 Ga0495594_0055542 Ga0495594_0055542_51_257 67
1877 3300046499 Ga0495594_0140826 Ga0495594_0140826_647_850 67
1878 3300046501 Ga0495607_0042933 Ga0495607_0042933_823_1026 67
1879 3300046511 Ga0495608_0040008 Ga0495608_0040008_581_784 67
1880 3300046511 Ga0495608_0157894 Ga0495608_0157894_827_1030 67
1881 3300046511 Ga0495608_0447957 Ga0495608_0447957_222_425 67
1882 3300046511 Ga0495608_0627494 Ga0495608_0627494_32_235 67
1883 3300046514 Ga0495618_0007856 Ga0495618_0007856_2912_3115 67
1884 3300046514 Ga0495618_0022729 Ga0495618_0022729_3295_3498 67
1885 3300046514 Ga0495618_0255728 Ga0495618_0255728_228_434 67
1886 3300046514 Ga0495618_0387054 Ga0495618_0387054_267_470 67
1887 3300046515 Ga0495620_0110578 Ga0495620_0110578_75_278 67
1888 3300046516 Ga0495628_0010042 Ga0495628_0010042_5750_5956 67
1889 3300046516 Ga0495628_0137701 Ga0495628_0137701_1131_1334 67
1890 3300046516 Ga0495628_0156972 Ga0495628_0156972_82_285 67
1891 3300046516 Ga0495628_0584191 Ga0495628_0584191_448_651 67
1892 3300046517 Ga0495630_0008315 Ga0495630_0008315_32_235 67
1893 3300046517 Ga0495630_0217395 Ga0495630_0217395_506_712 67
1894 3300046517 Ga0495630_0844286 Ga0495630_0844286_464_667 67
1895 3300046517 Ga0495630_1402619 Ga0495630_1402619_294_500 67
1896 3300046518 Ga0495631_0139636 Ga0495631_0139636_27_230 67
1897 3300046518 Ga0495631_0219806 Ga0495631_0219806_77_283 67
1898 3300046520 Ga0495637_0105712 Ga0495637_0105712_488_691 67
1899 3300046522 Ga0495643_0211792 Ga0495643_0211792_485_688 67
1900 3300046526 Ga0495666_0129992 Ga0495666_0129992_202_405 67
1901 3300046526 Ga0495666_0313549 Ga0495666_0313549_217_420 67
1902 3300046529 Ga0495652_0003588 Ga0495652_0003588_9723_9929 67
1903 3300046529 Ga0495652_0059422 Ga0495652_0059422_1938_2141 67
1904 3300046529 Ga0495652_0352690 Ga0495652_0352690_478_681 67
1905 3300046529 Ga0495652_0399634 Ga0495652_0399634_394_597 67
1906 3300046529 Ga0495652_0559306 Ga0495652_0559306_52_255 67
1907 3300046531 Ga0495665_0173646 Ga0495665_0173646_887_1090 67
1908 3300046531 Ga0495665_0634612 Ga0495665_0634612_81_284 67
1909 3300046533 Ga0495640_0054496 Ga0495640_0054496_59_262 67
1910 3300046533 Ga0495640_0054695 Ga0495640_0054695_32_235 67
1911 3300046533 Ga0495640_0206494 Ga0495640_0206494_995_1198 67
1912 3300046535 Ga0495586_0053081 Ga0495586_0053081_275_478 67
1913 3300046535 Ga0495586_0082387 Ga0495586_0082387_1509_1712 67
1914 3300046535 Ga0495586_0257410 Ga0495586_0257410_560_766 67
1915 3300046535 Ga0495586_0472462 Ga0495586_0472462_488_691 67
1916 3300046536 Ga0495587_0077239 Ga0495587_0077239_760_963 67
1917 3300046536 Ga0495587_0109041 Ga0495587_0109041_1360_1566 67
1918 3300046536 Ga0495587_0742135 Ga0495587_0742135_248_451 67
1919 3300046543 Ga0495645_0059107 Ga0495645_0059107_177_383 67
1920 3300046543 Ga0495645_0368563 Ga0495645_0368563_385_588 67
1921 3300046557 Ga0495622_0022827 Ga0495622_0022827_459_665 67
1922 3300046557 Ga0495622_0170550 Ga0495622_0170550_24_227 67
1923 3300046557 Ga0495622_0443017 Ga0495622_0443017_189_392 67
1924 3300046559 Ga0495667_0029452 Ga0495667_0029452_101_304 67
1925 3300046559 Ga0495667_0041818 Ga0495667_0041818_238_441 67
1926 3300046559 Ga0495667_0068317 Ga0495667_0068317_1203_1406 67
1927 3300046615 Ga0495656_0193205 Ga0495656_0193205_258_464 67
1928 3300046642 Ga0495634_0027278 Ga0495634_0027278_1445_1648 67
1929 3300046642 Ga0495634_0033758 Ga0495634_0033758_2428_2634 67
1930 3300046642 Ga0495634_0179627 Ga0495634_0179627_591_794 67
1931 3300046648 Ga0495611_0033087 Ga0495611_0033087_684_887 67
1932 3300046660 Ga0495625_0222544 Ga0495625_0222544_880_1086 67
1933 3300046663 Ga0495635_0002665 Ga0495635_0002665_1228_1434 67
1934 3300046663 Ga0495635_0124402 Ga0495635_0124402_32_235 67
1935 3300046663 Ga0495635_0962288 Ga0495635_0962288_71_274 67
1936 3300046665 Ga0495661_0170131 Ga0495661_0170131_421_624 67
1937 3300046674 Ga0495588_0067287 Ga0495588_0067287_1317_1520 67
1938 3300046674 Ga0495588_0078571 Ga0495588_0078571_628_831 67
1939 3300046674 Ga0495588_0451689 Ga0495588_0451689_373_576 67
1940 3300046674 Ga0495588_0645247 Ga0495588_0645247_195_401 67
1941 3300046675 Ga0495657_0002584 Ga0495657_0002584_13629_13832 67
1942 3300046675 Ga0495657_0042001 Ga0495657_0042001_2598_2801 67
1943 3300046675 Ga0495657_0115442 Ga0495657_0115442_322_525 67
1944 3300046675 Ga0495657_0314532 Ga0495657_0314532_320_523 67
1945 3300046675 Ga0495657_0320965 Ga0495657_0320965_62_265 67
1946 3300046678 Ga0495599_0022810 Ga0495599_0022810_893_1096 67
1947 3300046678 Ga0495599_0074779 Ga0495599_0074779_17_220 67
1948 3300046678 Ga0495599_0869618 Ga0495599_0869618_244_450 67
1949 3300046679 Ga0495623_0003796 Ga0495623_0003796_562_768 67
1950 3300046679 Ga0495623_0059079 Ga0495623_0059079_1093_1296 67
1951 3300046679 Ga0495623_0083855 Ga0495623_0083855_1585_1791 67
1952 3300046679 Ga0495623_0104972 Ga0495623_0104972_1302_1505 67
1953 3300046679 Ga0495623_0379528 Ga0495623_0379528_431_634 67
1954 3300046679 Ga0495623_0435910 Ga0495623_0435910_431_634 67
1955 3300046680 Ga0495646_0059352 Ga0495646_0059352_717_920 67
1956 3300046680 Ga0495646_0158769 Ga0495646_0158769_830_1033 67
1957 3300046680 Ga0495646_0357357 Ga0495646_0357357_337_543 67
1958 3300046681 Ga0495647_0569406 Ga0495647_0569406_155_358 67
1959 3300046683 Ga0495658_0415133 Ga0495658_0415133_263_466 67
1960 3300046689 Ga0495613_0011441 Ga0495613_0011441_4425_4628 67
1961 3300046689 Ga0495613_0084477 Ga0495613_0084477_348_551 67
1962 3300046689 Ga0495613_0138981 Ga0495613_0138981_1516_1719 67
1963 3300046689 Ga0495613_0237480 Ga0495613_0237480_972_1175 67
1964 3300046690 Ga0495624_0006967 Ga0495624_0006967_1657_1860 67
1965 3300046690 Ga0495624_0027762 Ga0495624_0027762_818_1021 67
1966 3300046690 Ga0495624_0146888 Ga0495624_0146888_926_1129 67
1967 3300046690 Ga0495624_0563981 Ga0495624_0563981_37_240 67
1968 3300046691 Ga0495670_0013056 Ga0495670_0013056_467_670 67
1969 3300046691 Ga0495670_0020026 Ga0495670_0020026_3069_3272 67
1970 3300046692 Ga0495671_0161446 Ga0495671_0161446_821_1024 67
1971 3300046694 Ga0495649_0402218 Ga0495649_0402218_433_636 67
1972 3300046794 Ga0495589_0221108 Ga0495589_0221108_551_754 67
1973 3300046794 Ga0495589_0335128 Ga0495589_0335128_264_470 67
1974 3300046794 Ga0495589_0521254 Ga0495589_0521254_323_529 67
1975 3300046809 Ga0495600_0008443 Ga0495600_0008443_789_995 67
1976 3300046809 Ga0495600_0045437 Ga0495600_0045437_2561_2764 67
1977 3300046809 Ga0495600_0244884 Ga0495600_0244884_895_1098 67
1978 3300046809 Ga0495600_0280645 Ga0495600_0280645_354_557 67
1979 3300046810 Ga0495660_0322596 Ga0495660_0322596_412_615 67
1980 3300047315 Ga0495581_0027064 Ga0495581_0027064_1218_1421 67
1981 3300047315 Ga0495581_0428420 Ga0495581_0428420_548_751 67
1982 3300047317 Ga0495604_0022655 Ga0495604_0022655_2358_2561 67
1983 3300047317 Ga0495604_0175014 Ga0495604_0175014_643_846 67
1984 3300047317 Ga0495604_0216151 Ga0495604_0216151_562_768 67
1985 3300047317 Ga0495604_0544271 Ga0495604_0544271_508_714 67
1986 3300047318 Ga0495636_0085601 Ga0495636_0085601_377_580 67
1987 3300047318 Ga0495636_0256394 Ga0495636_0256394_516_722 67
1988 3300047319 Ga0495674_0174539 Ga0495674_0174539_1058_1264 67
1989 3300047319 Ga0495674_0302329 Ga0495674_0302329_1020_1223 67
1990 3300047319 Ga0495674_0379116 Ga0495674_0379116_32_235 67
1991 3300047321 Ga0495676_0029254 Ga0495676_0029254_1876_2079 67
1992 3300047321 Ga0495676_0038718 Ga0495676_0038718_872_1078 67
1993 3300047321 Ga0495676_0090636 Ga0495676_0090636_1953_2156 67
1994 3300047321 Ga0495676_0509018 Ga0495676_0509018_312_515 67
1995 3300047322 Ga0495680_0158901 Ga0495680_0158901_103_306 67
1996 3300047322 Ga0495680_0357554 Ga0495680_0357554_705_908 67
1997 3300047322 Ga0495680_0453200 Ga0495680_0453200_32_235 67
1998 3300047323 Ga0495683_0127665 Ga0495683_0127665_942_1145 67
1999 3300047323 Ga0495683_0226451 Ga0495683_0226451_106_309 67
2000 3300047443 Ga0495687_014847 Ga0495687_014847_595_798 67
2001 3300047443 Ga0495687_044422 Ga0495687_044422_1268_1471 67
2002 3300047444 Ga0495675_0009960 Ga0495675_0009960_732_935 67
2003 3300047444 Ga0495675_0022793 Ga0495675_0022793_1275_1478 67
2004 3300047444 Ga0495675_0028408 Ga0495675_0028408_2344_2547 67
2005 3300047444 Ga0495675_0064305 Ga0495675_0064305_952_1155 67
2006 3300047444 Ga0495675_0423473 Ga0495675_0423473_72_275 67
2007 3300047447 Ga0495685_005390 Ga0495685_005390_573_776 67
2008 3300047447 Ga0495685_022256 Ga0495685_022256_1141_1344 67
2009 3300047447 Ga0495685_138526 Ga0495685_138526_67_270 67
2010 3300047447 Ga0495685_211284 Ga0495685_211284_288_491 67
2011 3300047470 Ga0495681_0211603 Ga0495681_0211603_463_666 67
2012 3300047471 Ga0495684_0168641 Ga0495684_0168641_887_1090 67
2013 3300047471 Ga0495684_0391701 Ga0495684_0391701_180_383 67
2014 3300047471 Ga0495684_0412100 Ga0495684_0412100_528_731 67
2015 3300047472 Ga0495686_0024806 Ga0495686_0024806_3131_3334 67
2016 3300047673 Ga0495593_0019207 Ga0495593_0019207_3256_3459 67
2017 3300048088 Ga0495602_0636795 Ga0495602_0636795_46_252 67
2018 3300048088 Ga0495602_0648191 Ga0495602_0648191_445_648 67
2019 3300048088 Ga0495602_0779261 Ga0495602_0779261_32_235 67
2020 3300048089 Ga0495614_0075784 Ga0495614_0075784_639_842 67
2021 3300048089 Ga0495614_0106237 Ga0495614_0106237_593_796 67
2022 3300048091 Ga0495626_0395030 Ga0495626_0395030_28_231 67
2023 3300048903 Ga0496100_0225359 Ga0496100_0225359_129_338 67
2024 3300048903 Ga0496100_0267539 Ga0496100_0267539_120_326 67
2025 3300048903 Ga0496100_0418829 Ga0496100_0418829_744_947 67
2026 3300048904 Ga0496101_0133559 Ga0496101_0133559_1477_1680 67
2027 3300048904 Ga0496101_0253562 Ga0496101_0253562_315_524 67
2028 3300048905 Ga0496102_0008136 Ga0496102_0008136_8260_8469 67
2029 3300048905 Ga0496102_0666327 Ga0496102_0666327_263_466 67
2030 3300048906 Ga0496103_0058025 Ga0496103_0058025_266_469 67
2031 3300048906 Ga0496103_0545441 Ga0496103_0545441_206_415 67
2032 3300048907 Ga0496104_0193546 Ga0496104_0193546_497_700 67
2033 3300048907 Ga0496104_0307286 Ga0496104_0307286_1252_1461 67
2034 3300048908 Ga0496105_0001951 Ga0496105_0001951_14280_14489 67
2035 3300048908 Ga0496105_0685997 Ga0496105_0685997_388_591 67
2036 3300048908 Ga0496105_1059263 Ga0496105_1059263_200_403 67
2037 3300048909 Ga0496106_0058655 Ga0496106_0058655_2266_2475 67
2038 3300048909 Ga0496106_0059467 Ga0496106_0059467_149_355 67
2039 3300048909 Ga0496106_0131596 Ga0496106_0131596_1506_1709 67
2040 3300048910 Ga0496107_0153111 Ga0496107_0153111_1073_1282 67
2041 3300048910 Ga0496107_0176672 Ga0496107_0176672_113_316 67
2042 3300048911 Ga0496108_0016852 Ga0496108_0016852_5486_5695 67
2043 3300048911 Ga0496108_1121815 Ga0496108_1121815_361_564 67
2044 3300048912 Ga0496109_0014763 Ga0496109_0014763_6539_6742 67
2045 3300048912 Ga0496109_0078823 Ga0496109_0078823_1734_1943 67
2046 3300048912 Ga0496109_0106641 Ga0496109_0106641_1299_1502 67
2047 3300048912 Ga0496109_1489189 Ga0496109_1489189_77_280 67
2048 3300048913 Ga0496110_0130544 Ga0496110_0130544_283_492 67
2049 3300048913 Ga0496110_0256284 Ga0496110_0256284_124_327 67
2050 3300048913 Ga0496110_0915618 Ga0496110_0915618_160_363 67
2051 3300048914 Ga0496111_0000966 Ga0496111_0000966_15086_15295 67
2052 3300048914 Ga0496111_0638406 Ga0496111_0638406_77_280 67
2053 3300048915 Ga0496112_1394456 Ga0496112_1394456_45_248 67
2054 3300048915 Ga0496112_1901542 Ga0496112_1901542_21_230 67
2055 3300048916 Ga0496113_0412533 Ga0496113_0412533_277_486 67
2056 3300048916 Ga0496113_0470773 Ga0496113_0470773_235_438 67
2057 3300048916 Ga0496113_1002278 Ga0496113_1002278_125_328 67
2058 3300048917 Ga0496114_0237928 Ga0496114_0237928_1154_1357 67
2059 3300048917 Ga0496114_1531513 Ga0496114_1531513_26_229 67
2060 3300048918 Ga0496115_0030212 Ga0496115_0030212_1918_2121 67
2061 3300048918 Ga0496115_0143568 Ga0496115_0143568_1502_1705 67
2062 3300048918 Ga0496115_0589125 Ga0496115_0589125_266_475 67
2063 3300048929 Ga0496126_0021509 Ga0496126_0021509_400_603 67
2064 3300048929 Ga0496126_0044968 Ga0496126_0044968_590_793 67
2065 3300048929 Ga0496126_0810372 Ga0496126_0810372_420_623 67
2066 3300048929 Ga0496126_0976717 Ga0496126_0976717_50_253 67
2067 3300049127 Ga0501306_082899 Ga0501306_082899_313_519 67
2068 3300049514 Ga0501291_064155 Ga0501291_064155_418_621 67
2069 3300049528 Ga0501312_040992 Ga0501312_040992_393_596 67
2070 3300049568 Ga0501031_0002572 Ga0501031_0002572_4829_5032 67
2071 3300049568 Ga0501031_0342624 Ga0501031_0342624_522_725 67
2072 3300049568 Ga0501031_0721815 Ga0501031_0721815_62_265 67
2073 3300049569 Ga0501032_0001212 Ga0501032_0001212_13627_13830 67
2074 3300049569 Ga0501032_0004014 Ga0501032_0004014_9421_9627 67
2075 3300049569 Ga0501032_0061569 Ga0501032_0061569_1478_1681 67
2076 3300049569 Ga0501032_0083428 Ga0501032_0083428_372_575 67
2077 3300049569 Ga0501032_0216319 Ga0501032_0216319_927_1133 67
2078 3300049569 Ga0501032_0731608 Ga0501032_0731608_230_436 67
2079 3300049570 Ga0501033_0008061 Ga0501033_0008061_4829_5032 67
2080 3300049570 Ga0501033_0038694 Ga0501033_0038694_2393_2596 67
2081 3300049570 Ga0501033_0043629 Ga0501033_0043629_556_759 67
2082 3300049570 Ga0501033_0102595 Ga0501033_0102595_1212_1415 67
2083 3300049570 Ga0501033_0121268 Ga0501033_0121268_332_535 67
2084 3300049570 Ga0501033_0487639 Ga0501033_0487639_380_583 67
2085 3300049570 Ga0501033_0608994 Ga0501033_0608994_176_379 67
2086 3300049571 Ga0501034_0006278 Ga0501034_0006278_3301_3504 67
2087 3300049571 Ga0501034_0035629 Ga0501034_0035629_1182_1385 67
2088 3300049571 Ga0501034_0092435 Ga0501034_0092435_2387_2590 67
2089 3300049571 Ga0501034_0135532 Ga0501034_0135532_1846_2052 67
2090 3300049571 Ga0501034_0204269 Ga0501034_0204269_339_542 67
2091 3300049571 Ga0501034_0770472 Ga0501034_0770472_247_450 67
2092 3300049572 Ga0501036_0008586 Ga0501036_0008586_5050_5253 67
2093 3300049572 Ga0501036_0026259 Ga0501036_0026259_3809_4012 67
2094 3300049572 Ga0501036_0070822 Ga0501036_0070822_2184_2387 67
2095 3300049572 Ga0501036_0287623 Ga0501036_0287623_36_239 67
2096 3300049572 Ga0501036_0636340 Ga0501036_0636340_407_610 67
2097 3300049572 Ga0501036_0771568 Ga0501036_0771568_214_417 67
2098 3300049572 Ga0501036_1290684 Ga0501036_1290684_92_295 67
2099 3300049573 Ga0501037_0000836 Ga0501037_0000836_13624_13827 67
2100 3300049573 Ga0501037_0028438 Ga0501037_0028438_781_984 67
2101 3300049573 Ga0501037_0038085 Ga0501037_0038085_2970_3173 67
2102 3300049574 Ga0501038_0012780 Ga0501038_0012780_3757_3960 67
2103 3300049574 Ga0501038_0038303 Ga0501038_0038303_612_815 67
2104 3300049574 Ga0501038_0098123 Ga0501038_0098123_1816_2019 67
2105 3300049574 Ga0501038_0202701 Ga0501038_0202701_1358_1561 67
2106 3300049574 Ga0501038_0381674 Ga0501038_0381674_326_532 67
2107 3300049574 Ga0501038_0432279 Ga0501038_0432279_370_573 67
2108 3300049575 Ga0501039_0007687 Ga0501039_0007687_3625_3828 67
2109 3300049575 Ga0501039_0356373 Ga0501039_0356373_846_1052 67
2110 3300049575 Ga0501039_0373550 Ga0501039_0373550_348_551 67
2111 3300049575 Ga0501039_0720933 Ga0501039_0720933_204_407 67
2112 3300049576 Ga0501040_0007931 Ga0501040_0007931_1588_1791 67
2113 3300049577 Ga0501041_0001518 Ga0501041_0001518_5827_6030 67
2114 3300049578 Ga0501042_0015097 Ga0501042_0015097_3491_3694 67
2115 3300049578 Ga0501042_0140483 Ga0501042_0140483_899_1102 67
2116 3300049579 Ga0501043_0005580 Ga0501043_0005580_6806_7009 67
2117 3300049579 Ga0501043_0032328 Ga0501043_0032328_2266_2469 67
2118 3300049579 Ga0501043_0062990 Ga0501043_0062990_1416_1619 67
2119 3300049579 Ga0501043_0176885 Ga0501043_0176885_339_542 67
2120 3300049579 Ga0501043_0252718 Ga0501043_0252718_31_234 67
2121 3300049579 Ga0501043_0314179 Ga0501043_0314179_706_912 67
2122 3300049580 Ga0501046_0037516 Ga0501046_0037516_200_403 67
2123 3300049580 Ga0501046_0143575 Ga0501046_0143575_1059_1262 67
2124 3300049580 Ga0501046_0494625 Ga0501046_0494625_410_613 67
2125 3300049581 Ga0501047_0000072 Ga0501047_0000072_1171_1374 67
2126 3300049581 Ga0501047_0001607 Ga0501047_0001607_11709_11912 67
2127 3300049581 Ga0501047_0070941 Ga0501047_0070941_1036_1239 67
2128 3300049581 Ga0501047_0152655 Ga0501047_0152655_398_601 67
2129 3300049581 Ga0501047_0169702 Ga0501047_0169702_1379_1582 67
2130 3300049581 Ga0501047_0384844 Ga0501047_0384844_143_349 67
2131 3300049582 Ga0501048_0015295 Ga0501048_0015295_1777_1980 67
2132 3300049582 Ga0501048_0037211 Ga0501048_0037211_1166_1369 67
2133 3300049583 Ga0501067_0013763 Ga0501067_0013763_3147_3350 67
2134 3300049584 Ga0501068_0003236 Ga0501068_0003236_1472_1675 67
2135 3300049585 Ga0501069_0017860 Ga0501069_0017860_684_890 67
2136 3300049585 Ga0501069_0031481 Ga0501069_0031481_200_403 67
2137 3300049586 Ga0501070_0005040 Ga0501070_0005040_3437_3643 67
2138 3300049586 Ga0501070_0008482 Ga0501070_0008482_8178_8384 67
2139 3300049586 Ga0501070_0009153 Ga0501070_0009153_2864_3070 67
2140 3300049586 Ga0501070_0012340 Ga0501070_0012340_200_403 67
2141 3300049586 Ga0501070_0012975 Ga0501070_0012975_6304_6510 67
2142 3300049586 Ga0501070_0031412 Ga0501070_0031412_1974_2177 67
2143 3300049586 Ga0501070_0845307 Ga0501070_0845307_132_335 67
2144 3300049586 Ga0501070_1474102 Ga0501070_1474102_262_465 67
2145 3300049587 Ga0501071_0006687 Ga0501071_0006687_7026_7229 67
2146 3300049587 Ga0501071_0244047 Ga0501071_0244047_905_1111 67
2147 3300049588 Ga0501072_0001898 Ga0501072_0001898_12184_12387 67
2148 3300049588 Ga0501072_0267605 Ga0501072_0267605_87_290 67
2149 3300049589 Ga0501073_0009415 Ga0501073_0009415_2149_2352 67
2150 3300049589 Ga0501073_0015567 Ga0501073_0015567_4201_4407 67
2151 3300049590 Ga0501074_0000607 Ga0501074_0000607_15074_15280 67
2152 3300049590 Ga0501074_0006705 Ga0501074_0006705_7504_7707 67
2153 3300049590 Ga0501074_0016000 Ga0501074_0016000_200_403 67
2154 3300049592 Ga0501076_0003333 Ga0501076_0003333_3284_3487 67
2155 3300049593 Ga0501077_0023052 Ga0501077_0023052_220_423 67
2156 3300049669 Ga0501235_008627 Ga0501235_008627_524_727 67
2157 3300049681 Ga0501251_022715 Ga0501251_022715_557_760 67
2158 3300049741 Ga0501079_0000029 Ga0501079_0000029_6993_7199 67
2159 3300049741 Ga0501079_0007167 Ga0501079_0007167_1159_1362 67
2160 3300049742 Ga0501080_0006601 Ga0501080_0006601_1685_1891 67
2161 3300049742 Ga0501080_0013816 Ga0501080_0013816_559_765 67
2162 3300049742 Ga0501080_0121371 Ga0501080_0121371_1186_1389 67
2163 3300049742 Ga0501080_0193663 Ga0501080_0193663_374_580 67
2164 3300049742 Ga0501080_0639037 Ga0501080_0639037_721_927 67
2165 3300049778 Ga0501282_001694 Ga0501282_001694_1471_1674 67
2166 3300049822 Ga0501035_0005086 Ga0501035_0005086_3082_3285 67
2167 3300049822 Ga0501035_0012487 Ga0501035_0012487_6614_6817 67
2168 3300049822 Ga0501035_0024124 Ga0501035_0024124_4821_5024 67
2169 3300049822 Ga0501035_0132132 Ga0501035_0132132_945_1148 67
2170 3300049822 Ga0501035_0298983 Ga0501035_0298983_197_400 67
2171 3300049822 Ga0501035_0479587 Ga0501035_0479587_69_275 67
2172 3300049823 Ga0501044_0005927 Ga0501044_0005927_6530_6733 67
2173 3300049823 Ga0501044_0007860 Ga0501044_0007860_5159_5365 67
2174 3300049823 Ga0501044_0050036 Ga0501044_0050036_2703_2906 67
2175 3300049823 Ga0501044_0059401 Ga0501044_0059401_3215_3421 67
2176 3300049823 Ga0501044_0065905 Ga0501044_0065905_2085_2288 67
2177 3300049823 Ga0501044_0091036 Ga0501044_0091036_1384_1587 67
2178 3300049823 Ga0501044_0092812 Ga0501044_0092812_1016_1219 67
2179 3300049823 Ga0501044_0203538 Ga0501044_0203538_1055_1258 67
2180 3300049823 Ga0501044_0210357 Ga0501044_0210357_1374_1577 67
2181 3300049823 Ga0501044_0237979 Ga0501044_0237979_1075_1278 67
2182 3300049824 Ga0501045_0014996 Ga0501045_0014996_3709_3912 67
2183 3300049824 Ga0501045_0553357 Ga0501045_0553357_539_742 67
2184 3300049824 Ga0501045_0801738 Ga0501045_0801738_398_601 67
2185 3300050490 nmdc:mga03n38_71279_c1 nmdc:mga03n38_71279_c1_1239_1445 67
2186 3300050507 nmdc:mga05p37_1302285_c1 nmdc:mga05p37_1302285_c1_302_511 67
2187 3300050508 nmdc:mga09592_21197_c1 nmdc:mga09592_21197_c1_383_592 67
2188 3300050511 nmdc:mga08y16_52073_c1 nmdc:mga08y16_52073_c1_405_614 67
2189 3300050512 nmdc:mga0n895_347695_c1 nmdc:mga0n895_347695_c1_1010_1213 67
2190 3300050512 nmdc:mga0n895_7764_c1 nmdc:mga0n895_7764_c1_1280_1489 67
2191 3300050513 nmdc:mga0rr50_1831282_c1 nmdc:mga0rr50_1831282_c1_96_299 67
2192 3300050513 nmdc:mga0rr50_4305_c1 nmdc:mga0rr50_4305_c1_6870_7079 67
2193 3300050514 nmdc:mga08x19_107348_c1 nmdc:mga08x19_107348_c1_763_966 67
2194 3300050514 nmdc:mga08x19_15062_c1 nmdc:mga08x19_15062_c1_3813_4022 67
2195 3300050514 nmdc:mga08x19_308513_c1 nmdc:mga08x19_308513_c1_517_720 67
2196 3300050515 nmdc:mga0a205_312603_c1 nmdc:mga0a205_312603_c1_1124_1327 67
2197 3300050515 nmdc:mga0a205_618_c1 nmdc:mga0a205_618_c1_10453_10662 67
2198 3300053077 Ga0495601_0039256 Ga0495601_0039256_2386_2589 67
2199 3300053077 Ga0495601_0264047 Ga0495601_0264047_732_938 67
2200 3300053077 Ga0495601_0734996 Ga0495601_0734996_330_533 67
2201 3300053078 Ga0495612_0003302 Ga0495612_0003302_2103_2309 67
2202 3300053078 Ga0495612_0028326 Ga0495612_0028326_460_663 67
2203 3300053083 Ga0495655_0020718 Ga0495655_0020718_323_526 67
2204 3300053083 Ga0495655_0176416 Ga0495655_0176416_275_481 67
2205 3300053084 Ga0495595_0087318 Ga0495595_0087318_1110_1313 67
2206 3300053085 Ga0495619_0014045 Ga0495619_0014045_4091_4294 67
2207 3300053085 Ga0495619_0092261 Ga0495619_0092261_1091_1297 67
2208 3300053092 Ga0500583_0271553 Ga0500583_0271553_516_719 67
2209 3300053093 Ga0500651_0403077 Ga0500651_0403077_157_363 67
2210 3300053094 Ga0500566_0137313 Ga0500566_0137313_226_429 67
2211 3300053096 Ga0500641_0084013 Ga0500641_0084013_402_605 67
2212 3300053096 Ga0500641_0381705 Ga0500641_0381705_62_265 67
2213 3300053099 Ga0500654_064920 Ga0500654_064920_1566_1769 67
2214 3300053101 Ga0500553_118913 Ga0500553_118913_678_881 67
2215 3300053104 Ga0500556_0401583 Ga0500556_0401583_311_514 67
2216 3300053106 Ga0500558_067368 Ga0500558_067368_898_1101 67
2217 3300053107 Ga0500560_127497 Ga0500560_127497_308_511 67
2218 3300053109 Ga0500569_004143 Ga0500569_004143_489_692 67
2219 3300053118 Ga0500594_0022448 Ga0500594_0022448_355_558 67
2220 3300053123 Ga0500614_017862 Ga0500614_017862_1340_1543 67
2221 3300053129 Ga0500628_012677 Ga0500628_012677_976_1179 67
2222 3300053131 Ga0500652_008937 Ga0500652_008937_3111_3314 67
2223 3300053133 Ga0500655_147778 Ga0500655_147778_244_447 67
2224 3300053134 Ga0500658_0003343 Ga0500658_0003343_2996_3199 67
2225 3300053140 Ga0500573_0065287 Ga0500573_0065287_1847_2050 67
2226 3300053140 Ga0500573_0137513 Ga0500573_0137513_723_926 67
2227 3300053140 Ga0500573_0320426 Ga0500573_0320426_195_401 67
2228 3300053143 Ga0500579_018317 Ga0500579_018317_2098_2301 67
2229 3300053147 Ga0500589_207773 Ga0500589_207773_300_503 67
2230 3300053149 Ga0500600_0032935 Ga0500600_0032935_525_728 67
2231 3300053149 Ga0500600_0295193 Ga0500600_0295193_379_585 67
2232 3300053150 Ga0500603_105497 Ga0500603_105497_51_254 67
2233 3300053153 Ga0500616_0256946 Ga0500616_0256946_67_270 67
2234 3300053160 Ga0500633_0000825 Ga0500633_0000825_2197_2400 67
2235 3300053161 Ga0500634_0050937 Ga0500634_0050937_34_237 67
2236 3300053732 Ga0500656_001561 Ga0500656_001561_371_574 67
2237 3300053739 Ga0500587_002484 Ga0500587_002484_69_272 67
2238 3300054114 Ga0501084_0004130 Ga0501084_0004130_9340_9543 67
2239 3300054114 Ga0501084_0110758 Ga0501084_0110758_556_762 67
2240 3300054114 Ga0501084_0284950 Ga0501084_0284950_1171_1374 67
2241 3300059490 Ga0587066_125493 Ga0587066_125493_287_490 67
2242 3300060344 Ga0587071_085205 Ga0587071_085205_406_609 67
2243 3300060346 Ga0587111_0019558 Ga0587111_0019558_115_318 67
2244 3300060353 Ga0501082_0008254 Ga0501082_0008254_3682_3885 67
2245 3300060353 Ga0501082_0689082 Ga0501082_0689082_234_437 67
2246 3300061719 Ga0466962_0001597 Ga0466962_0001597_1324_1527 67
2247 3300061719 Ga0466962_0003215 Ga0466962_0003215_1977_2180 67

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00313

CSD

'Cold-shock' DNA-binding domain

11

75

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i2z-assembly2.cif.gz_B structure of cold shock protein e from salmonella typhimurium 0.9752 1 66
1mjc-assembly1.cif.gz_A crystal structure of cspa, the major cold shock protein of escherichia coli 0.9699 2 66
1hza-assembly1.cif.gz_B bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability 0.9673 1 67
1c9o-assembly1.cif.gz_B crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp 0.9601 1 66
1hz9-assembly1.cif.gz_B bacillus caldolyticus cold-shock protein mutants to study determinants of protein stability 0.959 1 66
ID Description Score Start End Superfamily
af_P92186_48_133_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9689 2 65 2.40.50.140
af_Q94C69_1_75_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9596 2 64 2.40.50.140
af_Q9VRN5_36_116_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9471 2 66 2.40.50.140
af_I1LPN7_1_82_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9441 2 65 2.40.50.140
5o6fA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9433 1 66 2.40.50.140
ID Description Score Start End GO Terms
AF-L8PCS3-F1-model_v4 Putative Cold shock protein 1.01 1 67 GO:0003677
GO:0005737
AF-A0A7Y6CAR0-F1-model_v4 Cold-shock protein 1.009 1 67 GO:0003677
GO:0005737
AF-A0A0M2GS90-F1-model_v4 Cold-shock protein 1.009 1 67 GO:0003677
GO:0005737
AF-A0A7K2YX20-F1-model_v4 Cold shock domain-containing protein 1.009 1 67 GO:0003677
GO:0005737
AF-A0A7W7BXJ9-F1-model_v4 deleted 1.008 1 67

Feature Viewer

pLDDT pTM Quality
94.21 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map