metagRoot

F496629

General Info

Members	Datasets	Scaffolds	Average Seq Length
2276	631	4552	106

Family's Representative Sequence

Representative Sequence	3300046690\|Ga0495624_0034033\|Ga0495624_0034033_1824_2210
Length	128
Sequence	VQARMAIDAILHRTSYPATRANMAKISFVDHTGETRTIDVENGATVMEAAIRNAIPGIEAECGGACACATCHVYVDEAWREKVGSPSPMEEDMLDFGFDVRPNSRLSCQIKVSDELDGLVVSTPERQA

Samples

	Sample ID	Description	Type	Environment
1	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
2	3300000546	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled	Metagenome	Rhizosphere
3	3300000549	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled	Metagenome	Rhizosphere
4	3300001430	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5	Metagenome	Rhizosphere
5	3300001904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2	Metagenome	Rhizosphere
6	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
7	3300001978	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6	Metagenome	Rhizosphere
8	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
9	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
10	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
11	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
12	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
13	3300002073	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4	Metagenome	Rhizosphere
14	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
15	3300002126	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5	Metagenome	Rhizosphere
16	3300002155	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7	Metagenome	Rhizosphere
17	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
18	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
19	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
20	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
21	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
22	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
23	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
24	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
25	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
26	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
27	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
28	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
29	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
30	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
31	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
32	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
33	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
34	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
35	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
36	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
37	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
38	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
39	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
40	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
41	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
42	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
43	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
44	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
45	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
46	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
47	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
48	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
49	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
50	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
51	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
52	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
53	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
54	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
55	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
56	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
57	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
58	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
59	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
60	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
61	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
62	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
63	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
64	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
65	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
66	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
67	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
68	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
69	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
70	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
71	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
72	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
73	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
74	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
75	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
76	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
77	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
78	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
79	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
80	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
81	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
82	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
83	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
84	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
85	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
86	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
87	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
88	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
89	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
90	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
91	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
92	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
93	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
94	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
95	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
96	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
97	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
98	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
99	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
100	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
101	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
102	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
103	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
104	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
105	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
106	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
107	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
108	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
109	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
110	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
111	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
112	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
113	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
114	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
115	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
116	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
117	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
118	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
119	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
120	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
121	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
122	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
123	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
124	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
125	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
126	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
127	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
128	3300006943	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW	Metagenome	Nodule
129	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
130	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
131	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
132	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
133	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
134	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
135	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
136	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
137	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
138	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
139	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
140	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
141	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
142	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
143	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
144	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
145	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
146	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
147	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
148	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
149	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
150	3300012477	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610	Metagenome	Rhizosphere
151	3300012500	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610	Metagenome	Rhizosphere
152	3300012515	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610	Metagenome	Rhizosphere
153	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
154	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
155	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
156	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
157	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
158	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
159	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
160	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
161	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
162	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
163	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
164	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
165	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
166	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
167	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
168	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
169	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
170	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
171	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
172	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
173	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
174	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
175	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
176	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
177	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
178	3300023563	Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA4 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
179	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
180	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
181	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
182	3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
184	3300025290	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2)	Metagenome	Rhizosphere
185	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
186	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300027252	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
256	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
257	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
258	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300027424	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
260	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
270	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
271	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
274	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
275	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
276	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
277	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
278	3300030763	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
279	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
280	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
281	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
282	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
283	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
284	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
285	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
286	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
287	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
288	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
289	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
290	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
291	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
292	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
293	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
294	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
295	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
296	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
297	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
298	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
299	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
300	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
301	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
302	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
303	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
304	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
305	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
306	3300033545	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4	Metagenome	Unclassified
307	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
308	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
309	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
310	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
311	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
312	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
313	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
314	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
315	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
316	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
317	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
318	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
319	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
320	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
321	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
322	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
323	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
324	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
325	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
326	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
327	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
328	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
329	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
330	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
331	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
332	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
333	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
334	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
335	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
336	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
337	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
338	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
339	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
340	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
341	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
342	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
343	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
344	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
345	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
346	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
347	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
348	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
349	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
350	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
351	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
352	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
353	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
354	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
355	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
356	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
357	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
358	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
359	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
360	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
361	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
362	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
363	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
364	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
365	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
366	3300041501	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG	Metagenome	Unclassified
367	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
368	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
369	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
370	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
371	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
372	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
373	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
374	3300042008	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219	Metagenome	Rhizosphere
375	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
376	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
377	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
378	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
379	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
380	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
381	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
382	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
383	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
384	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
385	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
386	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
387	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
388	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
389	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
390	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
391	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
392	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
393	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
394	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
395	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
396	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
397	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
398	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
399	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
400	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
401	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
402	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
403	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
404	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
405	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
406	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
407	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
408	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
409	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
410	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
411	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
412	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
413	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
414	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
415	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
416	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
417	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
418	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
419	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
420	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
421	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
422	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
423	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
424	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
425	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
426	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
427	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
428	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
429	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
430	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
431	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
432	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
433	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
434	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
435	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
436	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
437	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
438	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
439	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
440	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
441	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
442	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
443	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
444	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
445	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
446	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
447	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
448	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
449	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
450	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
451	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
452	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
453	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
454	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
455	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
456	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
457	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
458	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
459	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
460	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
461	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
462	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
463	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
464	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
465	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
466	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
467	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
468	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
469	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
470	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
471	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
472	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
473	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
474	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
475	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
476	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
477	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
478	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
479	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
480	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
481	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
482	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
483	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
484	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
485	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
486	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
487	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
488	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
489	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
490	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
491	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
492	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
493	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
494	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
495	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
496	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
497	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
498	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
499	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
500	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
501	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
502	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
503	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
504	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
505	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
506	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
507	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
508	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
509	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
510	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
511	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
512	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
513	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
514	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
515	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
516	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
517	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
518	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
519	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
520	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
521	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
522	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
523	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
524	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
525	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
526	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
527	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
528	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
529	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
530	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
531	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
532	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
533	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
534	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
535	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
536	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
537	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
538	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
539	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
540	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
541	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
542	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
543	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
544	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
545	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
546	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
547	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
548	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
549	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
550	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
551	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
552	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
553	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
554	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
555	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
556	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
557	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
558	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
559	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
560	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
561	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
562	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
563	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
564	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
565	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
566	3300053095	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere	Metagenome	Endosphere
567	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
568	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
569	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
570	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
571	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
572	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
573	3300053106	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere	Metagenome	Endosphere
574	3300053107	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere	Metagenome	Endosphere
575	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
576	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
577	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
578	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
579	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
580	3300053120	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere	Metagenome	Endosphere
581	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
582	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
583	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
584	3300053126	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere	Metagenome	Endosphere
585	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
586	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
587	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
588	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
589	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
590	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
591	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
592	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
593	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
594	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
595	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
596	3300053144	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere	Metagenome	Endosphere
597	3300053145	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere	Metagenome	Endosphere
598	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
599	3300053147	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere	Metagenome	Endosphere
600	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
601	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
602	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
603	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
604	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
605	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
606	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
607	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
608	3300053159	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere	Metagenome	Endosphere
609	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
610	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
611	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
612	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
613	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
614	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
615	3300053723	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere	Metagenome	Endosphere
616	3300053724	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere	Metagenome	Endosphere
617	3300053725	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere	Metagenome	Endosphere
618	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
619	3300053728	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere	Metagenome	Endosphere
620	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
621	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
622	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
623	3300053732	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere	Metagenome	Endosphere
624	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
625	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
626	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
627	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
628	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
629	3300059642	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
630	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
631	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.6
Metatranscriptomes	0.4
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	10.46
Nodule	0.22
Rhizoplane	5.58
Rhizosphere	76.98
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0495624_0034033	3300046690	Bacteria	3299
2	LJNas_1036058	3300000546	Bacteria	535
3	LJQas_1001737	3300000549	Bacteria	3191
4	JGI24032J14994_100661	3300001430	Bacteria	1790
5	JGI24736J21556_1022977	3300001904	Bacteria	975
6	JGI24746J21847_1002854	3300001977	Bacteria	2719
7	JGI24747J21853_1005672	3300001978	Bacteria	1160
8	JGI24739J22299_10009199	3300001989	Bacteria	3688
9	JGI24737J22298_10002956	3300001990	Bacteria	6026
10	JGI24743J22301_10014472	3300001991	Bacteria	1455
11	JGI24735J21928_10050335	3300002067	Bacteria	1203
12	JGI24750J21931_1001017	3300002070	Bacteria	3674
13	JGI24745J21846_1005180	3300002073	Bacteria	1417
14	JGI24738J21930_10002463	3300002075	Bacteria	4838
15	JGI24035J26624_1004126	3300002126	Bacteria	1375
16	JGI24033J26618_1004331	3300002155	Bacteria	1529
17	JGI24034J26672_10000326	3300002239	Bacteria	6131
18	JGI24034J26672_10115892	3300002239	Bacteria	515
19	JGI24742J22300_10000397	3300002244	Bacteria	6487
20	JGI24751J29686_10031231	3300002459	Bacteria	1105
21	JGI25406J46586_10000048	3300003203	Bacteria	54715
22	JGI25153J46596_10010155	3300003215	Bacteria	4285
23	JGI25160J50197_1061920	3300003354	Bacteria	744
24	JGI25404J52841_10008446	3300003659	Bacteria	2193
25	JGI25404J52841_10014772	3300003659	Bacteria	1694
26	Ga0055539_1031323	3300003752	Bacteria	601
27	JGI25405J52794_10067855	3300003911	Bacteria	776
28	Ga0065704_10618305	3300005289	Bacteria	598
29	Ga0065712_10115194	3300005290	Bacteria	1755
30	Ga0065715_10020364	3300005293	Bacteria	2285
31	Ga0065715_10138453	3300005293	Bacteria	1891
32	Ga0065715_10239721	3300005293	Bacteria	1180
33	Ga0070658_10045107	3300005327	Bacteria	3563
34	Ga0070658_10064574	3300005327	Bacteria	2986
35	Ga0070658_10464065	3300005327	Bacteria	1092
36	Ga0070676_10044926	3300005328	Bacteria	2572
37	Ga0070683_100004361	3300005329	Bacteria	11642
38	Ga0070683_100016821	3300005329	Bacteria	6453
39	Ga0070683_100017403	3300005329	Bacteria	6353
40	Ga0070683_100032893	3300005329	Bacteria	4726
41	Ga0070683_101865451	3300005329	Bacteria	578
42	Ga0070690_100008785	3300005330	Bacteria	5833
43	Ga0070690_100127018	3300005330	Bacteria	1718
44	Ga0070690_100296944	3300005330	Bacteria	1157
45	Ga0070670_100040049	3300005331	Bacteria	4030
46	Ga0070670_100250243	3300005331	Bacteria	1544
47	Ga0070670_100647179	3300005331	Bacteria	948
48	Ga0070670_100907482	3300005331	Bacteria	799
49	Ga0070670_101728712	3300005331	Bacteria	576
50	Ga0070677_10001690	3300005333	Bacteria	6975
51	Ga0070677_10191799	3300005333	Bacteria	980
52	Ga0070677_10507342	3300005333	Bacteria	655
53	Ga0068869_100036691	3300005334	Bacteria	3481
54	Ga0068869_100478534	3300005334	Bacteria	1036
55	Ga0068869_100654050	3300005334	Bacteria	892
56	Ga0068869_101329518	3300005334	Bacteria	635
57	Ga0070666_10079025	3300005335	Bacteria	2246
58	Ga0070666_10308405	3300005335	Bacteria	1128
59	Ga0070666_10794747	3300005335	Bacteria	697
60	Ga0070680_100002749	3300005336	Bacteria	13052
61	Ga0070680_100012411	3300005336	Bacteria	6619
62	Ga0070680_100017942	3300005336	Bacteria	5587
63	Ga0070680_100068967	3300005336	Bacteria	2903
64	Ga0070680_100070428	3300005336	Bacteria	2872
65	Ga0070680_100135873	3300005336	Bacteria	2060
66	Ga0070680_100371605	3300005336	Bacteria	1217
67	Ga0070682_100005853	3300005337	Bacteria	6869
68	Ga0070682_100075034	3300005337	Bacteria	2174
69	Ga0070682_100319002	3300005337	Bacteria	1147
70	Ga0070682_100332368	3300005337	Bacteria	1127
71	Ga0070682_101296741	3300005337	Bacteria	619
72	Ga0068868_100002412	3300005338	Bacteria	12935
73	Ga0068868_100050884	3300005338	Bacteria	3255
74	Ga0068868_100218610	3300005338	Bacteria	1594
75	Ga0068868_101124176	3300005338	Bacteria	724
76	Ga0068868_101482208	3300005338	Bacteria	635
77	Ga0070660_100005972	3300005339	Bacteria	8416
78	Ga0070660_100010269	3300005339	Bacteria	6608
79	Ga0070660_100196924	3300005339	Bacteria	1634
80	Ga0070660_100198090	3300005339	Bacteria	1629
81	Ga0070660_101039328	3300005339	Bacteria	693
82	Ga0070660_101183641	3300005339	Bacteria	648
83	Ga0070689_100009752	3300005340	Bacteria	6819
84	Ga0070689_100092402	3300005340	Bacteria	2387
85	Ga0070689_100108998	3300005340	Bacteria	2200
86	Ga0070689_100228849	3300005340	Bacteria	1527
87	Ga0070689_100773718	3300005340	Bacteria	843
88	Ga0070691_10010624	3300005341	Bacteria	4204
89	Ga0070691_10021364	3300005341	Bacteria	2994
90	Ga0070691_10040897	3300005341	Bacteria	2191
91	Ga0070687_100012130	3300005343	Bacteria	3794
92	Ga0070687_101156359	3300005343	Bacteria	569
93	Ga0070661_100003759	3300005344	Bacteria	10464
94	Ga0070661_100140708	3300005344	Bacteria	1818
95	Ga0070661_100435706	3300005344	Bacteria	1041
96	Ga0070661_100475770	3300005344	Bacteria	997
97	Ga0070661_100695493	3300005344	Bacteria	828
98	Ga0070661_101288220	3300005344	Bacteria	613
99	Ga0070692_10047957	3300005345	Bacteria	2212
100	Ga0070692_10799823	3300005345	Bacteria	644
101	Ga0070668_100027765	3300005347	Bacteria	4296
102	Ga0070668_100243098	3300005347	Bacteria	1492
103	Ga0070669_100023952	3300005353	Bacteria	4373
104	Ga0070675_100030972	3300005354	Bacteria	4321
105	Ga0070671_100038059	3300005355	Bacteria	3993
106	Ga0070671_100088598	3300005355	Bacteria	2590
107	Ga0070674_100008138	3300005356	Bacteria	6220
108	Ga0070674_100025341	3300005356	Bacteria	3860
109	Ga0070674_100144731	3300005356	Bacteria	1788
110	Ga0070674_100754191	3300005356	Bacteria	837
111	Ga0070673_100025438	3300005364	Bacteria	4356
112	Ga0070673_101578910	3300005364	Bacteria	620
113	Ga0070688_100001055	3300005365	Bacteria	13850
114	Ga0070688_100322579	3300005365	Bacteria	1123
115	Ga0070659_100010614	3300005366	Bacteria	6783
116	Ga0070659_100062008	3300005366	Bacteria	2955
117	Ga0070659_100725638	3300005366	Bacteria	861
118	Ga0070659_100786619	3300005366	Bacteria	827
119	Ga0070667_100026906	3300005367	Bacteria	4786
120	Ga0070667_100290135	3300005367	Bacteria	1471
121	Ga0070667_100291124	3300005367	Bacteria	1468
122	Ga0070667_100647382	3300005367	Bacteria	976
123	Ga0070703_10243846	3300005406	Bacteria	726
124	Ga0070709_10005688	3300005434	Bacteria	6758
125	Ga0070709_10007029	3300005434	Bacteria	6154
126	Ga0070709_10011099	3300005434	Bacteria	5009
127	Ga0070709_10069358	3300005434	Bacteria	2270
128	Ga0070709_10196567	3300005434	Bacteria	1426
129	Ga0070709_10602611	3300005434	Bacteria	846
130	Ga0070709_10786755	3300005434	Bacteria	746
131	Ga0070714_100008062	3300005435	Bacteria	8211
132	Ga0070714_100045425	3300005435	Bacteria	3723
133	Ga0070714_100100329	3300005435	Bacteria	2550
134	Ga0070714_100121513	3300005435	Bacteria	2324
135	Ga0070714_100202601	3300005435	Bacteria	1816
136	Ga0070714_100310154	3300005435	Bacteria	1473
137	Ga0070714_100321104	3300005435	Bacteria	1448
138	Ga0070714_100450218	3300005435	Bacteria	1223
139	Ga0070714_100615619	3300005435	Bacteria	1044
140	Ga0070714_101035577	3300005435	Bacteria	799
141	Ga0070714_101990372	3300005435	Bacteria	567
142	Ga0070713_100029386	3300005436	Bacteria	4352
143	Ga0070713_100078012	3300005436	Bacteria	2818
144	Ga0070713_100130137	3300005436	Bacteria	2218
145	Ga0070713_100317129	3300005436	Bacteria	1439
146	Ga0070713_100718181	3300005436	Bacteria	955
147	Ga0070713_101594777	3300005436	Bacteria	633
148	Ga0070710_10006581	3300005437	Bacteria	5587
149	Ga0070710_10023736	3300005437	Bacteria	3227
150	Ga0070710_10150770	3300005437	Bacteria	1434
151	Ga0070710_10169376	3300005437	Bacteria	1360
152	Ga0070710_10196641	3300005437	Bacteria	1271
153	Ga0070710_10344560	3300005437	Bacteria	985
154	Ga0070710_10469062	3300005437	Bacteria	856
155	Ga0070701_10006414	3300005438	Bacteria	4948
156	Ga0070711_100018333	3300005439	Bacteria	4466
157	Ga0070711_100084197	3300005439	Bacteria	2274
158	Ga0070711_100115750	3300005439	Bacteria	1975
159	Ga0070711_100153343	3300005439	Bacteria	1739
160	Ga0070711_100336648	3300005439	Bacteria	1210
161	Ga0070711_100507093	3300005439	Bacteria	995
162	Ga0070711_100536658	3300005439	Bacteria	969
163	Ga0070711_101127350	3300005439	Bacteria	676
164	Ga0070705_100118452	3300005440	Bacteria	1705
165	Ga0070705_101139010	3300005440	Bacteria	640
166	Ga0070700_100018037	3300005441	Bacteria	4050
167	Ga0070694_100015789	3300005444	Bacteria	4749
168	Ga0070663_100099633	3300005455	Bacteria	2166
169	Ga0070663_100111772	3300005455	Bacteria	2054
170	Ga0070663_100277890	3300005455	Bacteria	1334
171	Ga0070663_100488316	3300005455	Bacteria	1021
172	Ga0070663_100556820	3300005455	Bacteria	959
173	Ga0070663_100731151	3300005455	Bacteria	843
174	Ga0070663_100809846	3300005455	Bacteria	804
175	Ga0070663_101477923	3300005455	Bacteria	603
176	Ga0070678_100010696	3300005456	Bacteria	5618
177	Ga0070678_100048840	3300005456	Bacteria	3050
178	Ga0070678_100061953	3300005456	Bacteria	2759
179	Ga0070678_100276540	3300005456	Bacteria	1418
180	Ga0070678_101712916	3300005456	Bacteria	592
181	Ga0070662_100327034	3300005457	Bacteria	1251
182	Ga0070662_100512353	3300005457	Bacteria	1002
183	Ga0070662_100670929	3300005457	Bacteria	876
184	Ga0070681_10002334	3300005458	Bacteria	17351
185	Ga0070681_10017929	3300005458	Bacteria	7077
186	Ga0070681_10044855	3300005458	Bacteria	4426
187	Ga0070681_10094902	3300005458	Bacteria	2931
188	Ga0070681_10152576	3300005458	Bacteria	2236
189	Ga0070681_10166647	3300005458	Bacteria	2126
190	Ga0070681_10388411	3300005458	Bacteria	1307
191	Ga0070681_10446594	3300005458	Bacteria	1205
192	Ga0070681_10671252	3300005458	Bacteria	951
193	Ga0070681_11799085	3300005458	Bacteria	539
194	Ga0068867_100018450	3300005459	Bacteria	4960
195	Ga0068867_100674135	3300005459	Bacteria	910
196	Ga0070685_10005442	3300005466	Bacteria	6449
197	Ga0070706_100623350	3300005467	Bacteria	1002
198	Ga0070706_101032332	3300005467	Bacteria	758
199	Ga0070706_101363443	3300005467	Bacteria	650
200	Ga0070706_101425220	3300005467	Bacteria	634
201	Ga0070707_101191346	3300005468	Bacteria	728
202	Ga0070698_100312244	3300005471	Bacteria	1503
203	Ga0070699_100125015	3300005518	Bacteria	2264
204	Ga0070699_100420930	3300005518	Bacteria	1209
205	Ga0070699_100626114	3300005518	Bacteria	982
206	Ga0070679_100022393	3300005530	Bacteria	6176
207	Ga0070679_100022725	3300005530	Bacteria	6132
208	Ga0070679_100037981	3300005530	Bacteria	4785
209	Ga0070679_100049473	3300005530	Bacteria	4186
210	Ga0070679_100149333	3300005530	Bacteria	2314
211	Ga0070679_100184248	3300005530	Bacteria	2059
212	Ga0070679_100223923	3300005530	Bacteria	1841
213	Ga0070679_100505041	3300005530	Bacteria	1153
214	Ga0070679_100606634	3300005530	Bacteria	1038
215	Ga0070679_102097914	3300005530	Bacteria	515
216	Ga0070684_100009832	3300005535	Bacteria	7554
217	Ga0070684_100083599	3300005535	Bacteria	2829
218	Ga0070684_100248238	3300005535	Bacteria	1626
219	Ga0070684_100634013	3300005535	Bacteria	994
220	Ga0070684_101048792	3300005535	Bacteria	766
221	Ga0070697_100053255	3300005536	Bacteria	3289
222	Ga0070697_100083715	3300005536	Bacteria	2630
223	Ga0070697_100651147	3300005536	Bacteria	928
224	Ga0070697_101841271	3300005536	Bacteria	541
225	Ga0068853_100000984	3300005539	Bacteria	20036
226	Ga0068853_100004957	3300005539	Bacteria	10372
227	Ga0068853_100085577	3300005539	Bacteria	2763
228	Ga0068853_100171402	3300005539	Bacteria	1963
229	Ga0068853_100256762	3300005539	Bacteria	1605
230	Ga0068853_100419889	3300005539	Bacteria	1254
231	Ga0068853_100453967	3300005539	Bacteria	1206
232	Ga0068853_101319121	3300005539	Bacteria	697
233	Ga0068853_101500301	3300005539	Bacteria	653
234	Ga0068853_102336289	3300005539	Bacteria	518
235	Ga0070672_100021142	3300005543	Bacteria	4757
236	Ga0070672_101193807	3300005543	Bacteria	678
237	Ga0070686_100004110	3300005544	Bacteria	8010
238	Ga0070686_100033851	3300005544	Bacteria	3143
239	Ga0070695_100017418	3300005545	Bacteria	4356
240	Ga0070695_100719474	3300005545	Bacteria	794
241	Ga0070696_100015647	3300005546	Bacteria	5097
242	Ga0070693_100015516	3300005547	Bacteria	3923
243	Ga0070693_100329449	3300005547	Bacteria	1039
244	Ga0070693_101291706	3300005547	Bacteria	564
245	Ga0070665_100114396	3300005548	Bacteria	2701
246	Ga0070665_100146433	3300005548	Bacteria	2365
247	Ga0070665_100425396	3300005548	Bacteria	1337
248	Ga0070665_100593266	3300005548	Bacteria	1121
249	Ga0070665_100622271	3300005548	Bacteria	1093
250	Ga0070665_101332377	3300005548	Bacteria	727
251	Ga0070704_100020391	3300005549	Bacteria	4273
252	Ga0068855_100005897	3300005563	Bacteria	14933
253	Ga0068855_100019356	3300005563	Bacteria	8180
254	Ga0068855_100078896	3300005563	Bacteria	3819
255	Ga0068855_100160127	3300005563	Bacteria	2555
256	Ga0068855_100164059	3300005563	Bacteria	2520
257	Ga0068855_100178613	3300005563	Bacteria	2401
258	Ga0068855_100180295	3300005563	Bacteria	2388
259	Ga0068855_100289720	3300005563	Bacteria	1815
260	Ga0068855_100325256	3300005563	Bacteria	1698
261	Ga0068855_100478545	3300005563	Bacteria	1356
262	Ga0068855_100908801	3300005563	Bacteria	929
263	Ga0068855_101136582	3300005563	Bacteria	815
264	Ga0070664_100023460	3300005564	Bacteria	5097
265	Ga0070664_100057848	3300005564	Bacteria	3297
266	Ga0070664_100063231	3300005564	Bacteria	3156
267	Ga0070664_100063732	3300005564	Bacteria	3143
268	Ga0070664_100625073	3300005564	Bacteria	1000
269	Ga0070664_100715071	3300005564	Bacteria	934
270	Ga0068857_100000188	3300005577	Bacteria	39917
271	Ga0068857_100123698	3300005577	Bacteria	2331
272	Ga0068857_100442383	3300005577	Bacteria	1214
273	Ga0068857_101065205	3300005577	Bacteria	780
274	Ga0068857_102074276	3300005577	Bacteria	558
275	Ga0068854_100016222	3300005578	Bacteria	4960
276	Ga0068854_100033734	3300005578	Bacteria	3569
277	Ga0068854_101308746	3300005578	Bacteria	653
278	Ga0068854_101638914	3300005578	Bacteria	587
279	Ga0068856_100000363	3300005614	Bacteria	49777
280	Ga0068856_100044892	3300005614	Bacteria	4350
281	Ga0068856_100059266	3300005614	Bacteria	3781
282	Ga0068856_100110671	3300005614	Bacteria	2743
283	Ga0068856_100164072	3300005614	Bacteria	2232
284	Ga0068856_101600190	3300005614	Bacteria	665
285	Ga0068856_101801217	3300005614	Bacteria	624
286	Ga0068856_102133750	3300005614	Bacteria	570
287	Ga0070702_100009057	3300005615	Bacteria	4854
288	Ga0070702_100078046	3300005615	Bacteria	1976
289	Ga0070702_100151911	3300005615	Bacteria	1487
290	Ga0070702_100940984	3300005615	Bacteria	680
291	Ga0068852_100024915	3300005616	Bacteria	4841
292	Ga0068852_100076320	3300005616	Bacteria	2958
293	Ga0068852_100155859	3300005616	Bacteria	2128
294	Ga0068852_100207139	3300005616	Bacteria	1858
295	Ga0068852_100371261	3300005616	Bacteria	1401
296	Ga0068852_100526777	3300005616	Bacteria	1180
297	Ga0068852_100724520	3300005616	Bacteria	1006
298	Ga0068852_101610117	3300005616	Bacteria	672
299	Ga0068859_100039941	3300005617	Bacteria	4709
300	Ga0068859_100382099	3300005617	Bacteria	1504
301	Ga0068859_101165160	3300005617	Bacteria	848
302	Ga0068859_102056819	3300005617	Bacteria	630
303	Ga0068864_100001357	3300005618	Bacteria	20342
304	Ga0068864_100069628	3300005618	Bacteria	3060
305	Ga0068864_100390148	3300005618	Bacteria	1321
306	Ga0068864_100396453	3300005618	Bacteria	1311
307	Ga0068864_101522988	3300005618	Bacteria	672
308	Ga0068866_10002122	3300005718	Bacteria	8252
309	Ga0068861_100034838	3300005719	Bacteria	3725
310	Ga0068861_100335247	3300005719	Bacteria	1322
311	Ga0068861_100508394	3300005719	Bacteria	1090
312	Ga0068861_100920106	3300005719	Bacteria	830
313	Ga0068851_10004581	3300005834	Bacteria	6233
314	Ga0068851_10093452	3300005834	Bacteria	1587
315	Ga0068851_10129155	3300005834	Bacteria	1365
316	Ga0068870_10003748	3300005840	Bacteria	6468
317	Ga0068870_10674597	3300005840	Bacteria	710
318	Ga0068863_100027984	3300005841	Bacteria	5380
319	Ga0068863_100226945	3300005841	Bacteria	1801
320	Ga0068863_100874228	3300005841	Bacteria	898
321	Ga0068863_102410873	3300005841	Bacteria	536
322	Ga0068858_100054141	3300005842	Bacteria	3710
323	Ga0068858_100249483	3300005842	Bacteria	1686
324	Ga0068858_101220071	3300005842	Bacteria	739
325	Ga0068860_100042875	3300005843	Bacteria	4318
326	Ga0068860_100181447	3300005843	Bacteria	2034
327	Ga0068860_100464302	3300005843	Bacteria	1260
328	Ga0068860_101419088	3300005843	Bacteria	716
329	Ga0068862_100166399	3300005844	Bacteria	1971
330	Ga0081455_10000051	3300005937	Bacteria	123542
331	Ga0081455_10020979	3300005937	Bacteria	6139
332	Ga0081455_10027827	3300005937	Bacteria	5176
333	Ga0081455_10429998	3300005937	Bacteria	908
334	Ga0081540_1004511	3300005983	Bacteria	10568
335	Ga0081540_1008574	3300005983	Bacteria	7128
336	Ga0081540_1015716	3300005983	Bacteria	4777
337	Ga0081540_1033603	3300005983	Bacteria	2782
338	Ga0081540_1041054	3300005983	Bacteria	2403
339	Ga0081540_1341912	3300005983	Bacteria	512
340	Ga0081539_10000008	3300005985	Bacteria	525071
341	Ga0070717_10010496	3300006028	Bacteria	6999
342	Ga0070717_10014007	3300006028	Bacteria	6160
343	Ga0070717_10125181	3300006028	Bacteria	2206
344	Ga0070717_10178896	3300006028	Bacteria	1848
345	Ga0070717_10252077	3300006028	Bacteria	1560
346	Ga0070717_10405815	3300006028	Bacteria	1225
347	Ga0070717_11439007	3300006028	Bacteria	626
348	Ga0075365_10059535	3300006038	Bacteria	2546
349	Ga0075365_10085252	3300006038	Bacteria	2145
350	Ga0075365_10113818	3300006038	Bacteria	1861
351	Ga0075365_10197078	3300006038	Bacteria	1410
352	Ga0075365_10221846	3300006038	Bacteria	1326
353	Ga0075363_100025274	3300006048	Bacteria	3027
354	Ga0075363_100063970	3300006048	Bacteria	1987
355	Ga0075363_100088250	3300006048	Bacteria	1704
356	Ga0075364_10016176	3300006051	Bacteria	4638
357	Ga0075364_11265807	3300006051	Bacteria	500
358	Ga0070715_10013166	3300006163	Bacteria	3031
359	Ga0070715_10040602	3300006163	Bacteria	1945
360	Ga0070715_10155044	3300006163	Bacteria	1126
361	Ga0070715_11005525	3300006163	Bacteria	520
362	Ga0070716_100018245	3300006173	Bacteria	3652
363	Ga0070716_100100401	3300006173	Bacteria	1773
364	Ga0070716_100203218	3300006173	Bacteria	1318
365	Ga0070716_100221417	3300006173	Bacteria	1272
366	Ga0070716_100291455	3300006173	Bacteria	1131
367	Ga0070716_100761363	3300006173	Bacteria	746
368	Ga0070716_100843430	3300006173	Bacteria	713
369	Ga0070716_101234627	3300006173	Bacteria	602
370	Ga0070712_100020432	3300006175	Bacteria	4333
371	Ga0070712_100077350	3300006175	Bacteria	2398
372	Ga0070712_100086553	3300006175	Bacteria	2284
373	Ga0070712_100144019	3300006175	Bacteria	1822
374	Ga0070712_100150717	3300006175	Bacteria	1785
375	Ga0070712_100994293	3300006175	Bacteria	726
376	Ga0070712_101212545	3300006175	Bacteria	656
377	Ga0075367_10014230	3300006178	Bacteria	4301
378	Ga0075367_10392665	3300006178	Bacteria	877
379	Ga0075367_10494775	3300006178	Bacteria	775
380	Ga0075367_11106572	3300006178	Bacteria	507
381	Ga0075369_10167662	3300006186	Bacteria	1008
382	Ga0075366_10074660	3300006195	Bacteria	2022
383	Ga0075366_10189011	3300006195	Bacteria	1251
384	Ga0075366_10857013	3300006195	Bacteria	566
385	Ga0097621_100103572	3300006237	Bacteria	2397
386	Ga0097621_100128307	3300006237	Bacteria	2156
387	Ga0097621_100277097	3300006237	Bacteria	1476
388	Ga0097621_101033254	3300006237	Bacteria	770
389	Ga0097621_101463251	3300006237	Bacteria	648
390	Ga0075370_10167560	3300006353	Bacteria	1290
391	Ga0075370_10734427	3300006353	Bacteria	601
392	Ga0068871_100022532	3300006358	Bacteria	4858
393	Ga0068871_100092967	3300006358	Bacteria	2516
394	Ga0068871_100150133	3300006358	Bacteria	1987
395	Ga0068871_102014151	3300006358	Bacteria	550
396	Ga0075428_100383473	3300006844	Bacteria	1507
397	Ga0075428_101408593	3300006844	Bacteria	731
398	Ga0075431_100269008	3300006847	Bacteria	1728
399	Ga0075433_10556032	3300006852	Bacteria	1008
400	Ga0075434_100021202	3300006871	Bacteria	6315
401	Ga0075434_100055864	3300006871	Bacteria	3923
402	Ga0075434_100098949	3300006871	Bacteria	2922
403	Ga0075429_100341133	3300006880	Bacteria	1312
404	Ga0068865_100019833	3300006881	Bacteria	4354
405	Ga0068865_100963725	3300006881	Bacteria	745
406	Ga0068865_101084218	3300006881	Bacteria	705
407	Ga0075436_101159396	3300006914	Bacteria	583
408	Ga0097620_100039941	3300006931	Bacteria	4709
409	Ga0097620_100382090	3300006931	Bacteria	1504
410	Ga0097620_101165170	3300006931	Bacteria	848
411	Ga0097620_102056836	3300006931	Bacteria	630
412	Ga0099824_1002915	3300006942	Bacteria	25054
413	Ga0099822_1004519	3300006943	Bacteria	18114
414	Ga0075435_100141211	3300007076	Bacteria	2021
415	Ga0075435_100630933	3300007076	Bacteria	930
416	Ga0075435_100780044	3300007076	Bacteria	832
417	Ga0075435_101365920	3300007076	Bacteria	621
418	Ga0099794_10053391	3300007265	Bacteria	1949
419	Ga0099794_10056148	3300007265	Bacteria	1904
420	Ga0099794_10057108	3300007265	Bacteria	1890
421	Ga0099794_10119931	3300007265	Bacteria	1323
422	Ga0099794_10154923	3300007265	Bacteria	1164
423	Ga0099795_10019151	3300007788	Bacteria	2210
424	Ga0099795_10087476	3300007788	Bacteria	1203
425	Ga0099795_10195341	3300007788	Bacteria	851
426	Ga0099795_10206384	3300007788	Bacteria	831
427	Ga0099795_10212649	3300007788	Bacteria	820
428	Ga0099795_10249871	3300007788	Bacteria	764
429	Ga0105251_10042091	3300009011	Bacteria	2219
430	Ga0105244_10069202	3300009036	Bacteria	1762
431	Ga0105244_10353717	3300009036	Bacteria	677
432	Ga0105250_10096315	3300009092	Bacteria	1206
433	Ga0105250_10355564	3300009092	Bacteria	642
434	Ga0105250_10529420	3300009092	Bacteria	538
435	Ga0105240_10005863	3300009093	Bacteria	18207
436	Ga0105240_10016715	3300009093	Bacteria	9924
437	Ga0105240_10048656	3300009093	Bacteria	5357
438	Ga0105240_10074340	3300009093	Bacteria	4195
439	Ga0105240_10095172	3300009093	Bacteria	3632
440	Ga0105240_10165624	3300009093	Bacteria	2622
441	Ga0105240_10989311	3300009093	Bacteria	900
442	Ga0105240_11285622	3300009093	Bacteria	772
443	Ga0105240_11341037	3300009093	Bacteria	753
444	Ga0105240_11680699	3300009093	Bacteria	663
445	Ga0105240_12083954	3300009093	Bacteria	589
446	Ga0111539_10032466	3300009094	Bacteria	6339
447	Ga0111539_10281179	3300009094	Bacteria	1936
448	Ga0111539_10644287	3300009094	Bacteria	1234
449	Ga0105245_10041790	3300009098	Bacteria	4088
450	Ga0105245_10046804	3300009098	Bacteria	3865
451	Ga0105245_10507005	3300009098	Bacteria	1223
452	Ga0105245_10613221	3300009098	Bacteria	1116
453	Ga0105245_13093343	3300009098	Bacteria	516
454	Ga0105247_10005342	3300009101	Bacteria	8097
455	Ga0105247_10021000	3300009101	Bacteria	3929
456	Ga0105247_10036419	3300009101	Bacteria	2999
457	Ga0105247_10100963	3300009101	Bacteria	1844
458	Ga0105247_10371755	3300009101	Bacteria	1011
459	Ga0114129_10627112	3300009147	Bacteria	1390
460	Ga0105243_10048240	3300009148	Bacteria	3356
461	Ga0105243_10120192	3300009148	Bacteria	2214
462	Ga0105243_10357553	3300009148	Bacteria	1343
463	Ga0105243_12176240	3300009148	Bacteria	591
464	Ga0105243_12680179	3300009148	Bacteria	539
465	Ga0105241_10064839	3300009174	Bacteria	2821
466	Ga0105241_10811602	3300009174	Bacteria	863
467	Ga0105241_10940058	3300009174	Bacteria	805
468	Ga0105241_11384580	3300009174	Bacteria	673
469	Ga0105241_11847133	3300009174	Bacteria	591
470	Ga0105242_10045252	3300009176	Bacteria	3566
471	Ga0105242_10605891	3300009176	Bacteria	1059
472	Ga0105242_12941345	3300009176	Bacteria	527
473	Ga0105248_10064580	3300009177	Bacteria	4109
474	Ga0105248_10080740	3300009177	Bacteria	3656
475	Ga0105248_10113008	3300009177	Bacteria	3063
476	Ga0105248_10405367	3300009177	Bacteria	1535
477	Ga0105248_11588574	3300009177	Bacteria	741
478	Ga0105248_11738369	3300009177	Bacteria	707
479	Ga0105237_10016073	3300009545	Bacteria	7783
480	Ga0105237_10019452	3300009545	Bacteria	7012
481	Ga0105237_10019884	3300009545	Bacteria	6933
482	Ga0105237_10022225	3300009545	Bacteria	6509
483	Ga0105237_10065710	3300009545	Bacteria	3622
484	Ga0105237_10175282	3300009545	Bacteria	2144
485	Ga0105237_10229700	3300009545	Bacteria	1856
486	Ga0105237_10521403	3300009545	Bacteria	1195
487	Ga0105237_10773812	3300009545	Bacteria	967
488	Ga0105237_10949054	3300009545	Bacteria	867
489	Ga0105237_12330897	3300009545	Bacteria	545
490	Ga0105238_10005575	3300009551	Bacteria	12435
491	Ga0105238_10031834	3300009551	Bacteria	5367
492	Ga0105238_10032834	3300009551	Bacteria	5283
493	Ga0105238_10212585	3300009551	Bacteria	1910
494	Ga0105238_10300337	3300009551	Bacteria	1589
495	Ga0105238_10344511	3300009551	Bacteria	1479
496	Ga0105238_10390157	3300009551	Bacteria	1384
497	Ga0105238_10885160	3300009551	Bacteria	911
498	Ga0105238_10939571	3300009551	Bacteria	884
499	Ga0105238_11513159	3300009551	Bacteria	700
500	Ga0105238_11847861	3300009551	Bacteria	636
501	Ga0105238_12574856	3300009551	Bacteria	545
502	Ga0105249_10051051	3300009553	Bacteria	3771
503	Ga0105249_10115634	3300009553	Bacteria	2542
504	Ga0105249_10540453	3300009553	Bacteria	1215
505	Ga0105249_10606890	3300009553	Bacteria	1149
506	Ga0105249_11370588	3300009553	Bacteria	779
507	Ga0099796_10002220	3300010159	Bacteria	4209
508	Ga0099796_10012074	3300010159	Bacteria	2428
509	Ga0099796_10032173	3300010159	Bacteria	1716
510	Ga0099796_10227295	3300010159	Bacteria	767
511	Ga0099796_10285366	3300010159	Bacteria	695
512	Ga0105239_10015407	3300010375	Bacteria	8470
513	Ga0105239_10030641	3300010375	Bacteria	5917
514	Ga0105239_10358054	3300010375	Bacteria	1648
515	Ga0105239_10374873	3300010375	Bacteria	1609
516	Ga0105239_11125252	3300010375	Bacteria	904
517	Ga0105239_11198208	3300010375	Bacteria	875
518	Ga0105239_12431073	3300010375	Bacteria	610
519	Ga0105239_13187260	3300010375	Bacteria	534
520	Ga0105246_10007392	3300011119	Bacteria	6731
521	Ga0105246_10012777	3300011119	Bacteria	5248
522	Ga0105246_10013957	3300011119	Bacteria	5044
523	Ga0105246_10298100	3300011119	Bacteria	1300
524	Ga0105246_10641369	3300011119	Bacteria	923
525	Ga0105246_11533155	3300011119	Bacteria	627
526	Ga0157336_1035825	3300012477	Bacteria	516
527	Ga0157314_1053473	3300012500	Bacteria	522
528	Ga0157338_1015442	3300012515	Bacteria	833
529	Ga0157373_10057846	3300013100	Bacteria	2749
530	Ga0157373_10143155	3300013100	Bacteria	1681
531	Ga0157373_10404669	3300013100	Bacteria	978
532	Ga0157371_10044405	3300013102	Bacteria	3164
533	Ga0157371_10181633	3300013102	Bacteria	1505
534	Ga0157371_10314354	3300013102	Bacteria	1136
535	Ga0157370_10023721	3300013104	Bacteria	6088
536	Ga0157370_10039704	3300013104	Bacteria	4548
537	Ga0157370_10046618	3300013104	Bacteria	4156
538	Ga0157370_10461005	3300013104	Bacteria	1168
539	Ga0157370_10599872	3300013104	Bacteria	1008
540	Ga0157370_10646416	3300013104	Bacteria	967
541	Ga0157370_10869112	3300013104	Bacteria	819
542	Ga0157370_11069293	3300013104	Bacteria	729
543	Ga0157370_12121084	3300013104	Bacteria	503
544	Ga0157369_10007589	3300013105	Bacteria	12482
545	Ga0157369_10009884	3300013105	Bacteria	10899
546	Ga0157369_10071830	3300013105	Bacteria	3714
547	Ga0157369_10467833	3300013105	Bacteria	1305
548	Ga0157369_10912936	3300013105	Bacteria	900
549	Ga0157369_11694599	3300013105	Bacteria	642
550	Ga0157369_11838272	3300013105	Bacteria	615
551	Ga0157369_12467736	3300013105	Bacteria	526
552	Ga0157374_10011358	3300013296	Bacteria	7707
553	Ga0157374_10027619	3300013296	Bacteria	5123
554	Ga0157374_10033343	3300013296	Bacteria	4698
555	Ga0157374_11684093	3300013296	Bacteria	659
556	Ga0157378_10003252	3300013297	Bacteria	14451
557	Ga0157378_10292268	3300013297	Bacteria	1574
558	Ga0163162_10015786	3300013306	Bacteria	7381
559	Ga0163162_10086444	3300013306	Bacteria	3213
560	Ga0163162_10939351	3300013306	Bacteria	976
561	Ga0163162_11530552	3300013306	Bacteria	760
562	Ga0163162_11724179	3300013306	Bacteria	715
563	Ga0157372_10037121	3300013307	Bacteria	5371
564	Ga0157372_10047392	3300013307	Bacteria	4776
565	Ga0157372_10187937	3300013307	Bacteria	2392
566	Ga0157372_10371492	3300013307	Bacteria	1666
567	Ga0157372_10510873	3300013307	Bacteria	1401
568	Ga0157372_11068674	3300013307	Bacteria	934
569	Ga0157372_13165677	3300013307	Bacteria	525
570	Ga0157375_10059222	3300013308	Bacteria	3793
571	Ga0157375_10127262	3300013308	Bacteria	2664
572	Ga0157375_10360420	3300013308	Bacteria	1620
573	Ga0157375_10699149	3300013308	Bacteria	1167
574	Ga0157375_11197703	3300013308	Bacteria	891
575	Ga0157375_12289359	3300013308	Bacteria	644
576	Ga0157375_12319856	3300013308	Bacteria	640
577	Ga0163163_10048475	3300014325	Bacteria	4177
578	Ga0163163_10093629	3300014325	Bacteria	3021
579	Ga0163163_10333120	3300014325	Bacteria	1573
580	Ga0163163_11138630	3300014325	Bacteria	843
581	Ga0163163_11234292	3300014325	Bacteria	810
582	Ga0157380_10031868	3300014326	Bacteria	4049
583	Ga0182008_10332273	3300014497	Bacteria	802
584	Ga0182008_10604409	3300014497	Bacteria	616
585	Ga0182008_10734613	3300014497	Bacteria	567
586	Ga0157377_10013067	3300014745	Bacteria	4193
587	Ga0157377_11621377	3300014745	Bacteria	519
588	Ga0157379_10038179	3300014968	Bacteria	4285
589	Ga0157379_10176970	3300014968	Bacteria	1927
590	Ga0157379_10927658	3300014968	Bacteria	827
591	Ga0157379_11549563	3300014968	Bacteria	646
592	Ga0157379_11688201	3300014968	Bacteria	620
593	Ga0157376_10006973	3300014969	Bacteria	8015
594	Ga0157376_10099161	3300014969	Bacteria	2541
595	Ga0157376_11682858	3300014969	Bacteria	669
596	Ga0163161_10022855	3300017792	Bacteria	4406
597	Ga0163161_10180360	3300017792	Bacteria	1619
598	Ga0163161_10210186	3300017792	Bacteria	1503
599	Ga0163161_11167376	3300017792	Bacteria	664
600	Ga0163161_11452374	3300017792	Bacteria	601
601	Ga0206356_11476213	3300020070	Bacteria	926
602	Ga0206353_10011407	3300020082	Bacteria	979
603	Ga0154015_1487628	3300020610	Bacteria	579
604	Ga0213873_10047833	3300021358	Bacteria	1123
605	Ga0213872_10302953	3300021361	Bacteria	663
606	Ga0213874_10042996	3300021377	Bacteria	1359
607	Ga0213876_10002010	3300021384	Bacteria	12176
608	Ga0213876_10139883	3300021384	Bacteria	1287
609	Ga0213875_10121278	3300021388	Bacteria	1222
610	Ga0213875_10339269	3300021388	Bacteria	713
611	Ga0213871_10030454	3300021441	Bacteria	1404
612	Ga0247530_116874	3300023563	Bacteria	529
613	Ga0209677_100138	3300025253	Bacteria	67992
614	Ga0209148_1006501	3300025254	Bacteria	2527
615	Ga0209233_1004761	3300025261	Bacteria	4576
616	Ga0209233_1005352	3300025261	Bacteria	4267
617	Ga0207666_1000235	3300025271	Bacteria	8146
618	Ga0209455_1002510	3300025272	Bacteria	7048
619	Ga0209455_1005649	3300025272	Bacteria	3824
620	Ga0207673_1000453	3300025290	Bacteria	4252
621	Ga0209758_1005809	3300025297	Bacteria	9248
622	Ga0209758_1016470	3300025297	Bacteria	3752
623	Ga0207697_10000024	3300025315	Bacteria	53113
624	Ga0207697_10110608	3300025315	Bacteria	1176
625	Ga0207697_10148852	3300025315	Bacteria	1018
626	Ga0207697_10427688	3300025315	Bacteria	588
627	Ga0207656_10022529	3300025321	Bacteria	2528
628	Ga0207656_10088108	3300025321	Bacteria	1405
629	Ga0207656_10097156	3300025321	Bacteria	1345
630	Ga0207656_10589388	3300025321	Bacteria	567
631	Ga0207713_1108082	3300025735	Bacteria	950
632	Ga0207653_10004126	3300025885	Bacteria	4569
633	Ga0207653_10103221	3300025885	Bacteria	1011
634	Ga0207682_10000087	3300025893	Bacteria	41904
635	Ga0207682_10427633	3300025893	Bacteria	626
636	Ga0207692_10001479	3300025898	Bacteria	8808
637	Ga0207692_10184208	3300025898	Bacteria	1218
638	Ga0207710_10011111	3300025900	Bacteria	3791
639	Ga0207710_10089435	3300025900	Bacteria	1439
640	Ga0207710_10435120	3300025900	Bacteria	676
641	Ga0207710_10446119	3300025900	Bacteria	668
642	Ga0207688_10018466	3300025901	Bacteria	3795
643	Ga0207688_10043006	3300025901	Bacteria	2515
644	Ga0207680_10021368	3300025903	Bacteria	3501
645	Ga0207680_10129971	3300025903	Bacteria	1659
646	Ga0207647_10082546	3300025904	Bacteria	1925
647	Ga0207647_10097696	3300025904	Bacteria	1746
648	Ga0207685_10093816	3300025905	Bacteria	1270
649	Ga0207685_10122301	3300025905	Bacteria	1144
650	Ga0207685_10146304	3300025905	Bacteria	1065
651	Ga0207685_10206825	3300025905	Bacteria	925
652	Ga0207685_10218396	3300025905	Bacteria	905
653	Ga0207699_10001043	3300025906	Bacteria	13063
654	Ga0207699_10203981	3300025906	Bacteria	1341
655	Ga0207699_10245056	3300025906	Bacteria	1233
656	Ga0207699_10307524	3300025906	Bacteria	1108
657	Ga0207699_10663046	3300025906	Bacteria	762
658	Ga0207699_10664080	3300025906	Bacteria	762
659	Ga0207699_10741653	3300025906	Bacteria	720
660	Ga0207645_10012517	3300025907	Bacteria	5753
661	Ga0207643_10009174	3300025908	Bacteria	5312
662	Ga0207643_10142349	3300025908	Bacteria	1433
663	Ga0207643_10513552	3300025908	Bacteria	767
664	Ga0207705_10150043	3300025909	Bacteria	1746
665	Ga0207705_10212002	3300025909	Bacteria	1469
666	Ga0207705_10438459	3300025909	Bacteria	1012
667	Ga0207705_10453553	3300025909	Bacteria	994
668	Ga0207705_10517089	3300025909	Bacteria	927
669	Ga0207684_10283518	3300025910	Bacteria	1428
670	Ga0207684_10556023	3300025910	Bacteria	982
671	Ga0207684_10636298	3300025910	Bacteria	909
672	Ga0207684_10826287	3300025910	Bacteria	782
673	Ga0207654_10284803	3300025911	Bacteria	1119
674	Ga0207654_10472390	3300025911	Bacteria	882
675	Ga0207654_10488099	3300025911	Bacteria	868
676	Ga0207707_10003044	3300025912	Bacteria	14897
677	Ga0207707_10003171	3300025912	Bacteria	14595
678	Ga0207707_10019021	3300025912	Bacteria	5992
679	Ga0207707_10022495	3300025912	Bacteria	5511
680	Ga0207707_10060558	3300025912	Bacteria	3293
681	Ga0207707_10084788	3300025912	Bacteria	2767
682	Ga0207707_10096165	3300025912	Bacteria	2588
683	Ga0207707_10221891	3300025912	Bacteria	1645
684	Ga0207707_10405789	3300025912	Bacteria	1169
685	Ga0207707_10547769	3300025912	Bacteria	983
686	Ga0207695_10021925	3300025913	Bacteria	7270
687	Ga0207695_10064514	3300025913	Bacteria	3770
688	Ga0207695_10071027	3300025913	Bacteria	3556
689	Ga0207695_10201051	3300025913	Bacteria	1907
690	Ga0207695_10378674	3300025913	Bacteria	1301
691	Ga0207695_10938171	3300025913	Bacteria	745
692	Ga0207695_11376374	3300025913	Bacteria	586
693	Ga0207671_10026128	3300025914	Bacteria	4379
694	Ga0207671_10067286	3300025914	Bacteria	2668
695	Ga0207671_10149060	3300025914	Bacteria	1807
696	Ga0207671_10566971	3300025914	Bacteria	905
697	Ga0207671_10887060	3300025914	Bacteria	705
698	Ga0207671_10915183	3300025914	Bacteria	693
699	Ga0207693_10011325	3300025915	Bacteria	7221
700	Ga0207693_10013925	3300025915	Bacteria	6476
701	Ga0207693_10016216	3300025915	Bacteria	5957
702	Ga0207693_10031663	3300025915	Bacteria	4179
703	Ga0207693_10035851	3300025915	Bacteria	3909
704	Ga0207693_10046955	3300025915	Bacteria	3393
705	Ga0207693_10102143	3300025915	Bacteria	2249
706	Ga0207663_10013831	3300025916	Bacteria	4399
707	Ga0207663_10047336	3300025916	Bacteria	2654
708	Ga0207663_10131515	3300025916	Bacteria	1730
709	Ga0207663_10191617	3300025916	Bacteria	1468
710	Ga0207663_10279197	3300025916	Bacteria	1240
711	Ga0207663_10326198	3300025916	Bacteria	1155
712	Ga0207663_10455433	3300025916	Bacteria	987
713	Ga0207663_10907553	3300025916	Bacteria	705
714	Ga0207660_10010857	3300025917	Bacteria	5921
715	Ga0207660_10012019	3300025917	Bacteria	5655
716	Ga0207660_10045770	3300025917	Bacteria	3084
717	Ga0207660_10148231	3300025917	Bacteria	1800
718	Ga0207660_10342977	3300025917	Bacteria	1196
719	Ga0207660_10604934	3300025917	Bacteria	893
720	Ga0207660_10763472	3300025917	Bacteria	789
721	Ga0207660_10940169	3300025917	Bacteria	705
722	Ga0207660_10991583	3300025917	Bacteria	685
723	Ga0207662_10000635	3300025918	Bacteria	15793
724	Ga0207662_10086521	3300025918	Bacteria	1921
725	Ga0207662_10175169	3300025918	Bacteria	1378
726	Ga0207662_11088571	3300025918	Bacteria	568
727	Ga0207657_10006779	3300025919	Bacteria	11827
728	Ga0207657_10009978	3300025919	Bacteria	9505
729	Ga0207657_10034334	3300025919	Bacteria	4563
730	Ga0207657_10089159	3300025919	Bacteria	2577
731	Ga0207657_10200891	3300025919	Bacteria	1604
732	Ga0207649_10010099	3300025920	Bacteria	5179
733	Ga0207649_10152705	3300025920	Bacteria	1592
734	Ga0207649_10321268	3300025920	Bacteria	1137
735	Ga0207649_10691595	3300025920	Bacteria	790
736	Ga0207649_10833174	3300025920	Bacteria	721
737	Ga0207649_11146641	3300025920	Bacteria	614
738	Ga0207652_10006101	3300025921	Bacteria	9747
739	Ga0207652_10011209	3300025921	Bacteria	7222
740	Ga0207652_10018275	3300025921	Bacteria	5749
741	Ga0207652_10018498	3300025921	Bacteria	5717
742	Ga0207652_10033171	3300025921	Bacteria	4346
743	Ga0207652_10036825	3300025921	Bacteria	4138
744	Ga0207652_10071415	3300025921	Bacteria	3016
745	Ga0207652_10096529	3300025921	Bacteria	2604
746	Ga0207652_10451960	3300025921	Bacteria	1158
747	Ga0207652_10672685	3300025921	Bacteria	925
748	Ga0207652_11292369	3300025921	Bacteria	632
749	Ga0207652_11349693	3300025921	Bacteria	616
750	Ga0207646_10092892	3300025922	Bacteria	2701
751	Ga0207646_10644127	3300025922	Bacteria	949
752	Ga0207646_11011162	3300025922	Bacteria	734
753	Ga0207681_10013135	3300025923	Bacteria	5119
754	Ga0207694_10014944	3300025924	Bacteria	5854
755	Ga0207694_10038212	3300025924	Bacteria	3690
756	Ga0207694_10113764	3300025924	Bacteria	2155
757	Ga0207694_10150533	3300025924	Bacteria	1874
758	Ga0207694_10398148	3300025924	Bacteria	1145
759	Ga0207694_10513923	3300025924	Bacteria	1003
760	Ga0207694_10534120	3300025924	Bacteria	983
761	Ga0207694_10720517	3300025924	Bacteria	841
762	Ga0207694_10847672	3300025924	Bacteria	772
763	Ga0207694_11130169	3300025924	Bacteria	663
764	Ga0207650_10131339	3300025925	Bacteria	1960
765	Ga0207650_10286498	3300025925	Bacteria	1342
766	Ga0207650_10491924	3300025925	Bacteria	1024
767	Ga0207650_11373923	3300025925	Bacteria	601
768	Ga0207659_10009175	3300025926	Bacteria	6178
769	Ga0207659_10179702	3300025926	Bacteria	1675
770	Ga0207687_10125587	3300025927	Bacteria	1926
771	Ga0207687_10161032	3300025927	Bacteria	1722
772	Ga0207687_10504494	3300025927	Bacteria	1010
773	Ga0207687_11187640	3300025927	Bacteria	656
774	Ga0207700_10109107	3300025928	Bacteria	2223
775	Ga0207700_10211763	3300025928	Bacteria	1639
776	Ga0207700_10251129	3300025928	Bacteria	1511
777	Ga0207700_10286552	3300025928	Bacteria	1418
778	Ga0207700_10287795	3300025928	Bacteria	1415
779	Ga0207700_10489150	3300025928	Bacteria	1088
780	Ga0207700_10572508	3300025928	Bacteria	1004
781	Ga0207700_10712268	3300025928	Bacteria	896
782	Ga0207664_10084091	3300025929	Bacteria	2595
783	Ga0207664_10084929	3300025929	Bacteria	2583
784	Ga0207664_10095998	3300025929	Bacteria	2440
785	Ga0207664_10164615	3300025929	Bacteria	1894
786	Ga0207664_10307217	3300025929	Bacteria	1397
787	Ga0207664_10423323	3300025929	Bacteria	1186
788	Ga0207664_10430720	3300025929	Bacteria	1176
789	Ga0207664_10652936	3300025929	Bacteria	945
790	Ga0207664_10842072	3300025929	Bacteria	824
791	Ga0207664_11511909	3300025929	Bacteria	593
792	Ga0207644_10019937	3300025931	Bacteria	4554
793	Ga0207644_10152623	3300025931	Bacteria	1789
794	Ga0207644_10896297	3300025931	Bacteria	743
795	Ga0207690_10019117	3300025932	Bacteria	4210
796	Ga0207690_10052527	3300025932	Bacteria	2730
797	Ga0207690_10063004	3300025932	Bacteria	2527
798	Ga0207690_10238865	3300025932	Bacteria	1398
799	Ga0207690_10474387	3300025932	Bacteria	1009
800	Ga0207690_10911694	3300025932	Bacteria	729
801	Ga0207706_10023021	3300025933	Bacteria	5594
802	Ga0207706_10354716	3300025933	Bacteria	1275
803	Ga0207706_10363322	3300025933	Bacteria	1257
804	Ga0207686_10008201	3300025934	Bacteria	5636
805	Ga0207686_10395014	3300025934	Bacteria	1052
806	Ga0207709_10012547	3300025935	Bacteria	4668
807	Ga0207709_10382897	3300025935	Bacteria	1071
808	Ga0207709_11342027	3300025935	Bacteria	591
809	Ga0207670_10018559	3300025936	Bacteria	4232
810	Ga0207669_10005648	3300025937	Bacteria	5639
811	Ga0207704_10059303	3300025938	Bacteria	2362
812	Ga0207665_10005489	3300025939	Bacteria	8464
813	Ga0207665_10028739	3300025939	Bacteria	3675
814	Ga0207665_10073798	3300025939	Bacteria	2334
815	Ga0207665_10078273	3300025939	Bacteria	2271
816	Ga0207665_10699175	3300025939	Bacteria	797
817	Ga0207665_10833261	3300025939	Bacteria	730
818	Ga0207691_10021651	3300025940	Bacteria	6069
819	Ga0207711_10024215	3300025941	Bacteria	5081
820	Ga0207711_10031910	3300025941	Bacteria	4451
821	Ga0207711_10202399	3300025941	Bacteria	1812
822	Ga0207711_10549437	3300025941	Bacteria	1077
823	Ga0207711_11294471	3300025941	Bacteria	671
824	Ga0207689_10004028	3300025942	Bacteria	13359
825	Ga0207689_10112974	3300025942	Bacteria	2233
826	Ga0207689_10235877	3300025942	Bacteria	1512
827	Ga0207661_10000906	3300025944	Bacteria	19430
828	Ga0207661_10021818	3300025944	Bacteria	4806
829	Ga0207661_10023237	3300025944	Bacteria	4683
830	Ga0207661_10035213	3300025944	Bacteria	3899
831	Ga0207661_10056819	3300025944	Bacteria	3143
832	Ga0207679_10005400	3300025945	Bacteria	8006
833	Ga0207679_10302433	3300025945	Bacteria	1379
834	Ga0207679_10456659	3300025945	Bacteria	1134
835	Ga0207679_11127328	3300025945	Bacteria	720
836	Ga0207679_11638250	3300025945	Bacteria	589
837	Ga0207667_10027037	3300025949	Bacteria	6256
838	Ga0207667_10081524	3300025949	Bacteria	3351
839	Ga0207667_10123514	3300025949	Bacteria	2667
840	Ga0207667_10162909	3300025949	Bacteria	2293
841	Ga0207667_10173956	3300025949	Bacteria	2212
842	Ga0207667_10234539	3300025949	Bacteria	1878
843	Ga0207667_10272252	3300025949	Bacteria	1731
844	Ga0207667_10492256	3300025949	Bacteria	1244
845	Ga0207667_10538208	3300025949	Bacteria	1182
846	Ga0207651_10016096	3300025960	Bacteria	4368
847	Ga0207651_10073919	3300025960	Bacteria	2426
848	Ga0207651_10384810	3300025960	Bacteria	1190
849	Ga0207712_10015527	3300025961	Bacteria	4916
850	Ga0207712_10733623	3300025961	Bacteria	864
851	Ga0207668_10013764	3300025972	Bacteria	4991
852	Ga0207668_10375993	3300025972	Bacteria	1194
853	Ga0207640_10010271	3300025981	Bacteria	5268
854	Ga0207640_10344802	3300025981	Bacteria	1194
855	Ga0207640_11031315	3300025981	Bacteria	725
856	Ga0207640_11255314	3300025981	Bacteria	660
857	Ga0207658_10028246	3300025986	Bacteria	3949
858	Ga0207658_10340785	3300025986	Bacteria	1303
859	Ga0207658_11621597	3300025986	Bacteria	591
860	Ga0207677_10017654	3300026023	Bacteria	4261
861	Ga0207677_10046452	3300026023	Bacteria	2908
862	Ga0207677_10443284	3300026023	Bacteria	1111
863	Ga0207677_10667999	3300026023	Bacteria	919
864	Ga0207703_10052285	3300026035	Bacteria	3316
865	Ga0207703_10383566	3300026035	Bacteria	1300
866	Ga0207703_10899464	3300026035	Bacteria	847
867	Ga0207703_10954995	3300026035	Bacteria	822
868	Ga0207639_10007147	3300026041	Bacteria	7608
869	Ga0207639_10071487	3300026041	Bacteria	2714
870	Ga0207639_10134037	3300026041	Bacteria	2054
871	Ga0207639_10515171	3300026041	Bacteria	1095
872	Ga0207639_10842447	3300026041	Bacteria	856
873	Ga0207639_11283395	3300026041	Bacteria	687
874	Ga0207678_10000216	3300026067	Bacteria	51220
875	Ga0207678_10030515	3300026067	Bacteria	4705
876	Ga0207678_10032157	3300026067	Bacteria	4573
877	Ga0207678_10038938	3300026067	Bacteria	4128
878	Ga0207678_10130234	3300026067	Bacteria	2146
879	Ga0207678_10138632	3300026067	Bacteria	2076
880	Ga0207678_10173262	3300026067	Bacteria	1842
881	Ga0207678_10186083	3300026067	Bacteria	1774
882	Ga0207708_10018421	3300026075	Bacteria	5259
883	Ga0207702_10000854	3300026078	Bacteria	31830
884	Ga0207702_10058622	3300026078	Bacteria	3277
885	Ga0207702_10434391	3300026078	Bacteria	1271
886	Ga0207702_10673456	3300026078	Bacteria	1018
887	Ga0207702_10773835	3300026078	Bacteria	948
888	Ga0207702_10976370	3300026078	Bacteria	840
889	Ga0207641_10027863	3300026088	Bacteria	4666
890	Ga0207641_10820428	3300026088	Bacteria	921
891	Ga0207641_10851043	3300026088	Bacteria	904
892	Ga0207648_10018423	3300026089	Bacteria	6323
893	Ga0207676_10522083	3300026095	Bacteria	1130
894	Ga0207676_10606089	3300026095	Bacteria	1052
895	Ga0207676_10905799	3300026095	Bacteria	865
896	Ga0207674_10002416	3300026116	Bacteria	23583
897	Ga0207674_10014786	3300026116	Bacteria	8608
898	Ga0207674_10046602	3300026116	Bacteria	4450
899	Ga0207674_10423351	3300026116	Bacteria	1287
900	Ga0207674_10866440	3300026116	Bacteria	871
901	Ga0207674_10911012	3300026116	Bacteria	847
902	Ga0207675_100000497	3300026118	Bacteria	38163
903	Ga0207675_100089455	3300026118	Bacteria	2893
904	Ga0207675_101429992	3300026118	Bacteria	712
905	Ga0207683_10021570	3300026121	Bacteria	5519
906	Ga0207683_10146830	3300026121	Bacteria	2127
907	Ga0207683_10159829	3300026121	Bacteria	2036
908	Ga0207683_10198848	3300026121	Bacteria	1821
909	Ga0207683_11008687	3300026121	Bacteria	773
910	Ga0207698_10034180	3300026142	Bacteria	3703
911	Ga0207698_10120994	3300026142	Bacteria	2216
912	Ga0207698_10133316	3300026142	Bacteria	2127
913	Ga0207698_10134180	3300026142	Bacteria	2121
914	Ga0207698_10441171	3300026142	Bacteria	1254
915	Ga0207698_10707613	3300026142	Bacteria	1003
916	Ga0209973_1002694	3300027252	Bacteria	1689
917	Ga0209589_1000004	3300027357	Bacteria	578529
918	Ga0209489_100004	3300027361	Bacteria	578529
919	Ga0209700_100004	3300027363	Bacteria	578529
920	Ga0209981_1041066	3300027378	Bacteria	692
921	Ga0209984_1019317	3300027424	Bacteria	925
922	Ga0209179_1059072	3300027512	Bacteria	831
923	Ga0209999_1005325	3300027543	Bacteria	2315
924	Ga0209970_1012444	3300027614	Bacteria	1406
925	Ga0210002_1001644	3300027617	Bacteria	3180
926	Ga0209983_1010562	3300027665	Bacteria	1886
927	Ga0209588_1011240	3300027671	Bacteria	2703
928	Ga0209588_1213303	3300027671	Bacteria	599
929	Ga0209966_1013504	3300027695	Bacteria	1513
930	Ga0209998_10004989	3300027717	Bacteria	2789
931	Ga0209974_10126024	3300027876	Bacteria	910
932	Ga0207428_10040191	3300027907	Bacteria	3796
933	Ga0207428_10142455	3300027907	Bacteria	1828
934	Ga0268266_10057192	3300028379	Bacteria	3356
935	Ga0268266_10153146	3300028379	Bacteria	2080
936	Ga0268266_10208590	3300028379	Bacteria	1791
937	Ga0268266_10296614	3300028379	Bacteria	1507
938	Ga0268266_12182183	3300028379	Bacteria	526
939	Ga0268265_10120725	3300028380	Bacteria	2158
940	Ga0268264_10027294	3300028381	Bacteria	4663
941	Ga0268264_10160234	3300028381	Bacteria	2026
942	Ga0265334_10010032	3300028573	Bacteria	4002
943	Ga0307517_10000315	3300028786	Bacteria	84020
944	Ga0307517_10295355	3300028786	Bacteria	912
945	Ga0307517_10343050	3300028786	Bacteria	815
946	Ga0307517_10419020	3300028786	Bacteria	703
947	Ga0307515_10467100	3300028794	Bacteria	875
948	Ga0307515_10767415	3300028794	Bacteria	584
949	Ga0265338_10132265	3300028800	Bacteria	1967
950	Ga0265338_10255200	3300028800	Bacteria	1292
951	Ga0265338_10790880	3300028800	Bacteria	650
952	Ga0307511_10115053	3300030521	Bacteria	1691
953	Ga0307511_10128195	3300030521	Bacteria	1539
954	Ga0265763_1036935	3300030763	Bacteria	576
955	Ga0265763_1039783	3300030763	Bacteria	563
956	Ga0265760_10219464	3300031090	Bacteria	648
957	Ga0265760_10320844	3300031090	Bacteria	551
958	Ga0265330_10017113	3300031235	Bacteria	3341
959	Ga0265330_10115345	3300031235	Bacteria	1145
960	Ga0265330_10121632	3300031235	Bacteria	1112
961	Ga0265332_10059951	3300031238	Bacteria	1629
962	Ga0265332_10176912	3300031238	Bacteria	890
963	Ga0265320_10005930	3300031240	Bacteria	7768
964	Ga0265325_10004491	3300031241	Bacteria	8802
965	Ga0265325_10027981	3300031241	Bacteria	3043
966	Ga0265329_10120254	3300031242	Bacteria	842
967	Ga0265340_10001950	3300031247	Bacteria	11797
968	Ga0265340_10135321	3300031247	Bacteria	1128
969	Ga0265340_10179229	3300031247	Bacteria	958
970	Ga0265340_10418930	3300031247	Bacteria	590
971	Ga0265340_10507460	3300031247	Bacteria	531
972	Ga0265339_10011050	3300031249	Bacteria	5578
973	Ga0265339_10019552	3300031249	Bacteria	3974
974	Ga0265339_10065389	3300031249	Bacteria	1950
975	Ga0265339_10282927	3300031249	Bacteria	794
976	Ga0265339_10302361	3300031249	Bacteria	762
977	Ga0265339_10306004	3300031249	Bacteria	757
978	Ga0265339_10325088	3300031249	Bacteria	729
979	Ga0265331_10002962	3300031250	Bacteria	11170
980	Ga0265331_10044035	3300031250	Bacteria	2160
981	Ga0265331_10047886	3300031250	Bacteria	2057
982	Ga0265316_10085965	3300031344	Bacteria	2405
983	Ga0265316_10282707	3300031344	Bacteria	1212
984	Ga0265316_10491813	3300031344	Bacteria	877
985	Ga0265316_10736400	3300031344	Bacteria	694
986	Ga0307513_10131898	3300031456	Bacteria	2442
987	Ga0307509_10528587	3300031507	Bacteria	860
988	Ga0307408_100945466	3300031548	Bacteria	791
989	Ga0307508_10014992	3300031616	Bacteria	7065
990	Ga0307508_10042358	3300031616	Bacteria	4085
991	Ga0307508_10059377	3300031616	Bacteria	3382
992	Ga0307508_10111887	3300031616	Bacteria	2330
993	Ga0307508_10151816	3300031616	Bacteria	1921
994	Ga0307508_10192629	3300031616	Bacteria	1640
995	Ga0307508_10412020	3300031616	Bacteria	943
996	Ga0307514_10574431	3300031649	Bacteria	514
997	Ga0316579_10368140	3300031691	Bacteria	695
998	Ga0265314_10002194	3300031711	Bacteria	20401
999	Ga0265314_10047631	3300031711	Bacteria	3014
1000	Ga0265314_10105470	3300031711	Bacteria	1802
1001	Ga0265342_10006933	3300031712	Bacteria	8374
1002	Ga0265342_10048652	3300031712	Bacteria	2541
1003	Ga0265342_10110738	3300031712	Bacteria	1554
1004	Ga0265342_10205604	3300031712	Bacteria	1067
1005	Ga0265342_10212143	3300031712	Bacteria	1046
1006	Ga0265342_10392753	3300031712	Bacteria	717
1007	Ga0307516_10034850	3300031730	Bacteria	5054
1008	Ga0307516_10061551	3300031730	Bacteria	3641
1009	Ga0307516_10123420	3300031730	Bacteria	2377
1010	Ga0307516_10164836	3300031730	Bacteria	1962
1011	Ga0307516_10197856	3300031730	Bacteria	1731
1012	Ga0307516_10309576	3300031730	Bacteria	1253
1013	Ga0307405_10182538	3300031731	Bacteria	1508
1014	Ga0307413_11667391	3300031824	Bacteria	568
1015	Ga0307410_10668544	3300031852	Bacteria	873
1016	Ga0307406_10490400	3300031901	Bacteria	994
1017	Ga0307406_11949190	3300031901	Bacteria	524
1018	Ga0307412_10838125	3300031911	Bacteria	801
1019	Ga0307416_100721508	3300032002	Bacteria	1087
1020	Ga0307416_101393979	3300032002	Bacteria	807
1021	Ga0307507_10065871	3300033179	Bacteria	3326
1022	Ga0307510_10026519	3300033180	Bacteria	6657
1023	Ga0307510_10057468	3300033180	Bacteria	4037
1024	Ga0307510_10080498	3300033180	Bacteria	3167
1025	Ga0307510_10093357	3300033180	Bacteria	2841
1026	Ga0307510_10237873	3300033180	Bacteria	1318
1027	Ga0307510_10306319	3300033180	Bacteria	1049
1028	Ga0316214_1032230	3300033545	Bacteria	745
1029	Ga0373930_0016844	3300034816	Bacteria	1387
1030	Ga0373930_0019564	3300034816	Bacteria	1311
1031	Ga0373930_0207082	3300034816	Bacteria	512
1032	Ga0373950_0004714	3300034818	Bacteria	2006
1033	Ga0373950_0037858	3300034818	Bacteria	914
1034	Ga0373950_0072406	3300034818	Bacteria	708
1035	Ga0373958_0004946	3300034819	Bacteria	1999
1036	Ga0373958_0083117	3300034819	Bacteria	728
1037	Ga0373938_0001969	3300034957	Bacteria	3291
1038	Ga0373938_0077245	3300034957	Bacteria	806
1039	Ga0373926_0011726	3300035083	Bacteria	2955
1040	Ga0373926_0104529	3300035083	Bacteria	1061
1041	Ga0373926_0162965	3300035083	Bacteria	852
1042	Ga0373926_0289426	3300035083	Bacteria	639
1043	Ga0373926_0460347	3300035083	Bacteria	505
1044	Ga0373928_0028800	3300035084	Bacteria	1217
1045	Ga0373928_0075729	3300035084	Bacteria	840
1046	Ga0373929_0083883	3300035085	Bacteria	781
1047	Ga0373934_0007858	3300035086	Bacteria	3966
1048	Ga0373934_0030209	3300035086	Bacteria	2119
1049	Ga0373934_0085256	3300035086	Bacteria	1271
1050	Ga0373934_0102339	3300035086	Bacteria	1158
1051	Ga0373934_0401822	3300035086	Bacteria	572
1052	Ga0373940_0041049	3300035088	Bacteria	1271
1053	Ga0373940_0058925	3300035088	Bacteria	1094
1054	Ga0373944_0085852	3300035089	Bacteria	1046
1055	Ga0373944_0140963	3300035089	Bacteria	844
1056	Ga0373949_0100084	3300035090	Bacteria	793
1057	Ga0373949_0200659	3300035090	Bacteria	599
1058	Ga0373951_0106820	3300035091	Bacteria	749
1059	Ga0373952_0238220	3300035092	Bacteria	546
1060	Ga0373923_0064818	3300035111	Bacteria	1559
1061	Ga0373923_0150563	3300035111	Bacteria	1057
1062	Ga0373923_0238673	3300035111	Bacteria	848
1063	Ga0373932_0003178	3300035112	Bacteria	3996
1064	Ga0373932_0089241	3300035112	Bacteria	986
1065	Ga0373932_0159486	3300035112	Bacteria	779
1066	Ga0373936_0009066	3300035113	Bacteria	3753
1067	Ga0373936_0019470	3300035113	Bacteria	2630
1068	Ga0373936_0033666	3300035113	Bacteria	2032
1069	Ga0373936_0074859	3300035113	Bacteria	1401
1070	Ga0373936_0335880	3300035113	Bacteria	686
1071	Ga0373939_0034604	3300035114	Bacteria	1484
1072	Ga0373939_0063215	3300035114	Bacteria	1185
1073	Ga0373941_0001764	3300035115	Bacteria	4653
1074	Ga0373945_0032068	3300035116	Bacteria	1860
1075	Ga0373945_0179049	3300035116	Bacteria	872
1076	Ga0373945_0303786	3300035116	Bacteria	684
1077	Ga0373945_0380160	3300035116	Bacteria	616
1078	Ga0373953_0001313	3300035117	Bacteria	7125
1079	Ga0373953_0156260	3300035117	Bacteria	979
1080	Ga0373953_0201419	3300035117	Bacteria	861
1081	Ga0373953_0372791	3300035117	Bacteria	627
1082	Ga0373953_0490978	3300035117	Bacteria	544
1083	Ga0373954_0009067	3300035118	Bacteria	4374
1084	Ga0373954_0012997	3300035118	Bacteria	3706
1085	Ga0373954_0035151	3300035118	Bacteria	2323
1086	Ga0373954_0052954	3300035118	Bacteria	1907
1087	Ga0373954_0186567	3300035118	Bacteria	1018
1088	Ga0373954_0446116	3300035118	Bacteria	640
1089	Ga0373954_0550385	3300035118	Bacteria	572
1090	Ga0373956_0004696	3300035119	Bacteria	5458
1091	Ga0373956_0031826	3300035119	Bacteria	2313
1092	Ga0373956_0042731	3300035119	Bacteria	2016
1093	Ga0373956_0072301	3300035119	Bacteria	1575
1094	Ga0373956_0236269	3300035119	Bacteria	868
1095	Ga0373957_0015994	3300035120	Bacteria	2591
1096	Ga0373957_0038519	3300035120	Bacteria	1790
1097	Ga0373957_0263874	3300035120	Bacteria	726
1098	Ga0373960_0025729	3300035121	Bacteria	1602
1099	Ga0373960_0134875	3300035121	Bacteria	831
1100	Ga0373943_0041528	3300035170	Bacteria	2225
1101	Ga0373943_0048547	3300035170	Bacteria	2080
1102	Ga0373943_0165948	3300035170	Bacteria	1205
1103	Ga0373943_0323145	3300035170	Bacteria	880
1104	Ga0373943_0560915	3300035170	Bacteria	671
1105	Ga0373946_0006892	3300035171	Bacteria	4136
1106	Ga0373946_0377380	3300035171	Bacteria	713
1107	Ga0373946_0657826	3300035171	Bacteria	546
1108	Ga0373955_0003971	3300035172	Bacteria	6529
1109	Ga0373955_0013347	3300035172	Bacteria	3971
1110	Ga0373955_0013510	3300035172	Bacteria	3951
1111	Ga0373955_0050138	3300035172	Bacteria	2269
1112	Ga0373955_0089527	3300035172	Bacteria	1752
1113	Ga0373955_0108507	3300035172	Bacteria	1602
1114	Ga0373942_0070189	3300035207	Bacteria	1021
1115	Ga0373942_0075510	3300035207	Bacteria	992
1116	Ga0373942_0078819	3300035207	Bacteria	974
1117	Ga0373961_0276245	3300035241	Bacteria	615
1118	Ga0373962_0007047	3300035242	Bacteria	2744
1119	Ga0373924_0013135	3300035410	Bacteria	3108
1120	Ga0373924_0403193	3300035410	Bacteria	611
1121	Ga0373931_0001322	3300035691	Bacteria	10604
1122	Ga0373931_0003411	3300035691	Bacteria	7131
1123	Ga0373931_0153455	3300035691	Bacteria	1344
1124	Ga0373931_0176998	3300035691	Bacteria	1261
1125	Ga0373931_0243837	3300035691	Bacteria	1090
1126	Ga0373931_0626572	3300035691	Bacteria	705
1127	Ga0373931_0803162	3300035691	Bacteria	627
1128	Ga0373935_0002486	3300035692	Bacteria	10552
1129	Ga0373935_0147422	3300035692	Bacteria	1594
1130	Ga0373935_0163662	3300035692	Bacteria	1518
1131	Ga0373935_0255181	3300035692	Bacteria	1228
1132	Ga0373935_0272228	3300035692	Bacteria	1190
1133	Ga0373935_0795602	3300035692	Bacteria	698
1134	Ga0373935_0920779	3300035692	Bacteria	648
1135	Ga0373935_1418866	3300035692	Bacteria	519
1136	Ga0373927_0002398	3300035695	Bacteria	13655
1137	Ga0373927_0008046	3300035695	Bacteria	7120
1138	Ga0373927_0008864	3300035695	Bacteria	6758
1139	Ga0373927_0031711	3300035695	Bacteria	3444
1140	Ga0373927_0043225	3300035695	Bacteria	2918
1141	Ga0373927_0064531	3300035695	Bacteria	2368
1142	Ga0373927_0123349	3300035695	Bacteria	1691
1143	Ga0373927_0360709	3300035695	Bacteria	958
1144	Ga0373927_0423538	3300035695	Bacteria	879
1145	Ga0373927_0515181	3300035695	Bacteria	790
1146	Ga0373933_0000159	3300035724	Bacteria	43953
1147	Ga0373933_0003951	3300035724	Bacteria	8186
1148	Ga0373933_0014603	3300035724	Bacteria	4371
1149	Ga0373933_0160749	3300035724	Bacteria	1426
1150	Ga0373933_0290949	3300035724	Bacteria	1056
1151	Ga0373933_0344105	3300035724	Bacteria	968
1152	Ga0373933_0369418	3300035724	Bacteria	933
1153	Ga0373947_0018604	3300035725	Bacteria	4000
1154	Ga0373947_0070284	3300035725	Bacteria	2145
1155	Ga0373947_0095267	3300035725	Bacteria	1863
1156	Ga0373947_0133790	3300035725	Bacteria	1585
1157	Ga0373947_0181412	3300035725	Bacteria	1371
1158	Ga0373947_0232187	3300035725	Bacteria	1215
1159	Ga0373947_0319306	3300035725	Bacteria	1038
1160	Ga0373947_0977929	3300035725	Bacteria	577
1161	Ga0373937_0043173	3300036401	Bacteria	4114
1162	Ga0373937_0051830	3300036401	Bacteria	3761
1163	Ga0373937_0091089	3300036401	Bacteria	2825
1164	Ga0373937_0171748	3300036401	Bacteria	2034
1165	Ga0373937_0351774	3300036401	Bacteria	1395
1166	Ga0373937_0426815	3300036401	Bacteria	1258
1167	Ga0373937_0489364	3300036401	Bacteria	1168
1168	Ga0373937_1636544	3300036401	Bacteria	591
1169	Ga0373925_0005473	3300037068	Bacteria	9454
1170	Ga0373925_0012714	3300037068	Bacteria	6097
1171	Ga0373925_0113139	3300037068	Bacteria	2099
1172	Ga0373925_0218040	3300037068	Bacteria	1522
1173	Ga0373925_0587147	3300037068	Bacteria	917
1174	Ga0373925_1037680	3300037068	Bacteria	675
1175	Ga0373925_1251256	3300037068	Bacteria	609
1176	Ga0373925_1349757	3300037068	Bacteria	584
1177	Ga0373925_1574644	3300037068	Bacteria	537
1178	Ga0373925_1674218	3300037068	Bacteria	520
1179	Ga0395899_0010740	3300037312	Bacteria	7020
1180	Ga0395899_0082079	3300037312	Bacteria	2345
1181	Ga0395899_0103593	3300037312	Bacteria	2052
1182	Ga0395900_0006177	3300037418	Bacteria	12511
1183	Ga0395900_0044631	3300037418	Bacteria	4566
1184	Ga0395900_0126335	3300037418	Bacteria	2623
1185	Ga0395900_0192776	3300037418	Bacteria	2066
1186	Ga0395900_0317639	3300037418	Bacteria	1539
1187	Ga0395900_0402705	3300037418	Bacteria	1332
1188	Ga0395900_0784567	3300037418	Bacteria	881
1189	Ga0395898_0008904	3300037466	Bacteria	10573
1190	Ga0395898_0022295	3300037466	Bacteria	6414
1191	Ga0395898_0025663	3300037466	Bacteria	5936
1192	Ga0395898_0032451	3300037466	Bacteria	5213
1193	Ga0395898_0047513	3300037466	Bacteria	4212
1194	Ga0395905_0099190	3300037471	Bacteria	2736
1195	Ga0436364_0227753	3300037853	Bacteria	763
1196	Ga0436364_0532278	3300037853	Bacteria	2240
1197	Ga0436364_0560944	3300037853	Bacteria	1037
1198	Ga0436364_1283998	3300037853	Bacteria	1222
1199	Ga0436364_1398857	3300037853	Bacteria	532
1200	Ga0436364_1450510	3300037853	Bacteria	533
1201	Ga0395901_0056670	3300038443	Bacteria	4077
1202	Ga0395901_0092167	3300038443	Bacteria	3172
1203	Ga0395901_0119653	3300038443	Bacteria	2767
1204	Ga0395901_0352190	3300038443	Bacteria	1519
1205	Ga0395901_0913343	3300038443	Bacteria	859
1206	Ga0436365_0353054	3300039437	Bacteria	1077
1207	Ga0436365_0376651	3300039437	Bacteria	2627
1208	Ga0436365_0514738	3300039437	Bacteria	22852
1209	Ga0436365_1004288	3300039437	Bacteria	898
1210	Ga0436365_1065976	3300039437	Bacteria	4159
1211	Ga0436365_1146080	3300039437	Bacteria	1305
1212	Ga0436365_1310157	3300039437	Bacteria	6429
1213	Ga0436365_1557769	3300039437	Bacteria	648
1214	Ga0436365_1848103	3300039437	Bacteria	2054
1215	Ga0436360_0258917	3300039438	Bacteria	612
1216	Ga0436360_0677590	3300039438	Bacteria	955
1217	Ga0436360_0694457	3300039438	Bacteria	866
1218	Ga0436361_0043816	3300039447	Bacteria	938
1219	Ga0436361_0319617	3300039447	Bacteria	3677
1220	Ga0436361_1061147	3300039447	Bacteria	2297
1221	Ga0436363_0502602	3300039450	Bacteria	1252
1222	Ga0436363_0546400	3300039450	Bacteria	1110
1223	Ga0436363_0636039	3300039450	Bacteria	1107
1224	Ga0436363_0719791	3300039450	Bacteria	1308
1225	Ga0436363_1005584	3300039450	Bacteria	767
1226	Ga0436363_1252148	3300039450	Bacteria	587
1227	Ga0436363_1554092	3300039450	Bacteria	808
1228	Ga0436363_1628687	3300039450	Bacteria	2949
1229	Ga0436363_1717547	3300039450	Bacteria	548
1230	Ga0436362_0819399	3300039453	Bacteria	4041
1231	Ga0436362_0836093	3300039453	Bacteria	2526
1232	Ga0439461_0068368	3300041410	Bacteria	819
1233	Ga0451793_0104807	3300041452	Bacteria	654
1234	Ga0451797_0352053	3300041453	Bacteria	1038
1235	Ga0451795_0756830	3300041456	Bacteria	815
1236	Ga0451795_0761934	3300041456	Bacteria	828
1237	Ga0451795_0858438	3300041456	Bacteria	1538
1238	Ga0451802_1063278	3300041460	Bacteria	2105
1239	Ga0451802_1196543	3300041460	Bacteria	580
1240	Ga0451804_0722157	3300041463	Bacteria	572
1241	Ga0451804_0920072	3300041463	Bacteria	1007
1242	Ga0451833_1099822	3300041491	Bacteria	590
1243	Ga0451835_0857824	3300041492	Bacteria	538
1244	Ga0451837_0764153	3300041494	Bacteria	667
1245	Ga0451839_0405707	3300041496	Bacteria	510
1246	Ga0451845_0254031	3300041501	Bacteria	771
1247	Ga0451849_0628187	3300041505	Bacteria	620
1248	Ga0451849_1162691	3300041505	Bacteria	837
1249	Ga0451851_0436017	3300041507	Bacteria	882
1250	Ga0451843_1251811	3300041509	Bacteria	921
1251	Ga0451853_0844485	3300041512	Bacteria	734
1252	Ga0439441_037605	3300042001	Bacteria	960
1253	Ga0439445_0104801	3300042004	Bacteria	804
1254	Ga0439448_0038578	3300042005	Bacteria	1538
1255	Ga0439450_010227	3300042008	Bacteria	1804
1256	Ga0439450_134806	3300042008	Bacteria	642
1257	Ga0439455_0043082	3300042012	Bacteria	1161
1258	Ga0439464_0157036	3300042439	Bacteria	713
1259	Ga0450893_0076350	3300042532	Bacteria	657
1260	Ga0439440_0161999	3300042993	Bacteria	646
1261	Ga0466969_0047101	3300044656	Bacteria	2135
1262	Ga0466969_0182532	3300044656	Bacteria	960
1263	Ga0466965_0314546	3300044683	Bacteria	852
1264	Ga0466966_0076378	3300044684	Bacteria	2092
1265	Ga0466966_0154750	3300044684	Bacteria	1397
1266	Ga0466966_0486578	3300044684	Bacteria	742
1267	Ga0466961_0065815	3300044693	Bacteria	2303
1268	Ga0466961_0820737	3300044693	Bacteria	555
1269	Ga0466963_0038916	3300044694	Bacteria	3112
1270	Ga0466963_0395685	3300044694	Bacteria	974
1271	Ga0466963_0805165	3300044694	Bacteria	663
1272	Ga0466964_0208899	3300044706	Bacteria	942
1273	Ga0466970_0048321	3300044765	Bacteria	2269
1274	Ga0466957_1111672	3300044842	Bacteria	570
1275	Ga0466959_0054917	3300045049	Bacteria	2909
1276	Ga0466959_0087303	3300045049	Bacteria	2244
1277	Ga0466958_0473174	3300045836	Bacteria	812
1278	Ga0466967_0333795	3300045976	Bacteria	1464
1279	Ga0466967_0936663	3300045976	Bacteria	862
1280	Ga0466967_1104768	3300045976	Bacteria	790
1281	Ga0466967_1404956	3300045976	Bacteria	695
1282	Ga0495617_061141	3300046452	Bacteria	1245
1283	Ga0495617_073030	3300046452	Bacteria	1127
1284	Ga0495592_0015700	3300046454	Bacteria	5746
1285	Ga0495592_0026278	3300046454	Bacteria	4414
1286	Ga0495592_0072587	3300046454	Bacteria	2504
1287	Ga0495592_0084903	3300046454	Bacteria	2283
1288	Ga0495592_0227945	3300046454	Bacteria	1242
1289	Ga0495592_0231284	3300046454	Bacteria	1231
1290	Ga0495592_0238937	3300046454	Bacteria	1206
1291	Ga0495603_0008490	3300046455	Bacteria	6205
1292	Ga0495603_0013031	3300046455	Bacteria	5026
1293	Ga0495603_0037141	3300046455	Bacteria	2923
1294	Ga0495603_0093112	3300046455	Bacteria	1761
1295	Ga0495603_0675842	3300046455	Bacteria	591
1296	Ga0495590_0443987	3300046457	Bacteria	501
1297	Ga0495629_0004438	3300046459	Bacteria	10512
1298	Ga0495629_0005450	3300046459	Bacteria	9489
1299	Ga0495629_0028196	3300046459	Bacteria	3986
1300	Ga0495629_0281091	3300046459	Bacteria	1142
1301	Ga0495629_0296285	3300046459	Bacteria	1108
1302	Ga0495629_0356641	3300046459	Bacteria	997
1303	Ga0495638_0115825	3300046460	Bacteria	1588
1304	Ga0495638_0255242	3300046460	Bacteria	964
1305	Ga0495638_0375960	3300046460	Bacteria	743
1306	Ga0495641_0026756	3300046461	Bacteria	2811
1307	Ga0495651_0002525	3300046462	Bacteria	14167
1308	Ga0495651_0011489	3300046462	Bacteria	6799
1309	Ga0495651_0037503	3300046462	Bacteria	3773
1310	Ga0495651_0075980	3300046462	Bacteria	2545
1311	Ga0495651_0130228	3300046462	Bacteria	1837
1312	Ga0495651_0283285	3300046462	Bacteria	1119
1313	Ga0495651_0319807	3300046462	Bacteria	1035
1314	Ga0495651_0664308	3300046462	Bacteria	652
1315	Ga0495653_0006566	3300046463	Bacteria	9546
1316	Ga0495653_0022990	3300046463	Bacteria	5041
1317	Ga0495653_0048926	3300046463	Bacteria	3260
1318	Ga0495653_0485981	3300046463	Bacteria	772
1319	Ga0495653_0578728	3300046463	Bacteria	692
1320	Ga0495653_0964105	3300046463	Bacteria	506
1321	Ga0495650_0275497	3300046471	Bacteria	567
1322	Ga0495580_0001797	3300046472	Bacteria	18844
1323	Ga0495580_0051628	3300046472	Bacteria	2907
1324	Ga0495580_0254846	3300046472	Bacteria	1201
1325	Ga0495582_0001266	3300046473	Bacteria	14206
1326	Ga0495582_0073842	3300046473	Bacteria	1888
1327	Ga0495582_0427912	3300046473	Bacteria	764
1328	Ga0495582_0592152	3300046473	Bacteria	642
1329	Ga0495605_0142266	3300046474	Bacteria	1075
1330	Ga0495605_0196860	3300046474	Bacteria	880
1331	Ga0495605_0251024	3300046474	Bacteria	757
1332	Ga0495639_0001127	3300046475	Bacteria	12059
1333	Ga0495639_0028125	3300046475	Bacteria	2491
1334	Ga0495639_0183330	3300046475	Bacteria	1020
1335	Ga0495639_0250035	3300046475	Bacteria	876
1336	Ga0495662_0118406	3300046476	Bacteria	1299
1337	Ga0495662_0254964	3300046476	Bacteria	864
1338	Ga0495662_0462572	3300046476	Bacteria	622
1339	Ga0495662_0550702	3300046476	Bacteria	565
1340	Ga0495662_0653275	3300046476	Bacteria	513
1341	Ga0495664_0051810	3300046477	Bacteria	2437
1342	Ga0495664_0051954	3300046477	Bacteria	2434
1343	Ga0495664_0187485	3300046477	Bacteria	1254
1344	Ga0495664_0191760	3300046477	Bacteria	1239
1345	Ga0495664_0286786	3300046477	Bacteria	994
1346	Ga0495664_0595431	3300046477	Bacteria	657
1347	Ga0495664_0804774	3300046477	Bacteria	552
1348	Ga0495664_0843315	3300046477	Bacteria	537
1349	Ga0495584_0096090	3300046491	Bacteria	1496
1350	Ga0495584_0309949	3300046491	Bacteria	802
1351	Ga0495584_0644294	3300046491	Bacteria	540
1352	Ga0495585_0118479	3300046492	Bacteria	1402
1353	Ga0495594_0001151	3300046499	Bacteria	13816
1354	Ga0495594_0050733	3300046499	Bacteria	2283
1355	Ga0495594_0457433	3300046499	Bacteria	725
1356	Ga0495594_0651163	3300046499	Bacteria	596
1357	Ga0495596_0131412	3300046500	Bacteria	971
1358	Ga0495596_0332200	3300046500	Bacteria	591
1359	Ga0495596_0337070	3300046500	Bacteria	587
1360	Ga0495607_0028444	3300046501	Bacteria	3449
1361	Ga0495607_0227399	3300046501	Bacteria	909
1362	Ga0495583_0030304	3300046506	Bacteria	2636
1363	Ga0495606_0003130	3300046507	Bacteria	17951
1364	Ga0495606_0046592	3300046507	Bacteria	2864
1365	Ga0495606_0091462	3300046507	Bacteria	1870
1366	Ga0495606_0136725	3300046507	Bacteria	1450
1367	Ga0495606_0178901	3300046507	Bacteria	1224
1368	Ga0495606_0205552	3300046507	Bacteria	1119
1369	Ga0495606_0378751	3300046507	Bacteria	743
1370	Ga0495606_0427824	3300046507	Bacteria	683
1371	Ga0495608_0013607	3300046511	Bacteria	5643
1372	Ga0495608_0044351	3300046511	Bacteria	2968
1373	Ga0495608_0114554	3300046511	Bacteria	1731
1374	Ga0495608_0246568	3300046511	Bacteria	1115
1375	Ga0495608_0338120	3300046511	Bacteria	928
1376	Ga0495608_0350531	3300046511	Bacteria	908
1377	Ga0495610_0074094	3300046512	Bacteria	1580
1378	Ga0495610_0110913	3300046512	Bacteria	1215
1379	Ga0495618_0039698	3300046514	Bacteria	2960
1380	Ga0495618_0043612	3300046514	Bacteria	2830
1381	Ga0495618_0127082	3300046514	Bacteria	1632
1382	Ga0495620_0021668	3300046515	Bacteria	3116
1383	Ga0495620_0040572	3300046515	Bacteria	2047
1384	Ga0495628_0035169	3300046516	Bacteria	4027
1385	Ga0495628_0035306	3300046516	Bacteria	4019
1386	Ga0495628_0038574	3300046516	Bacteria	3823
1387	Ga0495628_0177567	3300046516	Bacteria	1612
1388	Ga0495628_0674431	3300046516	Bacteria	732
1389	Ga0495628_0852394	3300046516	Bacteria	635
1390	Ga0495630_0324348	3300046517	Bacteria	1177
1391	Ga0495631_0115415	3300046518	Bacteria	1154
1392	Ga0495632_0030316	3300046519	Bacteria	2809
1393	Ga0495632_0148436	3300046519	Bacteria	1085
1394	Ga0495632_0303492	3300046519	Bacteria	707
1395	Ga0495637_0048047	3300046520	Bacteria	1799
1396	Ga0495643_0222483	3300046522	Bacteria	894
1397	Ga0495648_0006509	3300046524	Bacteria	9520
1398	Ga0495648_0066979	3300046524	Bacteria	2102
1399	Ga0495648_0092046	3300046524	Bacteria	1694
1400	Ga0495648_0150895	3300046524	Bacteria	1212
1401	Ga0495648_0331373	3300046524	Bacteria	702
1402	Ga0495666_0049090	3300046526	Bacteria	2031
1403	Ga0495666_0441002	3300046526	Bacteria	584
1404	Ga0495642_0170985	3300046528	Bacteria	944
1405	Ga0495642_0289871	3300046528	Bacteria	717
1406	Ga0495652_0033314	3300046529	Bacteria	4498
1407	Ga0495652_0077957	3300046529	Bacteria	2744
1408	Ga0495652_0091143	3300046529	Bacteria	2492
1409	Ga0495652_0146359	3300046529	Bacteria	1851
1410	Ga0495652_0209796	3300046529	Bacteria	1471
1411	Ga0495652_0306281	3300046529	Bacteria	1153
1412	Ga0495652_0548258	3300046529	Bacteria	795
1413	Ga0495652_0695467	3300046529	Bacteria	685
1414	Ga0495652_0812150	3300046529	Bacteria	622
1415	Ga0495654_0231632	3300046530	Bacteria	777
1416	Ga0495654_0300455	3300046530	Bacteria	655
1417	Ga0495665_0000387	3300046531	Bacteria	22327
1418	Ga0495665_0081019	3300046531	Bacteria	1707
1419	Ga0495665_0225382	3300046531	Bacteria	969
1420	Ga0495665_0319718	3300046531	Bacteria	793
1421	Ga0495640_0007176	3300046533	Bacteria	8776
1422	Ga0495640_0014256	3300046533	Bacteria	6021
1423	Ga0495640_0019657	3300046533	Bacteria	4982
1424	Ga0495640_0024804	3300046533	Bacteria	4357
1425	Ga0495640_0082038	3300046533	Bacteria	2143
1426	Ga0495640_0797998	3300046533	Bacteria	563
1427	Ga0495586_0147667	3300046535	Bacteria	1322
1428	Ga0495586_0423790	3300046535	Bacteria	766
1429	Ga0495587_0016717	3300046536	Bacteria	4563
1430	Ga0495587_0085150	3300046536	Bacteria	1830
1431	Ga0495587_0161103	3300046536	Bacteria	1277
1432	Ga0495587_0180707	3300046536	Bacteria	1196
1433	Ga0495587_0497535	3300046536	Bacteria	674
1434	Ga0495609_0115269	3300046538	Bacteria	1158
1435	Ga0495609_0121888	3300046538	Bacteria	1120
1436	Ga0495609_0240796	3300046538	Bacteria	747
1437	Ga0495621_0462332	3300046539	Bacteria	544
1438	Ga0495597_0114943	3300046542	Bacteria	1126
1439	Ga0495645_0041499	3300046543	Bacteria	3355
1440	Ga0495645_0080936	3300046543	Bacteria	2330
1441	Ga0495645_0099462	3300046543	Bacteria	2069
1442	Ga0495645_0131153	3300046543	Bacteria	1756
1443	Ga0495645_0255342	3300046543	Bacteria	1163
1444	Ga0495645_0607776	3300046543	Bacteria	672
1445	Ga0495645_0899777	3300046543	Bacteria	525
1446	Ga0495622_0004221	3300046557	Bacteria	6698
1447	Ga0495622_0021505	3300046557	Bacteria	3003
1448	Ga0495622_0115989	3300046557	Bacteria	1224
1449	Ga0495667_0023438	3300046559	Bacteria	4159
1450	Ga0495667_0025085	3300046559	Bacteria	4019
1451	Ga0495667_0043546	3300046559	Bacteria	2974
1452	Ga0495667_0087336	3300046559	Bacteria	2022
1453	Ga0495667_0474713	3300046559	Bacteria	785
1454	Ga0495656_0039358	3300046615	Bacteria	1963
1455	Ga0495656_0651019	3300046615	Bacteria	565
1456	Ga0495656_0753906	3300046615	Bacteria	525
1457	Ga0495656_0784496	3300046615	Bacteria	514
1458	Ga0495668_0077059	3300046616	Bacteria	1830
1459	Ga0495668_0183810	3300046616	Bacteria	1145
1460	Ga0495668_0363694	3300046616	Bacteria	794
1461	Ga0495668_0777618	3300046616	Bacteria	530
1462	Ga0495634_0056589	3300046642	Bacteria	2619
1463	Ga0495634_0061779	3300046642	Bacteria	2489
1464	Ga0495634_0082626	3300046642	Bacteria	2098
1465	Ga0495634_0166715	3300046642	Bacteria	1386
1466	Ga0495634_0212457	3300046642	Bacteria	1197
1467	Ga0495634_0248938	3300046642	Bacteria	1088
1468	Ga0495634_0315933	3300046642	Bacteria	941
1469	Ga0495634_0723220	3300046642	Bacteria	571
1470	Ga0495634_0756860	3300046642	Bacteria	556
1471	Ga0495611_0031706	3300046648	Bacteria	2328
1472	Ga0495611_0044474	3300046648	Bacteria	1986
1473	Ga0495611_0047036	3300046648	Bacteria	1935
1474	Ga0495611_0154375	3300046648	Bacteria	1072
1475	Ga0495611_0200585	3300046648	Bacteria	930
1476	Ga0495625_0080624	3300046660	Bacteria	2266
1477	Ga0495625_0111692	3300046660	Bacteria	1867
1478	Ga0495625_0361769	3300046660	Bacteria	914
1479	Ga0495625_0493425	3300046660	Bacteria	750
1480	Ga0495625_0895049	3300046660	Bacteria	509
1481	Ga0495635_0007958	3300046663	Bacteria	7409
1482	Ga0495635_0009875	3300046663	Bacteria	6670
1483	Ga0495635_0025778	3300046663	Bacteria	4095
1484	Ga0495635_0065003	3300046663	Bacteria	2503
1485	Ga0495635_0129827	3300046663	Bacteria	1718
1486	Ga0495635_0230994	3300046663	Bacteria	1250
1487	Ga0495635_0588159	3300046663	Bacteria	727
1488	Ga0495661_0007907	3300046665	Bacteria	7386
1489	Ga0495661_0416481	3300046665	Bacteria	651
1490	Ga0495588_0019891	3300046674	Bacteria	3294
1491	Ga0495588_0072753	3300046674	Bacteria	1789
1492	Ga0495588_0208042	3300046674	Bacteria	1033
1493	Ga0495657_0002717	3300046675	Bacteria	14762
1494	Ga0495657_0013118	3300046675	Bacteria	6125
1495	Ga0495657_0018893	3300046675	Bacteria	4981
1496	Ga0495657_0097535	3300046675	Bacteria	1876
1497	Ga0495657_0144106	3300046675	Bacteria	1483
1498	Ga0495657_0188652	3300046675	Bacteria	1261
1499	Ga0495657_0313653	3300046675	Bacteria	933
1500	Ga0495657_0472416	3300046675	Bacteria	733
1501	Ga0495599_0072048	3300046678	Bacteria	2156
1502	Ga0495599_0123490	3300046678	Bacteria	1609
1503	Ga0495599_0516124	3300046678	Bacteria	702
1504	Ga0495599_0593477	3300046678	Bacteria	645
1505	Ga0495623_0047712	3300046679	Bacteria	2718
1506	Ga0495623_0134542	3300046679	Bacteria	1476
1507	Ga0495623_0194029	3300046679	Bacteria	1171
1508	Ga0495623_0255166	3300046679	Bacteria	984
1509	Ga0495623_0286088	3300046679	Bacteria	915
1510	Ga0495623_0332354	3300046679	Bacteria	832
1511	Ga0495623_0334336	3300046679	Bacteria	829
1512	Ga0495646_0014421	3300046680	Bacteria	5025
1513	Ga0495646_0024478	3300046680	Bacteria	3802
1514	Ga0495646_0153634	3300046680	Bacteria	1278
1515	Ga0495646_0255212	3300046680	Bacteria	938
1516	Ga0495646_0477911	3300046680	Bacteria	641
1517	Ga0495647_0007713	3300046681	Bacteria	3614
1518	Ga0495647_0120768	3300046681	Bacteria	1102
1519	Ga0495647_0566651	3300046681	Bacteria	532
1520	Ga0495658_0004691	3300046683	Bacteria	6720
1521	Ga0495658_0252766	3300046683	Bacteria	1109
1522	Ga0495658_0384357	3300046683	Bacteria	894
1523	Ga0495658_0483038	3300046683	Bacteria	792
1524	Ga0495669_0128710	3300046684	Bacteria	1191
1525	Ga0495669_0390233	3300046684	Bacteria	674
1526	Ga0495613_0014064	3300046689	Bacteria	5938
1527	Ga0495613_0021064	3300046689	Bacteria	4860
1528	Ga0495613_0390296	3300046689	Bacteria	951
1529	Ga0495613_0485747	3300046689	Bacteria	833
1530	Ga0495613_0519865	3300046689	Bacteria	800
1531	Ga0495613_0762518	3300046689	Bacteria	633
1532	Ga0495624_0005689	3300046690	Bacteria	8948
1533	Ga0495624_0023741	3300046690	Bacteria	4042
1534	Ga0495624_0317464	3300046690	Bacteria	938
1535	Ga0495670_0514360	3300046691	Bacteria	650
1536	Ga0495671_0146379	3300046692	Bacteria	1150
1537	Ga0495671_0179162	3300046692	Bacteria	1029
1538	Ga0495671_0328730	3300046692	Bacteria	734
1539	Ga0495649_0094492	3300046694	Bacteria	1591
1540	Ga0495649_0116342	3300046694	Bacteria	1415
1541	Ga0495649_0291469	3300046694	Bacteria	832
1542	Ga0495589_0017902	3300046794	Bacteria	3634
1543	Ga0495589_0544834	3300046794	Bacteria	529
1544	Ga0495600_0000716	3300046809	Bacteria	17441
1545	Ga0495600_0039472	3300046809	Bacteria	3074
1546	Ga0495600_0057783	3300046809	Bacteria	2534
1547	Ga0495600_0066959	3300046809	Bacteria	2348
1548	Ga0495600_0169519	3300046809	Bacteria	1409
1549	Ga0495600_0851069	3300046809	Bacteria	541
1550	Ga0495581_0001283	3300047315	Bacteria	13848
1551	Ga0495581_0048546	3300047315	Bacteria	2451
1552	Ga0495581_0071672	3300047315	Bacteria	2005
1553	Ga0495581_0214943	3300047315	Bacteria	1124
1554	Ga0495581_0391619	3300047315	Bacteria	811
1555	Ga0495604_0020153	3300047317	Bacteria	5328
1556	Ga0495604_0050675	3300047317	Bacteria	3222
1557	Ga0495604_0062553	3300047317	Bacteria	2842
1558	Ga0495604_0090277	3300047317	Bacteria	2276
1559	Ga0495604_0101759	3300047317	Bacteria	2110
1560	Ga0495604_0273857	3300047317	Bacteria	1142
1561	Ga0495604_0364377	3300047317	Bacteria	958
1562	Ga0495604_0816141	3300047317	Bacteria	587
1563	Ga0495674_0005092	3300047319	Bacteria	12625
1564	Ga0495674_0021169	3300047319	Bacteria	6015
1565	Ga0495674_0050698	3300047319	Bacteria	3662
1566	Ga0495674_0350557	3300047319	Bacteria	1198
1567	Ga0495674_0383131	3300047319	Bacteria	1137
1568	Ga0495674_0407360	3300047319	Bacteria	1097
1569	Ga0495672_0014319	3300047320	Bacteria	5436
1570	Ga0495672_0129178	3300047320	Bacteria	1331
1571	Ga0495672_0214676	3300047320	Bacteria	953
1572	Ga0495672_0243605	3300047320	Bacteria	876
1573	Ga0495676_0016119	3300047321	Bacteria	6639
1574	Ga0495676_0051671	3300047321	Bacteria	3286
1575	Ga0495680_0008078	3300047322	Bacteria	9594
1576	Ga0495680_0011117	3300047322	Bacteria	7991
1577	Ga0495680_0092338	3300047322	Bacteria	2267
1578	Ga0495680_0124195	3300047322	Bacteria	1903
1579	Ga0495680_0497733	3300047322	Bacteria	828
1580	Ga0495683_0045580	3300047323	Bacteria	2203
1581	Ga0495683_0111677	3300047323	Bacteria	1304
1582	Ga0495683_0358498	3300047323	Bacteria	614
1583	Ga0495683_0400170	3300047323	Bacteria	571
1584	Ga0495687_114119	3300047443	Bacteria	987
1585	Ga0495687_123504	3300047443	Bacteria	930
1586	Ga0495675_0002561	3300047444	Bacteria	10889
1587	Ga0495675_0020996	3300047444	Bacteria	4157
1588	Ga0495675_0025843	3300047444	Bacteria	3742
1589	Ga0495675_0085852	3300047444	Bacteria	1978
1590	Ga0495675_0218322	3300047444	Bacteria	1155
1591	Ga0495677_0072952	3300047445	Bacteria	1280
1592	Ga0495677_0264783	3300047445	Bacteria	673
1593	Ga0495677_0276310	3300047445	Bacteria	659
1594	Ga0495673_0098874	3300047469	Bacteria	1182
1595	Ga0495673_0102866	3300047469	Bacteria	1152
1596	Ga0495681_0299519	3300047470	Bacteria	623
1597	Ga0495684_0015756	3300047471	Bacteria	5816
1598	Ga0495684_0030092	3300047471	Bacteria	4168
1599	Ga0495684_0122413	3300047471	Bacteria	1958
1600	Ga0495684_0143674	3300047471	Bacteria	1788
1601	Ga0495684_0320788	3300047471	Bacteria	1108
1602	Ga0495684_0455179	3300047471	Bacteria	888
1603	Ga0495684_0889380	3300047471	Bacteria	575
1604	Ga0495684_0961738	3300047471	Bacteria	545
1605	Ga0495686_0016846	3300047472	Bacteria	4942
1606	Ga0495686_0020174	3300047472	Bacteria	4447
1607	Ga0495686_0072469	3300047472	Bacteria	2118
1608	Ga0495686_0099238	3300047472	Bacteria	1758
1609	Ga0495686_0166096	3300047472	Bacteria	1286
1610	Ga0495686_0202004	3300047472	Bacteria	1140
1611	Ga0495686_0333764	3300047472	Bacteria	828
1612	Ga0495686_0349621	3300047472	Bacteria	804
1613	Ga0495593_0001105	3300047673	Bacteria	15740
1614	Ga0495593_0003538	3300047673	Bacteria	9347
1615	Ga0495593_0067409	3300047673	Bacteria	1863
1616	Ga0495593_0097452	3300047673	Bacteria	1510
1617	Ga0495593_0315138	3300047673	Bacteria	782
1618	Ga0495593_0418314	3300047673	Bacteria	670
1619	Ga0495593_0539323	3300047673	Bacteria	585
1620	Ga0495602_0018673	3300048088	Bacteria	6913
1621	Ga0495602_0081114	3300048088	Bacteria	2729
1622	Ga0495602_0214632	3300048088	Bacteria	1457
1623	Ga0495602_0251617	3300048088	Bacteria	1316
1624	Ga0495602_0774221	3300048088	Bacteria	646
1625	Ga0495602_1001104	3300048088	Bacteria	551
1626	Ga0495614_0053761	3300048089	Bacteria	1727
1627	Ga0496100_0005331	3300048903	Bacteria	6912
1628	Ga0496100_0195799	3300048903	Bacteria	1470
1629	Ga0496100_0286238	3300048903	Bacteria	1230
1630	Ga0496100_0378342	3300048903	Bacteria	1075
1631	Ga0496100_1024815	3300048903	Bacteria	650
1632	Ga0496101_0014003	3300048904	Bacteria	5386
1633	Ga0496101_0100615	3300048904	Bacteria	2163
1634	Ga0496101_0232142	3300048904	Bacteria	1434
1635	Ga0496101_0664693	3300048904	Bacteria	823
1636	Ga0496101_0859981	3300048904	Bacteria	714
1637	Ga0496101_0969444	3300048904	Bacteria	669
1638	Ga0496102_0012227	3300048905	Bacteria	7423
1639	Ga0496102_0012429	3300048905	Bacteria	7367
1640	Ga0496102_0043423	3300048905	Bacteria	4076
1641	Ga0496102_0174423	3300048905	Bacteria	2024
1642	Ga0496102_0577102	3300048905	Bacteria	1047
1643	Ga0496102_0781907	3300048905	Bacteria	877
1644	Ga0496102_1863245	3300048905	Bacteria	518
1645	Ga0496103_0056098	3300048906	Bacteria	2444
1646	Ga0496103_0329729	3300048906	Bacteria	982
1647	Ga0496104_0009476	3300048907	Bacteria	8665
1648	Ga0496104_0016178	3300048907	Bacteria	6771
1649	Ga0496104_0041599	3300048907	Bacteria	4310
1650	Ga0496104_0088563	3300048907	Bacteria	2957
1651	Ga0496104_0129469	3300048907	Bacteria	2424
1652	Ga0496104_0167850	3300048907	Bacteria	2104
1653	Ga0496104_0297573	3300048907	Bacteria	1526
1654	Ga0496104_0363031	3300048907	Bacteria	1361
1655	Ga0496105_0005739	3300048908	Bacteria	9453
1656	Ga0496105_0021062	3300048908	Bacteria	5273
1657	Ga0496105_0416560	3300048908	Bacteria	1064
1658	Ga0496105_0473160	3300048908	Bacteria	987
1659	Ga0496105_1153117	3300048908	Bacteria	573
1660	Ga0496105_1240576	3300048908	Bacteria	547
1661	Ga0496106_0012530	3300048909	Bacteria	6261
1662	Ga0496106_0016691	3300048909	Bacteria	5432
1663	Ga0496106_0018266	3300048909	Bacteria	5184
1664	Ga0496106_0020292	3300048909	Bacteria	4931
1665	Ga0496106_0051085	3300048909	Bacteria	3117
1666	Ga0496106_0174505	3300048909	Bacteria	1705
1667	Ga0496106_0393301	3300048909	Bacteria	1114
1668	Ga0496106_0471672	3300048909	Bacteria	1008
1669	Ga0496106_0537785	3300048909	Bacteria	938
1670	Ga0496106_0743425	3300048909	Bacteria	780
1671	Ga0496107_0003304	3300048910	Bacteria	10772
1672	Ga0496107_0008082	3300048910	Bacteria	7265
1673	Ga0496107_0013843	3300048910	Bacteria	5639
1674	Ga0496107_0043644	3300048910	Bacteria	3221
1675	Ga0496107_0152111	3300048910	Bacteria	1712
1676	Ga0496107_0684643	3300048910	Bacteria	755
1677	Ga0496108_0007942	3300048911	Bacteria	8601
1678	Ga0496108_0021225	3300048911	Bacteria	5336
1679	Ga0496108_0029934	3300048911	Bacteria	4512
1680	Ga0496108_0032611	3300048911	Bacteria	4327
1681	Ga0496108_0628994	3300048911	Bacteria	934
1682	Ga0496108_0748692	3300048911	Bacteria	845
1683	Ga0496108_0798413	3300048911	Bacteria	814
1684	Ga0496108_0887175	3300048911	Bacteria	766
1685	Ga0496108_1350394	3300048911	Bacteria	598
1686	Ga0496109_0003687	3300048912	Bacteria	12803
1687	Ga0496109_0025306	3300048912	Bacteria	5287
1688	Ga0496109_0040943	3300048912	Bacteria	4197
1689	Ga0496109_0067546	3300048912	Bacteria	3275
1690	Ga0496109_0085896	3300048912	Bacteria	2905
1691	Ga0496109_0154677	3300048912	Bacteria	2148
1692	Ga0496109_0544166	3300048912	Bacteria	1095
1693	Ga0496109_0687921	3300048912	Bacteria	960
1694	Ga0496109_1056847	3300048912	Bacteria	749
1695	Ga0496110_0004964	3300048913	Bacteria	10388
1696	Ga0496110_0034353	3300048913	Bacteria	4392
1697	Ga0496110_0077171	3300048913	Bacteria	2963
1698	Ga0496110_0354656	3300048913	Bacteria	1336
1699	Ga0496110_0697498	3300048913	Bacteria	916
1700	Ga0496111_0008299	3300048914	Bacteria	6869
1701	Ga0496111_0098884	3300048914	Bacteria	2142
1702	Ga0496111_0232459	3300048914	Bacteria	1369
1703	Ga0496111_0410631	3300048914	Bacteria	1000
1704	Ga0496111_0421955	3300048914	Bacteria	985
1705	Ga0496111_0675582	3300048914	Bacteria	752
1706	Ga0496111_0960695	3300048914	Bacteria	613
1707	Ga0496111_1325230	3300048914	Bacteria	506
1708	Ga0496112_0000206	3300048915	Bacteria	38420
1709	Ga0496112_0005422	3300048915	Bacteria	11029
1710	Ga0496112_0008279	3300048915	Bacteria	9305
1711	Ga0496112_0064891	3300048915	Bacteria	3603
1712	Ga0496112_0084595	3300048915	Bacteria	3137
1713	Ga0496112_0136775	3300048915	Bacteria	2420
1714	Ga0496112_0269342	3300048915	Bacteria	1651
1715	Ga0496112_0399111	3300048915	Bacteria	1315
1716	Ga0496112_0408342	3300048915	Bacteria	1297
1717	Ga0496112_0703365	3300048915	Bacteria	938
1718	Ga0496113_0016314	3300048916	Bacteria	5128
1719	Ga0496113_0030553	3300048916	Bacteria	3900
1720	Ga0496113_0099729	3300048916	Bacteria	2249
1721	Ga0496113_0118733	3300048916	Bacteria	2065
1722	Ga0496114_0019967	3300048917	Bacteria	5435
1723	Ga0496114_0024984	3300048917	Bacteria	4879
1724	Ga0496114_0124554	3300048917	Bacteria	2220
1725	Ga0496114_0127181	3300048917	Bacteria	2197
1726	Ga0496114_0172853	3300048917	Bacteria	1884
1727	Ga0496114_0198015	3300048917	Bacteria	1759
1728	Ga0496114_0594559	3300048917	Bacteria	976
1729	Ga0496114_0762789	3300048917	Bacteria	845
1730	Ga0496114_1021961	3300048917	Bacteria	710
1731	Ga0496114_1618578	3300048917	Bacteria	536
1732	Ga0496115_0001377	3300048918	Bacteria	17366
1733	Ga0496115_0044845	3300048918	Bacteria	3529
1734	Ga0496115_0049168	3300048918	Bacteria	3374
1735	Ga0496115_0093858	3300048918	Bacteria	2454
1736	Ga0496115_0117827	3300048918	Bacteria	2184
1737	Ga0496115_0147833	3300048918	Bacteria	1940
1738	Ga0496115_0148988	3300048918	Bacteria	1931
1739	Ga0496115_0162626	3300048918	Bacteria	1845
1740	Ga0496115_0164760	3300048918	Bacteria	1833
1741	Ga0496115_0167099	3300048918	Bacteria	1819
1742	Ga0496115_0227314	3300048918	Bacteria	1539
1743	Ga0496115_0372377	3300048918	Bacteria	1162
1744	Ga0496115_0509654	3300048918	Bacteria	966
1745	Ga0496116_0017030	3300048919	Bacteria	5661
1746	Ga0496116_0121846	3300048919	Bacteria	1507
1747	Ga0496117_0034062	3300048920	Bacteria	3844
1748	Ga0496117_0051689	3300048920	Bacteria	2902
1749	Ga0496117_0085163	3300048920	Bacteria	2059
1750	Ga0496117_0120350	3300048920	Bacteria	1614
1751	Ga0496117_0130331	3300048920	Bacteria	1525
1752	Ga0496117_0174167	3300048920	Bacteria	1245
1753	Ga0496118_0013465	3300048921	Bacteria	7732
1754	Ga0496118_0019942	3300048921	Bacteria	5967
1755	Ga0496118_0083221	3300048921	Bacteria	2238
1756	Ga0496118_0227580	3300048921	Bacteria	1079
1757	Ga0496118_0252604	3300048921	Bacteria	1001
1758	Ga0496119_0041768	3300048922	Bacteria	2915
1759	Ga0496119_0046117	3300048922	Bacteria	2725
1760	Ga0496119_0071371	3300048922	Bacteria	2033
1761	Ga0496120_0008077	3300048923	Bacteria	7735
1762	Ga0496120_0058495	3300048923	Bacteria	2165
1763	Ga0496120_0066772	3300048923	Bacteria	1988
1764	Ga0496121_0001934	3300048924	Bacteria	33033
1765	Ga0496121_0005854	3300048924	Bacteria	15573
1766	Ga0496121_0020191	3300048924	Bacteria	6610
1767	Ga0496121_0039869	3300048924	Bacteria	4130
1768	Ga0496121_0045204	3300048924	Bacteria	3786
1769	Ga0496121_0051282	3300048924	Bacteria	3476
1770	Ga0496121_0070819	3300048924	Bacteria	2807
1771	Ga0496121_0076065	3300048924	Bacteria	2678
1772	Ga0496121_0097429	3300048924	Bacteria	2279
1773	Ga0496121_0104300	3300048924	Bacteria	2179
1774	Ga0496121_0126237	3300048924	Bacteria	1923
1775	Ga0496121_0156239	3300048924	Bacteria	1673
1776	Ga0496121_0167833	3300048924	Bacteria	1598
1777	Ga0496121_0250121	3300048924	Bacteria	1230
1778	Ga0496121_0911807	3300048924	Bacteria	504
1779	Ga0496122_0278679	3300048925	Bacteria	915
1780	Ga0496123_0079157	3300048926	Bacteria	2010
1781	Ga0496123_0098906	3300048926	Bacteria	1704
1782	Ga0496123_0330768	3300048926	Bacteria	715
1783	Ga0496123_0374620	3300048926	Bacteria	655
1784	Ga0496124_0034959	3300048927	Bacteria	4400
1785	Ga0496124_0083548	3300048927	Bacteria	2619
1786	Ga0496124_0084852	3300048927	Bacteria	2596
1787	Ga0496124_0116077	3300048927	Bacteria	2147
1788	Ga0496124_0172218	3300048927	Bacteria	1675
1789	Ga0496124_0226487	3300048927	Bacteria	1401
1790	Ga0496124_0330913	3300048927	Bacteria	1086
1791	Ga0496124_0352413	3300048927	Bacteria	1041
1792	Ga0496124_0685247	3300048927	Bacteria	652
1793	Ga0496125_0000063	3300048928	Bacteria	250260
1794	Ga0496125_0000829	3300048928	Bacteria	49885
1795	Ga0496125_0029627	3300048928	Bacteria	4915
1796	Ga0496125_0110232	3300048928	Bacteria	1996
1797	Ga0496125_0141449	3300048928	Bacteria	1672
1798	Ga0496125_0210012	3300048928	Bacteria	1265
1799	Ga0496125_0371983	3300048928	Bacteria	845
1800	Ga0496125_0399916	3300048928	Bacteria	803
1801	Ga0496125_0460590	3300048928	Bacteria	726
1802	Ga0496126_0005845	3300048929	Bacteria	13899
1803	Ga0496126_0008064	3300048929	Bacteria	11410
1804	Ga0496126_0010991	3300048929	Bacteria	9418
1805	Ga0496126_0022305	3300048929	Bacteria	6163
1806	Ga0496126_0042276	3300048929	Bacteria	4209
1807	Ga0496126_0043155	3300048929	Bacteria	4161
1808	Ga0496126_0044994	3300048929	Bacteria	4060
1809	Ga0496126_0047811	3300048929	Bacteria	3915
1810	Ga0496126_0073326	3300048929	Bacteria	3043
1811	Ga0496126_0081826	3300048929	Bacteria	2854
1812	Ga0496126_0109095	3300048929	Bacteria	2412
1813	Ga0496126_0126259	3300048929	Bacteria	2214
1814	Ga0496126_0192457	3300048929	Bacteria	1727
1815	Ga0496126_0216005	3300048929	Bacteria	1613
1816	Ga0496126_0222101	3300048929	Bacteria	1586
1817	Ga0496126_0254677	3300048929	Bacteria	1461
1818	Ga0496126_0269799	3300048929	Bacteria	1412
1819	Ga0496126_0271167	3300048929	Bacteria	1408
1820	Ga0496126_0347215	3300048929	Bacteria	1214
1821	Ga0496126_0449399	3300048929	Bacteria	1037
1822	Ga0496126_0610025	3300048929	Bacteria	859
1823	Ga0496126_0808625	3300048929	Bacteria	718
1824	Ga0496126_0940616	3300048929	Bacteria	652
1825	Ga0496126_1031009	3300048929	Bacteria	615
1826	Ga0496126_1120475	3300048929	Bacteria	583
1827	Ga0495682_0029570	3300049460	Bacteria	2030
1828	Ga0495682_0204085	3300049460	Bacteria	701
1829	Ga0495682_0209688	3300049460	Bacteria	690
1830	Ga0495682_0229754	3300049460	Bacteria	657
1831	Ga0495682_0326270	3300049460	Bacteria	541
1832	Ga0501031_0000296	3300049568	Bacteria	28394
1833	Ga0501031_0095896	3300049568	Bacteria	1935
1834	Ga0501031_0156920	3300049568	Bacteria	1487
1835	Ga0501031_0772551	3300049568	Bacteria	616
1836	Ga0501031_0827063	3300049568	Bacteria	593
1837	Ga0501032_0000244	3300049569	Bacteria	45114
1838	Ga0501032_0032691	3300049569	Bacteria	3564
1839	Ga0501032_0047690	3300049569	Bacteria	2892
1840	Ga0501032_0055397	3300049569	Bacteria	2667
1841	Ga0501032_0064708	3300049569	Bacteria	2447
1842	Ga0501032_0238099	3300049569	Bacteria	1183
1843	Ga0501032_0638046	3300049569	Bacteria	677
1844	Ga0501032_0700202	3300049569	Bacteria	642
1845	Ga0501032_1023783	3300049569	Bacteria	518
1846	Ga0501032_1093992	3300049569	Bacteria	500
1847	Ga0501033_0001015	3300049570	Bacteria	25486
1848	Ga0501033_0007360	3300049570	Bacteria	8571
1849	Ga0501033_0203747	3300049570	Bacteria	1412
1850	Ga0501033_0248365	3300049570	Bacteria	1261
1851	Ga0501033_0482033	3300049570	Bacteria	859
1852	Ga0501033_0546705	3300049570	Bacteria	798
1853	Ga0501033_0596289	3300049570	Bacteria	758
1854	Ga0501034_0001010	3300049571	Bacteria	40327
1855	Ga0501034_0012100	3300049571	Bacteria	8922
1856	Ga0501034_0013977	3300049571	Bacteria	8262
1857	Ga0501034_0085942	3300049571	Bacteria	3146
1858	Ga0501034_0154116	3300049571	Bacteria	2272
1859	Ga0501034_0301904	3300049571	Bacteria	1538
1860	Ga0501034_0353303	3300049571	Bacteria	1398
1861	Ga0501034_0524455	3300049571	Bacteria	1096
1862	Ga0501034_0749578	3300049571	Bacteria	872
1863	Ga0501034_0753674	3300049571	Bacteria	869
1864	Ga0501034_1031719	3300049571	Bacteria	705
1865	Ga0501034_1179272	3300049571	Bacteria	645
1866	Ga0501036_0000405	3300049572	Bacteria	30399
1867	Ga0501036_0011247	3300049572	Bacteria	7404
1868	Ga0501036_0047043	3300049572	Bacteria	3653
1869	Ga0501036_0081024	3300049572	Bacteria	2743
1870	Ga0501036_0124757	3300049572	Bacteria	2174
1871	Ga0501036_0126909	3300049572	Bacteria	2154
1872	Ga0501036_0808951	3300049572	Bacteria	771
1873	Ga0501037_0000139	3300049573	Bacteria	67890
1874	Ga0501037_0011448	3300049573	Bacteria	6530
1875	Ga0501037_0031397	3300049573	Bacteria	3922
1876	Ga0501037_0041972	3300049573	Bacteria	3362
1877	Ga0501037_0108563	3300049573	Bacteria	1999
1878	Ga0501037_0179105	3300049573	Bacteria	1504
1879	Ga0501037_1126743	3300049573	Bacteria	507
1880	Ga0501038_0000659	3300049574	Bacteria	30648
1881	Ga0501038_0009242	3300049574	Bacteria	9044
1882	Ga0501038_0032678	3300049574	Bacteria	4588
1883	Ga0501038_0034763	3300049574	Bacteria	4428
1884	Ga0501038_0115548	3300049574	Bacteria	2218
1885	Ga0501038_0229060	3300049574	Bacteria	1479
1886	Ga0501038_0277015	3300049574	Bacteria	1321
1887	Ga0501038_0682330	3300049574	Bacteria	771
1888	Ga0501039_0001703	3300049575	Bacteria	16197
1889	Ga0501039_0066237	3300049575	Bacteria	2803
1890	Ga0501039_0112611	3300049575	Bacteria	2127
1891	Ga0501039_0246970	3300049575	Bacteria	1403
1892	Ga0501039_0299722	3300049575	Bacteria	1264
1893	Ga0501039_0355178	3300049575	Bacteria	1151
1894	Ga0501039_0916351	3300049575	Bacteria	682
1895	Ga0501040_0181865	3300049576	Bacteria	1490
1896	Ga0501040_0716806	3300049576	Bacteria	723
1897	Ga0501041_0863146	3300049577	Bacteria	581
1898	Ga0501042_0008661	3300049578	Bacteria	6740
1899	Ga0501042_0074414	3300049578	Bacteria	2431
1900	Ga0501042_1409306	3300049578	Bacteria	508
1901	Ga0501043_0000021	3300049579	Bacteria	155025
1902	Ga0501043_0010159	3300049579	Bacteria	7378
1903	Ga0501043_0011657	3300049579	Bacteria	6881
1904	Ga0501043_0025307	3300049579	Bacteria	4655
1905	Ga0501043_0057546	3300049579	Bacteria	3053
1906	Ga0501043_0075716	3300049579	Bacteria	2643
1907	Ga0501043_0088020	3300049579	Bacteria	2440
1908	Ga0501043_0160842	3300049579	Bacteria	1754
1909	Ga0501043_0242522	3300049579	Bacteria	1390
1910	Ga0501046_0000905	3300049580	Bacteria	28947
1911	Ga0501046_0018059	3300049580	Bacteria	5876
1912	Ga0501046_0019966	3300049580	Bacteria	5547
1913	Ga0501046_0047930	3300049580	Bacteria	3385
1914	Ga0501046_0129777	3300049580	Bacteria	1912
1915	Ga0501046_0336279	3300049580	Bacteria	1098
1916	Ga0501047_0000041	3300049581	Bacteria	184355
1917	Ga0501047_0046050	3300049581	Bacteria	4216
1918	Ga0501047_0056228	3300049581	Bacteria	3804
1919	Ga0501047_0093327	3300049581	Bacteria	2889
1920	Ga0501047_0106647	3300049581	Bacteria	2682
1921	Ga0501047_0148724	3300049581	Bacteria	2218
1922	Ga0501047_0149326	3300049581	Bacteria	2213
1923	Ga0501047_0584409	3300049581	Bacteria	939
1924	Ga0501047_0595149	3300049581	Bacteria	928
1925	Ga0501048_0000077	3300049582	Bacteria	51021
1926	Ga0501048_0007662	3300049582	Bacteria	8184
1927	Ga0501048_0025794	3300049582	Bacteria	4281
1928	Ga0501048_0097907	3300049582	Bacteria	2070
1929	Ga0501048_0277859	3300049582	Bacteria	1191
1930	Ga0501048_0371823	3300049582	Bacteria	1020
1931	Ga0501048_1352653	3300049582	Bacteria	512
1932	Ga0501067_0000360	3300049583	Bacteria	24898
1933	Ga0501067_0035178	3300049583	Bacteria	2781
1934	Ga0501067_0053240	3300049583	Bacteria	2242
1935	Ga0501067_0131650	3300049583	Bacteria	1392
1936	Ga0501067_0384568	3300049583	Bacteria	782
1937	Ga0501068_0000615	3300049584	Bacteria	18122
1938	Ga0501068_0046970	3300049584	Bacteria	2603
1939	Ga0501068_0147999	3300049584	Bacteria	1474
1940	Ga0501069_0000444	3300049585	Bacteria	18810
1941	Ga0501069_0004047	3300049585	Bacteria	7571
1942	Ga0501069_0026334	3300049585	Bacteria	3183
1943	Ga0501069_0101091	3300049585	Bacteria	1637
1944	Ga0501069_0837426	3300049585	Bacteria	558
1945	Ga0501070_0012417	3300049586	Bacteria	7183
1946	Ga0501070_0018768	3300049586	Bacteria	5802
1947	Ga0501070_0024774	3300049586	Bacteria	5032
1948	Ga0501070_0207430	3300049586	Bacteria	1609
1949	Ga0501070_0241185	3300049586	Bacteria	1479
1950	Ga0501070_0686561	3300049586	Bacteria	810
1951	Ga0501070_0869498	3300049586	Bacteria	704
1952	Ga0501070_0898184	3300049586	Bacteria	691
1953	Ga0501071_0029942	3300049587	Bacteria	3847
1954	Ga0501071_0081125	3300049587	Bacteria	2374
1955	Ga0501071_0616173	3300049587	Bacteria	835
1956	Ga0501072_0002889	3300049588	Bacteria	12928
1957	Ga0501072_0005294	3300049588	Bacteria	9823
1958	Ga0501072_0026930	3300049588	Bacteria	4486
1959	Ga0501072_0541890	3300049588	Bacteria	919
1960	Ga0501072_1568459	3300049588	Bacteria	508
1961	Ga0501073_0012051	3300049589	Bacteria	6311
1962	Ga0501073_0032509	3300049589	Bacteria	3719
1963	Ga0501073_0046272	3300049589	Bacteria	3061
1964	Ga0501073_0159996	3300049589	Bacteria	1560
1965	Ga0501073_0173839	3300049589	Bacteria	1491
1966	Ga0501073_0601133	3300049589	Bacteria	760
1967	Ga0501073_0618607	3300049589	Bacteria	748
1968	Ga0501074_0002874	3300049590	Bacteria	12065
1969	Ga0501074_0039159	3300049590	Bacteria	3433
1970	Ga0501074_0054680	3300049590	Bacteria	2878
1971	Ga0501074_0113393	3300049590	Bacteria	1939
1972	Ga0501076_0091239	3300049592	Bacteria	2451
1973	Ga0501076_0139601	3300049592	Bacteria	1968
1974	Ga0501076_0298179	3300049592	Bacteria	1321
1975	Ga0501077_0072705	3300049593	Bacteria	2179
1976	Ga0501077_0273766	3300049593	Bacteria	1074
1977	Ga0501079_0002023	3300049741	Bacteria	14514
1978	Ga0501079_0059981	3300049741	Bacteria	2934
1979	Ga0501079_0077153	3300049741	Bacteria	2577
1980	Ga0501080_0005648	3300049742	Bacteria	11180
1981	Ga0501080_0009361	3300049742	Bacteria	8933
1982	Ga0501080_0091380	3300049742	Bacteria	2827
1983	Ga0501080_0482855	3300049742	Bacteria	1108
1984	Ga0501080_1371578	3300049742	Bacteria	604
1985	Ga0501083_0000708	3300049744	Bacteria	21721
1986	Ga0501083_0010325	3300049744	Bacteria	6575
1987	Ga0501083_0013029	3300049744	Bacteria	5809
1988	Ga0501083_0168251	3300049744	Bacteria	1433
1989	Ga0501083_0463674	3300049744	Bacteria	824
1990	Ga0501035_0000090	3300049822	Bacteria	112445
1991	Ga0501035_0004697	3300049822	Bacteria	12968
1992	Ga0501035_0071086	3300049822	Bacteria	3082
1993	Ga0501035_0088372	3300049822	Bacteria	2730
1994	Ga0501035_0110118	3300049822	Bacteria	2414
1995	Ga0501035_0176374	3300049822	Bacteria	1843
1996	Ga0501035_0237471	3300049822	Bacteria	1551
1997	Ga0501035_0338323	3300049822	Bacteria	1261
1998	Ga0501044_0000054	3300049823	Bacteria	141399
1999	Ga0501044_0009165	3300049823	Bacteria	10810
2000	Ga0501044_0026000	3300049823	Bacteria	6201
2001	Ga0501044_0086635	3300049823	Bacteria	3163
2002	Ga0501044_0262384	3300049823	Bacteria	1665
2003	Ga0501044_0390133	3300049823	Bacteria	1306
2004	Ga0501044_0553292	3300049823	Bacteria	1047
2005	Ga0501044_0644076	3300049823	Bacteria	949
2006	Ga0501045_0034866	3300049824	Bacteria	3653
2007	Ga0501045_0071568	3300049824	Bacteria	2552
2008	Ga0501045_0193183	3300049824	Bacteria	1517
2009	Ga0501045_0252531	3300049824	Bacteria	1312
2010	nmdc:mga03683_157232_c1	3300050489	Bacteria	1028
2011	nmdc:mga03n38_202479_c1	3300050490	Bacteria	1028
2012	nmdc:mga03n38_253_c1	3300050490	Bacteria	12586
2013	nmdc:mga03n38_55251_c1	3300050490	Bacteria	1788
2014	nmdc:mga00v17_28731_c1	3300050491	Bacteria	3259
2015	nmdc:mga00v17_37039_c1	3300050491	Bacteria	2910
2016	nmdc:mga00v17_972743_c1	3300050491	Bacteria	535
2017	nmdc:mga0yw44_266101_c1	3300050492	Bacteria	1144
2018	nmdc:mga0yw44_291202_c1	3300050492	Bacteria	1093
2019	nmdc:mga0yw44_306553_c1	3300050492	Bacteria	1065
2020	nmdc:mga0yw44_61011_c1	3300050492	Bacteria	2312
2021	nmdc:mga0yw44_664316_c1	3300050492	Bacteria	708
2022	nmdc:mga0yw44_75483_c1	3300050492	Bacteria	2102
2023	nmdc:mga0yw44_81418_c1	3300050492	Bacteria	2030
2024	nmdc:mga0k408_103524_c1	3300050493	Bacteria	1679
2025	nmdc:mga06z11_111744_c1	3300050494	Bacteria	1514
2026	nmdc:mga06z11_189601_c1	3300050494	Bacteria	649
2027	nmdc:mga06z11_21680_c1	3300050494	Bacteria	2989
2028	nmdc:mga06z11_434447_c1	3300050494	Bacteria	792
2029	nmdc:mga04h51_113869_c1	3300050495	Bacteria	1000
2030	nmdc:mga04h51_12930_c1	3300050495	Bacteria	2353
2031	nmdc:mga04h51_18936_c1	3300050495	Bacteria	2035
2032	nmdc:mga07m45_11052_c1	3300050496	Bacteria	4734
2033	nmdc:mga07m45_14472_c1	3300050496	Bacteria	4201
2034	nmdc:mga07m45_403837_c1	3300050496	Bacteria	793
2035	nmdc:mga07m45_629482_c1	3300050496	Bacteria	619
2036	nmdc:mga07m45_636919_c1	3300050496	Bacteria	615
2037	nmdc:mga07m45_640671_c1	3300050496	Bacteria	613
2038	nmdc:mga07m45_778327_c1	3300050496	Bacteria	549
2039	nmdc:mga05p37_377925_c1	3300050507	Bacteria	1661
2040	nmdc:mga09592_295501_c1	3300050508	Bacteria	1404
2041	nmdc:mga06r32_251057_c1	3300050510	Bacteria	1756
2042	nmdc:mga08y16_1090581_c1	3300050511	Bacteria	774
2043	nmdc:mga08y16_291698_c1	3300050511	Bacteria	1682
2044	nmdc:mga08y16_344121_c1	3300050511	Bacteria	1533
2045	nmdc:mga08y16_542289_c1	3300050511	Bacteria	1178
2046	nmdc:mga0n895_1969676_c1	3300050512	Bacteria	542
2047	nmdc:mga0n895_261000_c1	3300050512	Bacteria	1758
2048	nmdc:mga0n895_28679_c1	3300050512	Bacteria	5298
2049	nmdc:mga0n895_9131_c1	3300050512	Bacteria	8656
2050	nmdc:mga0rr50_156212_c1	3300050513	Bacteria	1848
2051	nmdc:mga0rr50_1636965_c1	3300050513	Bacteria	543
2052	nmdc:mga0rr50_1877208_c1	3300050513	Bacteria	504
2053	nmdc:mga0rr50_336727_c1	3300050513	Bacteria	1267
2054	nmdc:mga0rr50_807575_c1	3300050513	Bacteria	800
2055	nmdc:mga08x19_137615_c1	3300050514	Bacteria	1647
2056	nmdc:mga08x19_385_c1	3300050514	Bacteria	31031
2057	nmdc:mga0a205_42275_c1	3300050515	Bacteria	4391
2058	nmdc:mga0sz30_19636_c1	3300050516	Bacteria	2719
2059	Ga0495601_0007076	3300053077	Bacteria	6573
2060	Ga0495601_0017559	3300053077	Bacteria	4346
2061	Ga0495601_0055423	3300053077	Bacteria	2510
2062	Ga0495601_0063139	3300053077	Bacteria	2354
2063	Ga0495601_0196055	3300053077	Bacteria	1320
2064	Ga0495601_0269852	3300053077	Bacteria	1110
2065	Ga0495601_0351084	3300053077	Bacteria	959
2066	Ga0495601_0834372	3300053077	Bacteria	584
2067	Ga0495612_0016043	3300053078	Bacteria	3001
2068	Ga0495612_0038950	3300053078	Bacteria	1932
2069	Ga0495612_0145523	3300053078	Bacteria	1029
2070	Ga0495612_0243543	3300053078	Bacteria	799
2071	Ga0495612_0347676	3300053078	Bacteria	669
2072	Ga0500610_0101301	3300053079	Bacteria	1490
2073	Ga0500635_0006466	3300053080	Bacteria	3131
2074	Ga0500635_0037969	3300053080	Bacteria	1595
2075	Ga0500635_0108224	3300053080	Bacteria	1030
2076	Ga0500635_0134163	3300053080	Bacteria	935
2077	Ga0495655_0019887	3300053083	Bacteria	1498
2078	Ga0495655_0092015	3300053083	Bacteria	885
2079	Ga0495655_0173715	3300053083	Bacteria	691
2080	Ga0495655_0302259	3300053083	Bacteria	550
2081	Ga0495595_0003789	3300053084	Bacteria	6015
2082	Ga0495595_0008686	3300053084	Bacteria	4180
2083	Ga0495595_0015978	3300053084	Bacteria	3205
2084	Ga0495595_0113332	3300053084	Bacteria	1316
2085	Ga0495619_0004493	3300053085	Bacteria	8907
2086	Ga0495619_0094854	3300053085	Bacteria	2024
2087	Ga0495619_0117993	3300053085	Bacteria	1817
2088	Ga0495619_0290253	3300053085	Bacteria	1133
2089	Ga0495619_0297452	3300053085	Bacteria	1118
2090	Ga0495619_0303303	3300053085	Bacteria	1106
2091	Ga0495619_0306665	3300053085	Bacteria	1099
2092	Ga0495619_0487927	3300053085	Bacteria	848
2093	Ga0500578_0064532	3300053086	Bacteria	2335
2094	Ga0500578_0098568	3300053086	Bacteria	1851
2095	Ga0500578_0210607	3300053086	Bacteria	1186
2096	Ga0500643_021798	3300053087	Bacteria	2072
2097	Ga0500644_0008642	3300053088	Bacteria	2693
2098	Ga0500644_0022502	3300053088	Bacteria	1902
2099	Ga0500644_0030059	3300053088	Bacteria	1715
2100	Ga0500644_0115990	3300053088	Bacteria	1037
2101	Ga0500646_0006024	3300053090	Bacteria	3077
2102	Ga0500646_0147031	3300053090	Bacteria	778
2103	Ga0500646_0164022	3300053090	Bacteria	744
2104	Ga0500583_0066349	3300053092	Bacteria	1717
2105	Ga0500583_0156815	3300053092	Bacteria	1133
2106	Ga0500583_0568188	3300053092	Bacteria	525
2107	Ga0500583_0585364	3300053092	Bacteria	514
2108	Ga0500651_0048332	3300053093	Bacteria	2672
2109	Ga0500651_0068878	3300053093	Bacteria	2203
2110	Ga0500651_0219551	3300053093	Bacteria	1115
2111	Ga0500651_0352124	3300053093	Bacteria	835
2112	Ga0500566_0000286	3300053094	Bacteria	27100
2113	Ga0500566_0017000	3300053094	Bacteria	4272
2114	Ga0500640_173255	3300053095	Bacteria	792
2115	Ga0500641_0013374	3300053096	Bacteria	3014
2116	Ga0500641_0058252	3300053096	Bacteria	1604
2117	Ga0500641_0085168	3300053096	Bacteria	1345
2118	Ga0500650_0000303	3300053098	Bacteria	11872
2119	Ga0500554_002745	3300053102	Bacteria	3503
2120	Ga0500554_003058	3300053102	Bacteria	3372
2121	Ga0500555_065469	3300053103	Bacteria	968
2122	Ga0500556_0000015	3300053104	Bacteria	202598
2123	Ga0500556_0032645	3300053104	Bacteria	1780
2124	Ga0500556_0157778	3300053104	Bacteria	895
2125	Ga0500557_000067	3300053105	Bacteria	40265
2126	Ga0500557_264290	3300053105	Bacteria	534
2127	Ga0500558_220524	3300053106	Bacteria	645
2128	Ga0500560_221542	3300053107	Bacteria	603
2129	Ga0500569_002124	3300053109	Bacteria	3855
2130	Ga0500569_003911	3300053109	Bacteria	3089
2131	Ga0500569_025145	3300053109	Bacteria	1618
2132	Ga0500572_001597	3300053111	Bacteria	5982
2133	Ga0500572_002982	3300053111	Bacteria	3960
2134	Ga0500572_021027	3300053111	Bacteria	1723
2135	Ga0500592_011208	3300053116	Bacteria	1432
2136	Ga0500594_0005337	3300053118	Bacteria	2849
2137	Ga0500594_0014905	3300053118	Bacteria	1867
2138	Ga0500595_003206	3300053119	Bacteria	7733
2139	Ga0500595_008771	3300053119	Bacteria	4111
2140	Ga0500595_010344	3300053119	Bacteria	3712
2141	Ga0500595_016343	3300053119	Bacteria	2765
2142	Ga0500595_016392	3300053119	Bacteria	2760
2143	Ga0500595_028137	3300053119	Bacteria	1918
2144	Ga0500595_030987	3300053119	Bacteria	1797
2145	Ga0500595_031606	3300053119	Bacteria	1774
2146	Ga0500595_142139	3300053119	Bacteria	672
2147	Ga0500595_151126	3300053119	Bacteria	649
2148	Ga0500597_130371	3300053120	Bacteria	1087
2149	Ga0500607_044464	3300053121	Bacteria	2388
2150	Ga0500607_067455	3300053121	Bacteria	1853
2151	Ga0500608_001127	3300053122	Bacteria	9527
2152	Ga0500608_031890	3300053122	Bacteria	2502
2153	Ga0500608_036232	3300053122	Bacteria	2354
2154	Ga0500608_042958	3300053122	Bacteria	2170
2155	Ga0500614_007891	3300053123	Bacteria	2249
2156	Ga0500621_055842	3300053126	Bacteria	1597
2157	Ga0500621_135245	3300053126	Bacteria	941
2158	Ga0500628_242446	3300053129	Bacteria	529
2159	Ga0500642_0000019	3300053130	Bacteria	159944
2160	Ga0500642_0000185	3300053130	Bacteria	25676
2161	Ga0500642_0006744	3300053130	Bacteria	3809
2162	Ga0500642_0014624	3300053130	Bacteria	2925
2163	Ga0500642_0244838	3300053130	Bacteria	825
2164	Ga0500642_0274321	3300053130	Bacteria	768
2165	Ga0500652_374206	3300053131	Bacteria	533
2166	Ga0500655_015901	3300053133	Bacteria	1382
2167	Ga0500658_0034809	3300053134	Bacteria	1990
2168	Ga0500658_0134696	3300053134	Bacteria	1104
2169	Ga0500559_0000130	3300053136	Bacteria	58494
2170	Ga0500559_0000596	3300053136	Bacteria	24584
2171	Ga0500559_0010555	3300053136	Bacteria	3963
2172	Ga0500559_0038434	3300053136	Bacteria	2078
2173	Ga0500559_0112776	3300053136	Bacteria	1260
2174	Ga0500559_0295045	3300053136	Bacteria	761
2175	Ga0500559_0298479	3300053136	Bacteria	756
2176	Ga0500559_0498908	3300053136	Bacteria	559
2177	Ga0500561_0188524	3300053137	Bacteria	650
2178	Ga0500564_026644	3300053138	Bacteria	2657
2179	Ga0500568_0001108	3300053139	Bacteria	18102
2180	Ga0500568_0015530	3300053139	Bacteria	3407
2181	Ga0500568_0025078	3300053139	Bacteria	2520
2182	Ga0500568_0027814	3300053139	Bacteria	2362
2183	Ga0500568_0031521	3300053139	Bacteria	2186
2184	Ga0500568_0045818	3300053139	Bacteria	1739
2185	Ga0500568_0125672	3300053139	Bacteria	955
2186	Ga0500573_0311057	3300053140	Bacteria	782
2187	Ga0500573_0482459	3300053140	Bacteria	565
2188	Ga0500573_0518060	3300053140	Bacteria	535
2189	Ga0500577_0000032	3300053142	Bacteria	33173
2190	Ga0500577_0036276	3300053142	Bacteria	1764
2191	Ga0500577_0090871	3300053142	Bacteria	1233
2192	Ga0500585_210898	3300053144	Bacteria	641
2193	Ga0500585_262886	3300053144	Bacteria	541
2194	Ga0500586_009874	3300053145	Bacteria	2670
2195	Ga0500588_0042373	3300053146	Bacteria	1378
2196	Ga0500589_066461	3300053147	Bacteria	1640
2197	Ga0500589_310173	3300053147	Bacteria	555
2198	Ga0500590_070828	3300053148	Bacteria	1732
2199	Ga0500590_141247	3300053148	Bacteria	1100
2200	Ga0500590_316998	3300053148	Bacteria	576
2201	Ga0500603_000347	3300053150	Bacteria	12096
2202	Ga0500603_036648	3300053150	Bacteria	1291
2203	Ga0500603_046723	3300053150	Bacteria	1172
2204	Ga0500604_0006496	3300053151	Bacteria	3093
2205	Ga0500616_0000041	3300053153	Bacteria	359328
2206	Ga0500616_0000084	3300053153	Bacteria	195562
2207	Ga0500616_0025767	3300053153	Bacteria	3261
2208	Ga0500616_0045606	3300053153	Bacteria	2335
2209	Ga0500619_013366	3300053154	Bacteria	2174
2210	Ga0500622_0002439	3300053156	Bacteria	13426
2211	Ga0500622_0023296	3300053156	Bacteria	3279
2212	Ga0500622_0072397	3300053156	Bacteria	1740
2213	Ga0500624_006451	3300053157	Bacteria	1588
2214	Ga0500624_043219	3300053157	Bacteria	817
2215	Ga0500627_0063983	3300053158	Bacteria	1621
2216	Ga0500627_0079796	3300053158	Bacteria	1457
2217	Ga0500627_0092097	3300053158	Bacteria	1357
2218	Ga0500627_0283200	3300053158	Bacteria	727
2219	Ga0500630_013143	3300053159	Bacteria	4077
2220	Ga0500633_0128837	3300053160	Bacteria	943
2221	Ga0500634_0043816	3300053161	Bacteria	2423
2222	Ga0500634_0081123	3300053161	Bacteria	1671
2223	Ga0500638_002167	3300053162	Bacteria	6683
2224	Ga0500638_009987	3300053162	Bacteria	4134
2225	Ga0500638_042226	3300053162	Bacteria	2214
2226	Ga0500638_083921	3300053162	Bacteria	1509
2227	Ga0500638_129794	3300053162	Bacteria	1144
2228	Ga0500639_094961	3300053163	Bacteria	1478
2229	Ga0500639_115775	3300053163	Bacteria	1295
2230	Ga0500639_192402	3300053163	Bacteria	887
2231	Ga0500639_232871	3300053163	Bacteria	756
2232	Ga0500636_0000047	3300053177	Bacteria	62796
2233	Ga0500636_0003630	3300053177	Bacteria	8704
2234	Ga0500636_0073564	3300053177	Bacteria	1979
2235	Ga0500636_0093851	3300053177	Bacteria	1715
2236	Ga0500636_0102922	3300053177	Bacteria	1621
2237	Ga0500636_0107587	3300053177	Bacteria	1578
2238	Ga0500636_0174349	3300053177	Bacteria	1160
2239	Ga0500636_0217629	3300053177	Bacteria	998
2240	Ga0500636_0268295	3300053177	Bacteria	859
2241	Ga0500636_0302769	3300053177	Bacteria	786
2242	Ga0500637_0005436	3300053178	Bacteria	6163
2243	Ga0500637_0016604	3300053178	Bacteria	3926
2244	Ga0500637_0267858	3300053178	Bacteria	946
2245	Ga0500637_0567131	3300053178	Bacteria	545
2246	Ga0500567_208116	3300053723	Bacteria	641
2247	Ga0500570_089616	3300053724	Bacteria	1346
2248	Ga0500576_150877	3300053725	Bacteria	868
2249	Ga0500611_013168	3300053727	Bacteria	1413
2250	Ga0500611_025569	3300053727	Bacteria	1171
2251	Ga0500611_187085	3300053727	Bacteria	582
2252	Ga0500657_135093	3300053728	Bacteria	948
2253	Ga0500625_023754	3300053729	Bacteria	2896
2254	Ga0500645_030379	3300053730	Bacteria	1626
2255	Ga0500645_059068	3300053730	Bacteria	1110
2256	Ga0500609_003551	3300053731	Bacteria	2184
2257	Ga0500609_038530	3300053731	Bacteria	660
2258	Ga0500656_008139	3300053732	Bacteria	1107
2259	Ga0500596_000310	3300053735	Bacteria	8700
2260	Ga0500596_000643	3300053735	Bacteria	6727
2261	Ga0500596_001183	3300053735	Bacteria	5265
2262	Ga0500601_000197	3300053737	Bacteria	12449
2263	Ga0501084_0017017	3300054114	Bacteria	6040
2264	Ga0501084_0031895	3300054114	Bacteria	4407
2265	Ga0501084_0054361	3300054114	Bacteria	3349
2266	Ga0501084_0159561	3300054114	Bacteria	1902
2267	Ga0500661_000101	3300055283	Bacteria	13840
2268	Ga0500661_088152	3300055283	Bacteria	580
2269	Ga0590071_213168	3300059421	Bacteria	510
2270	Ga0587069_148251	3300059642	Bacteria	519
2271	Ga0501082_0000007	3300060353	Bacteria	126506
2272	Ga0501082_0010697	3300060353	Bacteria	7897
2273	Ga0501082_0059576	3300060353	Bacteria	3290
2274	Ga0501082_0254305	3300060353	Bacteria	1528
2275	Ga0501082_0379892	3300060353	Bacteria	1233
2276	Ga0530510_0967644	3300061734	Bacteria	651
2277	Ga0495624_0034033
2278	LJNas_1036058
2279	LJQas_1001737
2280	JGI24032J14994_100661
2281	JGI24736J21556_1022977
2282	JGI24746J21847_1002854
2283	JGI24747J21853_1005672
2284	JGI24739J22299_10009199
2285	JGI24737J22298_10002956
2286	JGI24743J22301_10014472
2287	JGI24735J21928_10050335
2288	JGI24750J21931_1001017
2289	JGI24745J21846_1005180
2290	JGI24738J21930_10002463
2291	JGI24035J26624_1004126
2292	JGI24033J26618_1004331
2293	JGI24034J26672_10000326
2294	JGI24034J26672_10115892
2295	JGI24742J22300_10000397
2296	JGI24751J29686_10031231
2297	JGI25406J46586_10000048
2298	JGI25153J46596_10010155
2299	JGI25160J50197_1061920
2300	JGI25404J52841_10008446
2301	JGI25404J52841_10014772
2302	Ga0055539_1031323
2303	JGI25405J52794_10067855
2304	Ga0065704_10618305
2305	Ga0065712_10115194
2306	Ga0065715_10020364
2307	Ga0065715_10138453
2308	Ga0065715_10239721
2309	Ga0070658_10045107
2310	Ga0070658_10064574
2311	Ga0070658_10464065
2312	Ga0070676_10044926
2313	Ga0070683_100004361
2314	Ga0070683_100016821
2315	Ga0070683_100017403
2316	Ga0070683_100032893
2317	Ga0070683_101865451
2318	Ga0070690_100008785
2319	Ga0070690_100127018
2320	Ga0070690_100296944
2321	Ga0070670_100040049
2322	Ga0070670_100250243
2323	Ga0070670_100647179
2324	Ga0070670_100907482
2325	Ga0070670_101728712
2326	Ga0070677_10001690
2327	Ga0070677_10191799
2328	Ga0070677_10507342
2329	Ga0068869_100036691
2330	Ga0068869_100478534
2331	Ga0068869_100654050
2332	Ga0068869_101329518
2333	Ga0070666_10079025
2334	Ga0070666_10308405
2335	Ga0070666_10794747
2336	Ga0070680_100002749
2337	Ga0070680_100012411
2338	Ga0070680_100017942
2339	Ga0070680_100068967
2340	Ga0070680_100070428
2341	Ga0070680_100135873
2342	Ga0070680_100371605
2343	Ga0070682_100005853
2344	Ga0070682_100075034
2345	Ga0070682_100319002
2346	Ga0070682_100332368
2347	Ga0070682_101296741
2348	Ga0068868_100002412
2349	Ga0068868_100050884
2350	Ga0068868_100218610
2351	Ga0068868_101124176
2352	Ga0068868_101482208
2353	Ga0070660_100005972
2354	Ga0070660_100010269
2355	Ga0070660_100196924
2356	Ga0070660_100198090
2357	Ga0070660_101039328
2358	Ga0070660_101183641
2359	Ga0070689_100009752
2360	Ga0070689_100092402
2361	Ga0070689_100108998
2362	Ga0070689_100228849
2363	Ga0070689_100773718
2364	Ga0070691_10010624
2365	Ga0070691_10021364
2366	Ga0070691_10040897
2367	Ga0070687_100012130
2368	Ga0070687_101156359
2369	Ga0070661_100003759
2370	Ga0070661_100140708
2371	Ga0070661_100435706
2372	Ga0070661_100475770
2373	Ga0070661_100695493
2374	Ga0070661_101288220
2375	Ga0070692_10047957
2376	Ga0070692_10799823
2377	Ga0070668_100027765
2378	Ga0070668_100243098
2379	Ga0070669_100023952
2380	Ga0070675_100030972
2381	Ga0070671_100038059
2382	Ga0070671_100088598
2383	Ga0070674_100008138
2384	Ga0070674_100025341
2385	Ga0070674_100144731
2386	Ga0070674_100754191
2387	Ga0070673_100025438
2388	Ga0070673_101578910
2389	Ga0070688_100001055
2390	Ga0070688_100322579
2391	Ga0070659_100010614
2392	Ga0070659_100062008
2393	Ga0070659_100725638
2394	Ga0070659_100786619
2395	Ga0070667_100026906
2396	Ga0070667_100290135
2397	Ga0070667_100291124
2398	Ga0070667_100647382
2399	Ga0070703_10243846
2400	Ga0070709_10005688
2401	Ga0070709_10007029
2402	Ga0070709_10011099
2403	Ga0070709_10069358
2404	Ga0070709_10196567
2405	Ga0070709_10602611
2406	Ga0070709_10786755
2407	Ga0070714_100008062
2408	Ga0070714_100045425
2409	Ga0070714_100100329
2410	Ga0070714_100121513
2411	Ga0070714_100202601
2412	Ga0070714_100310154
2413	Ga0070714_100321104
2414	Ga0070714_100450218
2415	Ga0070714_100615619
2416	Ga0070714_101035577
2417	Ga0070714_101990372
2418	Ga0070713_100029386
2419	Ga0070713_100078012
2420	Ga0070713_100130137
2421	Ga0070713_100317129
2422	Ga0070713_100718181
2423	Ga0070713_101594777
2424	Ga0070710_10006581
2425	Ga0070710_10023736
2426	Ga0070710_10150770
2427	Ga0070710_10169376
2428	Ga0070710_10196641
2429	Ga0070710_10344560
2430	Ga0070710_10469062
2431	Ga0070701_10006414
2432	Ga0070711_100018333
2433	Ga0070711_100084197
2434	Ga0070711_100115750
2435	Ga0070711_100153343
2436	Ga0070711_100336648
2437	Ga0070711_100507093
2438	Ga0070711_100536658
2439	Ga0070711_101127350
2440	Ga0070705_100118452
2441	Ga0070705_101139010
2442	Ga0070700_100018037
2443	Ga0070694_100015789
2444	Ga0070663_100099633
2445	Ga0070663_100111772
2446	Ga0070663_100277890
2447	Ga0070663_100488316
2448	Ga0070663_100556820
2449	Ga0070663_100731151
2450	Ga0070663_100809846
2451	Ga0070663_101477923
2452	Ga0070678_100010696
2453	Ga0070678_100048840
2454	Ga0070678_100061953
2455	Ga0070678_100276540
2456	Ga0070678_101712916
2457	Ga0070662_100327034
2458	Ga0070662_100512353
2459	Ga0070662_100670929
2460	Ga0070681_10002334
2461	Ga0070681_10017929
2462	Ga0070681_10044855
2463	Ga0070681_10094902
2464	Ga0070681_10152576
2465	Ga0070681_10166647
2466	Ga0070681_10388411
2467	Ga0070681_10446594
2468	Ga0070681_10671252
2469	Ga0070681_11799085
2470	Ga0068867_100018450
2471	Ga0068867_100674135
2472	Ga0070685_10005442
2473	Ga0070706_100623350
2474	Ga0070706_101032332
2475	Ga0070706_101363443
2476	Ga0070706_101425220
2477	Ga0070707_101191346
2478	Ga0070698_100312244
2479	Ga0070699_100125015
2480	Ga0070699_100420930
2481	Ga0070699_100626114
2482	Ga0070679_100022393
2483	Ga0070679_100022725
2484	Ga0070679_100037981
2485	Ga0070679_100049473
2486	Ga0070679_100149333
2487	Ga0070679_100184248
2488	Ga0070679_100223923
2489	Ga0070679_100505041
2490	Ga0070679_100606634
2491	Ga0070679_102097914
2492	Ga0070684_100009832
2493	Ga0070684_100083599
2494	Ga0070684_100248238
2495	Ga0070684_100634013
2496	Ga0070684_101048792
2497	Ga0070697_100053255
2498	Ga0070697_100083715
2499	Ga0070697_100651147
2500	Ga0070697_101841271
2501	Ga0068853_100000984
2502	Ga0068853_100004957
2503	Ga0068853_100085577
2504	Ga0068853_100171402
2505	Ga0068853_100256762
2506	Ga0068853_100419889
2507	Ga0068853_100453967
2508	Ga0068853_101319121
2509	Ga0068853_101500301
2510	Ga0068853_102336289
2511	Ga0070672_100021142
2512	Ga0070672_101193807
2513	Ga0070686_100004110
2514	Ga0070686_100033851
2515	Ga0070695_100017418
2516	Ga0070695_100719474
2517	Ga0070696_100015647
2518	Ga0070693_100015516
2519	Ga0070693_100329449
2520	Ga0070693_101291706
2521	Ga0070665_100114396
2522	Ga0070665_100146433
2523	Ga0070665_100425396
2524	Ga0070665_100593266
2525	Ga0070665_100622271
2526	Ga0070665_101332377
2527	Ga0070704_100020391
2528	Ga0068855_100005897
2529	Ga0068855_100019356
2530	Ga0068855_100078896
2531	Ga0068855_100160127
2532	Ga0068855_100164059
2533	Ga0068855_100178613
2534	Ga0068855_100180295
2535	Ga0068855_100289720
2536	Ga0068855_100325256
2537	Ga0068855_100478545
2538	Ga0068855_100908801
2539	Ga0068855_101136582
2540	Ga0070664_100023460
2541	Ga0070664_100057848
2542	Ga0070664_100063231
2543	Ga0070664_100063732
2544	Ga0070664_100625073
2545	Ga0070664_100715071
2546	Ga0068857_100000188
2547	Ga0068857_100123698
2548	Ga0068857_100442383
2549	Ga0068857_101065205
2550	Ga0068857_102074276
2551	Ga0068854_100016222
2552	Ga0068854_100033734
2553	Ga0068854_101308746
2554	Ga0068854_101638914
2555	Ga0068856_100000363
2556	Ga0068856_100044892
2557	Ga0068856_100059266
2558	Ga0068856_100110671
2559	Ga0068856_100164072
2560	Ga0068856_101600190
2561	Ga0068856_101801217
2562	Ga0068856_102133750
2563	Ga0070702_100009057
2564	Ga0070702_100078046
2565	Ga0070702_100151911
2566	Ga0070702_100940984
2567	Ga0068852_100024915
2568	Ga0068852_100076320
2569	Ga0068852_100155859
2570	Ga0068852_100207139
2571	Ga0068852_100371261
2572	Ga0068852_100526777
2573	Ga0068852_100724520
2574	Ga0068852_101610117
2575	Ga0068859_100039941
2576	Ga0068859_100382099
2577	Ga0068859_101165160
2578	Ga0068859_102056819
2579	Ga0068864_100001357
2580	Ga0068864_100069628
2581	Ga0068864_100390148
2582	Ga0068864_100396453
2583	Ga0068864_101522988
2584	Ga0068866_10002122
2585	Ga0068861_100034838
2586	Ga0068861_100335247
2587	Ga0068861_100508394
2588	Ga0068861_100920106
2589	Ga0068851_10004581
2590	Ga0068851_10093452
2591	Ga0068851_10129155
2592	Ga0068870_10003748
2593	Ga0068870_10674597
2594	Ga0068863_100027984
2595	Ga0068863_100226945
2596	Ga0068863_100874228
2597	Ga0068863_102410873
2598	Ga0068858_100054141
2599	Ga0068858_100249483
2600	Ga0068858_101220071
2601	Ga0068860_100042875
2602	Ga0068860_100181447
2603	Ga0068860_100464302
2604	Ga0068860_101419088
2605	Ga0068862_100166399
2606	Ga0081455_10000051
2607	Ga0081455_10020979
2608	Ga0081455_10027827
2609	Ga0081455_10429998
2610	Ga0081540_1004511
2611	Ga0081540_1008574
2612	Ga0081540_1015716
2613	Ga0081540_1033603
2614	Ga0081540_1041054
2615	Ga0081540_1341912
2616	Ga0081539_10000008
2617	Ga0070717_10010496
2618	Ga0070717_10014007
2619	Ga0070717_10125181
2620	Ga0070717_10178896
2621	Ga0070717_10252077
2622	Ga0070717_10405815
2623	Ga0070717_11439007
2624	Ga0075365_10059535
2625	Ga0075365_10085252
2626	Ga0075365_10113818
2627	Ga0075365_10197078
2628	Ga0075365_10221846
2629	Ga0075363_100025274
2630	Ga0075363_100063970
2631	Ga0075363_100088250
2632	Ga0075364_10016176
2633	Ga0075364_11265807
2634	Ga0070715_10013166
2635	Ga0070715_10040602
2636	Ga0070715_10155044
2637	Ga0070715_11005525
2638	Ga0070716_100018245
2639	Ga0070716_100100401
2640	Ga0070716_100203218
2641	Ga0070716_100221417
2642	Ga0070716_100291455
2643	Ga0070716_100761363
2644	Ga0070716_100843430
2645	Ga0070716_101234627
2646	Ga0070712_100020432
2647	Ga0070712_100077350
2648	Ga0070712_100086553
2649	Ga0070712_100144019
2650	Ga0070712_100150717
2651	Ga0070712_100994293
2652	Ga0070712_101212545
2653	Ga0075367_10014230
2654	Ga0075367_10392665
2655	Ga0075367_10494775
2656	Ga0075367_11106572
2657	Ga0075369_10167662
2658	Ga0075366_10074660
2659	Ga0075366_10189011
2660	Ga0075366_10857013
2661	Ga0097621_100103572
2662	Ga0097621_100128307
2663	Ga0097621_100277097
2664	Ga0097621_101033254
2665	Ga0097621_101463251
2666	Ga0075370_10167560
2667	Ga0075370_10734427
2668	Ga0068871_100022532
2669	Ga0068871_100092967
2670	Ga0068871_100150133
2671	Ga0068871_102014151
2672	Ga0075428_100383473
2673	Ga0075428_101408593
2674	Ga0075431_100269008
2675	Ga0075433_10556032
2676	Ga0075434_100021202
2677	Ga0075434_100055864
2678	Ga0075434_100098949
2679	Ga0075429_100341133
2680	Ga0068865_100019833
2681	Ga0068865_100963725
2682	Ga0068865_101084218
2683	Ga0075436_101159396
2684	Ga0097620_100039941
2685	Ga0097620_100382090
2686	Ga0097620_101165170
2687	Ga0097620_102056836
2688	Ga0099824_1002915
2689	Ga0099822_1004519
2690	Ga0075435_100141211
2691	Ga0075435_100630933
2692	Ga0075435_100780044
2693	Ga0075435_101365920
2694	Ga0099794_10053391
2695	Ga0099794_10056148
2696	Ga0099794_10057108
2697	Ga0099794_10119931
2698	Ga0099794_10154923
2699	Ga0099795_10019151
2700	Ga0099795_10087476
2701	Ga0099795_10195341
2702	Ga0099795_10206384
2703	Ga0099795_10212649
2704	Ga0099795_10249871
2705	Ga0105251_10042091
2706	Ga0105244_10069202
2707	Ga0105244_10353717
2708	Ga0105250_10096315
2709	Ga0105250_10355564
2710	Ga0105250_10529420
2711	Ga0105240_10005863
2712	Ga0105240_10016715
2713	Ga0105240_10048656
2714	Ga0105240_10074340
2715	Ga0105240_10095172
2716	Ga0105240_10165624
2717	Ga0105240_10989311
2718	Ga0105240_11285622
2719	Ga0105240_11341037
2720	Ga0105240_11680699
2721	Ga0105240_12083954
2722	Ga0111539_10032466
2723	Ga0111539_10281179
2724	Ga0111539_10644287
2725	Ga0105245_10041790
2726	Ga0105245_10046804
2727	Ga0105245_10507005
2728	Ga0105245_10613221
2729	Ga0105245_13093343
2730	Ga0105247_10005342
2731	Ga0105247_10021000
2732	Ga0105247_10036419
2733	Ga0105247_10100963
2734	Ga0105247_10371755
2735	Ga0114129_10627112
2736	Ga0105243_10048240
2737	Ga0105243_10120192
2738	Ga0105243_10357553
2739	Ga0105243_12176240
2740	Ga0105243_12680179
2741	Ga0105241_10064839
2742	Ga0105241_10811602
2743	Ga0105241_10940058
2744	Ga0105241_11384580
2745	Ga0105241_11847133
2746	Ga0105242_10045252
2747	Ga0105242_10605891
2748	Ga0105242_12941345
2749	Ga0105248_10064580
2750	Ga0105248_10080740
2751	Ga0105248_10113008
2752	Ga0105248_10405367
2753	Ga0105248_11588574
2754	Ga0105248_11738369
2755	Ga0105237_10016073
2756	Ga0105237_10019452
2757	Ga0105237_10019884
2758	Ga0105237_10022225
2759	Ga0105237_10065710
2760	Ga0105237_10175282
2761	Ga0105237_10229700
2762	Ga0105237_10521403
2763	Ga0105237_10773812
2764	Ga0105237_10949054
2765	Ga0105237_12330897
2766	Ga0105238_10005575
2767	Ga0105238_10031834
2768	Ga0105238_10032834
2769	Ga0105238_10212585
2770	Ga0105238_10300337
2771	Ga0105238_10344511
2772	Ga0105238_10390157
2773	Ga0105238_10885160
2774	Ga0105238_10939571
2775	Ga0105238_11513159
2776	Ga0105238_11847861
2777	Ga0105238_12574856
2778	Ga0105249_10051051
2779	Ga0105249_10115634
2780	Ga0105249_10540453
2781	Ga0105249_10606890
2782	Ga0105249_11370588
2783	Ga0099796_10002220
2784	Ga0099796_10012074
2785	Ga0099796_10032173
2786	Ga0099796_10227295
2787	Ga0099796_10285366
2788	Ga0105239_10015407
2789	Ga0105239_10030641
2790	Ga0105239_10358054
2791	Ga0105239_10374873
2792	Ga0105239_11125252
2793	Ga0105239_11198208
2794	Ga0105239_12431073
2795	Ga0105239_13187260
2796	Ga0105246_10007392
2797	Ga0105246_10012777
2798	Ga0105246_10013957
2799	Ga0105246_10298100
2800	Ga0105246_10641369
2801	Ga0105246_11533155
2802	Ga0157336_1035825
2803	Ga0157314_1053473
2804	Ga0157338_1015442
2805	Ga0157373_10057846
2806	Ga0157373_10143155
2807	Ga0157373_10404669
2808	Ga0157371_10044405
2809	Ga0157371_10181633
2810	Ga0157371_10314354
2811	Ga0157370_10023721
2812	Ga0157370_10039704
2813	Ga0157370_10046618
2814	Ga0157370_10461005
2815	Ga0157370_10599872
2816	Ga0157370_10646416
2817	Ga0157370_10869112
2818	Ga0157370_11069293
2819	Ga0157370_12121084
2820	Ga0157369_10007589
2821	Ga0157369_10009884
2822	Ga0157369_10071830
2823	Ga0157369_10467833
2824	Ga0157369_10912936
2825	Ga0157369_11694599
2826	Ga0157369_11838272
2827	Ga0157369_12467736
2828	Ga0157374_10011358
2829	Ga0157374_10027619
2830	Ga0157374_10033343
2831	Ga0157374_11684093
2832	Ga0157378_10003252
2833	Ga0157378_10292268
2834	Ga0163162_10015786
2835	Ga0163162_10086444
2836	Ga0163162_10939351
2837	Ga0163162_11530552
2838	Ga0163162_11724179
2839	Ga0157372_10037121
2840	Ga0157372_10047392
2841	Ga0157372_10187937
2842	Ga0157372_10371492
2843	Ga0157372_10510873
2844	Ga0157372_11068674
2845	Ga0157372_13165677
2846	Ga0157375_10059222
2847	Ga0157375_10127262
2848	Ga0157375_10360420
2849	Ga0157375_10699149
2850	Ga0157375_11197703
2851	Ga0157375_12289359
2852	Ga0157375_12319856
2853	Ga0163163_10048475
2854	Ga0163163_10093629
2855	Ga0163163_10333120
2856	Ga0163163_11138630
2857	Ga0163163_11234292
2858	Ga0157380_10031868
2859	Ga0182008_10332273
2860	Ga0182008_10604409
2861	Ga0182008_10734613
2862	Ga0157377_10013067
2863	Ga0157377_11621377
2864	Ga0157379_10038179
2865	Ga0157379_10176970
2866	Ga0157379_10927658
2867	Ga0157379_11549563
2868	Ga0157379_11688201
2869	Ga0157376_10006973
2870	Ga0157376_10099161
2871	Ga0157376_11682858
2872	Ga0163161_10022855
2873	Ga0163161_10180360
2874	Ga0163161_10210186
2875	Ga0163161_11167376
2876	Ga0163161_11452374
2877	Ga0206356_11476213
2878	Ga0206353_10011407
2879	Ga0154015_1487628
2880	Ga0213873_10047833
2881	Ga0213872_10302953
2882	Ga0213874_10042996
2883	Ga0213876_10002010
2884	Ga0213876_10139883
2885	Ga0213875_10121278
2886	Ga0213875_10339269
2887	Ga0213871_10030454
2888	Ga0247530_116874
2889	Ga0209677_100138
2890	Ga0209148_1006501
2891	Ga0209233_1004761
2892	Ga0209233_1005352
2893	Ga0207666_1000235
2894	Ga0209455_1002510
2895	Ga0209455_1005649
2896	Ga0207673_1000453
2897	Ga0209758_1005809
2898	Ga0209758_1016470
2899	Ga0207697_10000024
2900	Ga0207697_10110608
2901	Ga0207697_10148852
2902	Ga0207697_10427688
2903	Ga0207656_10022529
2904	Ga0207656_10088108
2905	Ga0207656_10097156
2906	Ga0207656_10589388
2907	Ga0207713_1108082
2908	Ga0207653_10004126
2909	Ga0207653_10103221
2910	Ga0207682_10000087
2911	Ga0207682_10427633
2912	Ga0207692_10001479
2913	Ga0207692_10184208
2914	Ga0207710_10011111
2915	Ga0207710_10089435
2916	Ga0207710_10435120
2917	Ga0207710_10446119
2918	Ga0207688_10018466
2919	Ga0207688_10043006
2920	Ga0207680_10021368
2921	Ga0207680_10129971
2922	Ga0207647_10082546
2923	Ga0207647_10097696
2924	Ga0207685_10093816
2925	Ga0207685_10122301
2926	Ga0207685_10146304
2927	Ga0207685_10206825
2928	Ga0207685_10218396
2929	Ga0207699_10001043
2930	Ga0207699_10203981
2931	Ga0207699_10245056
2932	Ga0207699_10307524
2933	Ga0207699_10663046
2934	Ga0207699_10664080
2935	Ga0207699_10741653
2936	Ga0207645_10012517
2937	Ga0207643_10009174
2938	Ga0207643_10142349
2939	Ga0207643_10513552
2940	Ga0207705_10150043
2941	Ga0207705_10212002
2942	Ga0207705_10438459
2943	Ga0207705_10453553
2944	Ga0207705_10517089
2945	Ga0207684_10283518
2946	Ga0207684_10556023
2947	Ga0207684_10636298
2948	Ga0207684_10826287
2949	Ga0207654_10284803
2950	Ga0207654_10472390
2951	Ga0207654_10488099
2952	Ga0207707_10003044
2953	Ga0207707_10003171
2954	Ga0207707_10019021
2955	Ga0207707_10022495
2956	Ga0207707_10060558
2957	Ga0207707_10084788
2958	Ga0207707_10096165
2959	Ga0207707_10221891
2960	Ga0207707_10405789
2961	Ga0207707_10547769
2962	Ga0207695_10021925
2963	Ga0207695_10064514
2964	Ga0207695_10071027
2965	Ga0207695_10201051
2966	Ga0207695_10378674
2967	Ga0207695_10938171
2968	Ga0207695_11376374
2969	Ga0207671_10026128
2970	Ga0207671_10067286
2971	Ga0207671_10149060
2972	Ga0207671_10566971
2973	Ga0207671_10887060
2974	Ga0207671_10915183
2975	Ga0207693_10011325
2976	Ga0207693_10013925
2977	Ga0207693_10016216
2978	Ga0207693_10031663
2979	Ga0207693_10035851
2980	Ga0207693_10046955
2981	Ga0207693_10102143
2982	Ga0207663_10013831
2983	Ga0207663_10047336
2984	Ga0207663_10131515
2985	Ga0207663_10191617
2986	Ga0207663_10279197
2987	Ga0207663_10326198
2988	Ga0207663_10455433
2989	Ga0207663_10907553
2990	Ga0207660_10010857
2991	Ga0207660_10012019
2992	Ga0207660_10045770
2993	Ga0207660_10148231
2994	Ga0207660_10342977
2995	Ga0207660_10604934
2996	Ga0207660_10763472
2997	Ga0207660_10940169
2998	Ga0207660_10991583
2999	Ga0207662_10000635
3000	Ga0207662_10086521
3001	Ga0207662_10175169
3002	Ga0207662_11088571
3003	Ga0207657_10006779
3004	Ga0207657_10009978
3005	Ga0207657_10034334
3006	Ga0207657_10089159
3007	Ga0207657_10200891
3008	Ga0207649_10010099
3009	Ga0207649_10152705
3010	Ga0207649_10321268
3011	Ga0207649_10691595
3012	Ga0207649_10833174
3013	Ga0207649_11146641
3014	Ga0207652_10006101
3015	Ga0207652_10011209
3016	Ga0207652_10018275
3017	Ga0207652_10018498
3018	Ga0207652_10033171
3019	Ga0207652_10036825
3020	Ga0207652_10071415
3021	Ga0207652_10096529
3022	Ga0207652_10451960
3023	Ga0207652_10672685
3024	Ga0207652_11292369
3025	Ga0207652_11349693
3026	Ga0207646_10092892
3027	Ga0207646_10644127
3028	Ga0207646_11011162
3029	Ga0207681_10013135
3030	Ga0207694_10014944
3031	Ga0207694_10038212
3032	Ga0207694_10113764
3033	Ga0207694_10150533
3034	Ga0207694_10398148
3035	Ga0207694_10513923
3036	Ga0207694_10534120
3037	Ga0207694_10720517
3038	Ga0207694_10847672
3039	Ga0207694_11130169
3040	Ga0207650_10131339
3041	Ga0207650_10286498
3042	Ga0207650_10491924
3043	Ga0207650_11373923
3044	Ga0207659_10009175
3045	Ga0207659_10179702
3046	Ga0207687_10125587
3047	Ga0207687_10161032
3048	Ga0207687_10504494
3049	Ga0207687_11187640
3050	Ga0207700_10109107
3051	Ga0207700_10211763
3052	Ga0207700_10251129
3053	Ga0207700_10286552
3054	Ga0207700_10287795
3055	Ga0207700_10489150
3056	Ga0207700_10572508
3057	Ga0207700_10712268
3058	Ga0207664_10084091
3059	Ga0207664_10084929
3060	Ga0207664_10095998
3061	Ga0207664_10164615
3062	Ga0207664_10307217
3063	Ga0207664_10423323
3064	Ga0207664_10430720
3065	Ga0207664_10652936
3066	Ga0207664_10842072
3067	Ga0207664_11511909
3068	Ga0207644_10019937
3069	Ga0207644_10152623
3070	Ga0207644_10896297
3071	Ga0207690_10019117
3072	Ga0207690_10052527
3073	Ga0207690_10063004
3074	Ga0207690_10238865
3075	Ga0207690_10474387
3076	Ga0207690_10911694
3077	Ga0207706_10023021
3078	Ga0207706_10354716
3079	Ga0207706_10363322
3080	Ga0207686_10008201
3081	Ga0207686_10395014
3082	Ga0207709_10012547
3083	Ga0207709_10382897
3084	Ga0207709_11342027
3085	Ga0207670_10018559
3086	Ga0207669_10005648
3087	Ga0207704_10059303
3088	Ga0207665_10005489
3089	Ga0207665_10028739
3090	Ga0207665_10073798
3091	Ga0207665_10078273
3092	Ga0207665_10699175
3093	Ga0207665_10833261
3094	Ga0207691_10021651
3095	Ga0207711_10024215
3096	Ga0207711_10031910
3097	Ga0207711_10202399
3098	Ga0207711_10549437
3099	Ga0207711_11294471
3100	Ga0207689_10004028
3101	Ga0207689_10112974
3102	Ga0207689_10235877
3103	Ga0207661_10000906
3104	Ga0207661_10021818
3105	Ga0207661_10023237
3106	Ga0207661_10035213
3107	Ga0207661_10056819
3108	Ga0207679_10005400
3109	Ga0207679_10302433
3110	Ga0207679_10456659
3111	Ga0207679_11127328
3112	Ga0207679_11638250
3113	Ga0207667_10027037
3114	Ga0207667_10081524
3115	Ga0207667_10123514
3116	Ga0207667_10162909
3117	Ga0207667_10173956
3118	Ga0207667_10234539
3119	Ga0207667_10272252
3120	Ga0207667_10492256
3121	Ga0207667_10538208
3122	Ga0207651_10016096
3123	Ga0207651_10073919
3124	Ga0207651_10384810
3125	Ga0207712_10015527
3126	Ga0207712_10733623
3127	Ga0207668_10013764
3128	Ga0207668_10375993
3129	Ga0207640_10010271
3130	Ga0207640_10344802
3131	Ga0207640_11031315
3132	Ga0207640_11255314
3133	Ga0207658_10028246
3134	Ga0207658_10340785
3135	Ga0207658_11621597
3136	Ga0207677_10017654
3137	Ga0207677_10046452
3138	Ga0207677_10443284
3139	Ga0207677_10667999
3140	Ga0207703_10052285
3141	Ga0207703_10383566
3142	Ga0207703_10899464
3143	Ga0207703_10954995
3144	Ga0207639_10007147
3145	Ga0207639_10071487
3146	Ga0207639_10134037
3147	Ga0207639_10515171
3148	Ga0207639_10842447
3149	Ga0207639_11283395
3150	Ga0207678_10000216
3151	Ga0207678_10030515
3152	Ga0207678_10032157
3153	Ga0207678_10038938
3154	Ga0207678_10130234
3155	Ga0207678_10138632
3156	Ga0207678_10173262
3157	Ga0207678_10186083
3158	Ga0207708_10018421
3159	Ga0207702_10000854
3160	Ga0207702_10058622
3161	Ga0207702_10434391
3162	Ga0207702_10673456
3163	Ga0207702_10773835
3164	Ga0207702_10976370
3165	Ga0207641_10027863
3166	Ga0207641_10820428
3167	Ga0207641_10851043
3168	Ga0207648_10018423
3169	Ga0207676_10522083
3170	Ga0207676_10606089
3171	Ga0207676_10905799
3172	Ga0207674_10002416
3173	Ga0207674_10014786
3174	Ga0207674_10046602
3175	Ga0207674_10423351
3176	Ga0207674_10866440
3177	Ga0207674_10911012
3178	Ga0207675_100000497
3179	Ga0207675_100089455
3180	Ga0207675_101429992
3181	Ga0207683_10021570
3182	Ga0207683_10146830
3183	Ga0207683_10159829
3184	Ga0207683_10198848
3185	Ga0207683_11008687
3186	Ga0207698_10034180
3187	Ga0207698_10120994
3188	Ga0207698_10133316
3189	Ga0207698_10134180
3190	Ga0207698_10441171
3191	Ga0207698_10707613
3192	Ga0209973_1002694
3193	Ga0209589_1000004
3194	Ga0209489_100004
3195	Ga0209700_100004
3196	Ga0209981_1041066
3197	Ga0209984_1019317
3198	Ga0209179_1059072
3199	Ga0209999_1005325
3200	Ga0209970_1012444
3201	Ga0210002_1001644
3202	Ga0209983_1010562
3203	Ga0209588_1011240
3204	Ga0209588_1213303
3205	Ga0209966_1013504
3206	Ga0209998_10004989
3207	Ga0209974_10126024
3208	Ga0207428_10040191
3209	Ga0207428_10142455
3210	Ga0268266_10057192
3211	Ga0268266_10153146
3212	Ga0268266_10208590
3213	Ga0268266_10296614
3214	Ga0268266_12182183
3215	Ga0268265_10120725
3216	Ga0268264_10027294
3217	Ga0268264_10160234
3218	Ga0265334_10010032
3219	Ga0307517_10000315
3220	Ga0307517_10295355
3221	Ga0307517_10343050
3222	Ga0307517_10419020
3223	Ga0307515_10467100
3224	Ga0307515_10767415
3225	Ga0265338_10132265
3226	Ga0265338_10255200
3227	Ga0265338_10790880
3228	Ga0307511_10115053
3229	Ga0307511_10128195
3230	Ga0265763_1036935
3231	Ga0265763_1039783
3232	Ga0265760_10219464
3233	Ga0265760_10320844
3234	Ga0265330_10017113
3235	Ga0265330_10115345
3236	Ga0265330_10121632
3237	Ga0265332_10059951
3238	Ga0265332_10176912
3239	Ga0265320_10005930
3240	Ga0265325_10004491
3241	Ga0265325_10027981
3242	Ga0265329_10120254
3243	Ga0265340_10001950
3244	Ga0265340_10135321
3245	Ga0265340_10179229
3246	Ga0265340_10418930
3247	Ga0265340_10507460
3248	Ga0265339_10011050
3249	Ga0265339_10019552
3250	Ga0265339_10065389
3251	Ga0265339_10282927
3252	Ga0265339_10302361
3253	Ga0265339_10306004
3254	Ga0265339_10325088
3255	Ga0265331_10002962
3256	Ga0265331_10044035
3257	Ga0265331_10047886
3258	Ga0265316_10085965
3259	Ga0265316_10282707
3260	Ga0265316_10491813
3261	Ga0265316_10736400
3262	Ga0307513_10131898
3263	Ga0307509_10528587
3264	Ga0307408_100945466
3265	Ga0307508_10014992
3266	Ga0307508_10042358
3267	Ga0307508_10059377
3268	Ga0307508_10111887
3269	Ga0307508_10151816
3270	Ga0307508_10192629
3271	Ga0307508_10412020
3272	Ga0307514_10574431
3273	Ga0316579_10368140
3274	Ga0265314_10002194
3275	Ga0265314_10047631
3276	Ga0265314_10105470
3277	Ga0265342_10006933
3278	Ga0265342_10048652
3279	Ga0265342_10110738
3280	Ga0265342_10205604
3281	Ga0265342_10212143
3282	Ga0265342_10392753
3283	Ga0307516_10034850
3284	Ga0307516_10061551
3285	Ga0307516_10123420
3286	Ga0307516_10164836
3287	Ga0307516_10197856
3288	Ga0307516_10309576
3289	Ga0307405_10182538
3290	Ga0307413_11667391
3291	Ga0307410_10668544
3292	Ga0307406_10490400
3293	Ga0307406_11949190
3294	Ga0307412_10838125
3295	Ga0307416_100721508
3296	Ga0307416_101393979
3297	Ga0307507_10065871
3298	Ga0307510_10026519
3299	Ga0307510_10057468
3300	Ga0307510_10080498
3301	Ga0307510_10093357
3302	Ga0307510_10237873
3303	Ga0307510_10306319
3304	Ga0316214_1032230
3305	Ga0373930_0016844
3306	Ga0373930_0019564
3307	Ga0373930_0207082
3308	Ga0373950_0004714
3309	Ga0373950_0037858
3310	Ga0373950_0072406
3311	Ga0373958_0004946
3312	Ga0373958_0083117
3313	Ga0373938_0001969
3314	Ga0373938_0077245
3315	Ga0373926_0011726
3316	Ga0373926_0104529
3317	Ga0373926_0162965
3318	Ga0373926_0289426
3319	Ga0373926_0460347
3320	Ga0373928_0028800
3321	Ga0373928_0075729
3322	Ga0373929_0083883
3323	Ga0373934_0007858
3324	Ga0373934_0030209
3325	Ga0373934_0085256
3326	Ga0373934_0102339
3327	Ga0373934_0401822
3328	Ga0373940_0041049
3329	Ga0373940_0058925
3330	Ga0373944_0085852
3331	Ga0373944_0140963
3332	Ga0373949_0100084
3333	Ga0373949_0200659
3334	Ga0373951_0106820
3335	Ga0373952_0238220
3336	Ga0373923_0064818
3337	Ga0373923_0150563
3338	Ga0373923_0238673
3339	Ga0373932_0003178
3340	Ga0373932_0089241
3341	Ga0373932_0159486
3342	Ga0373936_0009066
3343	Ga0373936_0019470
3344	Ga0373936_0033666
3345	Ga0373936_0074859
3346	Ga0373936_0335880
3347	Ga0373939_0034604
3348	Ga0373939_0063215
3349	Ga0373941_0001764
3350	Ga0373945_0032068
3351	Ga0373945_0179049
3352	Ga0373945_0303786
3353	Ga0373945_0380160
3354	Ga0373953_0001313
3355	Ga0373953_0156260
3356	Ga0373953_0201419
3357	Ga0373953_0372791
3358	Ga0373953_0490978
3359	Ga0373954_0009067
3360	Ga0373954_0012997
3361	Ga0373954_0035151
3362	Ga0373954_0052954
3363	Ga0373954_0186567
3364	Ga0373954_0446116
3365	Ga0373954_0550385
3366	Ga0373956_0004696
3367	Ga0373956_0031826
3368	Ga0373956_0042731
3369	Ga0373956_0072301
3370	Ga0373956_0236269
3371	Ga0373957_0015994
3372	Ga0373957_0038519
3373	Ga0373957_0263874
3374	Ga0373960_0025729
3375	Ga0373960_0134875
3376	Ga0373943_0041528
3377	Ga0373943_0048547
3378	Ga0373943_0165948
3379	Ga0373943_0323145
3380	Ga0373943_0560915
3381	Ga0373946_0006892
3382	Ga0373946_0377380
3383	Ga0373946_0657826
3384	Ga0373955_0003971
3385	Ga0373955_0013347
3386	Ga0373955_0013510
3387	Ga0373955_0050138
3388	Ga0373955_0089527
3389	Ga0373955_0108507
3390	Ga0373942_0070189
3391	Ga0373942_0075510
3392	Ga0373942_0078819
3393	Ga0373961_0276245
3394	Ga0373962_0007047
3395	Ga0373924_0013135
3396	Ga0373924_0403193
3397	Ga0373931_0001322
3398	Ga0373931_0003411
3399	Ga0373931_0153455
3400	Ga0373931_0176998
3401	Ga0373931_0243837
3402	Ga0373931_0626572
3403	Ga0373931_0803162
3404	Ga0373935_0002486
3405	Ga0373935_0147422
3406	Ga0373935_0163662
3407	Ga0373935_0255181
3408	Ga0373935_0272228
3409	Ga0373935_0795602
3410	Ga0373935_0920779
3411	Ga0373935_1418866
3412	Ga0373927_0002398
3413	Ga0373927_0008046
3414	Ga0373927_0008864
3415	Ga0373927_0031711
3416	Ga0373927_0043225
3417	Ga0373927_0064531
3418	Ga0373927_0123349
3419	Ga0373927_0360709
3420	Ga0373927_0423538
3421	Ga0373927_0515181
3422	Ga0373933_0000159
3423	Ga0373933_0003951
3424	Ga0373933_0014603
3425	Ga0373933_0160749
3426	Ga0373933_0290949
3427	Ga0373933_0344105
3428	Ga0373933_0369418
3429	Ga0373947_0018604
3430	Ga0373947_0070284
3431	Ga0373947_0095267
3432	Ga0373947_0133790
3433	Ga0373947_0181412
3434	Ga0373947_0232187
3435	Ga0373947_0319306
3436	Ga0373947_0977929
3437	Ga0373937_0043173
3438	Ga0373937_0051830
3439	Ga0373937_0091089
3440	Ga0373937_0171748
3441	Ga0373937_0351774
3442	Ga0373937_0426815
3443	Ga0373937_0489364
3444	Ga0373937_1636544
3445	Ga0373925_0005473
3446	Ga0373925_0012714
3447	Ga0373925_0113139
3448	Ga0373925_0218040
3449	Ga0373925_0587147
3450	Ga0373925_1037680
3451	Ga0373925_1251256
3452	Ga0373925_1349757
3453	Ga0373925_1574644
3454	Ga0373925_1674218
3455	Ga0395899_0010740
3456	Ga0395899_0082079
3457	Ga0395899_0103593
3458	Ga0395900_0006177
3459	Ga0395900_0044631
3460	Ga0395900_0126335
3461	Ga0395900_0192776
3462	Ga0395900_0317639
3463	Ga0395900_0402705
3464	Ga0395900_0784567
3465	Ga0395898_0008904
3466	Ga0395898_0022295
3467	Ga0395898_0025663
3468	Ga0395898_0032451
3469	Ga0395898_0047513
3470	Ga0395905_0099190
3471	Ga0436364_0227753
3472	Ga0436364_0532278
3473	Ga0436364_0560944
3474	Ga0436364_1283998
3475	Ga0436364_1398857
3476	Ga0436364_1450510
3477	Ga0395901_0056670
3478	Ga0395901_0092167
3479	Ga0395901_0119653
3480	Ga0395901_0352190
3481	Ga0395901_0913343
3482	Ga0436365_0353054
3483	Ga0436365_0376651
3484	Ga0436365_0514738
3485	Ga0436365_1004288
3486	Ga0436365_1065976
3487	Ga0436365_1146080
3488	Ga0436365_1310157
3489	Ga0436365_1557769
3490	Ga0436365_1848103
3491	Ga0436360_0258917
3492	Ga0436360_0677590
3493	Ga0436360_0694457
3494	Ga0436361_0043816
3495	Ga0436361_0319617
3496	Ga0436361_1061147
3497	Ga0436363_0502602
3498	Ga0436363_0546400
3499	Ga0436363_0636039
3500	Ga0436363_0719791
3501	Ga0436363_1005584
3502	Ga0436363_1252148
3503	Ga0436363_1554092
3504	Ga0436363_1628687
3505	Ga0436363_1717547
3506	Ga0436362_0819399
3507	Ga0436362_0836093
3508	Ga0439461_0068368
3509	Ga0451793_0104807
3510	Ga0451797_0352053
3511	Ga0451795_0756830
3512	Ga0451795_0761934
3513	Ga0451795_0858438
3514	Ga0451802_1063278
3515	Ga0451802_1196543
3516	Ga0451804_0722157
3517	Ga0451804_0920072
3518	Ga0451833_1099822
3519	Ga0451835_0857824
3520	Ga0451837_0764153
3521	Ga0451839_0405707
3522	Ga0451845_0254031
3523	Ga0451849_0628187
3524	Ga0451849_1162691
3525	Ga0451851_0436017
3526	Ga0451843_1251811
3527	Ga0451853_0844485
3528	Ga0439441_037605
3529	Ga0439445_0104801
3530	Ga0439448_0038578
3531	Ga0439450_010227
3532	Ga0439450_134806
3533	Ga0439455_0043082
3534	Ga0439464_0157036
3535	Ga0450893_0076350
3536	Ga0439440_0161999
3537	Ga0466969_0047101
3538	Ga0466969_0182532
3539	Ga0466965_0314546
3540	Ga0466966_0076378
3541	Ga0466966_0154750
3542	Ga0466966_0486578
3543	Ga0466961_0065815
3544	Ga0466961_0820737
3545	Ga0466963_0038916
3546	Ga0466963_0395685
3547	Ga0466963_0805165
3548	Ga0466964_0208899
3549	Ga0466970_0048321
3550	Ga0466957_1111672
3551	Ga0466959_0054917
3552	Ga0466959_0087303
3553	Ga0466958_0473174
3554	Ga0466967_0333795
3555	Ga0466967_0936663
3556	Ga0466967_1104768
3557	Ga0466967_1404956
3558	Ga0495617_061141
3559	Ga0495617_073030
3560	Ga0495592_0015700
3561	Ga0495592_0026278
3562	Ga0495592_0072587
3563	Ga0495592_0084903
3564	Ga0495592_0227945
3565	Ga0495592_0231284
3566	Ga0495592_0238937
3567	Ga0495603_0008490
3568	Ga0495603_0013031
3569	Ga0495603_0037141
3570	Ga0495603_0093112
3571	Ga0495603_0675842
3572	Ga0495590_0443987
3573	Ga0495629_0004438
3574	Ga0495629_0005450
3575	Ga0495629_0028196
3576	Ga0495629_0281091
3577	Ga0495629_0296285
3578	Ga0495629_0356641
3579	Ga0495638_0115825
3580	Ga0495638_0255242
3581	Ga0495638_0375960
3582	Ga0495641_0026756
3583	Ga0495651_0002525
3584	Ga0495651_0011489
3585	Ga0495651_0037503
3586	Ga0495651_0075980
3587	Ga0495651_0130228
3588	Ga0495651_0283285
3589	Ga0495651_0319807
3590	Ga0495651_0664308
3591	Ga0495653_0006566
3592	Ga0495653_0022990
3593	Ga0495653_0048926
3594	Ga0495653_0485981
3595	Ga0495653_0578728
3596	Ga0495653_0964105
3597	Ga0495650_0275497
3598	Ga0495580_0001797
3599	Ga0495580_0051628
3600	Ga0495580_0254846
3601	Ga0495582_0001266
3602	Ga0495582_0073842
3603	Ga0495582_0427912
3604	Ga0495582_0592152
3605	Ga0495605_0142266
3606	Ga0495605_0196860
3607	Ga0495605_0251024
3608	Ga0495639_0001127
3609	Ga0495639_0028125
3610	Ga0495639_0183330
3611	Ga0495639_0250035
3612	Ga0495662_0118406
3613	Ga0495662_0254964
3614	Ga0495662_0462572
3615	Ga0495662_0550702
3616	Ga0495662_0653275
3617	Ga0495664_0051810
3618	Ga0495664_0051954
3619	Ga0495664_0187485
3620	Ga0495664_0191760
3621	Ga0495664_0286786
3622	Ga0495664_0595431
3623	Ga0495664_0804774
3624	Ga0495664_0843315
3625	Ga0495584_0096090
3626	Ga0495584_0309949
3627	Ga0495584_0644294
3628	Ga0495585_0118479
3629	Ga0495594_0001151
3630	Ga0495594_0050733
3631	Ga0495594_0457433
3632	Ga0495594_0651163
3633	Ga0495596_0131412
3634	Ga0495596_0332200
3635	Ga0495596_0337070
3636	Ga0495607_0028444
3637	Ga0495607_0227399
3638	Ga0495583_0030304
3639	Ga0495606_0003130
3640	Ga0495606_0046592
3641	Ga0495606_0091462
3642	Ga0495606_0136725
3643	Ga0495606_0178901
3644	Ga0495606_0205552
3645	Ga0495606_0378751
3646	Ga0495606_0427824
3647	Ga0495608_0013607
3648	Ga0495608_0044351
3649	Ga0495608_0114554
3650	Ga0495608_0246568
3651	Ga0495608_0338120
3652	Ga0495608_0350531
3653	Ga0495610_0074094
3654	Ga0495610_0110913
3655	Ga0495618_0039698
3656	Ga0495618_0043612
3657	Ga0495618_0127082
3658	Ga0495620_0021668
3659	Ga0495620_0040572
3660	Ga0495628_0035169
3661	Ga0495628_0035306
3662	Ga0495628_0038574
3663	Ga0495628_0177567
3664	Ga0495628_0674431
3665	Ga0495628_0852394
3666	Ga0495630_0324348
3667	Ga0495631_0115415
3668	Ga0495632_0030316
3669	Ga0495632_0148436
3670	Ga0495632_0303492
3671	Ga0495637_0048047
3672	Ga0495643_0222483
3673	Ga0495648_0006509
3674	Ga0495648_0066979
3675	Ga0495648_0092046
3676	Ga0495648_0150895
3677	Ga0495648_0331373
3678	Ga0495666_0049090
3679	Ga0495666_0441002
3680	Ga0495642_0170985
3681	Ga0495642_0289871
3682	Ga0495652_0033314
3683	Ga0495652_0077957
3684	Ga0495652_0091143
3685	Ga0495652_0146359
3686	Ga0495652_0209796
3687	Ga0495652_0306281
3688	Ga0495652_0548258
3689	Ga0495652_0695467
3690	Ga0495652_0812150
3691	Ga0495654_0231632
3692	Ga0495654_0300455
3693	Ga0495665_0000387
3694	Ga0495665_0081019
3695	Ga0495665_0225382
3696	Ga0495665_0319718
3697	Ga0495640_0007176
3698	Ga0495640_0014256
3699	Ga0495640_0019657
3700	Ga0495640_0024804
3701	Ga0495640_0082038
3702	Ga0495640_0797998
3703	Ga0495586_0147667
3704	Ga0495586_0423790
3705	Ga0495587_0016717
3706	Ga0495587_0085150
3707	Ga0495587_0161103
3708	Ga0495587_0180707
3709	Ga0495587_0497535
3710	Ga0495609_0115269
3711	Ga0495609_0121888
3712	Ga0495609_0240796
3713	Ga0495621_0462332
3714	Ga0495597_0114943
3715	Ga0495645_0041499
3716	Ga0495645_0080936
3717	Ga0495645_0099462
3718	Ga0495645_0131153
3719	Ga0495645_0255342
3720	Ga0495645_0607776
3721	Ga0495645_0899777
3722	Ga0495622_0004221
3723	Ga0495622_0021505
3724	Ga0495622_0115989
3725	Ga0495667_0023438
3726	Ga0495667_0025085
3727	Ga0495667_0043546
3728	Ga0495667_0087336
3729	Ga0495667_0474713
3730	Ga0495656_0039358
3731	Ga0495656_0651019
3732	Ga0495656_0753906
3733	Ga0495656_0784496
3734	Ga0495668_0077059
3735	Ga0495668_0183810
3736	Ga0495668_0363694
3737	Ga0495668_0777618
3738	Ga0495634_0056589
3739	Ga0495634_0061779
3740	Ga0495634_0082626
3741	Ga0495634_0166715
3742	Ga0495634_0212457
3743	Ga0495634_0248938
3744	Ga0495634_0315933
3745	Ga0495634_0723220
3746	Ga0495634_0756860
3747	Ga0495611_0031706
3748	Ga0495611_0044474
3749	Ga0495611_0047036
3750	Ga0495611_0154375
3751	Ga0495611_0200585
3752	Ga0495625_0080624
3753	Ga0495625_0111692
3754	Ga0495625_0361769
3755	Ga0495625_0493425
3756	Ga0495625_0895049
3757	Ga0495635_0007958
3758	Ga0495635_0009875
3759	Ga0495635_0025778
3760	Ga0495635_0065003
3761	Ga0495635_0129827
3762	Ga0495635_0230994
3763	Ga0495635_0588159
3764	Ga0495661_0007907
3765	Ga0495661_0416481
3766	Ga0495588_0019891
3767	Ga0495588_0072753
3768	Ga0495588_0208042
3769	Ga0495657_0002717
3770	Ga0495657_0013118
3771	Ga0495657_0018893
3772	Ga0495657_0097535
3773	Ga0495657_0144106
3774	Ga0495657_0188652
3775	Ga0495657_0313653
3776	Ga0495657_0472416
3777	Ga0495599_0072048
3778	Ga0495599_0123490
3779	Ga0495599_0516124
3780	Ga0495599_0593477
3781	Ga0495623_0047712
3782	Ga0495623_0134542
3783	Ga0495623_0194029
3784	Ga0495623_0255166
3785	Ga0495623_0286088
3786	Ga0495623_0332354
3787	Ga0495623_0334336
3788	Ga0495646_0014421
3789	Ga0495646_0024478
3790	Ga0495646_0153634
3791	Ga0495646_0255212
3792	Ga0495646_0477911
3793	Ga0495647_0007713
3794	Ga0495647_0120768
3795	Ga0495647_0566651
3796	Ga0495658_0004691
3797	Ga0495658_0252766
3798	Ga0495658_0384357
3799	Ga0495658_0483038
3800	Ga0495669_0128710
3801	Ga0495669_0390233
3802	Ga0495613_0014064
3803	Ga0495613_0021064
3804	Ga0495613_0390296
3805	Ga0495613_0485747
3806	Ga0495613_0519865
3807	Ga0495613_0762518
3808	Ga0495624_0005689
3809	Ga0495624_0023741
3810	Ga0495624_0317464
3811	Ga0495670_0514360
3812	Ga0495671_0146379
3813	Ga0495671_0179162
3814	Ga0495671_0328730
3815	Ga0495649_0094492
3816	Ga0495649_0116342
3817	Ga0495649_0291469
3818	Ga0495589_0017902
3819	Ga0495589_0544834
3820	Ga0495600_0000716
3821	Ga0495600_0039472
3822	Ga0495600_0057783
3823	Ga0495600_0066959
3824	Ga0495600_0169519
3825	Ga0495600_0851069
3826	Ga0495581_0001283
3827	Ga0495581_0048546
3828	Ga0495581_0071672
3829	Ga0495581_0214943
3830	Ga0495581_0391619
3831	Ga0495604_0020153
3832	Ga0495604_0050675
3833	Ga0495604_0062553
3834	Ga0495604_0090277
3835	Ga0495604_0101759
3836	Ga0495604_0273857
3837	Ga0495604_0364377
3838	Ga0495604_0816141
3839	Ga0495674_0005092
3840	Ga0495674_0021169
3841	Ga0495674_0050698
3842	Ga0495674_0350557
3843	Ga0495674_0383131
3844	Ga0495674_0407360
3845	Ga0495672_0014319
3846	Ga0495672_0129178
3847	Ga0495672_0214676
3848	Ga0495672_0243605
3849	Ga0495676_0016119
3850	Ga0495676_0051671
3851	Ga0495680_0008078
3852	Ga0495680_0011117
3853	Ga0495680_0092338
3854	Ga0495680_0124195
3855	Ga0495680_0497733
3856	Ga0495683_0045580
3857	Ga0495683_0111677
3858	Ga0495683_0358498
3859	Ga0495683_0400170
3860	Ga0495687_114119
3861	Ga0495687_123504
3862	Ga0495675_0002561
3863	Ga0495675_0020996
3864	Ga0495675_0025843
3865	Ga0495675_0085852
3866	Ga0495675_0218322
3867	Ga0495677_0072952
3868	Ga0495677_0264783
3869	Ga0495677_0276310
3870	Ga0495673_0098874
3871	Ga0495673_0102866
3872	Ga0495681_0299519
3873	Ga0495684_0015756
3874	Ga0495684_0030092
3875	Ga0495684_0122413
3876	Ga0495684_0143674
3877	Ga0495684_0320788
3878	Ga0495684_0455179
3879	Ga0495684_0889380
3880	Ga0495684_0961738
3881	Ga0495686_0016846
3882	Ga0495686_0020174
3883	Ga0495686_0072469
3884	Ga0495686_0099238
3885	Ga0495686_0166096
3886	Ga0495686_0202004
3887	Ga0495686_0333764
3888	Ga0495686_0349621
3889	Ga0495593_0001105
3890	Ga0495593_0003538
3891	Ga0495593_0067409
3892	Ga0495593_0097452
3893	Ga0495593_0315138
3894	Ga0495593_0418314
3895	Ga0495593_0539323
3896	Ga0495602_0018673
3897	Ga0495602_0081114
3898	Ga0495602_0214632
3899	Ga0495602_0251617
3900	Ga0495602_0774221
3901	Ga0495602_1001104
3902	Ga0495614_0053761
3903	Ga0496100_0005331
3904	Ga0496100_0195799
3905	Ga0496100_0286238
3906	Ga0496100_0378342
3907	Ga0496100_1024815
3908	Ga0496101_0014003
3909	Ga0496101_0100615
3910	Ga0496101_0232142
3911	Ga0496101_0664693
3912	Ga0496101_0859981
3913	Ga0496101_0969444
3914	Ga0496102_0012227
3915	Ga0496102_0012429
3916	Ga0496102_0043423
3917	Ga0496102_0174423
3918	Ga0496102_0577102
3919	Ga0496102_0781907
3920	Ga0496102_1863245
3921	Ga0496103_0056098
3922	Ga0496103_0329729
3923	Ga0496104_0009476
3924	Ga0496104_0016178
3925	Ga0496104_0041599
3926	Ga0496104_0088563
3927	Ga0496104_0129469
3928	Ga0496104_0167850
3929	Ga0496104_0297573
3930	Ga0496104_0363031
3931	Ga0496105_0005739
3932	Ga0496105_0021062
3933	Ga0496105_0416560
3934	Ga0496105_0473160
3935	Ga0496105_1153117
3936	Ga0496105_1240576
3937	Ga0496106_0012530
3938	Ga0496106_0016691
3939	Ga0496106_0018266
3940	Ga0496106_0020292
3941	Ga0496106_0051085
3942	Ga0496106_0174505
3943	Ga0496106_0393301
3944	Ga0496106_0471672
3945	Ga0496106_0537785
3946	Ga0496106_0743425
3947	Ga0496107_0003304
3948	Ga0496107_0008082
3949	Ga0496107_0013843
3950	Ga0496107_0043644
3951	Ga0496107_0152111
3952	Ga0496107_0684643
3953	Ga0496108_0007942
3954	Ga0496108_0021225
3955	Ga0496108_0029934
3956	Ga0496108_0032611
3957	Ga0496108_0628994
3958	Ga0496108_0748692
3959	Ga0496108_0798413
3960	Ga0496108_0887175
3961	Ga0496108_1350394
3962	Ga0496109_0003687
3963	Ga0496109_0025306
3964	Ga0496109_0040943
3965	Ga0496109_0067546
3966	Ga0496109_0085896
3967	Ga0496109_0154677
3968	Ga0496109_0544166
3969	Ga0496109_0687921
3970	Ga0496109_1056847
3971	Ga0496110_0004964
3972	Ga0496110_0034353
3973	Ga0496110_0077171
3974	Ga0496110_0354656
3975	Ga0496110_0697498
3976	Ga0496111_0008299
3977	Ga0496111_0098884
3978	Ga0496111_0232459
3979	Ga0496111_0410631
3980	Ga0496111_0421955
3981	Ga0496111_0675582
3982	Ga0496111_0960695
3983	Ga0496111_1325230
3984	Ga0496112_0000206
3985	Ga0496112_0005422
3986	Ga0496112_0008279
3987	Ga0496112_0064891
3988	Ga0496112_0084595
3989	Ga0496112_0136775
3990	Ga0496112_0269342
3991	Ga0496112_0399111
3992	Ga0496112_0408342
3993	Ga0496112_0703365
3994	Ga0496113_0016314
3995	Ga0496113_0030553
3996	Ga0496113_0099729
3997	Ga0496113_0118733
3998	Ga0496114_0019967
3999	Ga0496114_0024984
4000	Ga0496114_0124554
4001	Ga0496114_0127181
4002	Ga0496114_0172853
4003	Ga0496114_0198015
4004	Ga0496114_0594559
4005	Ga0496114_0762789
4006	Ga0496114_1021961
4007	Ga0496114_1618578
4008	Ga0496115_0001377
4009	Ga0496115_0044845
4010	Ga0496115_0049168
4011	Ga0496115_0093858
4012	Ga0496115_0117827
4013	Ga0496115_0147833
4014	Ga0496115_0148988
4015	Ga0496115_0162626
4016	Ga0496115_0164760
4017	Ga0496115_0167099
4018	Ga0496115_0227314
4019	Ga0496115_0372377
4020	Ga0496115_0509654
4021	Ga0496116_0017030
4022	Ga0496116_0121846
4023	Ga0496117_0034062
4024	Ga0496117_0051689
4025	Ga0496117_0085163
4026	Ga0496117_0120350
4027	Ga0496117_0130331
4028	Ga0496117_0174167
4029	Ga0496118_0013465
4030	Ga0496118_0019942
4031	Ga0496118_0083221
4032	Ga0496118_0227580
4033	Ga0496118_0252604
4034	Ga0496119_0041768
4035	Ga0496119_0046117
4036	Ga0496119_0071371
4037	Ga0496120_0008077
4038	Ga0496120_0058495
4039	Ga0496120_0066772
4040	Ga0496121_0001934
4041	Ga0496121_0005854
4042	Ga0496121_0020191
4043	Ga0496121_0039869
4044	Ga0496121_0045204
4045	Ga0496121_0051282
4046	Ga0496121_0070819
4047	Ga0496121_0076065
4048	Ga0496121_0097429
4049	Ga0496121_0104300
4050	Ga0496121_0126237
4051	Ga0496121_0156239
4052	Ga0496121_0167833
4053	Ga0496121_0250121
4054	Ga0496121_0911807
4055	Ga0496122_0278679
4056	Ga0496123_0079157
4057	Ga0496123_0098906
4058	Ga0496123_0330768
4059	Ga0496123_0374620
4060	Ga0496124_0034959
4061	Ga0496124_0083548
4062	Ga0496124_0084852
4063	Ga0496124_0116077
4064	Ga0496124_0172218
4065	Ga0496124_0226487
4066	Ga0496124_0330913
4067	Ga0496124_0352413
4068	Ga0496124_0685247
4069	Ga0496125_0000063
4070	Ga0496125_0000829
4071	Ga0496125_0029627
4072	Ga0496125_0110232
4073	Ga0496125_0141449
4074	Ga0496125_0210012
4075	Ga0496125_0371983
4076	Ga0496125_0399916
4077	Ga0496125_0460590
4078	Ga0496126_0005845
4079	Ga0496126_0008064
4080	Ga0496126_0010991
4081	Ga0496126_0022305
4082	Ga0496126_0042276
4083	Ga0496126_0043155
4084	Ga0496126_0044994
4085	Ga0496126_0047811
4086	Ga0496126_0073326
4087	Ga0496126_0081826
4088	Ga0496126_0109095
4089	Ga0496126_0126259
4090	Ga0496126_0192457
4091	Ga0496126_0216005
4092	Ga0496126_0222101
4093	Ga0496126_0254677
4094	Ga0496126_0269799
4095	Ga0496126_0271167
4096	Ga0496126_0347215
4097	Ga0496126_0449399
4098	Ga0496126_0610025
4099	Ga0496126_0808625
4100	Ga0496126_0940616
4101	Ga0496126_1031009
4102	Ga0496126_1120475
4103	Ga0495682_0029570
4104	Ga0495682_0204085
4105	Ga0495682_0209688
4106	Ga0495682_0229754
4107	Ga0495682_0326270
4108	Ga0501031_0000296
4109	Ga0501031_0095896
4110	Ga0501031_0156920
4111	Ga0501031_0772551
4112	Ga0501031_0827063
4113	Ga0501032_0000244
4114	Ga0501032_0032691
4115	Ga0501032_0047690
4116	Ga0501032_0055397
4117	Ga0501032_0064708
4118	Ga0501032_0238099
4119	Ga0501032_0638046
4120	Ga0501032_0700202
4121	Ga0501032_1023783
4122	Ga0501032_1093992
4123	Ga0501033_0001015
4124	Ga0501033_0007360
4125	Ga0501033_0203747
4126	Ga0501033_0248365
4127	Ga0501033_0482033
4128	Ga0501033_0546705
4129	Ga0501033_0596289
4130	Ga0501034_0001010
4131	Ga0501034_0012100
4132	Ga0501034_0013977
4133	Ga0501034_0085942
4134	Ga0501034_0154116
4135	Ga0501034_0301904
4136	Ga0501034_0353303
4137	Ga0501034_0524455
4138	Ga0501034_0749578
4139	Ga0501034_0753674
4140	Ga0501034_1031719
4141	Ga0501034_1179272
4142	Ga0501036_0000405
4143	Ga0501036_0011247
4144	Ga0501036_0047043
4145	Ga0501036_0081024
4146	Ga0501036_0124757
4147	Ga0501036_0126909
4148	Ga0501036_0808951
4149	Ga0501037_0000139
4150	Ga0501037_0011448
4151	Ga0501037_0031397
4152	Ga0501037_0041972
4153	Ga0501037_0108563
4154	Ga0501037_0179105
4155	Ga0501037_1126743
4156	Ga0501038_0000659
4157	Ga0501038_0009242
4158	Ga0501038_0032678
4159	Ga0501038_0034763
4160	Ga0501038_0115548
4161	Ga0501038_0229060
4162	Ga0501038_0277015
4163	Ga0501038_0682330
4164	Ga0501039_0001703
4165	Ga0501039_0066237
4166	Ga0501039_0112611
4167	Ga0501039_0246970
4168	Ga0501039_0299722
4169	Ga0501039_0355178
4170	Ga0501039_0916351
4171	Ga0501040_0181865
4172	Ga0501040_0716806
4173	Ga0501041_0863146
4174	Ga0501042_0008661
4175	Ga0501042_0074414
4176	Ga0501042_1409306
4177	Ga0501043_0000021
4178	Ga0501043_0010159
4179	Ga0501043_0011657
4180	Ga0501043_0025307
4181	Ga0501043_0057546
4182	Ga0501043_0075716
4183	Ga0501043_0088020
4184	Ga0501043_0160842
4185	Ga0501043_0242522
4186	Ga0501046_0000905
4187	Ga0501046_0018059
4188	Ga0501046_0019966
4189	Ga0501046_0047930
4190	Ga0501046_0129777
4191	Ga0501046_0336279
4192	Ga0501047_0000041
4193	Ga0501047_0046050
4194	Ga0501047_0056228
4195	Ga0501047_0093327
4196	Ga0501047_0106647
4197	Ga0501047_0148724
4198	Ga0501047_0149326
4199	Ga0501047_0584409
4200	Ga0501047_0595149
4201	Ga0501048_0000077
4202	Ga0501048_0007662
4203	Ga0501048_0025794
4204	Ga0501048_0097907
4205	Ga0501048_0277859
4206	Ga0501048_0371823
4207	Ga0501048_1352653
4208	Ga0501067_0000360
4209	Ga0501067_0035178
4210	Ga0501067_0053240
4211	Ga0501067_0131650
4212	Ga0501067_0384568
4213	Ga0501068_0000615
4214	Ga0501068_0046970
4215	Ga0501068_0147999
4216	Ga0501069_0000444
4217	Ga0501069_0004047
4218	Ga0501069_0026334
4219	Ga0501069_0101091
4220	Ga0501069_0837426
4221	Ga0501070_0012417
4222	Ga0501070_0018768
4223	Ga0501070_0024774
4224	Ga0501070_0207430
4225	Ga0501070_0241185
4226	Ga0501070_0686561
4227	Ga0501070_0869498
4228	Ga0501070_0898184
4229	Ga0501071_0029942
4230	Ga0501071_0081125
4231	Ga0501071_0616173
4232	Ga0501072_0002889
4233	Ga0501072_0005294
4234	Ga0501072_0026930
4235	Ga0501072_0541890
4236	Ga0501072_1568459
4237	Ga0501073_0012051
4238	Ga0501073_0032509
4239	Ga0501073_0046272
4240	Ga0501073_0159996
4241	Ga0501073_0173839
4242	Ga0501073_0601133
4243	Ga0501073_0618607
4244	Ga0501074_0002874
4245	Ga0501074_0039159
4246	Ga0501074_0054680
4247	Ga0501074_0113393
4248	Ga0501076_0091239
4249	Ga0501076_0139601
4250	Ga0501076_0298179
4251	Ga0501077_0072705
4252	Ga0501077_0273766
4253	Ga0501079_0002023
4254	Ga0501079_0059981
4255	Ga0501079_0077153
4256	Ga0501080_0005648
4257	Ga0501080_0009361
4258	Ga0501080_0091380
4259	Ga0501080_0482855
4260	Ga0501080_1371578
4261	Ga0501083_0000708
4262	Ga0501083_0010325
4263	Ga0501083_0013029
4264	Ga0501083_0168251
4265	Ga0501083_0463674
4266	Ga0501035_0000090
4267	Ga0501035_0004697
4268	Ga0501035_0071086
4269	Ga0501035_0088372
4270	Ga0501035_0110118
4271	Ga0501035_0176374
4272	Ga0501035_0237471
4273	Ga0501035_0338323
4274	Ga0501044_0000054
4275	Ga0501044_0009165
4276	Ga0501044_0026000
4277	Ga0501044_0086635
4278	Ga0501044_0262384
4279	Ga0501044_0390133
4280	Ga0501044_0553292
4281	Ga0501044_0644076
4282	Ga0501045_0034866
4283	Ga0501045_0071568
4284	Ga0501045_0193183
4285	Ga0501045_0252531
4286	nmdc:mga03683_157232_c1
4287	nmdc:mga03n38_202479_c1
4288	nmdc:mga03n38_253_c1
4289	nmdc:mga03n38_55251_c1
4290	nmdc:mga00v17_28731_c1
4291	nmdc:mga00v17_37039_c1
4292	nmdc:mga00v17_972743_c1
4293	nmdc:mga0yw44_266101_c1
4294	nmdc:mga0yw44_291202_c1
4295	nmdc:mga0yw44_306553_c1
4296	nmdc:mga0yw44_61011_c1
4297	nmdc:mga0yw44_664316_c1
4298	nmdc:mga0yw44_75483_c1
4299	nmdc:mga0yw44_81418_c1
4300	nmdc:mga0k408_103524_c1
4301	nmdc:mga06z11_111744_c1
4302	nmdc:mga06z11_189601_c1
4303	nmdc:mga06z11_21680_c1
4304	nmdc:mga06z11_434447_c1
4305	nmdc:mga04h51_113869_c1
4306	nmdc:mga04h51_12930_c1
4307	nmdc:mga04h51_18936_c1
4308	nmdc:mga07m45_11052_c1
4309	nmdc:mga07m45_14472_c1
4310	nmdc:mga07m45_403837_c1
4311	nmdc:mga07m45_629482_c1
4312	nmdc:mga07m45_636919_c1
4313	nmdc:mga07m45_640671_c1
4314	nmdc:mga07m45_778327_c1
4315	nmdc:mga05p37_377925_c1
4316	nmdc:mga09592_295501_c1
4317	nmdc:mga06r32_251057_c1
4318	nmdc:mga08y16_1090581_c1
4319	nmdc:mga08y16_291698_c1
4320	nmdc:mga08y16_344121_c1
4321	nmdc:mga08y16_542289_c1
4322	nmdc:mga0n895_1969676_c1
4323	nmdc:mga0n895_261000_c1
4324	nmdc:mga0n895_28679_c1
4325	nmdc:mga0n895_9131_c1
4326	nmdc:mga0rr50_156212_c1
4327	nmdc:mga0rr50_1636965_c1
4328	nmdc:mga0rr50_1877208_c1
4329	nmdc:mga0rr50_336727_c1
4330	nmdc:mga0rr50_807575_c1
4331	nmdc:mga08x19_137615_c1
4332	nmdc:mga08x19_385_c1
4333	nmdc:mga0a205_42275_c1
4334	nmdc:mga0sz30_19636_c1
4335	Ga0495601_0007076
4336	Ga0495601_0017559
4337	Ga0495601_0055423
4338	Ga0495601_0063139
4339	Ga0495601_0196055
4340	Ga0495601_0269852
4341	Ga0495601_0351084
4342	Ga0495601_0834372
4343	Ga0495612_0016043
4344	Ga0495612_0038950
4345	Ga0495612_0145523
4346	Ga0495612_0243543
4347	Ga0495612_0347676
4348	Ga0500610_0101301
4349	Ga0500635_0006466
4350	Ga0500635_0037969
4351	Ga0500635_0108224
4352	Ga0500635_0134163
4353	Ga0495655_0019887
4354	Ga0495655_0092015
4355	Ga0495655_0173715
4356	Ga0495655_0302259
4357	Ga0495595_0003789
4358	Ga0495595_0008686
4359	Ga0495595_0015978
4360	Ga0495595_0113332
4361	Ga0495619_0004493
4362	Ga0495619_0094854
4363	Ga0495619_0117993
4364	Ga0495619_0290253
4365	Ga0495619_0297452
4366	Ga0495619_0303303
4367	Ga0495619_0306665
4368	Ga0495619_0487927
4369	Ga0500578_0064532
4370	Ga0500578_0098568
4371	Ga0500578_0210607
4372	Ga0500643_021798
4373	Ga0500644_0008642
4374	Ga0500644_0022502
4375	Ga0500644_0030059
4376	Ga0500644_0115990
4377	Ga0500646_0006024
4378	Ga0500646_0147031
4379	Ga0500646_0164022
4380	Ga0500583_0066349
4381	Ga0500583_0156815
4382	Ga0500583_0568188
4383	Ga0500583_0585364
4384	Ga0500651_0048332
4385	Ga0500651_0068878
4386	Ga0500651_0219551
4387	Ga0500651_0352124
4388	Ga0500566_0000286
4389	Ga0500566_0017000
4390	Ga0500640_173255
4391	Ga0500641_0013374
4392	Ga0500641_0058252
4393	Ga0500641_0085168
4394	Ga0500650_0000303
4395	Ga0500554_002745
4396	Ga0500554_003058
4397	Ga0500555_065469
4398	Ga0500556_0000015
4399	Ga0500556_0032645
4400	Ga0500556_0157778
4401	Ga0500557_000067
4402	Ga0500557_264290
4403	Ga0500558_220524
4404	Ga0500560_221542
4405	Ga0500569_002124
4406	Ga0500569_003911
4407	Ga0500569_025145
4408	Ga0500572_001597
4409	Ga0500572_002982
4410	Ga0500572_021027
4411	Ga0500592_011208
4412	Ga0500594_0005337
4413	Ga0500594_0014905
4414	Ga0500595_003206
4415	Ga0500595_008771
4416	Ga0500595_010344
4417	Ga0500595_016343
4418	Ga0500595_016392
4419	Ga0500595_028137
4420	Ga0500595_030987
4421	Ga0500595_031606
4422	Ga0500595_142139
4423	Ga0500595_151126
4424	Ga0500597_130371
4425	Ga0500607_044464
4426	Ga0500607_067455
4427	Ga0500608_001127
4428	Ga0500608_031890
4429	Ga0500608_036232
4430	Ga0500608_042958
4431	Ga0500614_007891
4432	Ga0500621_055842
4433	Ga0500621_135245
4434	Ga0500628_242446
4435	Ga0500642_0000019
4436	Ga0500642_0000185
4437	Ga0500642_0006744
4438	Ga0500642_0014624
4439	Ga0500642_0244838
4440	Ga0500642_0274321
4441	Ga0500652_374206
4442	Ga0500655_015901
4443	Ga0500658_0034809
4444	Ga0500658_0134696
4445	Ga0500559_0000130
4446	Ga0500559_0000596
4447	Ga0500559_0010555
4448	Ga0500559_0038434
4449	Ga0500559_0112776
4450	Ga0500559_0295045
4451	Ga0500559_0298479
4452	Ga0500559_0498908
4453	Ga0500561_0188524
4454	Ga0500564_026644
4455	Ga0500568_0001108
4456	Ga0500568_0015530
4457	Ga0500568_0025078
4458	Ga0500568_0027814
4459	Ga0500568_0031521
4460	Ga0500568_0045818
4461	Ga0500568_0125672
4462	Ga0500573_0311057
4463	Ga0500573_0482459
4464	Ga0500573_0518060
4465	Ga0500577_0000032
4466	Ga0500577_0036276
4467	Ga0500577_0090871
4468	Ga0500585_210898
4469	Ga0500585_262886
4470	Ga0500586_009874
4471	Ga0500588_0042373
4472	Ga0500589_066461
4473	Ga0500589_310173
4474	Ga0500590_070828
4475	Ga0500590_141247
4476	Ga0500590_316998
4477	Ga0500603_000347
4478	Ga0500603_036648
4479	Ga0500603_046723
4480	Ga0500604_0006496
4481	Ga0500616_0000041
4482	Ga0500616_0000084
4483	Ga0500616_0025767
4484	Ga0500616_0045606
4485	Ga0500619_013366
4486	Ga0500622_0002439
4487	Ga0500622_0023296
4488	Ga0500622_0072397
4489	Ga0500624_006451
4490	Ga0500624_043219
4491	Ga0500627_0063983
4492	Ga0500627_0079796
4493	Ga0500627_0092097
4494	Ga0500627_0283200
4495	Ga0500630_013143
4496	Ga0500633_0128837
4497	Ga0500634_0043816
4498	Ga0500634_0081123
4499	Ga0500638_002167
4500	Ga0500638_009987
4501	Ga0500638_042226
4502	Ga0500638_083921
4503	Ga0500638_129794
4504	Ga0500639_094961
4505	Ga0500639_115775
4506	Ga0500639_192402
4507	Ga0500639_232871
4508	Ga0500636_0000047
4509	Ga0500636_0003630
4510	Ga0500636_0073564
4511	Ga0500636_0093851
4512	Ga0500636_0102922
4513	Ga0500636_0107587
4514	Ga0500636_0174349
4515	Ga0500636_0217629
4516	Ga0500636_0268295
4517	Ga0500636_0302769
4518	Ga0500637_0005436
4519	Ga0500637_0016604
4520	Ga0500637_0267858
4521	Ga0500637_0567131
4522	Ga0500567_208116
4523	Ga0500570_089616
4524	Ga0500576_150877
4525	Ga0500611_013168
4526	Ga0500611_025569
4527	Ga0500611_187085
4528	Ga0500657_135093
4529	Ga0500625_023754
4530	Ga0500645_030379
4531	Ga0500645_059068
4532	Ga0500609_003551
4533	Ga0500609_038530
4534	Ga0500656_008139
4535	Ga0500596_000310
4536	Ga0500596_000643
4537	Ga0500596_001183
4538	Ga0500601_000197
4539	Ga0501084_0017017
4540	Ga0501084_0031895
4541	Ga0501084_0054361
4542	Ga0501084_0159561
4543	Ga0500661_000101
4544	Ga0500661_088152
4545	Ga0590071_213168
4546	Ga0587069_148251
4547	Ga0501082_0000007
4548	Ga0501082_0010697
4549	Ga0501082_0059576
4550	Ga0501082_0254305
4551	Ga0501082_0379892
4552	Ga0530510_0967644

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

29

113

0.86 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3hui-assembly1.cif.gz_A	crystal structure of the mutant a105r of [2fe-2s] ferredoxin in the class i cyp199a2 system from rhodopseudomonas palustris	0.9942	1	106
3hui-assembly1.cif.gz_A	crystal structure of the mutant a105r of [2fe-2s] ferredoxin in the class i cyp199a2 system from rhodopseudomonas palustris	0.985	1	106
1uwm-assembly1.cif.gz_A	reduced ferredoxin 6 from rhodobacter capsulatus	0.9812	2	106
6nbl-assembly2.cif.gz_D	cytochrome p450cam-putidaredoxin complex bound to camphor and cyanide	0.9783	1	106
1r7s-assembly3.cif.gz_C	putidaredoxin (fe2s2 ferredoxin), c73g mutant	0.9744	2	106

ID	Description	Score	Start	End	Superfamily
af_K7MNS2_198_314_2.40.330.10	Mainly Beta;Beta Barrel;At1g16640 B3 domain;DNA-binding pseudobarrel domain	0.9877	3	16	2.40.330.10
1uwmA00	Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain	0.9812	2	106	3.10.20.30
4ltuB00	Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain	0.9667	3	106	3.10.20.30
af_Q9CPW2_55_168_3.10.20.30	Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain	0.9649	2	105	3.10.20.30
af_A4I234_54_172_3.10.20.30	Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain	0.9475	2	105	3.10.20.30

ID	Description	Score	Start	End	GO Terms
AF-A0A177IQL7-F1-model_v4	Ferredoxin 2Fe-2S	0.9999	1	106	GO:0009055 GO:0051537 GO:0140647
AF-A0A3S1VV72-F1-model_v4	deleted	0.9996	23	106
AF-A0A512JJY0-F1-model_v4	(2Fe-2S) ferredoxin	0.9986	1	106	GO:0009055 GO:0051537 GO:0140647
AF-A0A654B8P4-F1-model_v4	Ferredoxin, 2Fe-2S	0.9985	1	106	GO:0005829 GO:0009055 GO:0051537 GO:0140647
AF-A0A1I2SPE8-F1-model_v4	Ferredoxin, 2Fe-2S	0.998	1	106	GO:0009055 GO:0051537 GO:0140647

F496629

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

29

113

0.86

Structural Annotation

Top 5 Hits

Map