metagRoot

F496744

General Info

Members	Datasets	Scaffolds	Average Seq Length
2369	957	4738	359

Family's Representative Sequence

Representative Sequence	3300031903\|Ga0307407_10094486\|Ga0307407_100944862
Length	415
Sequence	VFPTRLVFPTSLWVACRKVANNLYLASDRGRRTFKNVLYYLTQRLTDLESAFRVFIYLTLRAILAALTALAISLLVGPWMIRSLSMNQIGQRVRDDGPKTHLPKAGTPTMGGALILVAMCASTLLWADLSNRFVWVVLLTTLAFGLVGFWDDYLKLVKRNSRGLIPRYKYFWQSVAGIGCALALYMTAEVPAETALFVPFFKTVALPLGVGYIVVTYFVVVGMSNAVNLTDGLDGLAIMPTVLVGGALGVFAYATGNAVFSSYLGIPFIEGTGEVLVFCATLVGAGLGFLWFNTYPAQVFMGDIGALALGAALGIIGVIVRQEIVLFIMSGVFLMEMVSVILQVASFKLTGKRIFRMAPIHHHFELKGWAEPKVIVRCCTGLDAGQGPHRCRGAWPYWLVLRALLAFARRGLRGH

Samples

	Sample ID	Description	Type	Environment
1	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
2	2124908027	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1	Metagenome	Rhizosphere
3	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
4	3300001904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2	Metagenome	Rhizosphere
5	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
6	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
7	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
8	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
9	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
10	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
11	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
12	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
13	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
14	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
15	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
16	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
17	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
18	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
19	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
20	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
21	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
22	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
23	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
24	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
25	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
26	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
27	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
28	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
29	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
30	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
31	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
32	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
33	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
34	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
35	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
36	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
37	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
38	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
39	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
40	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
41	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
42	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
43	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
44	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
45	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
46	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
47	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
48	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
49	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
50	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
51	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
52	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
53	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
54	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
55	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
56	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
57	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
58	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
59	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
60	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
61	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
62	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
63	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
64	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
65	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
66	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
67	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
68	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
69	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
70	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
71	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
72	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
73	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
74	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
75	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
76	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
77	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
78	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
79	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
80	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
81	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
82	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
83	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
84	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
85	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
86	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
87	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
88	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
89	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
90	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
91	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
92	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
93	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
94	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
95	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
96	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
97	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
98	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
99	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
100	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
101	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
102	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
103	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
104	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
105	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
106	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
107	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
108	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
109	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
110	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
111	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
112	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
113	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
114	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
115	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
116	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
117	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
118	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
119	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
120	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
121	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
122	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
123	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
124	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
125	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
126	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
127	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
128	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
129	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
130	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
131	3300006194	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1	Metagenome	Rhizosphere
132	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
133	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
134	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
135	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
136	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
137	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
138	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
139	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
140	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
141	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
142	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
143	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
144	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
145	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
146	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
147	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
148	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
149	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
150	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
151	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
152	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
153	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
154	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
155	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
156	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
157	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
158	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
159	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
160	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
161	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
162	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
163	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
164	3300009979	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG	Metagenome	Rhizosphere
165	3300009984	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG	Metagenome	Rhizosphere
166	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
167	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
168	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
169	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
170	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
171	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
172	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
173	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
174	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
175	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
176	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
177	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
178	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
179	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
180	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
181	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
182	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
183	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
184	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
185	3300015685	Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12	Metagenome	Unclassified
186	3300015689	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02	Metagenome	Rhizosphere
187	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
188	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
189	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
190	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
191	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
192	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
193	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
194	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
195	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
196	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
197	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
198	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
199	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
200	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
201	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
202	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
203	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
204	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
205	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
206	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
207	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
208	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
209	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
210	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
211	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
212	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
213	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
214	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
215	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
216	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
217	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
218	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
219	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
220	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
221	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
222	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
223	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
224	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
225	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
226	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
260	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
270	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
271	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
275	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
276	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
278	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
279	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
280	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
281	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
282	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
283	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
284	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
285	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
286	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
287	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
288	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
289	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
290	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
291	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
292	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
293	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
294	3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
295	3300027364	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2)	Metagenome	Rhizosphere
296	3300027378	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
297	3300027462	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2)	Metagenome	Rhizosphere
298	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
299	3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
300	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
301	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
302	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
303	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
304	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
305	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
306	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
307	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
308	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
309	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
310	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
311	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
312	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
313	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
314	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
315	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
316	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
317	3300030731	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3	Metagenome	Rhizosphere
318	3300030732	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1	Metagenome	Rhizosphere
319	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
320	3300030735	Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4	Metagenome	Rhizosphere
321	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
322	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
323	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
324	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
325	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
326	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
327	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
328	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
329	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
330	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
331	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
332	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
333	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
334	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
335	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
336	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
337	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
338	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
339	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
340	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
341	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
342	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
343	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
344	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
345	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
346	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
347	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
348	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
349	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
350	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
351	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
352	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
353	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
354	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
355	3300032168	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
356	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
357	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
358	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
359	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
360	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
361	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
362	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
363	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
364	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
365	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
366	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
367	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
368	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
369	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
370	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
371	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
372	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
373	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
374	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
375	3300038705	Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1	Metagenome	Unclassified
376	3300038725	Seagrass microbial communities from Seahorse Key, FL, USA - HV0818	Metagenome	Unclassified
377	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
378	3300038741	Seagrass microbial communities from Seahorse Key, FL, USA - SV0818	Metagenome	Unclassified
379	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
380	3300039110	Seagrass microbial communities from Seahorse Key, FL, USA - SV0319	Metagenome	Unclassified
381	3300039145	Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1	Metagenome	Unclassified
382	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
383	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
384	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
385	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
386	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
387	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
388	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
389	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
390	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
391	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
392	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
393	3300041462	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG	Metagenome	Rhizoplane
394	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
395	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
396	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
397	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
398	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
399	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
400	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
401	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
402	3300042013	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339	Metagenome	Rhizosphere
403	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
404	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
405	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
406	3300042137	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519	Metagenome	Rhizosphere
407	3300042139	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442	Metagenome	Rhizosphere
408	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
409	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
410	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
411	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
412	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
413	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
414	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
415	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
416	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
417	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
418	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
419	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
420	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
421	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
422	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
423	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
424	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
425	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
426	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
427	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
428	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
429	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
430	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
431	3300046458	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere	Metagenome	Rhizosphere
432	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
433	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
434	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
435	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
436	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
437	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
438	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
439	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
440	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
441	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
442	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
443	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
444	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
445	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
446	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
447	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
448	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
449	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
450	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
451	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
452	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
453	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
454	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
455	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
456	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
457	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
458	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
459	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
460	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
461	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
462	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
463	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
464	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
465	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
466	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
467	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
468	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
469	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
470	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
471	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
472	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
473	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
474	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
475	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
476	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
477	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
478	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
479	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
480	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
481	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
482	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
483	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
484	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
485	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
486	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
487	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
488	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
489	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
490	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
491	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
492	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
493	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
494	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
495	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
496	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
497	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
498	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
499	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
500	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
501	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
502	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
503	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
504	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
505	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
506	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
507	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
508	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
509	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
510	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
511	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
512	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
513	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
514	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
515	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
516	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
517	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
518	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
519	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
520	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
521	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
522	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
523	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
524	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
525	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
526	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
527	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
528	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
529	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
530	3300049675	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control	Metagenome	Rhizosphere
531	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
532	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
533	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
534	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
535	3300049763	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control	Metagenome	Rhizosphere
536	3300049767	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought	Metagenome	Rhizosphere
537	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
538	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
539	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
540	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
541	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
542	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
543	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
544	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
545	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
546	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
547	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
548	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
549	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
550	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
551	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
552	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
553	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
554	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
555	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
556	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
557	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
558	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
559	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
560	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
561	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
562	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
563	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
564	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
565	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
566	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
567	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
568	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
569	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
570	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
571	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
572	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
573	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
574	3300053732	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere	Metagenome	Endosphere
575	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
576	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
577	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
578	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
579	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
580	2510065053	Pseudomonas sp. MOIL14HWK12:I1	Isolate	Rhizosphere
581	2510065055	Pseudomonas sp. MOIL14HWK12:I2	Isolate	Rhizosphere
582	2510065058	Pseudomonas oleovorans MOIL14HWK12	Isolate	Rhizosphere
583	2511231004	Pseudomonas sp. GM102	Isolate	Nodule
584	2511231006	Pseudomonas sp. GM17	Isolate	Nodule
585	2511231007	Pseudomonas sp. GM18	Isolate	Nodule
586	2511231008	Pseudomonas sp. GM21	Isolate	Nodule
587	2511231010	Pseudomonas sp. GM25	Isolate	Nodule
588	2511231011	Pseudomonas sp. GM30	Isolate	Nodule
589	2511231012	Pseudomonas sp. GM33	Isolate	Nodule
590	2511231014	Pseudomonas sp. GM48	Isolate	Nodule
591	2511231015	Pseudomonas sp. GM49	Isolate	Nodule
592	2511231016	Pseudomonas sp. GM50	Isolate	Nodule
593	2511231017	Pseudomonas sp. GM55	Isolate	Nodule
594	2511231018	Pseudomonas sp. GM60	Isolate	Nodule
595	2511231019	Pseudomonas sp. GM67	Isolate	Nodule
596	2511231020	Pseudomonas sp. GM74	Isolate	Nodule
597	2511231021	Pseudomonas sp. GM78	Isolate	Nodule
598	2511231022	Pseudomonas sp. GM79	Isolate	Nodule
599	2511231023	Pseudomonas sp. GM80	Isolate	Nodule
600	2511231024	Pseudomonas sp. GM84	Isolate	Nodule
601	2511231025	Pantoea sp. YR343	Isolate	Rhizosphere
602	2511231031	Pseudomonas sp. GM16	Isolate	Nodule
603	2511231035	Pantoea sp. GM01	Isolate	Rhizosphere
604	2511231156	Pseudomonas ogarae F113	Isolate	Rhizosphere
605	2512047018	Pseudomonas chlororaphis chlororaphis GP72	Isolate	Rhizosphere
606	2513237087	Azorhizobium doebereinerae UFLA1-100	Isolate	Nodule
607	2537561728	Pectobacterium wasabiae CFBP 3304	Isolate	Rhizoplane
608	2554235132	Pseudomonas aeruginosa PGPR2	Isolate	Unclassified
609	2554235231	Pseudomonas putida MTCC 5279	Isolate	Unclassified
610	2554235341	Pseudomonas protegens CHA0	Isolate	Rhizosphere
611	2571042365	Lysobacter oryzae DSM 21044	Isolate	Rhizosphere
612	2576861471	Stenotrophomonas rhizophila DSM 14405	Isolate	Rhizosphere
613	2582580891	Pseudomonas chlororaphis YL-1	Isolate	Unclassified
614	2585427591	Rahnella aquatilis OV744	Isolate	Rhizosphere
615	2585427592	Rahnella aquatilis OV588	Isolate	Rhizosphere
616	2593339238	Luteibacter sp. UNCMF366Tsu5.1	Isolate	Unclassified
617	2593339239	Luteibacter sp. UNCMF331Sha3.1	Isolate	Unclassified
618	2597489887	Pseudomonas chlororaphis aureofaciens 30-84	Isolate	Rhizosphere
619	2597489888	Pseudomonas fluorescens SS101	Isolate	Rhizosphere
620	2597489889	Pseudomonas synxantha BG33R	Isolate	Rhizosphere
621	2599185155	Pseudomonas sp. NFACC10-1	Isolate	Rhizoplane
622	2599185160	Pseudomonas sp. NFPP25	Isolate	Rhizoplane
623	2599185161	Pseudomonas sp. NFPP09	Isolate	Rhizoplane
624	2599185162	Pseudomonas sp. NFPP10	Isolate	Rhizoplane
625	2599185163	Pseudomonas sp. NFPP12	Isolate	Rhizoplane
626	2599185164	Pseudomonas sp. NFPP13	Isolate	Rhizoplane
627	2599185165	Pseudomonas sp. NFPP18	Isolate	Rhizoplane
628	2599185166	Pseudomonas sp. NFPP08	Isolate	Rhizoplane
629	2599185167	Pseudomonas sp. NFPP28	Isolate	Rhizoplane
630	2599185168	Pseudomonas sp. NFPP05	Isolate	Rhizoplane
631	2599185179	Pseudomonas sp. NFR09	Isolate	Rhizoplane
632	2599185181	Pseudomonas sp. NFPP17	Isolate	Rhizoplane
633	2599185182	Pseudomonas sp. NFPP19	Isolate	Rhizoplane
634	2599185185	Pseudomonas sp. NFPP07	Isolate	Rhizoplane
635	2599185186	Pseudomonas sp. NFPP15	Isolate	Rhizoplane
636	2599185188	Pseudomonas sp. NFACC45	Isolate	Rhizoplane
637	2599185189	Pseudomonas sp. NFPP02	Isolate	Rhizoplane
638	2599185190	Pseudomonas sp. NFPP04	Isolate	Rhizoplane
639	2599185191	Pseudomonas sp. NFPP24	Isolate	Rhizoplane
640	2599185212	Pseudomonas sp. NFACC15-1	Isolate	Rhizoplane
641	2599185248	Pseudomonas sp. NFACC08-1	Isolate	Rhizoplane
642	2599185257	Pseudomonas sp. NFACC41-3	Isolate	Rhizoplane
643	2599185288	Pseudomonas sp. NFACC25	Isolate	Rhizoplane
644	2599185289	Pseudomonas sp. NFACC51	Isolate	Rhizoplane
645	2599185290	Pseudomonas sp. NFPP11	Isolate	Rhizoplane
646	2599185291	Pseudomonas sp. NFACC48-1	Isolate	Rhizoplane
647	2599185299	Pantoea ananatis NFR11	Isolate	Rhizoplane
648	2599185300	Pseudomonas sp. NFACC39-1	Isolate	Rhizoplane
649	2599185302	Pseudomonas sp. NFACC43	Isolate	Rhizoplane
650	2599185303	Pseudomonas sp. NFACC42-2	Isolate	Rhizoplane
651	2599185304	Pseudomonas sp. NFACC47-1	Isolate	Rhizoplane
652	2599185305	Pseudomonas sp. NFACC07-1	Isolate	Rhizoplane
653	2599185306	Pseudomonas sp. NFACC16-2	Isolate	Rhizoplane
654	2599185307	Pseudomonas sp. NFACC02	Isolate	Rhizoplane
655	2599185308	Pseudomonas sp. NFACC17-2	Isolate	Rhizoplane
656	2599185309	Pseudomonas sp. NFACC49-2	Isolate	Rhizoplane
657	2599185310	Pseudomonas sp. NFACC09-4	Isolate	Rhizoplane
658	2599185311	Pseudomonas sp. NFACC04-2	Isolate	Rhizoplane
659	2599185312	Pseudomonas sp. NFACC32-1	Isolate	Rhizoplane
660	2599185313	Pseudomonas sp. NFACC05-1	Isolate	Rhizoplane
661	2599185314	Pseudomonas sp. NFACC23-1	Isolate	Rhizoplane
662	2599185315	Pseudomonas sp. NFACC44-2	Isolate	Rhizoplane
663	2599185316	Pseudomonas sp. NFACC52	Isolate	Rhizoplane
664	2599185317	Pseudomonas sp. NFACC06-1	Isolate	Rhizoplane
665	2599185318	Pseudomonas sp. NFACC13-1	Isolate	Rhizoplane
666	2599185319	Pseudomonas sp. NFACC24-1	Isolate	Rhizoplane
667	2599185320	Pseudomonas sp. NFACC36	Isolate	Rhizoplane
668	2599185321	Pseudomonas sp. NFACC54	Isolate	Rhizoplane
669	2599185322	Pseudomonas sp. NFACC14	Isolate	Rhizoplane
670	2599185323	Pseudomonas sp. NFACC37-1	Isolate	Rhizoplane
671	2599185324	Pseudomonas sp. NFACC46-3	Isolate	Rhizoplane
672	2599185325	Pseudomonas sp. NFACC56-3	Isolate	Rhizoplane
673	2599185356	Pseudomonas sp. NFPP14	Isolate	Rhizoplane
674	2600254930	Pseudomonas sp. NFIX10	Isolate	Rhizoplane
675	2600254931	Pseudomonas sp. NFIX28	Isolate	Rhizoplane
676	2600254954	Pseudomonas sp. NFACC19-2	Isolate	Rhizoplane
677	2600255283	Pseudomonas sp. NFR16	Isolate	Rhizoplane
678	2600255296	Pseudomonas sp. NFR02	Isolate	Rhizoplane
679	2600255313	Pseudomonas sp. NFPP16	Isolate	Rhizoplane
680	2600255318	Pseudomonas putida NFIX47	Isolate	Rhizoplane
681	2600255389	Pseudomonas sp. NFPP33	Isolate	Rhizoplane
682	2603880185	Pseudomonas sp. NFIX46	Isolate	Rhizoplane
683	2603880199	Pseudomonas sp. NFIX49	Isolate	Rhizoplane
684	2606217733	Pseudomonas aeruginosa NFHH01	Isolate	Rhizoplane
685	2608642108	Pantoea agglomerans NFPP29	Isolate	Rhizoplane
686	2619619299	Pseudomonas veronii R4 Genome sequencing	Isolate	Unclassified
687	2623620443	Pseudomonas sp. DR 5-09	Isolate	Unclassified
688	2623620446	Pseudomonas sp. GR 6-02	Isolate	Unclassified
689	2643221565	Pseudomonas sp. Root562	Isolate	Unclassified
690	2643221571	Pseudomonas sp. Root569	Isolate	Unclassified
691	2643221579	Pseudoxanthomonas sp. Root630	Isolate	Unclassified
692	2643221580	Devosia sp. Root635	Isolate	Unclassified
693	2643221581	Pseudoxanthomonas sp. Root65	Isolate	Unclassified
694	2643221586	Lysobacter sp. Root667	Isolate	Unclassified
695	2643221589	Pseudomonas sp. Root68	Isolate	Unclassified
696	2643221591	Devosia sp. Root685	Isolate	Unclassified
697	2643221593	Lysobacter sp. Root690	Isolate	Unclassified
698	2643221602	Pseudomonas sp. Root71	Isolate	Unclassified
699	2643221612	Lysobacter sp. Root76	Isolate	Unclassified
700	2643221633	Pseudomonas sp. Root329	Isolate	Unclassified
701	2643221650	Pseudomonas sp. Root401	Isolate	Unclassified
702	2643221695	Lysobacter sp. Root494	Isolate	Unclassified
703	2643221713	Pseudomonas sp. Root9	Isolate	Unclassified
704	2643221720	Lysobacter sp. Root916	Isolate	Unclassified
705	2643221727	Lysobacter sp. Root96	Isolate	Unclassified
706	2643221728	Lysobacter sp. Root983	Isolate	Unclassified
707	2648501693	Pantoea ananatis B1-9	Isolate	Rhizosphere
708	2651869719	Genome Sequence of Pseudomonas fluorescens UM270	Isolate	Rhizosphere
709	2667528170	Pseudomonas sp. NFACC50-1	Isolate	Rhizoplane
710	2667528171	Pseudomonas sp. NFPP22	Isolate	Rhizoplane
711	2667528173	Rahnella sp. NFIX50	Isolate	Rhizoplane
712	2667528176	Pseudomonas sp. NFACC11-2	Isolate	Rhizoplane
713	2671180172	Pseudomonas sp. NFIX51	Isolate	Rhizoplane
714	2675903420	Pseudomonas fluorescens Ps006	Isolate	Unclassified
715	2675903515	Pseudomonas thivervalensis DSM 13194	Isolate	Unclassified
716	2684622997	Pantoea ananatis NFIX48	Isolate	Rhizoplane
717	2687453129	Halotalea alkalilenta IHB B 13600	Isolate	Unclassified
718	2687453130	Dyella thiooxydans ATSB10	Isolate	Unclassified
719	2706794495	Dickeya zeae ZJU1202	Isolate	Unclassified
720	2713897148	Pseudomonas fluorescens SF39a	Isolate	Rhizosphere
721	2713897149	Pseudomonas fluorescens SF4c	Isolate	Rhizosphere
722	2718217725	Pseudomonas fluorescens CREA-C16	Isolate	Rhizosphere
723	2718218334	Luteibacter rhizovicinus LJ96	Isolate	Rhizosphere
724	2721755607	Pseudomonas fluorescens Pt14	Isolate	Rhizosphere
725	2734482264	Dyella sp. AD052	Isolate	Unclassified
726	2738541265	Pseudomonas sp. GV077	Isolate	Unclassified
727	2738541271	Pseudomonas sp. GV021	Isolate	Unclassified
728	2738541276	Cellvibrio sp. YR554	Isolate	Unclassified
729	2738541282	Pseudomonas sp. GV058	Isolate	Unclassified
730	2738541294	Pseudomonas sp. GV087	Isolate	Unclassified
731	2738541303	Pseudomonas sp. GV105	Isolate	Unclassified
732	2738541309	Pseudomonas sp. GV047	Isolate	Unclassified
733	2738543004	Pseudomonas sp. GV085	Isolate	Unclassified
734	2738543009	Luteibacter sp. OK325	Isolate	Unclassified
735	2738543015	Pseudomonas sp. GV041	Isolate	Unclassified
736	2738543016	Pseudomonas sp. GV012	Isolate	Unclassified
737	2738543020	Pseudomonas sp. GV054	Isolate	Unclassified
738	2738543021	Pseudomonas sp. GV071	Isolate	Unclassified
739	2738543025	Pseudomonas sp. GV091	Isolate	Unclassified
740	2740892503	Pseudomonas chlororaphis piscium PCL1391	Isolate	Unclassified
741	2744054620	Pseudomonas thivervalensis LMG 21626	Isolate	Unclassified
742	2747842428	Stenotrophomonas sp. WCS2014-113	Isolate	Unclassified
743	2747842501	Xanthomonas sp. WCS2014-23	Isolate	Unclassified
744	2765235840	Stenotrophomonas maltophilia AA1	Isolate	Unclassified
745	2765235841	Pseudomonas putida AA7	Isolate	Unclassified
746	2773857670	Pseudomonas sp. 478	Isolate	Unclassified
747	2773857672	Pseudomonas sp. 1766	Isolate	Unclassified
748	2773857673	Pseudomonas sp. 443	Isolate	Unclassified
749	2784132063	Pseudomonas sp. 424	Isolate	Unclassified
750	2784132072	Pseudomonas sp. 460	Isolate	Unclassified
751	2791355520	Pseudomonas sp. s211(2017)	Isolate	Unclassified
752	2806310737	Pseudomonas mosselii BS011	Isolate	Unclassified
753	2806310745	Pseudomonas mosselii PtA1	Isolate	Unclassified
754	2808606361	Pseudomonas sp. SJZ075	Isolate	Rhizosphere
755	2808606373	Pseudomonas sp. SLBN-2	Isolate	Unclassified
756	2808606376	Pseudomonas sp. SJZ074	Isolate	Rhizosphere
757	2808606377	Pseudomonas sp. SJZ083	Isolate	Rhizosphere
758	2808606378	Pseudomonas sp. SJZ078	Isolate	Rhizosphere
759	2808606379	Pseudomonas sp. SJZ079	Isolate	Rhizosphere
760	2808606380	Pseudomonas sp. SJZ085	Isolate	Rhizosphere
761	2808606381	Pseudomonas sp. SJZ077	Isolate	Rhizosphere
762	2808606382	Pseudomonas sp. SJZ080	Isolate	Rhizosphere
763	2808606383	Pseudomonas sp. SJZ124	Isolate	Rhizosphere
764	2808606385	Pseudomonas sp. SJZ103	Isolate	Rhizosphere
765	2808606388	Pseudomonas sp. SJZ094	Isolate	Rhizosphere
766	2808606389	Pseudomonas sp. SJZ101	Isolate	Rhizosphere
767	2808606414	Pantoea sp. SJZ147	Isolate	Rhizosphere
768	2808606445	Pseudomonas sp. SJZ131	Isolate	Rhizosphere
769	2811994881	Pseudomonas sp. SLBN-26	Isolate	Unclassified
770	2816332141	Stenotrophomonas muris 1190 (v2) (version 2)	Isolate	Unclassified
771	2816332298	Pseudomonas veronii R02	Isolate	Rhizosphere
772	2818991440	Luteibacter yeojuensis 583	Isolate	Unclassified
773	2818991456	Pseudomonas koreensis 3286	Isolate	Rhizosphere
774	2818991457	Xanthomonas translucens 569	Isolate	Unclassified
775	2818991464	Pseudomonas protegens 3295	Isolate	Rhizosphere
776	2823421272	Pseudomonas mendocina S5.2	Isolate	Rhizoplane
777	2825651385	Pseudomonas brassicacearum L13-6-12	Isolate	Rhizosphere
778	2826581358	Pseudomonas viridiflava CDRTc14	Isolate	Unclassified
779	2834028612	Pseudomonas fluorescens 513	Isolate	Unclassified
780	2834578030	Paracoccus thiocyanatus SST	Isolate	Unclassified
781	2842391507	Stenotrophomonas maltophilia SEMIA 4027	Isolate	Nodule
782	2842757796	Stenotrophomonas sp. R-72406	Isolate	Unclassified
783	2842805378	Pseudomonas sp. R-72599	Isolate	Unclassified
784	2842815866	Pseudomonas sp. R-72210	Isolate	Unclassified
785	2842826826	Pseudomonas sp. R-72172	Isolate	Unclassified
786	2842832357	Pseudomonas sp. R-72164	Isolate	Unclassified
787	2842837860	Pseudomonas sp. R-72102	Isolate	Unclassified
788	2842843487	Pseudomonas sp. R-72074	Isolate	Unclassified
789	2842849001	Pseudomonas sp. R-72008	Isolate	Unclassified
790	2842854478	Pseudomonas sp. R-71998	Isolate	Unclassified
791	2842914999	Luteibacter sp. R-72151	Isolate	Unclassified
792	2842918807	Luteibacter sp. R-73110	Isolate	Unclassified
793	2844528606	Pantoea sp. R-72498 v. 2	Isolate	Unclassified
794	2844665904	Pseudomonas protegens H1F10C	Isolate	Unclassified
795	2846540461	Photorhabdus luminescens HIM3	Isolate	Rhizosphere
796	2847797336	Pantoea ananatis NN08200	Isolate	Unclassified
797	2852103415	Edaphovirga cremea DSM 105170	Isolate	Rhizosphere
798	2852612431	Pseudomonas sp. SJZ073	Isolate	Rhizosphere
799	2852649853	Stenotrophomonas sp. JAI102	Isolate	Rhizosphere
800	2852657418	Pseudomonas sp. JAI115	Isolate	Rhizosphere
801	2852667396	Pseudomonas sp. JAI120	Isolate	Rhizosphere
802	2852684882	Xanthomonas sp. JAI131	Isolate	Rhizosphere
803	2854601825	Dickeya dianthicola SS70	Isolate	Stem Tuber
804	2855195626	Pectobacterium atrosepticum SS26	Isolate	Stem Tuber
805	2857442823	Stenotrophomonas sp. R-74235	Isolate	Unclassified
806	2858466076	Pectobacterium polaris SS28	Isolate	Stem Tuber
807	2860339153	Pseudomonas sp. JAI111	Isolate	Rhizosphere
808	2860867994	Pseudomonas sp. R1-43-08	Isolate	Rhizosphere
809	2865014394	Pantoea sp. R-71966	Isolate	Unclassified
810	2871272651	Pectobacterium carotovorum SS96	Isolate	Stem Tuber
811	2871282230	Pectobacterium parmentieri SS90	Isolate	Stem Tuber
812	2874220319	Stenotrophomonas maltophilia PS5	Isolate	Unclassified
813	2876601092	Pantoea endophytica 596	Isolate	Unclassified
814	2878029506	Pseudomonas fluorescens DR397	Isolate	Rhizosphere
815	2880230671	Pseudomonas fluorescens LBUM677	Isolate	Unclassified
816	2881609920	Pantoea sp. ARC607	Isolate	Rhizosphere
817	2881714928	Pseudidiomarina mangrovi ZQ330	Isolate	Rhizosphere
818	2884338543	Luteibacter pinisoli MAH-14	Isolate	Rhizosphere
819	2894414249	Luteimonas sp. LNNU 24178	Isolate	Rhizosphere
820	2895498888	Pseudoxanthomonas sp. SGD-10	Isolate	Rhizosphere
821	2895511927	Pseudoxanthomonas sp. SGD-5-1	Isolate	Rhizosphere
822	2895522137	Pseudoxanthomonas sp. SGNA-20	Isolate	Rhizosphere
823	2895525241	Pseudoxanthomonas sp. SGT-18	Isolate	Rhizosphere
824	2900051742	Pectobacterium zantedeschiae 2M	Isolate	Stem Tuber
825	2904463128	Luteibacter yeojuensis 3191	Isolate	Unclassified
826	2904474040	Rahnella aquatilis 4485	Isolate	Rhizosphere
827	2904518522	Pseudomonas fluorescens 4488	Isolate	Rhizosphere
828	2904550169	Stutzerimonas stutzeri 1099	Isolate	Rhizosphere
829	2908446538	Pseudomonas sp. R76	Isolate	Rhizosphere
830	2912963787	Pseudomonas sp. R32	Isolate	Rhizosphere
831	2913036834	Pseudomonas viciae 11K1	Isolate	Rhizosphere
832	2916178963	Pseudoalteromonas rhizosphaerae RA15	Isolate	Rhizosphere
833	2917070673	Pseudomonas protegens CHA0	Isolate	Rhizosphere
834	2917832318	Pseudomonas rhizoryzae RY24	Isolate	Unclassified
835	2919063839	Pseudomonas pharyngis 1098	Isolate	Rhizosphere
836	2919085039	Luteibacter sp. 1214	Isolate	Unclassified
837	2919089067	Stenotrophomonas sp. 1337	Isolate	Rhizosphere
838	2919125081	Pseudomonas psychrotolerans 1545	Isolate	Rhizosphere
839	2919130084	Xanthomonas sp. 1678	Isolate	Rhizosphere
840	2919134579	Stenotrophomonas geniculata 1733	Isolate	Rhizosphere
841	2919150387	Rahnella aceris 1817	Isolate	Unclassified
842	2919155634	Pseudomonas fulva 1992	Isolate	Unclassified
843	2919385768	Pseudomonas sp. 2957	Isolate	Unclassified
844	2919404418	Luteibacter sp. 3190	Isolate	Unclassified
845	2919456309	Pseudomonas sp. 3296	Isolate	Rhizosphere
846	2919481497	Pseudomonas brassicacearum 3432	Isolate	Unclassified
847	2919487758	Pseudomonas koreensis 3441	Isolate	Unclassified
848	2919501602	Pseudomonas alcaliphila 3512	Isolate	Unclassified
849	2919513703	Luteimonas sp. 3794	Isolate	Unclassified
850	2919675420	Luteimonas terrae 4099	Isolate	Unclassified
851	2919688452	Pararheinheimera soli 4138	Isolate	Unclassified
852	2919697872	Pseudomonas frederiksbergensis 4169	Isolate	Unclassified
853	2923153595	Pseudomonas chlororaphis piscium PCL1391	Isolate	Unclassified
854	2923516293	Pseudoxanthomonas mexicana SLBN-89	Isolate	Rhizosphere
855	2923519811	Pseudomonas otitidis SLBN-103	Isolate	Rhizosphere
856	2923586266	Pseudomonas fluorescens 1550	Isolate	Rhizosphere
857	2926063275	Pseudomonas sp. 3400	Isolate	Unclassified
858	2927143783	Rahnella sp. 2050	Isolate	Unclassified
859	2928496128	Stenotrophomonas indicatrix 1163	Isolate	Unclassified
860	2929144301	Pseudomonas sp. R-71838 Hybrid assembly	Isolate	Unclassified
861	2929189879	Pseudomonas sp. R-71842 Hybrid assembly	Isolate	Unclassified
862	2929195423	Xanthomonas sp. R-73098 Hybrid assembly	Isolate	Unclassified
863	2931369376	Pseudomonas fluorescens DR133	Isolate	Rhizosphere
864	2931380184	Stenotrophomonas sp. DR822	Isolate	Rhizosphere
865	2931390751	Pseudomonas sp. DR208	Isolate	Rhizosphere
866	2931396565	Pseudomonas sp. DR48	Isolate	Rhizosphere
867	2935353572	Pseudomonas protegens TECH19	Isolate	Unclassified
868	2937610967	Stenotrophomonas maltophilia EP20	Isolate	Unclassified
869	2939589442	Stenotrophomonas rhizophila 716	Isolate	Rhizosphere
870	2939602548	Pantoea dispersa 1175	Isolate	Rhizosphere
871	2939622612	Stenotrophomonas sp. 2619	Isolate	Rhizosphere
872	2939626828	Stenotrophomonas sp. 2694	Isolate	Rhizosphere
873	2939636861	Pseudomonas sp. 2725	Isolate	Rhizosphere
874	2939651529	Pseudomonas sp. 2835	Isolate	Rhizosphere
875	2941471342	Luteibacter sp. 621	Isolate	Unclassified
876	2941475908	Stenotrophomonas rhizophila 2680	Isolate	Rhizosphere
877	2941489479	Lysobacter enzymogenes 2943	Isolate	Rhizosphere
878	2945928738	Pseudomonas cedrina W1I11	Isolate	Rhizosphere
879	2945951305	Pantoea agglomerans W2I1	Isolate	Rhizosphere
880	2945961074	Pseudomonas sp. W2I6	Isolate	Rhizosphere
881	2946006987	Pseudomonas sp. W3I7	Isolate	Rhizosphere
882	2946027586	Pseudomonas sp. W4I3	Isolate	Rhizosphere
883	2947233263	Pseudomonas synxantha W2I4	Isolate	Rhizosphere
884	2953994433	Luteibacter sp. W1I16	Isolate	Rhizosphere
885	2961047084	Stenotrophomonas maltophilia EP5	Isolate	Unclassified
886	2961064222	Stenotrophomonas maltophilia EP13	Isolate	Unclassified
887	2969304461	Pseudomonas sp. R84	Isolate	Rhizosphere
888	2974289157	Pseudomonas fluorescens SORGH_AS 191	Isolate	Unclassified
889	2974298342	Pseudomonas sp. SORGH_AS 211	Isolate	Unclassified
890	2974307012	Stenotrophomonas sp. SORGH_AS_0282	Isolate	Unclassified
891	2977247770	Stenotrophomonas rhizophila SORGH_AS 457	Isolate	Unclassified
892	2978975091	Pantoea anthophila SORGH_AS 797	Isolate	Unclassified
893	2984286254	Pseudomonas chlororaphis aurantiaca JD37	Isolate	Rhizosphere
894	2984494565	Pantoea ananatis SORGH_AS197	Isolate	Aerial Root
895	2984499530	Pseudomonas sp. SORGH_AS199	Isolate	Aerial Root
896	2984504281	Pseudomonas psychrotolerans SORGH_AS201	Isolate	Aerial Root
897	2984514374	Stenotrophomonas sp. SORGH_AS282	Isolate	Aerial Root
898	2987605356	Stenotrophomonas sp. ATCM1_4	Isolate	Unclassified
899	2988728565	Pseudomonas corrugata RM1-1-4	Isolate	Rhizosphere
900	2990261002	Pantoea ananatis SORGH_AS213	Isolate	Aerial Root
901	2995948881	Lysobacter enzymogenes B25	Isolate	Unclassified
902	2998139840	Pseudomonas iranensis SWRI54	Isolate	Rhizosphere
903	3007252601	Pseudomonas punonensis D1-6	Isolate	Unclassified
904	3007315729	Pseudomonas argentinensis SA190	Isolate	Unclassified
905	3007395558	Pseudomonas chlororaphis PCL1601	Isolate	Rhizosphere
906	3007419365	Pseudomonas vanderleydeniana RW8P3	Isolate	Unclassified
907	3007511990	Pseudomonas fluorescens G20-18	Isolate	Rhizosphere
908	3007614139	Pseudomonas sp. PB106	Isolate	Unclassified
909	3007619802	Pseudomonas sp. PB120	Isolate	Unclassified
910	3007718800	Pseudomonas fluorescens BW11P2	Isolate	Rhizosphere
911	3007855910	Pseudomonas khorasanensis SWRI153	Isolate	Rhizosphere
912	3007861166	Pseudomonas hamedanensis SWRI65	Isolate	Rhizosphere
913	3007866637	Pseudomonas marvdashtae SWRI102	Isolate	Rhizosphere
914	3007872151	Pseudomonas sp. SWRI51	Isolate	Rhizosphere
915	637000220	Pseudomonas protegens Pf-5	Isolate	Rhizoplane
916	640427133	Stutzerimonas stutzeri A1501	Isolate	Rhizosphere
917	651053060	Stutzerimonas stutzeri CMT.A.9	Isolate	Rhizosphere
918	8001522603	Methylomicrobium sp. RS1	Isolate	Unclassified
919	8002869464	Pseudoxanthomonas helianthi 110414	Isolate	Unclassified
920	8003014200	Lysobacter changpingensis Cm-3-T8	Isolate	Rhizosphere
921	8015556637	Bdellovibrio reynosensis LBG001	Isolate	Rhizosphere
922	8015687852	Pseudomonas chlororaphis aurantiaca RP4	Isolate	Rhizosphere
923	8016728285	Pseudomonas psychrotolerans SORGH_AS 227	Isolate	Unclassified
924	8016733728	Pantoea sp. SORGH_AS 659	Isolate	Unclassified
925	8019499862	Kluyvera sp. 1366	Isolate	Rhizosphere
926	8019769354	Pseudomonas sp. MSSRFD41	Isolate	Rhizosphere
927	8019775933	Pseudomonas sp. PvR083	Isolate	Rhizosphere
928	8021622325	Xanthomonas sp. LMG12462	Isolate	Rhizosphere
929	8021626552	Xanthomonas sp. LMG12460	Isolate	Rhizosphere
930	8021648035	Xanthomonas sp. LMG 12461	Isolate	Rhizosphere
931	8029995093	Pseudomonas atacamensis SM1	Isolate	Rhizosphere
932	8034962539	Pseudomonas sediminis PI11	Isolate	Rhizosphere
933	8052494512	Pseudomonas putida LD6	Isolate	Unclassified
934	8054285046	Pseudomonas petroselini MAFF 311096	Isolate	Nodule
935	8054347763	Pseudomonas carnis NWU Be30	Isolate	Unclassified
936	8054357960	Idiomarina rhizosphaerae M1R2S28	Isolate	Rhizosphere
937	8054503363	Pseudomonas sivasensis BsEB-1	Isolate	Unclassified
938	8054929484	Pseudomonas vlassakiae RW4S1	Isolate	Rhizosphere
939	8055693939	Hafnia alvei A23BA	Isolate	Rhizosphere
940	8055770955	Pseudomonas chlororaphis qlu-1	Isolate	Rhizosphere
941	8055817908	Pseudomonas pergaminensis 1008	Isolate	Rhizosphere
942	8055878733	Pseudomonas palmensis BBB001	Isolate	Rhizosphere
943	8056115690	Pseudomonas muyukensis COW39	Isolate	Rhizosphere
944	8056120720	Pseudomonas maumuensis COW77	Isolate	Rhizosphere
945	8056125926	Pseudomonas azerbaijanorientalis SWRI123	Isolate	Rhizosphere
946	8056131705	Pseudomonas asgharzadehiana SWRI132	Isolate	Rhizosphere
947	8056137416	Pseudomonas fakonensis COW40	Isolate	Rhizosphere
948	8056143049	Pseudomonas alvandae SWRI17	Isolate	Rhizosphere
949	8056148874	Pseudomonas khavaziana SWRI124	Isolate	Rhizosphere
950	8056155041	Pseudomonas farris SWRI79	Isolate	Rhizosphere
951	8056161164	Pseudomonas azadiae SWRI103	Isolate	Rhizosphere
952	8056166840	Pseudomonas triticicola SWRI88	Isolate	Rhizosphere
953	8056172158	Pseudomonas ekonensis COR58	Isolate	Rhizosphere
954	8056177738	Pseudomonas azerbaijanoccidentalis SWRI74	Isolate	Rhizosphere
955	8056569372	Pseudomonas serboccidentalis IT-P374	Isolate	Rhizosphere
956	8057160832	Larsenimonas rhizosphaerae GH2-1	Isolate	Rhizosphere
957	8057798959	Pseudomonas piscis BW16M1	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	83.75
Metatranscriptomes	0.3
Isolates	15.96

Biome Distribution

Category	Percentage (%)
Aerial Root	0.21
Bulb	0
Endosphere	9.71
Nodule	1.22
Rhizoplane	4.31
Rhizosphere	71.8
Stem	0
Stem Tuber	0.25
Unclassified	0.13

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0307407_10094486	3300031903	Bacteria	1841
2	MRS2a_Contig_63	2124908027	Bacteria	63450
3	SwRhRL2b_contig_1105253	2162886007	Bacteria	2701
4	SwRhRL2b_contig_676791	2162886007	Bacteria	198396
5	JGI24736J21556_1007421	3300001904	Bacteria	1843
6	JGI25156J39149_1000763	3300002705	Bacteria	16723
7	JGI25156J39149_1002791	3300002705	Bacteria	6048
8	JGI25162J39368_1001084	3300002737	Bacteria	16531
9	JGI25162J39368_1002516	3300002737	Bacteria	7010
10	JGI25157J39369_1000213	3300002741	Bacteria	48048
11	JGI25157J39369_1000829	3300002741	Bacteria	15329
12	JGI25163J39215_1000001	3300002771	Bacteria	314282
13	JGI25163J39215_1000880	3300002771	Bacteria	7010
14	JGI25164J39214_1000001	3300002772	Bacteria	477015
15	JGI25164J39214_1000135	3300002772	Bacteria	71187
16	JGI25164J39214_1001202	3300002772	Bacteria	7013
17	JGI25164J39214_1001204	3300002772	Bacteria	7010
18	JGI25152J39213_1000190	3300002773	Bacteria	41171
19	JGI25150J39212_1000138	3300002774	Bacteria	41134
20	JGI25151J46595_10000048	3300003187	Bacteria	166842
21	JGI25151J46595_10000382	3300003187	Bacteria	46006
22	JGI25406J46586_10003896	3300003203	Bacteria	6977
23	JGI25406J46586_10005488	3300003203	Bacteria	5878
24	JGI25165J46597_1000057	3300003214	Bacteria	217135
25	JGI25165J46597_1002165	3300003214	Bacteria	7013
26	JGI25165J46597_1002167	3300003214	Bacteria	7010
27	JGI25153J46596_10000241	3300003215	Bacteria	46006
28	rootH2_10006349	3300003320	Bacteria	25989
29	rootH2_10268922	3300003320	Bacteria	1467
30	rootL2_10013355	3300003322	Bacteria	12552
31	rootH1_10179880	3300003323	Bacteria	1617
32	Ga0006562J51391_1000525	3300003578	Bacteria	10975
33	Ga0055538_1000004	3300003751	Bacteria	615646
34	Ga0055538_1000036	3300003751	Bacteria	190579
35	Ga0055539_1000004	3300003752	Bacteria	615646
36	Ga0055539_1000047	3300003752	Bacteria	190579
37	Ga0055539_1001313	3300003752	Bacteria	4846
38	Ga0055533_1000007	3300003756	Bacteria	615646
39	Ga0055533_1000058	3300003756	Bacteria	190579
40	Ga0055533_1007238	3300003756	Bacteria	1533
41	Ga0055532_1000234	3300003758	Bacteria	40769
42	Ga0055525_1000007	3300003759	Bacteria	615646
43	Ga0055525_1000113	3300003759	Bacteria	124686
44	Ga0055525_1000124	3300003759	Bacteria	116698
45	Ga0055525_1000184	3300003759	Bacteria	77971
46	Ga0055527_1000094	3300003760	Bacteria	68614
47	Ga0055527_1000180	3300003760	Bacteria	42287
48	Ga0055527_1005482	3300003760	Bacteria	1647
49	Ga0055535_1000421	3300003761	Bacteria	39851
50	Ga0055535_1000807	3300003761	Bacteria	22701
51	Ga0055535_1002047	3300003761	Bacteria	8140
52	Ga0055535_1002095	3300003761	Bacteria	7939
53	Ga0055542_1000312	3300003762	Bacteria	52869
54	Ga0055542_1000326	3300003762	Bacteria	50636
55	Ga0055542_1001929	3300003762	Bacteria	8145
56	Ga0055542_1001976	3300003762	Bacteria	7951
57	Ga0055529_1000137	3300003763	Bacteria	103695
58	Ga0055529_1000434	3300003763	Bacteria	42287
59	Ga0055529_1000893	3300003763	Bacteria	16800
60	Ga0055526_1002585	3300003771	Bacteria	12096
61	Ga0055537_1000270	3300003773	Bacteria	37693
62	Ga0055537_1000884	3300003773	Bacteria	14283
63	Ga0055524_1000005	3300003775	Bacteria	344542
64	Ga0055536_1002013	3300003781	Bacteria	11659
65	Ga0055536_1008200	3300003781	Bacteria	4533
66	Ga0055536_1029241	3300003781	Bacteria	1484
67	Ga0055536_1029304	3300003781	Bacteria	1481
68	Ga0055534_1000002	3300003784	Bacteria	390762
69	Ga0055534_1000187	3300003784	Bacteria	45318
70	Ga0055528_1000002	3300003790	Bacteria	368879
71	Ga0055528_1001833	3300003790	Bacteria	12128
72	Ga0055530_10001485	3300003791	Bacteria	17029
73	Ga0055530_10004669	3300003791	Bacteria	6948
74	Ga0055530_10004676	3300003791	Bacteria	6945
75	Ga0055540_1000363	3300003792	Bacteria	38285
76	Ga0055540_1003931	3300003792	Bacteria	6948
77	Ga0055540_1003941	3300003792	Bacteria	6937
78	Ga0055531_10000348	3300003794	Bacteria	45293
79	Ga0055531_10005465	3300003794	Bacteria	7436
80	Ga0055531_10008944	3300003794	Bacteria	5189
81	Ga0055541_1000004	3300003841	Bacteria	615646
82	Ga0055541_1000034	3300003841	Bacteria	190579
83	Ga0058692_1000032	3300003856	Bacteria	179581
84	Ga0058692_1000037	3300003856	Bacteria	143875
85	Ga0058692_1000783	3300003856	Bacteria	12740
86	Ga0058692_1001581	3300003856	Bacteria	8216
87	Ga0058692_1005124	3300003856	Bacteria	3772
88	Ga0058692_1017455	3300003856	Bacteria	1575
89	Ga0065714_10000563	3300005288	Bacteria	3754
90	Ga0065714_10003117	3300005288	Bacteria	16101
91	Ga0065714_10004344	3300005288	Bacteria	10373
92	Ga0065704_10000476	3300005289	Bacteria	53412
93	Ga0065704_10001720	3300005289	Bacteria	6940
94	Ga0065704_10009233	3300005289	Bacteria	2763
95	Ga0065704_10013896	3300005289	Bacteria	2244
96	Ga0065704_10018606	3300005289	Bacteria	1183
97	Ga0065704_10070132	3300005289	Bacteria	1955461
98	Ga0065704_10073599	3300005289	Bacteria	6972
99	Ga0065704_10125537	3300005289	Bacteria	1701
100	Ga0065704_10189551	3300005289	Bacteria	1196
101	Ga0065712_10000146	3300005290	Bacteria	63767
102	Ga0065712_10004871	3300005290	Bacteria	3078
103	Ga0065712_10075242	3300005290	Bacteria	3902
104	Ga0065712_10102956	3300005290	Bacteria	1989
105	Ga0065712_10145274	3300005290	Bacteria	1414
106	Ga0065712_10159572	3300005290	Bacteria	1309
107	Ga0065715_10004965	3300005293	Bacteria	3618
108	Ga0065715_10105027	3300005293	Bacteria	2919
109	Ga0065707_10082076	3300005295	Bacteria	22556
110	Ga0065707_10087110	3300005295	Bacteria	5159
111	Ga0070658_10011586	3300005327	Bacteria	7073
112	Ga0070658_10014463	3300005327	Bacteria	6332
113	Ga0070658_10051284	3300005327	Bacteria	3344
114	Ga0070658_10081269	3300005327	Bacteria	2662
115	Ga0070658_10199025	3300005327	Bacteria	1690
116	Ga0070676_10000003	3300005328	Bacteria	204138
117	Ga0070676_10000200	3300005328	Bacteria	25328
118	Ga0070683_100009144	3300005329	Bacteria	8455
119	Ga0070683_100012737	3300005329	Bacteria	7314
120	Ga0070683_100042529	3300005329	Bacteria	4184
121	Ga0070683_100131422	3300005329	Bacteria	2369
122	Ga0070690_100002111	3300005330	Bacteria	10619
123	Ga0070670_100000017	3300005331	Bacteria	224429
124	Ga0070670_100012303	3300005331	Bacteria	7323
125	Ga0070670_100026164	3300005331	Bacteria	5022
126	Ga0070670_100045099	3300005331	Bacteria	3790
127	Ga0070670_100175103	3300005331	Bacteria	1862
128	Ga0070670_100321070	3300005331	Bacteria	1357
129	Ga0070677_10002103	3300005333	Bacteria	6348
130	Ga0068869_100025331	3300005334	Bacteria	4118
131	Ga0070666_10013077	3300005335	Bacteria	5257
132	Ga0070666_10016809	3300005335	Bacteria	4685
133	Ga0070666_10064950	3300005335	Bacteria	2476
134	Ga0070680_100000033	3300005336	Bacteria	70320
135	Ga0070680_100007344	3300005336	Bacteria	8406
136	Ga0070680_100010140	3300005336	Bacteria	7263
137	Ga0070680_100106269	3300005336	Bacteria	2334
138	Ga0070680_100107458	3300005336	Bacteria	2321
139	Ga0070682_100000010	3300005337	Bacteria	280957
140	Ga0070682_100012319	3300005337	Bacteria	4901
141	Ga0070682_100016238	3300005337	Bacteria	4326
142	Ga0070682_100025280	3300005337	Bacteria	3542
143	Ga0070682_100059422	3300005337	Bacteria	2415
144	Ga0070682_100105075	3300005337	Bacteria	1871
145	Ga0068868_100001011	3300005338	Bacteria	19245
146	Ga0068868_100221076	3300005338	Bacteria	1586
147	Ga0070660_100009393	3300005339	Bacteria	6875
148	Ga0070660_100066995	3300005339	Bacteria	2797
149	Ga0070689_100001646	3300005340	Bacteria	14296
150	Ga0070689_100006887	3300005340	Bacteria	7910
151	Ga0070689_100010067	3300005340	Bacteria	6731
152	Ga0070691_10000705	3300005341	Bacteria	13044
153	Ga0070691_10040552	3300005341	Bacteria	2200
154	Ga0070687_100007699	3300005343	Bacteria	4513
155	Ga0070661_100000152	3300005344	Bacteria	56781
156	Ga0070661_100002022	3300005344	Bacteria	14014
157	Ga0070661_100017350	3300005344	Bacteria	5107
158	Ga0070661_100059879	3300005344	Bacteria	2794
159	Ga0070692_10014446	3300005345	Bacteria	3710
160	Ga0070668_100002651	3300005347	Bacteria	13146
161	Ga0070668_100003416	3300005347	Bacteria	11720
162	Ga0070668_100006359	3300005347	Bacteria	8750
163	Ga0070668_100011223	3300005347	Bacteria	6670
164	Ga0070668_100091912	3300005347	Bacteria	2393
165	Ga0070668_100100682	3300005347	Bacteria	2289
166	Ga0070668_100103594	3300005347	Bacteria	2257
167	Ga0070669_100001632	3300005353	Bacteria	16233
168	Ga0070669_100004176	3300005353	Bacteria	10464
169	Ga0070669_100005702	3300005353	Bacteria	8980
170	Ga0070669_100021348	3300005353	Bacteria	4627
171	Ga0070669_100170924	3300005353	Bacteria	1694
172	Ga0070675_100002542	3300005354	Bacteria	13648
173	Ga0070675_100023685	3300005354	Bacteria	4911
174	Ga0070675_100031612	3300005354	Bacteria	4281
175	Ga0070675_100175591	3300005354	Bacteria	1850
176	Ga0070671_100000032	3300005355	Bacteria	108079
177	Ga0070671_100002723	3300005355	Bacteria	13719
178	Ga0070671_100012026	3300005355	Bacteria	6962
179	Ga0070671_100079088	3300005355	Bacteria	2748
180	Ga0070674_100001153	3300005356	Bacteria	13919
181	Ga0070674_100002386	3300005356	Bacteria	10381
182	Ga0070674_100016581	3300005356	Bacteria	4618
183	Ga0070674_100017347	3300005356	Bacteria	4526
184	Ga0070673_100001949	3300005364	Bacteria	12432
185	Ga0070673_100097382	3300005364	Bacteria	2416
186	Ga0070673_100105178	3300005364	Bacteria	2331
187	Ga0070673_100121457	3300005364	Bacteria	2180
188	Ga0070688_100002556	3300005365	Bacteria	9215
189	Ga0070688_100005687	3300005365	Bacteria	6586
190	Ga0070688_100243847	3300005365	Bacteria	1277
191	Ga0070659_100039765	3300005366	Bacteria	3673
192	Ga0070659_100112421	3300005366	Bacteria	2199
193	Ga0070667_100000091	3300005367	Bacteria	112602
194	Ga0070667_100000184	3300005367	Bacteria	75408
195	Ga0070667_100004862	3300005367	Bacteria	11255
196	Ga0070667_100007577	3300005367	Bacteria	9006
197	Ga0070667_100039135	3300005367	Bacteria	3974
198	Ga0070667_100054242	3300005367	Bacteria	3385
199	Ga0070667_100088280	3300005367	Bacteria	2662
200	Ga0070667_100263554	3300005367	Bacteria	1544
201	Ga0070703_10051111	3300005406	Bacteria	1322
202	Ga0070709_10007470	3300005434	Bacteria	5992
203	Ga0070714_100004437	3300005435	Bacteria	10565
204	Ga0070713_100003198	3300005436	Bacteria	10781
205	Ga0070713_100140271	3300005436	Bacteria	2140
206	Ga0070713_100288440	3300005436	Bacteria	1507
207	Ga0070710_10043881	3300005437	Bacteria	2478
208	Ga0070701_10001965	3300005438	Bacteria	7790
209	Ga0070711_100022575	3300005439	Bacteria	4080
210	Ga0070711_100038637	3300005439	Bacteria	3211
211	Ga0070705_100006181	3300005440	Bacteria	5864
212	Ga0070705_100009902	3300005440	Bacteria	4753
213	Ga0070705_100038683	3300005440	Bacteria	2701
214	Ga0070700_100035342	3300005441	Bacteria	3024
215	Ga0070700_100035520	3300005441	Bacteria	3017
216	Ga0070694_100015940	3300005444	Bacteria	4728
217	Ga0070663_100049802	3300005455	Bacteria	2977
218	Ga0070663_100295463	3300005455	Bacteria	1295
219	Ga0070678_100000873	3300005456	Bacteria	15442
220	Ga0070678_100004180	3300005456	Bacteria	8147
221	Ga0070678_100025717	3300005456	Bacteria	3966
222	Ga0070678_100188584	3300005456	Bacteria	1694
223	Ga0070662_100002336	3300005457	Bacteria	11665
224	Ga0070662_100017832	3300005457	Bacteria	4790
225	Ga0070662_100018279	3300005457	Bacteria	4740
226	Ga0070662_100046535	3300005457	Bacteria	3117
227	Ga0070681_10000231	3300005458	Bacteria	43967
228	Ga0070681_10003742	3300005458	Bacteria	14275
229	Ga0070681_10004886	3300005458	Bacteria	12856
230	Ga0070681_10008772	3300005458	Bacteria	9923
231	Ga0070681_10010910	3300005458	Bacteria	8984
232	Ga0070681_10032932	3300005458	Bacteria	5202
233	Ga0070681_10055146	3300005458	Bacteria	3959
234	Ga0070681_10109988	3300005458	Bacteria	2695
235	Ga0070681_10176964	3300005458	Bacteria	2055
236	Ga0070681_10344316	3300005458	Bacteria	1401
237	Ga0068867_100002636	3300005459	Bacteria	12656
238	Ga0070685_10000016	3300005466	Bacteria	112355
239	Ga0070685_10004841	3300005466	Bacteria	6812
240	Ga0070685_10019928	3300005466	Bacteria	3626
241	Ga0070706_100049704	3300005467	Bacteria	3869
242	Ga0070706_100080423	3300005467	Bacteria	3018
243	Ga0070698_100069321	3300005471	Bacteria	3541
244	Ga0070699_100000004	3300005518	Bacteria	404262
245	Ga0070699_100011960	3300005518	Bacteria	7491
246	Ga0070699_100014559	3300005518	Bacteria	6766
247	Ga0070699_100022641	3300005518	Bacteria	5416
248	Ga0070679_100002362	3300005530	Bacteria	17109
249	Ga0070679_100008695	3300005530	Bacteria	9571
250	Ga0070679_100012434	3300005530	Bacteria	8133
251	Ga0070679_100036391	3300005530	Bacteria	4883
252	Ga0070679_100063743	3300005530	Bacteria	3674
253	Ga0070679_100123136	3300005530	Bacteria	2577
254	Ga0070679_100207125	3300005530	Bacteria	1925
255	Ga0070684_100001693	3300005535	Bacteria	16042
256	Ga0070684_100430285	3300005535	Bacteria	1219
257	Ga0070697_100000413	3300005536	Bacteria	32976
258	Ga0070697_100052375	3300005536	Bacteria	3316
259	Ga0068853_100002810	3300005539	Bacteria	13179
260	Ga0068853_100003992	3300005539	Bacteria	11345
261	Ga0068853_100009575	3300005539	Bacteria	7808
262	Ga0068853_100047274	3300005539	Bacteria	3692
263	Ga0068853_100080418	3300005539	Bacteria	2851
264	Ga0068853_100181540	3300005539	Bacteria	1908
265	Ga0068853_100242966	3300005539	Bacteria	1651
266	Ga0068853_100245651	3300005539	Bacteria	1641
267	Ga0070672_100001239	3300005543	Bacteria	15675
268	Ga0070672_100001777	3300005543	Bacteria	13480
269	Ga0070672_100002261	3300005543	Bacteria	12151
270	Ga0070672_100055733	3300005543	Bacteria	3097
271	Ga0070672_100090827	3300005543	Bacteria	2464
272	Ga0070686_100038718	3300005544	Bacteria	2966
273	Ga0070695_100011659	3300005545	Bacteria	5260
274	Ga0070696_100000221	3300005546	Bacteria	34380
275	Ga0070696_100003227	3300005546	Bacteria	10858
276	Ga0070696_100006775	3300005546	Bacteria	7649
277	Ga0070696_100008595	3300005546	Bacteria	6831
278	Ga0070693_100007267	3300005547	Bacteria	5408
279	Ga0070693_100008377	3300005547	Bacteria	5094
280	Ga0070693_100014491	3300005547	Unclassified	4040
281	Ga0070693_100018052	3300005547	Bacteria	3679
282	Ga0070665_100000092	3300005548	Bacteria	174397
283	Ga0070665_100000726	3300005548	Bacteria	43911
284	Ga0070665_100002581	3300005548	Bacteria	19843
285	Ga0070665_100003573	3300005548	Bacteria	16475
286	Ga0070665_100003735	3300005548	Bacteria	16126
287	Ga0070665_100005780	3300005548	Bacteria	12694
288	Ga0070665_100005905	3300005548	Bacteria	12540
289	Ga0070665_100008952	3300005548	Bacteria	10144
290	Ga0070665_100012130	3300005548	Bacteria	8694
291	Ga0070665_100012849	3300005548	Bacteria	8429
292	Ga0070665_100033222	3300005548	Bacteria	5191
293	Ga0070665_100045517	3300005548	Bacteria	4407
294	Ga0070665_100075209	3300005548	Bacteria	3384
295	Ga0070665_100086852	3300005548	Bacteria	3133
296	Ga0070665_100111469	3300005548	Bacteria	2738
297	Ga0070665_100130736	3300005548	Bacteria	2513
298	Ga0070665_100207772	3300005548	Bacteria	1958
299	Ga0070665_100383712	3300005548	Bacteria	1412
300	Ga0070704_100016762	3300005549	Bacteria	4639
301	Ga0068855_100006468	3300005563	Bacteria	14252
302	Ga0068855_100030035	3300005563	Bacteria	6501
303	Ga0068855_100063707	3300005563	Bacteria	4302
304	Ga0068855_100109891	3300005563	Bacteria	3165
305	Ga0068855_100119277	3300005563	Bacteria	3020
306	Ga0068855_100129328	3300005563	Bacteria	2885
307	Ga0068855_100196220	3300005563	Bacteria	2274
308	Ga0068855_100460996	3300005563	Bacteria	1386
309	Ga0070664_100042182	3300005564	Bacteria	3852
310	Ga0070664_100044383	3300005564	Bacteria	3753
311	Ga0070664_100058870	3300005564	Bacteria	3268
312	Ga0070664_100131593	3300005564	Bacteria	2198
313	Ga0070664_100382244	3300005564	Bacteria	1285
314	Ga0068857_100036427	3300005577	Bacteria	4359
315	Ga0068857_100045003	3300005577	Bacteria	3914
316	Ga0068854_100005117	3300005578	Bacteria	8262
317	Ga0068854_100022957	3300005578	Bacteria	4257
318	Ga0068854_100046963	3300005578	Bacteria	3076
319	Ga0068854_100054265	3300005578	Bacteria	2881
320	Ga0068854_100123247	3300005578	Bacteria	1971
321	Ga0068854_100138863	3300005578	Bacteria	1863
322	Ga0068854_100238205	3300005578	Bacteria	1448
323	Ga0068856_100000639	3300005614	Bacteria	38100
324	Ga0068856_100001721	3300005614	Bacteria	22879
325	Ga0068856_100028809	3300005614	Bacteria	5426
326	Ga0068856_100035946	3300005614	Bacteria	4857
327	Ga0068856_100041467	3300005614	Bacteria	4524
328	Ga0070702_100006861	3300005615	Bacteria	5419
329	Ga0070702_100108954	3300005615	Bacteria	1713
330	Ga0068852_100005134	3300005616	Bacteria	9330
331	Ga0068852_100009359	3300005616	Bacteria	7275
332	Ga0068852_100013010	3300005616	Bacteria	6351
333	Ga0068852_100026399	3300005616	Bacteria	4720
334	Ga0068852_100163760	3300005616	Bacteria	2079
335	Ga0068859_100007477	3300005617	Bacteria	11091
336	Ga0068859_100054203	3300005617	Bacteria	4032
337	Ga0068859_100075153	3300005617	Bacteria	3419
338	Ga0068859_100274475	3300005617	Bacteria	1778
339	Ga0068859_100304180	3300005617	Bacteria	1688
340	Ga0068859_100415467	3300005617	Bacteria	1441
341	Ga0068864_100000008	3300005618	Bacteria	390035
342	Ga0068864_100000029	3300005618	Bacteria	224429
343	Ga0068864_100026073	3300005618	Bacteria	4927
344	Ga0068866_10096129	3300005718	Bacteria	1624
345	Ga0068861_100004868	3300005719	Bacteria	9033
346	Ga0068861_100014526	3300005719	Bacteria	5527
347	Ga0068861_100093127	3300005719	Bacteria	2382
348	Ga0068851_10000152	3300005834	Bacteria	36836
349	Ga0068851_10000956	3300005834	Bacteria	12498
350	Ga0068851_10002254	3300005834	Bacteria	8460
351	Ga0068851_10015571	3300005834	Bacteria	3625
352	Ga0068851_10021460	3300005834	Bacteria	3136
353	Ga0068870_10003894	3300005840	Bacteria	6366
354	Ga0068870_10005974	3300005840	Bacteria	5348
355	Ga0068870_10011358	3300005840	Bacteria	4128
356	Ga0068863_100033135	3300005841	Bacteria	4921
357	Ga0068863_100040516	3300005841	Bacteria	4429
358	Ga0068863_100116113	3300005841	Bacteria	2551
359	Ga0068863_100196465	3300005841	Bacteria	1939
360	Ga0068858_100000592	3300005842	Bacteria	37962
361	Ga0068858_100002497	3300005842	Bacteria	18555
362	Ga0068858_100045992	3300005842	Bacteria	4046
363	Ga0068858_100050030	3300005842	Bacteria	3869
364	Ga0068858_100069878	3300005842	Bacteria	3255
365	Ga0068858_100082088	3300005842	Bacteria	2996
366	Ga0068858_100087974	3300005842	Bacteria	2890
367	Ga0068858_100153710	3300005842	Bacteria	2164
368	Ga0068860_100000729	3300005843	Bacteria	37435
369	Ga0068860_100017924	3300005843	Bacteria	6895
370	Ga0068860_100026369	3300005843	Bacteria	5603
371	Ga0068860_100040914	3300005843	Bacteria	4428
372	Ga0068860_100185262	3300005843	Bacteria	2013
373	Ga0068860_100231567	3300005843	Bacteria	1795
374	Ga0068860_100247877	3300005843	Bacteria	1734
375	Ga0068860_100382023	3300005843	Bacteria	1390
376	Ga0068862_100003493	3300005844	Bacteria	13504
377	Ga0068862_100008743	3300005844	Bacteria	8383
378	Ga0081455_10000679	3300005937	Bacteria	44123
379	Ga0081455_10006489	3300005937	Bacteria	12539
380	Ga0081455_10024101	3300005937	Bacteria	5644
381	Ga0081540_1066220	3300005983	Bacteria	1694
382	Ga0081539_10000006	3300005985	Bacteria	534555
383	Ga0081539_10000078	3300005985	Bacteria	226113
384	Ga0070717_10000237	3300006028	Bacteria	37986
385	Ga0070717_10014174	3300006028	Bacteria	6129
386	Ga0075365_10010950	3300006038	Bacteria	5313
387	Ga0075365_10014187	3300006038	Bacteria	4788
388	Ga0075365_10049979	3300006038	Bacteria	2757
389	Ga0075368_10026400	3300006042	Bacteria	2234
390	Ga0075363_100002315	3300006048	Bacteria	7736
391	Ga0075364_10000194	3300006051	Bacteria	28183
392	Ga0075364_10000594	3300006051	Bacteria	18716
393	Ga0075364_10015021	3300006051	Bacteria	4794
394	Ga0075364_10016378	3300006051	Bacteria	4612
395	Ga0075364_10031329	3300006051	Bacteria	3417
396	Ga0075432_10003876	3300006058	Bacteria	5097
397	Ga0070716_100219069	3300006173	Bacteria	1277
398	Ga0070712_100063288	3300006175	Bacteria	2619
399	Ga0070712_100070548	3300006175	Bacteria	2497
400	Ga0070712_100171452	3300006175	Bacteria	1684
401	Ga0075367_10007375	3300006178	Bacteria	5625
402	Ga0075367_10035704	3300006178	Bacteria	2879
403	Ga0075369_10000114	3300006186	Bacteria	21842
404	Ga0075427_10000184	3300006194	Bacteria	6232
405	Ga0075366_10005771	3300006195	Bacteria	6723
406	Ga0097621_100001594	3300006237	Bacteria	15517
407	Ga0097621_100019022	3300006237	Bacteria	5263
408	Ga0097621_100038516	3300006237	Bacteria	3837
409	Ga0097621_100040739	3300006237	Bacteria	3736
410	Ga0097621_100047781	3300006237	Bacteria	3469
411	Ga0097621_100121967	3300006237	Bacteria	2211
412	Ga0097621_100243823	3300006237	Bacteria	1572
413	Ga0075370_10000249	3300006353	Bacteria	19340
414	Ga0068871_100000187	3300006358	Bacteria	42079
415	Ga0068871_100061017	3300006358	Bacteria	3078
416	Ga0068871_100061751	3300006358	Bacteria	3061
417	Ga0068871_100067917	3300006358	Bacteria	2926
418	Ga0068871_100150506	3300006358	Bacteria	1984
419	Ga0068871_100257162	3300006358	Bacteria	1522
420	Ga0075428_100002550	3300006844	Bacteria	19813
421	Ga0075430_100001093	3300006846	Bacteria	21552
422	Ga0075430_100005749	3300006846	Bacteria	10465
423	Ga0075430_100030468	3300006846	Bacteria	4583
424	Ga0075431_100000014	3300006847	Bacteria	86359
425	Ga0075431_100022419	3300006847	Bacteria	6455
426	Ga0075433_10238225	3300006852	Bacteria	1615
427	Ga0075434_100381193	3300006871	Bacteria	1431
428	Ga0075429_100001449	3300006880	Bacteria	19471
429	Ga0075429_100002488	3300006880	Bacteria	15503
430	Ga0075429_100087268	3300006880	Bacteria	2719
431	Ga0075429_100192941	3300006880	Bacteria	1784
432	Ga0068865_100054203	3300006881	Bacteria	2785
433	Ga0068865_100197539	3300006881	Bacteria	1560
434	Ga0075436_100003359	3300006914	Bacteria	10956
435	Ga0075436_100012836	3300006914	Bacteria	5743
436	Ga0097620_100007478	3300006931	Bacteria	11091
437	Ga0097620_100054202	3300006931	Bacteria	4032
438	Ga0097620_100075153	3300006931	Bacteria	3419
439	Ga0097620_100274481	3300006931	Bacteria	1778
440	Ga0097620_100304186	3300006931	Bacteria	1688
441	Ga0097620_100415450	3300006931	Bacteria	1441
442	Ga0099823_1002160	3300006944	Bacteria	17488
443	Ga0099823_1045624	3300006944	Bacteria	2913
444	Ga0099826_10030774	3300006948	Bacteria	3891
445	Ga0075435_100000180	3300007076	Bacteria	37414
446	Ga0075435_100084233	3300007076	Bacteria	2616
447	Ga0099794_10004973	3300007265	Bacteria	5288
448	Ga0105251_10000004	3300009011	Bacteria	285212
449	Ga0105251_10000192	3300009011	Bacteria	61516
450	Ga0105251_10002884	3300009011	Bacteria	12950
451	Ga0105251_10003555	3300009011	Bacteria	11247
452	Ga0105251_10005870	3300009011	Bacteria	7940
453	Ga0105251_10006959	3300009011	Bacteria	7081
454	Ga0105251_10007390	3300009011	Bacteria	6780
455	Ga0105251_10007819	3300009011	Bacteria	6513
456	Ga0105251_10013831	3300009011	Bacteria	4491
457	Ga0105251_10050750	3300009011	Bacteria	1980
458	Ga0105251_10107651	3300009011	Bacteria	1272
459	Ga0105244_10000293	3300009036	Bacteria	49039
460	Ga0105244_10001043	3300009036	Bacteria	23186
461	Ga0105244_10002697	3300009036	Bacteria	13278
462	Ga0105244_10005126	3300009036	Bacteria	8787
463	Ga0105244_10142279	3300009036	Bacteria	1153
464	Ga0105244_10148643	3300009036	Bacteria	1123
465	Ga0105250_10000376	3300009092	Bacteria	33365
466	Ga0105250_10001838	3300009092	Bacteria	11085
467	Ga0105250_10006433	3300009092	Bacteria	5130
468	Ga0105250_10041176	3300009092	Bacteria	1852
469	Ga0105250_10057579	3300009092	Bacteria	1560
470	Ga0105250_10072138	3300009092	Bacteria	1395
471	Ga0105240_10000239	3300009093	Bacteria	109259
472	Ga0105240_10000425	3300009093	Bacteria	78173
473	Ga0105240_10001884	3300009093	Bacteria	34865
474	Ga0105240_10024741	3300009093	Bacteria	7909
475	Ga0105240_10047403	3300009093	Bacteria	5438
476	Ga0105240_10054647	3300009093	Bacteria	5004
477	Ga0105240_10246896	3300009093	Bacteria	2066
478	Ga0105240_10299364	3300009093	Bacteria	1840
479	Ga0105240_10399617	3300009093	Bacteria	1548
480	Ga0111539_10020948	3300009094	Bacteria	8050
481	Ga0105245_10005587	3300009098	Bacteria	11045
482	Ga0105245_10119069	3300009098	Bacteria	2465
483	Ga0105247_10023329	3300009101	Bacteria	3728
484	Ga0105247_10028029	3300009101	Bacteria	3406
485	Ga0105247_10053722	3300009101	Bacteria	2485
486	Ga0105247_10123544	3300009101	Bacteria	1680
487	Ga0114129_10001674	3300009147	Bacteria	30207
488	Ga0114129_10056145	3300009147	Bacteria	5517
489	Ga0105243_10002016	3300009148	Bacteria	17266
490	Ga0105243_10002762	3300009148	Bacteria	14596
491	Ga0105243_10007906	3300009148	Bacteria	8168
492	Ga0105243_10008935	3300009148	Bacteria	7661
493	Ga0105243_10051043	3300009148	Bacteria	3270
494	Ga0105243_10092274	3300009148	Bacteria	2496
495	Ga0105243_10146701	3300009148	Bacteria	2019
496	Ga0105241_10014772	3300009174	Bacteria	5716
497	Ga0105241_10139005	3300009174	Bacteria	1975
498	Ga0105241_10285428	3300009174	Bacteria	1411
499	Ga0105241_10349854	3300009174	Bacteria	1283
500	Ga0105242_10001040	3300009176	Bacteria	21802
501	Ga0105242_10101772	3300009176	Bacteria	2435
502	Ga0105242_10114625	3300009176	Bacteria	2303
503	Ga0105248_10001607	3300009177	Bacteria	25120
504	Ga0105248_10001989	3300009177	Bacteria	22727
505	Ga0105248_10003695	3300009177	Bacteria	16961
506	Ga0105248_10158393	3300009177	Bacteria	2555
507	Ga0105248_10168970	3300009177	Bacteria	2465
508	Ga0105248_10353491	3300009177	Bacteria	1654
509	Ga0105237_10001329	3300009545	Bacteria	32791
510	Ga0105237_10001989	3300009545	Bacteria	26016
511	Ga0105237_10002874	3300009545	Bacteria	20941
512	Ga0105237_10022941	3300009545	Bacteria	6400
513	Ga0105237_10046333	3300009545	Bacteria	4373
514	Ga0105237_10091917	3300009545	Bacteria	3024
515	Ga0105237_10104192	3300009545	Bacteria	2828
516	Ga0105237_10153249	3300009545	Bacteria	2301
517	Ga0105238_10000760	3300009551	Bacteria	33531
518	Ga0105238_10003249	3300009551	Bacteria	16225
519	Ga0105238_10021594	3300009551	Bacteria	6557
520	Ga0105238_10021685	3300009551	Bacteria	6544
521	Ga0105238_10045967	3300009551	Bacteria	4408
522	Ga0105238_10152017	3300009551	Bacteria	2290
523	Ga0105249_10015163	3300009553	Bacteria	6820
524	Ga0105249_10018919	3300009553	Bacteria	6138
525	Ga0105249_10054550	3300009553	Bacteria	3655
526	Ga0105249_10068006	3300009553	Bacteria	3284
527	Ga0105249_10170758	3300009553	Bacteria	2108
528	Ga0105249_10175107	3300009553	Bacteria	2083
529	Ga0105249_10295618	3300009553	Bacteria	1622
530	Ga0105032_100571	3300009979	Bacteria	3648
531	Ga0105029_100746	3300009984	Bacteria	1836
532	Ga0105239_10001952	3300010375	Bacteria	26895
533	Ga0105239_10028570	3300010375	Bacteria	6132
534	Ga0105239_10029453	3300010375	Bacteria	6036
535	Ga0105239_10146291	3300010375	Bacteria	2636
536	Ga0105239_10239261	3300010375	Bacteria	2037
537	Ga0105239_10329702	3300010375	Bacteria	1722
538	Ga0105239_10456250	3300010375	Bacteria	1450
539	Ga0105246_10002790	3300011119	Bacteria	10572
540	Ga0105246_10009344	3300011119	Bacteria	6041
541	Ga0105246_10012293	3300011119	Bacteria	5338
542	Ga0105246_10060365	3300011119	Bacteria	2634
543	Ga0105246_10132713	3300011119	Bacteria	1862
544	Ga0105246_10152445	3300011119	Bacteria	1751
545	Ga0105246_10356107	3300011119	Bacteria	1201
546	Ga0157373_10011236	3300013100	Bacteria	6588
547	Ga0157373_10047796	3300013100	Bacteria	3051
548	Ga0157373_10232961	3300013100	Bacteria	1301
549	Ga0157371_10000020	3300013102	Bacteria	304987
550	Ga0157371_10000461	3300013102	Bacteria	49732
551	Ga0157371_10000790	3300013102	Bacteria	36369
552	Ga0157371_10002383	3300013102	Bacteria	17980
553	Ga0157371_10004229	3300013102	Bacteria	12625
554	Ga0157371_10004820	3300013102	Bacteria	11605
555	Ga0157371_10005049	3300013102	Bacteria	11286
556	Ga0157371_10008728	3300013102	Bacteria	8044
557	Ga0157371_10155557	3300013102	Bacteria	1631
558	Ga0157371_10260135	3300013102	Bacteria	1251
559	Ga0157370_10000452	3300013104	Bacteria	51362
560	Ga0157370_10008259	3300013104	Bacteria	11239
561	Ga0157370_10010220	3300013104	Bacteria	9908
562	Ga0157370_10017410	3300013104	Bacteria	7251
563	Ga0157370_10025172	3300013104	Bacteria	5891
564	Ga0157370_10031758	3300013104	Bacteria	5163
565	Ga0157370_10034559	3300013104	Bacteria	4920
566	Ga0157370_10197779	3300013104	Bacteria	1865
567	Ga0157370_10240595	3300013104	Bacteria	1675
568	Ga0157370_10250068	3300013104	Bacteria	1640
569	Ga0157370_10331699	3300013104	Bacteria	1403
570	Ga0157369_10002184	3300013105	Bacteria	23571
571	Ga0157369_10023569	3300013105	Bacteria	6855
572	Ga0157369_10044930	3300013105	Bacteria	4806
573	Ga0157369_10078398	3300013105	Bacteria	3539
574	Ga0157369_10207631	3300013105	Bacteria	2054
575	Ga0157369_10281982	3300013105	Bacteria	1730
576	Ga0157369_10361252	3300013105	Bacteria	1508
577	Ga0157369_10407091	3300013105	Bacteria	1411
578	Ga0157369_10424073	3300013105	Bacteria	1379
579	Ga0157374_10055027	3300013296	Bacteria	3712
580	Ga0157378_10025328	3300013297	Bacteria	5225
581	Ga0157378_10071214	3300013297	Bacteria	3122
582	Ga0157378_10091846	3300013297	Bacteria	2761
583	Ga0157378_10134895	3300013297	Bacteria	2288
584	Ga0157378_10169886	3300013297	Bacteria	2044
585	Ga0157378_10486013	3300013297	Bacteria	1231
586	Ga0163162_10000017	3300013306	Bacteria	233474
587	Ga0163162_10072410	3300013306	Bacteria	3501
588	Ga0163162_10132501	3300013306	Bacteria	2602
589	Ga0157372_10000885	3300013307	Bacteria	32549
590	Ga0157372_10006013	3300013307	Bacteria	12890
591	Ga0157372_10008464	3300013307	Bacteria	10919
592	Ga0157372_10011691	3300013307	Bacteria	9347
593	Ga0157372_10044332	3300013307	Bacteria	4928
594	Ga0157372_10054880	3300013307	Bacteria	4447
595	Ga0157372_10146121	3300013307	Bacteria	2726
596	Ga0157372_10157212	3300013307	Bacteria	2626
597	Ga0157372_10199462	3300013307	Bacteria	2318
598	Ga0157372_10207567	3300013307	Bacteria	2270
599	Ga0157372_10624234	3300013307	Bacteria	1256
600	Ga0157375_10000014	3300013308	Bacteria	319231
601	Ga0157375_10001966	3300013308	Bacteria	17723
602	Ga0157375_10028219	3300013308	Bacteria	5257
603	Ga0157375_10125409	3300013308	Bacteria	2682
604	Ga0157375_10271795	3300013308	Bacteria	1857
605	Ga0157375_10293664	3300013308	Bacteria	1788
606	Ga0157375_10539702	3300013308	Bacteria	1329
607	Ga0163163_10000061	3300014325	Bacteria	119752
608	Ga0163163_10038297	3300014325	Bacteria	4672
609	Ga0163163_10039314	3300014325	Bacteria	4617
610	Ga0163163_10074600	3300014325	Bacteria	3385
611	Ga0163163_10128926	3300014325	Bacteria	2569
612	Ga0157380_10000190	3300014326	Bacteria	35831
613	Ga0157380_10008956	3300014326	Bacteria	7151
614	Ga0157380_10054098	3300014326	Bacteria	3184
615	Ga0182008_10000084	3300014497	Bacteria	72998
616	Ga0182008_10026390	3300014497	Bacteria	2946
617	Ga0157379_10013595	3300014968	Bacteria	7132
618	Ga0157379_10118898	3300014968	Bacteria	2377
619	Ga0157379_10141918	3300014968	Bacteria	2165
620	Ga0157376_10207953	3300014969	Bacteria	1805
621	Ga0157376_10211146	3300014969	Bacteria	1792
622	Ga0182006_1002046	3300015261	Bacteria	11317
623	Ga0182006_1025580	3300015261	Bacteria	2423
624	Ga0182006_1046130	3300015261	Bacteria	1693
625	Ga0182007_10000060	3300015262	Bacteria	88258
626	Ga0182005_1000421	3300015265	Bacteria	22901
627	Ga0182005_1014360	3300015265	Bacteria	2216
628	Ga0183369_1018	3300015685	Bacteria	117953
629	Ga0183360_10001	3300015689	Bacteria	3943671
630	Ga0163161_10064216	3300017792	Bacteria	2678
631	Ga0197907_11300396	3300020069	Bacteria	7794
632	Ga0206356_10105888	3300020070	Bacteria	11595
633	Ga0213872_10002256	3300021361	Bacteria	11513
634	Ga0213872_10002918	3300021361	Bacteria	9719
635	Ga0213872_10007213	3300021361	Bacteria	5493
636	Ga0213872_10015339	3300021361	Bacteria	3566
637	Ga0213876_10000125	3300021384	Bacteria	83238
638	Ga0213876_10082647	3300021384	Bacteria	1699
639	Ga0213875_10000027	3300021388	Bacteria	190420
640	Ga0213875_10053367	3300021388	Bacteria	1893
641	Ga0213871_10009080	3300021441	Bacteria	2215
642	Ga0209760_100044	3300025207	Bacteria	111537
643	Ga0209760_100085	3300025207	Bacteria	74397
644	Ga0209760_100291	3300025207	Bacteria	17606
645	Ga0209784_100001	3300025224	Bacteria	3600592
646	Ga0209784_100050	3300025224	Bacteria	191780
647	Ga0209566_100001	3300025225	Bacteria	3600765
648	Ga0209566_100063	3300025225	Bacteria	191780
649	Ga0209674_100002	3300025226	Bacteria	3600592
650	Ga0209674_100079	3300025226	Bacteria	205836
651	Ga0209674_100084	3300025226	Bacteria	191780
652	Ga0209672_100005	3300025228	Bacteria	1069303
653	Ga0209672_100055	3300025228	Bacteria	221655
654	Ga0209672_100189	3300025228	Bacteria	50005
655	Ga0209672_101422	3300025228	Bacteria	8658
656	Ga0209147_100083	3300025229	Bacteria	191212
657	Ga0209563_100008	3300025230	Bacteria	1554545
658	Ga0209563_100045	3300025230	Bacteria	377102
659	Ga0209563_100084	3300025230	Bacteria	191780
660	Ga0209563_100632	3300025230	Bacteria	11328
661	Ga0207427_100002	3300025231	Bacteria	1355321
662	Ga0207427_100007	3300025231	Bacteria	746220
663	Ga0207427_100038	3300025231	Bacteria	292975
664	Ga0207427_100053	3300025231	Bacteria	217191
665	Ga0209437_100006	3300025233	Bacteria	1042724
666	Ga0209437_100009	3300025233	Bacteria	915954
667	Ga0209437_100046	3300025233	Bacteria	405293
668	Ga0209437_100063	3300025233	Bacteria	335477
669	Ga0209437_100108	3300025233	Bacteria	217191
670	Ga0209258_100006	3300025242	Bacteria	1069303
671	Ga0209258_100055	3300025242	Bacteria	337291
672	Ga0209258_100113	3300025242	Bacteria	191178
673	Ga0209258_100135	3300025242	Bacteria	170832
674	Ga0209258_100152	3300025242	Bacteria	160154
675	Ga0207425_1000040	3300025245	Bacteria	218121
676	Ga0207425_1002601	3300025245	Bacteria	6257
677	Ga0209646_1000359	3300025246	Bacteria	31604
678	Ga0209646_1001074	3300025246	Bacteria	8196
679	Ga0209026_1000055	3300025250	Bacteria	237197
680	Ga0209026_1000510	3300025250	Bacteria	27418
681	Ga0209677_100004	3300025253	Bacteria	1554545
682	Ga0209677_100047	3300025253	Bacteria	191780
683	Ga0209677_100899	3300025253	Bacteria	14547
684	Ga0209148_1000012	3300025254	Bacteria	1069303
685	Ga0209148_1000014	3300025254	Bacteria	925277
686	Ga0209148_1000058	3300025254	Bacteria	357482
687	Ga0209148_1000102	3300025254	Bacteria	216658
688	Ga0209759_1000159	3300025256	Bacteria	116456
689	Ga0209759_1000267	3300025256	Bacteria	74733
690	Ga0209759_1000386	3300025256	Bacteria	55050
691	Ga0209129_1000011	3300025258	Bacteria	568657
692	Ga0209233_1000059	3300025261	Bacteria	414562
693	Ga0209233_1000074	3300025261	Bacteria	357367
694	Ga0209233_1000125	3300025261	Bacteria	217190
695	Ga0209233_1000516	3300025261	Bacteria	22499
696	Ga0209233_1000779	3300025261	Bacteria	14368
697	Ga0209233_1003072	3300025261	Bacteria	5944
698	Ga0209565_1000001	3300025263	Bacteria	2950419
699	Ga0209565_1000472	3300025263	Bacteria	29961
700	Ga0209455_1000008	3300025272	Bacteria	1069303
701	Ga0209455_1000014	3300025272	Bacteria	806601
702	Ga0209455_1000018	3300025272	Bacteria	718034
703	Ga0209673_1000001	3300025273	Bacteria	3176258
704	Ga0209673_1000032	3300025273	Bacteria	339956
705	Ga0209130_1009595	3300025284	Bacteria	2742
706	Ga0209130_1009724	3300025284	Bacteria	2713
707	Ga0209675_1000001	3300025291	Bacteria	2950293
708	Ga0209675_1000020	3300025291	Bacteria	335854
709	Ga0209676_1000006	3300025292	Bacteria	1039588
710	Ga0209676_1000010	3300025292	Bacteria	954025
711	Ga0209676_1000027	3300025292	Bacteria	560222
712	Ga0209676_1000131	3300025292	Bacteria	185298
713	Ga0209676_1000181	3300025292	Bacteria	147350
714	Ga0209676_1000504	3300025292	Bacteria	61740
715	Ga0209676_1000541	3300025292	Bacteria	58348
716	Ga0209676_1002017	3300025292	Bacteria	15973
717	Ga0209676_1004055	3300025292	Bacteria	8426
718	Ga0209676_1004400	3300025292	Bacteria	7869
719	Ga0209676_1005322	3300025292	Bacteria	6780
720	Ga0209676_1005977	3300025292	Bacteria	6152
721	Ga0209025_1000002	3300025294	Bacteria	1393142
722	Ga0209025_1000006	3300025294	Bacteria	1153444
723	Ga0209025_1001895	3300025294	Bacteria	24398
724	Ga0209025_1003736	3300025294	Bacteria	13958
725	Ga0209564_1000001	3300025295	Bacteria	3176258
726	Ga0209564_1000210	3300025295	Bacteria	133323
727	Ga0209758_1000003	3300025297	Bacteria	1398533
728	Ga0209758_1019052	3300025297	Bacteria	3332
729	Ga0209050_1000019	3300025298	Bacteria	608757
730	Ga0209050_1000027	3300025298	Bacteria	483261
731	Ga0209050_1001000	3300025298	Bacteria	35489
732	Ga0209050_1001606	3300025298	Bacteria	23288
733	Ga0209050_1002093	3300025298	Bacteria	18293
734	Ga0209050_1005828	3300025298	Bacteria	7554
735	Ga0209050_1006379	3300025298	Bacteria	6997
736	Ga0209256_1000006	3300025299	Bacteria	1250310
737	Ga0209256_1002997	3300025299	Bacteria	12541
738	Ga0207426_1009164	3300025302	Bacteria	3935
739	Ga0209051_1000065	3300025303	Bacteria	231445
740	Ga0209051_1000504	3300025303	Bacteria	49506
741	Ga0209051_1001179	3300025303	Bacteria	23669
742	Ga0209051_1004963	3300025303	Bacteria	7952
743	Ga0209051_1012764	3300025303	Bacteria	4045
744	Ga0209257_1000067	3300025304	Bacteria	342468
745	Ga0209257_1000086	3300025304	Bacteria	287437
746	Ga0209257_1000119	3300025304	Bacteria	225893
747	Ga0209257_1000197	3300025304	Bacteria	149491
748	Ga0209257_1001869	3300025304	Bacteria	22842
749	Ga0209257_1003148	3300025304	Bacteria	14717
750	Ga0209257_1005527	3300025304	Bacteria	8809
751	Ga0209257_1005529	3300025304	Bacteria	8809
752	Ga0209257_1005904	3300025304	Bacteria	8245
753	Ga0207697_10048006	3300025315	Bacteria	1761
754	Ga0207656_10000130	3300025321	Bacteria	28129
755	Ga0207656_10000248	3300025321	Bacteria	18827
756	Ga0207656_10030929	3300025321	Bacteria	2214
757	Ga0207656_10059384	3300025321	Bacteria	1673
758	Ga0207696_1000022	3300025711	Bacteria	427529
759	Ga0207696_1000054	3300025711	Bacteria	266962
760	Ga0207696_1000093	3300025711	Bacteria	184278
761	Ga0207696_1000203	3300025711	Bacteria	91200
762	Ga0207696_1000210	3300025711	Bacteria	88330
763	Ga0207696_1000213	3300025711	Bacteria	87128
764	Ga0207696_1000384	3300025711	Bacteria	42611
765	Ga0207696_1007881	3300025711	Bacteria	4129
766	Ga0207655_1000005	3300025728	Bacteria	917277
767	Ga0207655_1000015	3300025728	Bacteria	600662
768	Ga0207655_1000311	3300025728	Bacteria	72337
769	Ga0207655_1000617	3300025728	Bacteria	42744
770	Ga0207655_1001239	3300025728	Bacteria	24435
771	Ga0207655_1001289	3300025728	Bacteria	23749
772	Ga0207655_1002487	3300025728	Bacteria	14910
773	Ga0207655_1004103	3300025728	Bacteria	10476
774	Ga0207655_1004110	3300025728	Bacteria	10467
775	Ga0207655_1004943	3300025728	Bacteria	9250
776	Ga0207655_1005319	3300025728	Bacteria	8804
777	Ga0207655_1006657	3300025728	Bacteria	7614
778	Ga0207655_1007459	3300025728	Bacteria	7091
779	Ga0207655_1007637	3300025728	Bacteria	6983
780	Ga0207655_1007750	3300025728	Bacteria	6923
781	Ga0207655_1029198	3300025728	Bacteria	2587
782	Ga0207655_1057751	3300025728	Bacteria	1522
783	Ga0207713_1000007	3300025735	Bacteria	564979
784	Ga0207713_1000013	3300025735	Bacteria	475751
785	Ga0207713_1000068	3300025735	Bacteria	192415
786	Ga0207713_1000244	3300025735	Bacteria	69698
787	Ga0207713_1000374	3300025735	Bacteria	48773
788	Ga0207713_1001566	3300025735	Bacteria	17969
789	Ga0207713_1002224	3300025735	Bacteria	14374
790	Ga0207713_1004208	3300025735	Bacteria	9422
791	Ga0207713_1006723	3300025735	Bacteria	6949
792	Ga0207713_1014645	3300025735	Bacteria	4062
793	Ga0207713_1020468	3300025735	Bacteria	3204
794	Ga0207713_1038674	3300025735	Bacteria	2022
795	Ga0207682_10000049	3300025893	Bacteria	50126
796	Ga0207710_10005021	3300025900	Bacteria	5731
797	Ga0207710_10009208	3300025900	Bacteria	4154
798	Ga0207680_10003931	3300025903	Bacteria	7012
799	Ga0207680_10044024	3300025903	Bacteria	2622
800	Ga0207680_10045420	3300025903	Bacteria	2590
801	Ga0207647_10000020	3300025904	Bacteria	123888
802	Ga0207647_10000262	3300025904	Bacteria	43207
803	Ga0207647_10003416	3300025904	Bacteria	11908
804	Ga0207647_10017447	3300025904	Bacteria	4879
805	Ga0207699_10223586	3300025906	Bacteria	1286
806	Ga0207699_10397202	3300025906	Bacteria	981
807	Ga0207645_10000003	3300025907	Bacteria	273622
808	Ga0207643_10007303	3300025908	Bacteria	5929
809	Ga0207705_10000087	3300025909	Bacteria	114441
810	Ga0207705_10000153	3300025909	Bacteria	74093
811	Ga0207705_10005926	3300025909	Bacteria	9089
812	Ga0207705_10006901	3300025909	Bacteria	8391
813	Ga0207705_10061475	3300025909	Bacteria	2713
814	Ga0207705_10093844	3300025909	Bacteria	2200
815	Ga0207684_10172494	3300025910	Bacteria	1864
816	Ga0207654_10019154	3300025911	Bacteria	3606
817	Ga0207654_10069430	3300025911	Bacteria	2088
818	Ga0207707_10000075	3300025912	Bacteria	101459
819	Ga0207707_10000148	3300025912	Bacteria	73167
820	Ga0207707_10000799	3300025912	Bacteria	30853
821	Ga0207707_10000906	3300025912	Bacteria	28907
822	Ga0207707_10002373	3300025912	Bacteria	16974
823	Ga0207707_10010226	3300025912	Bacteria	8145
824	Ga0207707_10027296	3300025912	Bacteria	4993
825	Ga0207707_10038947	3300025912	Bacteria	4155
826	Ga0207707_10050849	3300025912	Bacteria	3609
827	Ga0207707_10085657	3300025912	Bacteria	2753
828	Ga0207707_10100291	3300025912	Bacteria	2530
829	Ga0207707_10313653	3300025912	Bacteria	1355
830	Ga0207695_10000082	3300025913	Bacteria	284333
831	Ga0207695_10000859	3300025913	Bacteria	55564
832	Ga0207695_10001984	3300025913	Bacteria	31600
833	Ga0207695_10011480	3300025913	Bacteria	10721
834	Ga0207695_10012672	3300025913	Bacteria	10100
835	Ga0207695_10025730	3300025913	Bacteria	6581
836	Ga0207695_10025909	3300025913	Bacteria	6554
837	Ga0207695_10077466	3300025913	Bacteria	3377
838	Ga0207695_10180837	3300025913	Bacteria	2029
839	Ga0207695_10278794	3300025913	Bacteria	1566
840	Ga0207695_10314894	3300025913	Bacteria	1455
841	Ga0207695_10436752	3300025913	Bacteria	1193
842	Ga0207671_10000121	3300025914	Bacteria	119659
843	Ga0207671_10000665	3300025914	Bacteria	44905
844	Ga0207671_10027768	3300025914	Bacteria	4231
845	Ga0207671_10056887	3300025914	Bacteria	2898
846	Ga0207671_10105580	3300025914	Bacteria	2138
847	Ga0207671_10218622	3300025914	Bacteria	1492
848	Ga0207693_10067775	3300025915	Bacteria	2794
849	Ga0207693_10070958	3300025915	Bacteria	2726
850	Ga0207663_10002414	3300025916	Bacteria	8974
851	Ga0207660_10000970	3300025917	Bacteria	18968
852	Ga0207660_10001074	3300025917	Bacteria	18174
853	Ga0207660_10001268	3300025917	Bacteria	16951
854	Ga0207660_10003248	3300025917	Bacteria	10649
855	Ga0207660_10006489	3300025917	Bacteria	7588
856	Ga0207660_10039513	3300025917	Bacteria	3299
857	Ga0207660_10067017	3300025917	Bacteria	2599
858	Ga0207660_10176185	3300025917	Bacteria	1658
859	Ga0207657_10012801	3300025919	Bacteria	8257
860	Ga0207657_10014104	3300025919	Bacteria	7819
861	Ga0207657_10019332	3300025919	Bacteria	6473
862	Ga0207657_10114774	3300025919	Bacteria	2220
863	Ga0207657_10158515	3300025919	Bacteria	1839
864	Ga0207657_10176960	3300025919	Bacteria	1726
865	Ga0207649_10000004	3300025920	Bacteria	360726
866	Ga0207649_10003540	3300025920	Bacteria	8539
867	Ga0207649_10040932	3300025920	Bacteria	2819
868	Ga0207649_10065098	3300025920	Bacteria	2307
869	Ga0207649_10131693	3300025920	Bacteria	1700
870	Ga0207652_10000017	3300025921	Bacteria	188391
871	Ga0207652_10000040	3300025921	Bacteria	131566
872	Ga0207652_10000418	3300025921	Bacteria	44135
873	Ga0207652_10000741	3300025921	Bacteria	31499
874	Ga0207652_10008742	3300025921	Bacteria	8152
875	Ga0207652_10015518	3300025921	Bacteria	6195
876	Ga0207652_10036821	3300025921	Bacteria	4138
877	Ga0207652_10041476	3300025921	Bacteria	3913
878	Ga0207652_10047858	3300025921	Bacteria	3653
879	Ga0207652_10058924	3300025921	Bacteria	3309
880	Ga0207646_10002861	3300025922	Bacteria	20043
881	Ga0207681_10000173	3300025923	Bacteria	53026
882	Ga0207681_10001160	3300025923	Bacteria	17005
883	Ga0207681_10016143	3300025923	Bacteria	4665
884	Ga0207681_10022975	3300025923	Bacteria	3983
885	Ga0207681_10081037	3300025923	Bacteria	2291
886	Ga0207681_10089599	3300025923	Bacteria	2193
887	Ga0207681_10157130	3300025923	Bacteria	1710
888	Ga0207694_10000412	3300025924	Bacteria	39847
889	Ga0207694_10008601	3300025924	Bacteria	7709
890	Ga0207694_10010001	3300025924	Bacteria	7150
891	Ga0207694_10073264	3300025924	Bacteria	2679
892	Ga0207694_10092388	3300025924	Bacteria	2389
893	Ga0207694_10114523	3300025924	Bacteria	2148
894	Ga0207694_10199382	3300025924	Bacteria	1628
895	Ga0207650_10000003	3300025925	Bacteria	1123235
896	Ga0207650_10002038	3300025925	Bacteria	14145
897	Ga0207650_10010026	3300025925	Bacteria	6487
898	Ga0207650_10016767	3300025925	Bacteria	5123
899	Ga0207650_10037073	3300025925	Bacteria	3551
900	Ga0207650_10045395	3300025925	Bacteria	3232
901	Ga0207650_10280051	3300025925	Bacteria	1358
902	Ga0207659_10001245	3300025926	Bacteria	15261
903	Ga0207659_10021072	3300025926	Bacteria	4320
904	Ga0207659_10033777	3300025926	Bacteria	3523
905	Ga0207687_10004161	3300025927	Bacteria	9688
906	Ga0207687_10071421	3300025927	Bacteria	2480
907	Ga0207700_10006747	3300025928	Bacteria	6972
908	Ga0207664_10008387	3300025929	Bacteria	7203
909	Ga0207664_10014460	3300025929	Bacteria	5699
910	Ga0207644_10000014	3300025931	Bacteria	181604
911	Ga0207644_10004481	3300025931	Bacteria	9067
912	Ga0207644_10021392	3300025931	Bacteria	4405
913	Ga0207644_10137674	3300025931	Bacteria	1876
914	Ga0207690_10000494	3300025932	Bacteria	25468
915	Ga0207690_10001282	3300025932	Bacteria	15874
916	Ga0207690_10031758	3300025932	Bacteria	3383
917	Ga0207690_10154125	3300025932	Bacteria	1706
918	Ga0207690_10231292	3300025932	Bacteria	1419
919	Ga0207706_10003057	3300025933	Bacteria	16108
920	Ga0207706_10006038	3300025933	Bacteria	11268
921	Ga0207706_10012827	3300025933	Bacteria	7628
922	Ga0207706_10028324	3300025933	Bacteria	5003
923	Ga0207686_10034933	3300025934	Bacteria	3013
924	Ga0207709_10000224	3300025935	Bacteria	71687
925	Ga0207709_10000792	3300025935	Bacteria	24662
926	Ga0207709_10001009	3300025935	Bacteria	20872
927	Ga0207709_10002087	3300025935	Bacteria	12876
928	Ga0207709_10013845	3300025935	Bacteria	4453
929	Ga0207709_10158183	3300025935	Bacteria	1577
930	Ga0207670_10026959	3300025936	Bacteria	3627
931	Ga0207670_10036211	3300025936	Bacteria	3207
932	Ga0207670_10084609	3300025936	Bacteria	2227
933	Ga0207670_10158523	3300025936	Bacteria	1687
934	Ga0207669_10015503	3300025937	Bacteria	3845
935	Ga0207669_10028588	3300025937	Bacteria	3069
936	Ga0207669_10053185	3300025937	Bacteria	2437
937	Ga0207704_10038905	3300025938	Bacteria	2764
938	Ga0207704_10061140	3300025938	Bacteria	2335
939	Ga0207665_10018979	3300025939	Bacteria	4517
940	Ga0207691_10000387	3300025940	Bacteria	44126
941	Ga0207691_10001603	3300025940	Bacteria	22495
942	Ga0207691_10004502	3300025940	Bacteria	13495
943	Ga0207691_10004786	3300025940	Bacteria	13098
944	Ga0207691_10006299	3300025940	Bacteria	11455
945	Ga0207691_10016900	3300025940	Bacteria	6922
946	Ga0207691_10031270	3300025940	Bacteria	4969
947	Ga0207691_10106967	3300025940	Bacteria	2491
948	Ga0207711_10000939	3300025941	Bacteria	28103
949	Ga0207711_10065045	3300025941	Bacteria	3151
950	Ga0207711_10126078	3300025941	Bacteria	2290
951	Ga0207689_10011462	3300025942	Bacteria	7599
952	Ga0207689_10011479	3300025942	Bacteria	7593
953	Ga0207689_10048435	3300025942	Bacteria	3505
954	Ga0207661_10021711	3300025944	Bacteria	4815
955	Ga0207661_10049844	3300025944	Bacteria	3335
956	Ga0207661_10090906	3300025944	Bacteria	2543
957	Ga0207661_10095223	3300025944	Bacteria	2489
958	Ga0207661_10208002	3300025944	Bacteria	1723
959	Ga0207679_10000043	3300025945	Bacteria	123125
960	Ga0207679_10004434	3300025945	Bacteria	8743
961	Ga0207679_10019343	3300025945	Bacteria	4572
962	Ga0207679_10057596	3300025945	Bacteria	2875
963	Ga0207667_10000675	3300025949	Bacteria	44235
964	Ga0207667_10001331	3300025949	Bacteria	30972
965	Ga0207667_10002419	3300025949	Bacteria	23393
966	Ga0207667_10003364	3300025949	Bacteria	19733
967	Ga0207667_10021240	3300025949	Bacteria	7196
968	Ga0207667_10026555	3300025949	Bacteria	6322
969	Ga0207667_10035305	3300025949	Bacteria	5363
970	Ga0207667_10082691	3300025949	Bacteria	3325
971	Ga0207667_10164855	3300025949	Bacteria	2278
972	Ga0207667_10292912	3300025949	Bacteria	1663
973	Ga0207651_10080379	3300025960	Bacteria	2346
974	Ga0207651_10318395	3300025960	Bacteria	1299
975	Ga0207712_10000395	3300025961	Bacteria	37905
976	Ga0207712_10013603	3300025961	Bacteria	5218
977	Ga0207712_10024486	3300025961	Bacteria	3998
978	Ga0207712_10216637	3300025961	Bacteria	1528
979	Ga0207712_10315618	3300025961	Bacteria	1288
980	Ga0207668_10007682	3300025972	Bacteria	6417
981	Ga0207668_10008274	3300025972	Bacteria	6198
982	Ga0207668_10010152	3300025972	Bacteria	5678
983	Ga0207668_10013028	3300025972	Bacteria	5107
984	Ga0207668_10021564	3300025972	Bacteria	4109
985	Ga0207668_10022638	3300025972	Bacteria	4027
986	Ga0207668_10023374	3300025972	Bacteria	3971
987	Ga0207668_10026252	3300025972	Bacteria	3780
988	Ga0207640_10001728	3300025981	Bacteria	11724
989	Ga0207640_10004723	3300025981	Bacteria	7398
990	Ga0207640_10054086	3300025981	Bacteria	2624
991	Ga0207640_10096783	3300025981	Bacteria	2059
992	Ga0207640_10110958	3300025981	Bacteria	1944
993	Ga0207640_10237328	3300025981	Bacteria	1407
994	Ga0207640_10263917	3300025981	Bacteria	1343
995	Ga0207658_10000012	3300025986	Bacteria	224402
996	Ga0207658_10000245	3300025986	Bacteria	56695
997	Ga0207658_10001744	3300025986	Bacteria	16375
998	Ga0207658_10007986	3300025986	Bacteria	7205
999	Ga0207658_10040929	3300025986	Bacteria	3353
1000	Ga0207658_10048750	3300025986	Bacteria	3107
1001	Ga0207677_10000008	3300026023	Bacteria	266293
1002	Ga0207677_10001774	3300026023	Bacteria	11399
1003	Ga0207703_10000576	3300026035	Bacteria	37429
1004	Ga0207703_10016979	3300026035	Bacteria	5676
1005	Ga0207703_10056158	3300026035	Bacteria	3206
1006	Ga0207703_10067367	3300026035	Bacteria	2946
1007	Ga0207703_10070214	3300026035	Bacteria	2890
1008	Ga0207703_10107170	3300026035	Bacteria	2378
1009	Ga0207703_10109250	3300026035	Bacteria	2357
1010	Ga0207703_10124572	3300026035	Bacteria	2217
1011	Ga0207703_10384742	3300026035	Bacteria	1299
1012	Ga0207639_10000024	3300026041	Bacteria	213218
1013	Ga0207639_10000429	3300026041	Bacteria	29070
1014	Ga0207639_10001589	3300026041	Bacteria	15259
1015	Ga0207639_10006869	3300026041	Bacteria	7753
1016	Ga0207639_10010999	3300026041	Bacteria	6273
1017	Ga0207639_10022001	3300026041	Bacteria	4587
1018	Ga0207639_10033730	3300026041	Bacteria	3779
1019	Ga0207639_10057558	3300026041	Bacteria	2985
1020	Ga0207639_10168161	3300026041	Bacteria	1854
1021	Ga0207639_10274919	3300026041	Bacteria	1479
1022	Ga0207678_10013058	3300026067	Bacteria	7287
1023	Ga0207678_10068493	3300026067	Bacteria	3044
1024	Ga0207678_10193842	3300026067	Bacteria	1737
1025	Ga0207678_10416105	3300026067	Bacteria	1165
1026	Ga0207708_10012140	3300026075	Bacteria	6423
1027	Ga0207708_10034495	3300026075	Bacteria	3848
1028	Ga0207708_10055505	3300026075	Bacteria	3020
1029	Ga0207708_10077462	3300026075	Bacteria	2552
1030	Ga0207702_10000155	3300026078	Bacteria	80813
1031	Ga0207702_10014043	3300026078	Bacteria	6649
1032	Ga0207702_10024166	3300026078	Bacteria	5041
1033	Ga0207702_10124308	3300026078	Bacteria	2313
1034	Ga0207641_10024285	3300026088	Bacteria	4996
1035	Ga0207641_10072269	3300026088	Bacteria	2970
1036	Ga0207641_10159004	3300026088	Bacteria	2052
1037	Ga0207648_10000605	3300026089	Bacteria	40285
1038	Ga0207648_10026946	3300026089	Bacteria	5104
1039	Ga0207648_10036045	3300026089	Bacteria	4358
1040	Ga0207648_10045833	3300026089	Bacteria	3834
1041	Ga0207648_10052902	3300026089	Bacteria	3550
1042	Ga0207676_10000003	3300026095	Bacteria	1123235
1043	Ga0207676_10000070	3300026095	Bacteria	104103
1044	Ga0207676_10138128	3300026095	Bacteria	2082
1045	Ga0207674_10010601	3300026116	Bacteria	10428
1046	Ga0207674_10019860	3300026116	Bacteria	7271
1047	Ga0207674_10140696	3300026116	Bacteria	2372
1048	Ga0207674_10250276	3300026116	Bacteria	1719
1049	Ga0207675_100009143	3300026118	Bacteria	9293
1050	Ga0207675_100027650	3300026118	Bacteria	5282
1051	Ga0207675_100052996	3300026118	Bacteria	3785
1052	Ga0207675_100054807	3300026118	Bacteria	3720
1053	Ga0207675_100061557	3300026118	Bacteria	3503
1054	Ga0207675_100078348	3300026118	Bacteria	3096
1055	Ga0207675_100078379	3300026118	Bacteria	3096
1056	Ga0207675_100138186	3300026118	Bacteria	2313
1057	Ga0207683_10000005	3300026121	Bacteria	187889
1058	Ga0207683_10010458	3300026121	Bacteria	7918
1059	Ga0207683_10011093	3300026121	Bacteria	7680
1060	Ga0207683_10035345	3300026121	Bacteria	4345
1061	Ga0207683_10054930	3300026121	Bacteria	3492
1062	Ga0207683_10067932	3300026121	Bacteria	3145
1063	Ga0207683_10068007	3300026121	Bacteria	3143
1064	Ga0207683_10253678	3300026121	Bacteria	1605
1065	Ga0207698_10003709	3300026142	Bacteria	9236
1066	Ga0207698_10004132	3300026142	Bacteria	8820
1067	Ga0207698_10018515	3300026142	Bacteria	4748
1068	Ga0207698_10027609	3300026142	Bacteria	4032
1069	Ga0207698_10140631	3300026142	Bacteria	2079
1070	Ga0207698_10170768	3300026142	Bacteria	1914
1071	Ga0207698_10331398	3300026142	Bacteria	1430
1072	Ga0209281_1000015	3300027111	Bacteria	590084
1073	Ga0209281_1001253	3300027111	Bacteria	16564
1074	Ga0209389_1000002	3300027296	Bacteria	333932
1075	Ga0209389_1039782	3300027296	Bacteria	3655
1076	Ga0209371_1000028	3300027312	Bacteria	429688
1077	Ga0209371_1000053	3300027312	Bacteria	264616
1078	Ga0209371_1000055	3300027312	Bacteria	257599
1079	Ga0209371_1000096	3300027312	Bacteria	160552
1080	Ga0209371_1000372	3300027312	Bacteria	48390
1081	Ga0209371_1000383	3300027312	Bacteria	46871
1082	Ga0209371_1000393	3300027312	Bacteria	46071
1083	Ga0209371_1000886	3300027312	Bacteria	23892
1084	Ga0209371_1001326	3300027312	Bacteria	17256
1085	Ga0209371_1001917	3300027312	Bacteria	12702
1086	Ga0209371_1004830	3300027312	Bacteria	5652
1087	Ga0209969_1002097	3300027360	Bacteria	2749
1088	Ga0209967_1004455	3300027364	Bacteria	1862
1089	Ga0209981_1006357	3300027378	Bacteria	1579
1090	Ga0210000_1001840	3300027462	Bacteria	3002
1091	Ga0209999_1001530	3300027543	Bacteria	3975
1092	Ga0209982_1001316	3300027552	Bacteria	3367
1093	Ga0209982_1002763	3300027552	Bacteria	2469
1094	Ga0209970_1002461	3300027614	Bacteria	3148
1095	Ga0209970_1003229	3300027614	Bacteria	2752
1096	Ga0209983_1000734	3300027665	Bacteria	7112
1097	Ga0209983_1001878	3300027665	Bacteria	4669
1098	Ga0209983_1010422	3300027665	Bacteria	1900
1099	Ga0209971_1000263	3300027682	Bacteria	14833
1100	Ga0209971_1001937	3300027682	Bacteria	5057
1101	Ga0209813_10013154	3300027866	Bacteria	2203
1102	Ga0209974_10000936	3300027876	Bacteria	10190
1103	Ga0209974_10057215	3300027876	Bacteria	1317
1104	Ga0207428_10015119	3300027907	Bacteria	6681
1105	Ga0207428_10125850	3300027907	Bacteria	1963
1106	Ga0207428_10262208	3300027907	Bacteria	1287
1107	Ga0268266_10000001	3300028379	Bacteria	4040580
1108	Ga0268266_10000008	3300028379	Bacteria	1161875
1109	Ga0268266_10000351	3300028379	Bacteria	71625
1110	Ga0268266_10002049	3300028379	Bacteria	22350
1111	Ga0268266_10004501	3300028379	Bacteria	13324
1112	Ga0268266_10007953	3300028379	Bacteria	9481
1113	Ga0268266_10016101	3300028379	Bacteria	6392
1114	Ga0268266_10017481	3300028379	Bacteria	6116
1115	Ga0268266_10081895	3300028379	Bacteria	2814
1116	Ga0268266_10118592	3300028379	Bacteria	2352
1117	Ga0268266_10157861	3300028379	Bacteria	2050
1118	Ga0268266_10191937	3300028379	Bacteria	1865
1119	Ga0268266_10221220	3300028379	Bacteria	1740
1120	Ga0268265_10000238	3300028380	Bacteria	62848
1121	Ga0268265_10010569	3300028380	Bacteria	6233
1122	Ga0268265_10020952	3300028380	Bacteria	4570
1123	Ga0268265_10131304	3300028380	Bacteria	2082
1124	Ga0268264_10000009	3300028381	Bacteria	724972
1125	Ga0268264_10009455	3300028381	Bacteria	8072
1126	Ga0268264_10037377	3300028381	Bacteria	4003
1127	Ga0268264_10062001	3300028381	Bacteria	3139
1128	Ga0268264_10312818	3300028381	Bacteria	1482
1129	Ga0268264_10377258	3300028381	Bacteria	1357
1130	Ga0268264_10437605	3300028381	Bacteria	1264
1131	Ga0265334_10000005	3300028573	Bacteria	242590
1132	Ga0265334_10000055	3300028573	Bacteria	81789
1133	Ga0265334_10008909	3300028573	Bacteria	4259
1134	Ga0265318_10006014	3300028577	Bacteria	5629
1135	Ga0265323_10000092	3300028653	Bacteria	51020
1136	Ga0265323_10022424	3300028653	Bacteria	2413
1137	Ga0265322_10000318	3300028654	Bacteria	20234
1138	Ga0307515_10018143	3300028794	Bacteria	12766
1139	Ga0307515_10240103	3300028794	Bacteria	1585
1140	Ga0265338_10012530	3300028800	Bacteria	9662
1141	Ga0265338_10013943	3300028800	Bacteria	9016
1142	Ga0265338_10020660	3300028800	Bacteria	6912
1143	Ga0265338_10038824	3300028800	Bacteria	4503
1144	Ga0265338_10046681	3300028800	Bacteria	3966
1145	Ga0265338_10067136	3300028800	Bacteria	3099
1146	Ga0265338_10078863	3300028800	Bacteria	2775
1147	Ga0268256_1000030	3300030500	Bacteria	429688
1148	Ga0268256_1000053	3300030500	Bacteria	264616
1149	Ga0268256_1000054	3300030500	Bacteria	257599
1150	Ga0268256_1000086	3300030500	Bacteria	160533
1151	Ga0268256_1000316	3300030500	Bacteria	48390
1152	Ga0268256_1000347	3300030500	Bacteria	44781
1153	Ga0268256_1000384	3300030500	Bacteria	41079
1154	Ga0268256_1001022	3300030500	Bacteria	18837
1155	Ga0268256_1003519	3300030500	Bacteria	7021
1156	Ga0307511_10000048	3300030521	Bacteria	98665
1157	Ga0307511_10105523	3300030521	Bacteria	1823
1158	Ga0316177_1040214	3300030731	Bacteria	12983
1159	Ga0316176_1226866	3300030732	Bacteria	1218
1160	Ga0314311_1077855	3300030733	Bacteria	3990
1161	Ga0314311_1098321	3300030733	Bacteria	10159
1162	Ga0316178_1061620	3300030735	Bacteria	22064
1163	Ga0265332_10023267	3300031238	Bacteria	2732
1164	Ga0265320_10006593	3300031240	Bacteria	7296
1165	Ga0265320_10053556	3300031240	Bacteria	1950
1166	Ga0265325_10001456	3300031241	Bacteria	16632
1167	Ga0265325_10003046	3300031241	Bacteria	11083
1168	Ga0265325_10012192	3300031241	Bacteria	4919
1169	Ga0265340_10046100	3300031247	Bacteria	2127
1170	Ga0265339_10000839	3300031249	Bacteria	23710
1171	Ga0265339_10001900	3300031249	Bacteria	15338
1172	Ga0265339_10033861	3300031249	Bacteria	2874
1173	Ga0265331_10005707	3300031250	Bacteria	7467
1174	Ga0265327_10000050	3300031251	Bacteria	266536
1175	Ga0265327_10000686	3300031251	Bacteria	54251
1176	Ga0265327_10003233	3300031251	Bacteria	15840
1177	Ga0265327_10055346	3300031251	Bacteria	2050
1178	Ga0265327_10082641	3300031251	Bacteria	1582
1179	Ga0265316_10014740	3300031344	Bacteria	6863
1180	Ga0265316_10057360	3300031344	Bacteria	3037
1181	Ga0265316_10138016	3300031344	Bacteria	1833
1182	Ga0307513_10003153	3300031456	Bacteria	22531
1183	Ga0307513_10009635	3300031456	Bacteria	12198
1184	Ga0307513_10011253	3300031456	Bacteria	11137
1185	Ga0307513_10013985	3300031456	Bacteria	9831
1186	Ga0307513_10114999	3300031456	Bacteria	2674
1187	Ga0307513_10116313	3300031456	Bacteria	2654
1188	Ga0307513_10151784	3300031456	Bacteria	2224
1189	Ga0307509_10000803	3300031507	Bacteria	53898
1190	Ga0307509_10187296	3300031507	Bacteria	1926
1191	Ga0307408_100000020	3300031548	Bacteria	340408
1192	Ga0307408_100008855	3300031548	Bacteria	6647
1193	Ga0265313_10000157	3300031595	Bacteria	70659
1194	Ga0265313_10000285	3300031595	Bacteria	55547
1195	Ga0265313_10003134	3300031595	Bacteria	13655
1196	Ga0265313_10011118	3300031595	Bacteria	5614
1197	Ga0307514_10087132	3300031649	Bacteria	2289
1198	Ga0316575_10002292	3300031665	Bacteria	6399
1199	Ga0316575_10018222	3300031665	Bacteria	2674
1200	Ga0316575_10052454	3300031665	Bacteria	1624
1201	Ga0316579_10000314	3300031691	Bacteria	15003
1202	Ga0316579_10002675	3300031691	Bacteria	6775
1203	Ga0316579_10004615	3300031691	Bacteria	5479
1204	Ga0316579_10014182	3300031691	Bacteria	3439
1205	Ga0316579_10044328	3300031691	Bacteria	2071
1206	Ga0265314_10001951	3300031711	Bacteria	21973
1207	Ga0265314_10016816	3300031711	Bacteria	5764
1208	Ga0265314_10044236	3300031711	Bacteria	3158
1209	Ga0265342_10000223	3300031712	Bacteria	64311
1210	Ga0265342_10009087	3300031712	Bacteria	7043
1211	Ga0265342_10011729	3300031712	Bacteria	5979
1212	Ga0265342_10020541	3300031712	Bacteria	4232
1213	Ga0316576_10002990	3300031727	Bacteria	9807
1214	Ga0316576_10005553	3300031727	Bacteria	7722
1215	Ga0316576_10007808	3300031727	Bacteria	6759
1216	Ga0316576_10009657	3300031727	Bacteria	6241
1217	Ga0316576_10020790	3300031727	Bacteria	4528
1218	Ga0316576_10050561	3300031727	Bacteria	3023
1219	Ga0316576_10051602	3300031727	Bacteria	2994
1220	Ga0316576_10056812	3300031727	Bacteria	2859
1221	Ga0316576_10077524	3300031727	Bacteria	2461
1222	Ga0316576_10110491	3300031727	Bacteria	2060
1223	Ga0316576_10121372	3300031727	Bacteria	1962
1224	Ga0316578_10000370	3300031728	Bacteria	14342
1225	Ga0316578_10004657	3300031728	Bacteria	6508
1226	Ga0316578_10014656	3300031728	Bacteria	4194
1227	Ga0307516_10040204	3300031730	Bacteria	4657
1228	Ga0307405_10033582	3300031731	Bacteria	3045
1229	Ga0307405_10038439	3300031731	Bacteria	2885
1230	Ga0316577_10000223	3300031733	Bacteria	19464
1231	Ga0316577_10000344	3300031733	Bacteria	17334
1232	Ga0316577_10000644	3300031733	Bacteria	14535
1233	Ga0316577_10004466	3300031733	Bacteria	7220
1234	Ga0316577_10006163	3300031733	Bacteria	6324
1235	Ga0316577_10025724	3300031733	Bacteria	3273
1236	Ga0316577_10049713	3300031733	Bacteria	2340
1237	Ga0307413_10053876	3300031824	Bacteria	2437
1238	Ga0307413_10099593	3300031824	Bacteria	1916
1239	Ga0307413_10123215	3300031824	Bacteria	1760
1240	Ga0307413_10144998	3300031824	Bacteria	1647
1241	Ga0307413_10218949	3300031824	Bacteria	1389
1242	Ga0307410_10015095	3300031852	Bacteria	4570
1243	Ga0307410_10022754	3300031852	Bacteria	3881
1244	Ga0307410_10058477	3300031852	Bacteria	2628
1245	Ga0307410_10142513	3300031852	Bacteria	1775
1246	Ga0307406_10007418	3300031901	Bacteria	6080
1247	Ga0307406_10018163	3300031901	Bacteria	4104
1248	Ga0307406_10058472	3300031901	Bacteria	2478
1249	Ga0307406_10083468	3300031901	Bacteria	2130
1250	Ga0307406_10086704	3300031901	Bacteria	2097
1251	Ga0307406_10098513	3300031901	Bacteria	1985
1252	Ga0307407_10003636	3300031903	Bacteria	6377
1253	Ga0307407_10048132	3300031903	Bacteria	2424
1254	Ga0307412_10147349	3300031911	Bacteria	1732
1255	Ga0307409_100000732	3300031995	Bacteria	14712
1256	Ga0307409_100056073	3300031995	Bacteria	3046
1257	Ga0307409_100080605	3300031995	Bacteria	2627
1258	Ga0307409_100091404	3300031995	Bacteria	2494
1259	Ga0307416_100035612	3300032002	Bacteria	3804
1260	Ga0307416_100071096	3300032002	Bacteria	2889
1261	Ga0307416_100073357	3300032002	Bacteria	2853
1262	Ga0307414_10008201	3300032004	Bacteria	5909
1263	Ga0307414_10049423	3300032004	Bacteria	2908
1264	Ga0307414_10059649	3300032004	Bacteria	2695
1265	Ga0307414_10074968	3300032004	Bacteria	2454
1266	Ga0307414_10077203	3300032004	Bacteria	2423
1267	Ga0307414_10107686	3300032004	Bacteria	2112
1268	Ga0307414_10108878	3300032004	Bacteria	2103
1269	Ga0307414_10175296	3300032004	Bacteria	1719
1270	Ga0307414_10245636	3300032004	Bacteria	1484
1271	Ga0307414_10309415	3300032004	Bacteria	1340
1272	Ga0307414_10463390	3300032004	Bacteria	1114
1273	Ga0307411_10001016	3300032005	Bacteria	10840
1274	Ga0307411_10012786	3300032005	Bacteria	4599
1275	Ga0307411_10235981	3300032005	Bacteria	1428
1276	Ga0307411_10259440	3300032005	Bacteria	1371
1277	Ga0307415_100009622	3300032126	Bacteria	5432
1278	Ga0307415_100112633	3300032126	Bacteria	2022
1279	Ga0307415_100219485	3300032126	Bacteria	1523
1280	Ga0316583_10003257	3300032133	Bacteria	5704
1281	Ga0316583_10007471	3300032133	Bacteria	3934
1282	Ga0316585_10000533	3300032137	Bacteria	9168
1283	Ga0316585_10004220	3300032137	Bacteria	3993
1284	Ga0316585_10025372	3300032137	Bacteria	1838
1285	Ga0316580_10000173	3300032139	Bacteria	12821
1286	Ga0316593_10000597	3300032168	Bacteria	6831
1287	Ga0316593_10003204	3300032168	Bacteria	4022
1288	Ga0316593_10031255	3300032168	Bacteria	1734
1289	Ga0316593_10035202	3300032168	Bacteria	1646
1290	Ga0373926_0005667	3300035083	Bacteria	4122
1291	Ga0373932_0041024	3300035112	Bacteria	1336
1292	Ga0373956_0028701	3300035119	Bacteria	2422
1293	Ga0373946_0017116	3300035171	Bacteria	2769
1294	Ga0316574_0001355	3300035398	Bacteria	11531
1295	Ga0316574_0003909	3300035398	Bacteria	7747
1296	Ga0316574_0004949	3300035398	Bacteria	7056
1297	Ga0316574_0008403	3300035398	Bacteria	5731
1298	Ga0316574_0009069	3300035398	Bacteria	5559
1299	Ga0316574_0010536	3300035398	Bacteria	5229
1300	Ga0316574_0012253	3300035398	Bacteria	4903
1301	Ga0316574_0015345	3300035398	Bacteria	4444
1302	Ga0316574_0016881	3300035398	Bacteria	4261
1303	Ga0316574_0019082	3300035398	Bacteria	4041
1304	Ga0316574_0020157	3300035398	Bacteria	3944
1305	Ga0316574_0053937	3300035398	Bacteria	2511
1306	Ga0316574_0055368	3300035398	Bacteria	2479
1307	Ga0373931_0026984	3300035691	Bacteria	2928
1308	Ga0373927_0000001	3300035695	Bacteria	1082160
1309	Ga0373927_0000497	3300035695	Bacteria	29917
1310	Ga0373933_0023786	3300035724	Bacteria	3503
1311	Ga0373933_0117258	3300035724	Bacteria	1665
1312	Ga0373937_0021774	3300036401	Bacteria	5754
1313	Ga0373937_0026796	3300036401	Bacteria	5210
1314	Ga0373937_0124512	3300036401	Bacteria	2404
1315	Ga0373937_0165534	3300036401	Bacteria	2073
1316	Ga0373937_0264512	3300036401	Bacteria	1622
1317	Ga0316582_0001233	3300036647	Bacteria	11036
1318	Ga0316582_0001903	3300036647	Bacteria	9501
1319	Ga0316582_0005900	3300036647	Bacteria	6369
1320	Ga0316582_0011958	3300036647	Bacteria	4826
1321	Ga0316582_0020379	3300036647	Bacteria	3898
1322	Ga0316582_0025140	3300036647	Bacteria	3572
1323	Ga0316582_0028240	3300036647	Bacteria	3397
1324	Ga0316582_0050463	3300036647	Bacteria	2636
1325	Ga0316582_0116443	3300036647	Bacteria	1784
1326	Ga0316582_0212138	3300036647	Bacteria	1323
1327	Ga0316582_0233157	3300036647	Bacteria	1260
1328	Ga0316584_0007781	3300036712	Bacteria	7349
1329	Ga0316584_0008226	3300036712	Bacteria	7177
1330	Ga0316584_0010288	3300036712	Bacteria	6536
1331	Ga0316584_0011067	3300036712	Bacteria	6324
1332	Ga0316584_0012611	3300036712	Bacteria	5964
1333	Ga0316584_0014632	3300036712	Bacteria	5593
1334	Ga0316584_0015152	3300036712	Bacteria	5510
1335	Ga0316584_0032840	3300036712	Bacteria	3841
1336	Ga0316584_0037482	3300036712	Bacteria	3602
1337	Ga0316584_0074587	3300036712	Bacteria	2543
1338	Ga0316584_0096406	3300036712	Bacteria	2214
1339	Ga0316584_0099737	3300036712	Bacteria	2175
1340	Ga0316584_0169501	3300036712	Bacteria	1620
1341	Ga0316584_0178465	3300036712	Bacteria	1573
1342	Ga0373925_0001873	3300037068	Bacteria	17476
1343	Ga0373925_0059430	3300037068	Bacteria	2868
1344	Ga0373925_0267982	3300037068	Bacteria	1373
1345	Ga0395899_0000081	3300037312	Bacteria	169527
1346	Ga0395899_0005214	3300037312	Bacteria	10107
1347	Ga0395899_0014609	3300037312	Bacteria	5992
1348	Ga0395899_0018037	3300037312	Bacteria	5371
1349	Ga0395899_0067968	3300037312	Bacteria	2613
1350	Ga0395900_0000024	3300037418	Bacteria	323480
1351	Ga0395900_0006880	3300037418	Bacteria	11798
1352	Ga0395900_0017919	3300037418	Bacteria	7228
1353	Ga0395900_0020257	3300037418	Bacteria	6788
1354	Ga0395900_0041563	3300037418	Bacteria	4739
1355	Ga0395900_0077135	3300037418	Bacteria	3424
1356	Ga0395900_0087119	3300037418	Bacteria	3209
1357	Ga0395900_0124560	3300037418	Bacteria	2643
1358	Ga0395900_0174301	3300037418	Bacteria	2188
1359	Ga0395900_0238896	3300037418	Bacteria	1823
1360	Ga0395898_0000044	3300037466	Bacteria	298164
1361	Ga0395898_0000132	3300037466	Bacteria	192211
1362	Ga0395898_0072784	3300037466	Bacteria	3320
1363	Ga0395898_0110601	3300037466	Bacteria	2633
1364	Ga0395898_0131980	3300037466	Bacteria	2392
1365	Ga0395898_0151247	3300037466	Bacteria	2220
1366	Ga0395905_0000436	3300037471	Bacteria	58290
1367	Ga0395905_0004628	3300037471	Bacteria	14231
1368	Ga0395905_0029306	3300037471	Bacteria	5187
1369	Ga0395905_0129243	3300037471	Bacteria	2376
1370	Ga0395905_0199430	3300037471	Bacteria	1876
1371	Ga0316581_0001082	3300037588	Bacteria	5890
1372	Ga0316581_0006262	3300037588	Bacteria	3141
1373	Ga0316581_0039891	3300037588	Bacteria	1429
1374	Ga0436364_0446012	3300037853	Bacteria	193523
1375	Ga0436364_0449818	3300037853	Bacteria	2092
1376	Ga0436364_0628810	3300037853	Bacteria	2987
1377	Ga0436364_0710305	3300037853	Bacteria	4095
1378	Ga0436364_0931849	3300037853	Bacteria	7170
1379	Ga0436364_1175804	3300037853	Bacteria	8670
1380	Ga0436364_1238290	3300037853	Bacteria	5784
1381	Ga0395901_0013273	3300038443	Bacteria	8367
1382	Ga0395901_0024951	3300038443	Bacteria	6136
1383	Ga0395901_0073303	3300038443	Bacteria	3570
1384	Ga0395901_0137225	3300038443	Bacteria	2570
1385	Ga0395901_0302237	3300038443	Bacteria	1659
1386	Ga0237819_00853	3300038705	Bacteria	9592
1387	Ga0237819_01136	3300038705	Bacteria	7671
1388	Ga0237819_05564	3300038705	Bacteria	1964
1389	Ga0400484_09238	3300038725	Bacteria	3452
1390	Ga0400484_42261	3300038725	Bacteria	5745
1391	Ga0400490_10834	3300038726	Bacteria	1789
1392	Ga0400488_02598	3300038741	Bacteria	5459
1393	Ga0400488_59213	3300038741	Bacteria	1235
1394	Ga0400483_046648	3300039062	Bacteria	3103
1395	Ga0400483_048940	3300039062	Bacteria	2443
1396	Ga0400483_088143	3300039062	Bacteria	5346
1397	Ga0400483_218937	3300039062	Bacteria	2567
1398	Ga0400483_224464	3300039062	Bacteria	121183
1399	Ga0400483_253768	3300039062	Bacteria	3582
1400	Ga0400483_290698	3300039062	Bacteria	4188
1401	Ga0400487_22360	3300039110	Bacteria	76631
1402	Ga0237816_00761	3300039145	Bacteria	2695
1403	Ga0436365_0215846	3300039437	Bacteria	49725
1404	Ga0436365_0360171	3300039437	Bacteria	13869
1405	Ga0436365_0462933	3300039437	Bacteria	1961
1406	Ga0436365_1119503	3300039437	Bacteria	4615
1407	Ga0436365_1322600	3300039437	Bacteria	3214
1408	Ga0436365_1430109	3300039437	Bacteria	3159
1409	Ga0436365_1713844	3300039437	Bacteria	3042
1410	Ga0436361_0029807	3300039447	Bacteria	5018
1411	Ga0436361_0193594	3300039447	Bacteria	7272
1412	Ga0436361_0297903	3300039447	Bacteria	12260
1413	Ga0436361_0446792	3300039447	Bacteria	9702
1414	Ga0436361_0729555	3300039447	Bacteria	20176
1415	Ga0436363_0375975	3300039450	Bacteria	36949
1416	Ga0436363_1415861	3300039450	Bacteria	1461
1417	Ga0436362_0336022	3300039453	Bacteria	9543
1418	Ga0436362_0423328	3300039453	Bacteria	2962
1419	Ga0436362_0791946	3300039453	Bacteria	1358
1420	Ga0439436_0001140	3300041404	Bacteria	7534
1421	Ga0439436_0004285	3300041404	Bacteria	4370
1422	Ga0439438_000003	3300041405	Bacteria	464587
1423	Ga0439438_000957	3300041405	Bacteria	12865
1424	Ga0439438_018033	3300041405	Bacteria	2018
1425	Ga0439447_000887	3300041407	Bacteria	10927
1426	Ga0439447_001393	3300041407	Bacteria	8860
1427	Ga0439447_003845	3300041407	Bacteria	5269
1428	Ga0439466_0000002	3300041411	Bacteria	494198
1429	Ga0451793_1857627	3300041452	Bacteria	2104
1430	Ga0451797_0274168	3300041453	Bacteria	1384
1431	Ga0451797_0912495	3300041453	Bacteria	1287
1432	Ga0451800_0576752	3300041459	Bacteria	2784
1433	Ga0451806_279283	3300041462	Bacteria	2701
1434	Ga0451804_0115246	3300041463	Bacteria	1539
1435	Ga0451807_0585596	3300041486	Bacteria	2373
1436	Ga0451807_0634797	3300041486	Bacteria	2555
1437	Ga0451837_0582815	3300041494	Bacteria	1728
1438	Ga0451843_0365125	3300041509	Bacteria	1586
1439	Ga0439448_0010077	3300042005	Bacteria	2794
1440	Ga0439432_001994	3300042006	Bacteria	7725
1441	Ga0439432_005988	3300042006	Bacteria	4362
1442	Ga0439432_010887	3300042006	Bacteria	3140
1443	Ga0439432_027591	3300042006	Bacteria	1853
1444	Ga0439449_0001853	3300042007	Bacteria	8321
1445	Ga0439449_0006794	3300042007	Bacteria	4364
1446	Ga0439449_0038361	3300042007	Bacteria	1781
1447	Ga0439452_000004	3300042010	Bacteria	764268
1448	Ga0439456_000447	3300042013	Bacteria	9109
1449	Ga0439456_015545	3300042013	Bacteria	1589
1450	Ga0439462_0022880	3300042015	Bacteria	1637
1451	Ga0439463_000398	3300042016	Bacteria	12029
1452	Ga0439463_009060	3300042016	Bacteria	2450
1453	Ga0450911_000023	3300042115	Bacteria	90815
1454	Ga0450902_000375	3300042137	Bacteria	5475
1455	Ga0450904_000874	3300042139	Bacteria	4923
1456	Ga0450907_000111	3300042146	Bacteria	30855
1457	Ga0450907_001439	3300042146	Bacteria	5154
1458	Ga0439446_0003799	3300042156	Bacteria	3781
1459	Ga0439435_0005080	3300042436	Bacteria	2875
1460	Ga0439460_0021660	3300042461	Bacteria	1758
1461	Ga0451577_0008930	3300042876	Bacteria	9698
1462	Ga0451577_0113445	3300042876	Bacteria	2426
1463	Ga0451577_0239325	3300042876	Bacteria	1642
1464	Ga0451577_0361447	3300042876	Bacteria	1317
1465	Ga0466969_0000960	3300044656	Bacteria	15534
1466	Ga0466969_0014103	3300044656	Bacteria	4205
1467	Ga0466969_0015224	3300044656	Bacteria	4032
1468	Ga0466972_0006413	3300044658	Bacteria	5908
1469	Ga0453683_0000017	3300044673	Bacteria	309594
1470	Ga0453683_0008072	3300044673	Bacteria	7085
1471	Ga0466965_0001344	3300044683	Bacteria	9858
1472	Ga0466966_0005086	3300044684	Bacteria	8641
1473	Ga0466966_0029397	3300044684	Bacteria	3575
1474	Ga0466961_0005884	3300044693	Bacteria	7771
1475	Ga0466961_0019003	3300044693	Bacteria	4421
1476	Ga0466964_0006646	3300044706	Bacteria	4310
1477	Ga0466964_0014639	3300044706	Bacteria	2983
1478	Ga0466964_0076182	3300044706	Bacteria	1430
1479	Ga0453684_0000316	3300044712	Bacteria	204457
1480	Ga0453684_0001076	3300044712	Bacteria	86924
1481	Ga0453684_0006694	3300044712	Bacteria	21744
1482	Ga0453684_0010490	3300044712	Bacteria	15828
1483	Ga0453684_0058656	3300044712	Bacteria	4970
1484	Ga0453684_0065068	3300044712	Bacteria	4652
1485	Ga0453684_0114270	3300044712	Bacteria	3273
1486	Ga0453684_0149461	3300044712	Bacteria	2778
1487	Ga0453684_0179861	3300044712	Bacteria	2484
1488	Ga0453684_0206048	3300044712	Bacteria	2289
1489	Ga0453684_0214640	3300044712	Unclassified	2234
1490	Ga0453684_0308949	3300044712	Bacteria	1795
1491	Ga0453684_0333312	3300044712	Bacteria	1715
1492	Ga0466971_0000025	3300044719	Bacteria	62833
1493	Ga0466971_0001123	3300044719	Bacteria	11133
1494	Ga0466971_0006335	3300044719	Bacteria	5137
1495	Ga0466971_0028919	3300044719	Bacteria	2479
1496	Ga0466968_0033961	3300044735	Bacteria	2127
1497	Ga0466970_0012472	3300044765	Bacteria	4346
1498	Ga0466970_0072443	3300044765	Bacteria	1853
1499	Ga0466957_0034917	3300044842	Bacteria	3016
1500	Ga0466957_0036876	3300044842	Bacteria	2941
1501	Ga0466957_0042287	3300044842	Bacteria	2756
1502	Ga0466959_0000254	3300045049	Bacteria	32770
1503	Ga0466959_0009961	3300045049	Bacteria	6774
1504	Ga0466959_0010127	3300045049	Bacteria	6725
1505	Ga0466959_0019425	3300045049	Bacteria	4997
1506	Ga0466959_0031054	3300045049	Bacteria	3953
1507	Ga0466959_0135231	3300045049	Bacteria	1745
1508	Ga0451576_0000001	3300045051	Bacteria	1802108
1509	Ga0451576_0000128	3300045051	Bacteria	192071
1510	Ga0451576_0000197	3300045051	Bacteria	152331
1511	Ga0451576_0000267	3300045051	Bacteria	127501
1512	Ga0451576_0002564	3300045051	Bacteria	26816
1513	Ga0451576_0037311	3300045051	Bacteria	5149
1514	Ga0451576_0062608	3300045051	Bacteria	3878
1515	Ga0451576_0189878	3300045051	Bacteria	2145
1516	Ga0451576_0302931	3300045051	Bacteria	1672
1517	Ga0451576_0351318	3300045051	Bacteria	1544
1518	Ga0466958_0004333	3300045836	Bacteria	7475
1519	Ga0466958_0056097	3300045836	Bacteria	2392
1520	Ga0466967_0196446	3300045976	Bacteria	1909
1521	Ga0495627_014099	3300046453	Bacteria	2798
1522	Ga0495590_0007330	3300046457	Bacteria	4260
1523	Ga0495591_000015	3300046458	Bacteria	252107
1524	Ga0495591_000024	3300046458	Bacteria	191134
1525	Ga0495591_001361	3300046458	Bacteria	15338
1526	Ga0495591_002424	3300046458	Bacteria	10382
1527	Ga0495591_008674	3300046458	Bacteria	4134
1528	Ga0495638_0001599	3300046460	Bacteria	20232
1529	Ga0495638_0001921	3300046460	Bacteria	17886
1530	Ga0495651_0089801	3300046462	Bacteria	2306
1531	Ga0495650_0000004	3300046471	Bacteria	779487
1532	Ga0495650_0000996	3300046471	Bacteria	32109
1533	Ga0495650_0018564	3300046471	Bacteria	3450
1534	Ga0495580_0027978	3300046472	Bacteria	4100
1535	Ga0495605_0000016	3300046474	Bacteria	289508
1536	Ga0495605_0001211	3300046474	Bacteria	17187
1537	Ga0495605_0001789	3300046474	Bacteria	13794
1538	Ga0495605_0007714	3300046474	Bacteria	6099
1539	Ga0495584_0008633	3300046491	Bacteria	5273
1540	Ga0495585_0007984	3300046492	Bacteria	6435
1541	Ga0495585_0008051	3300046492	Bacteria	6407
1542	Ga0495585_0029967	3300046492	Bacteria	3095
1543	Ga0495594_0003833	3300046499	Bacteria	7726
1544	Ga0495607_0003388	3300046501	Bacteria	12219
1545	Ga0495607_0036069	3300046501	Bacteria	2984
1546	Ga0495583_0000041	3300046506	Bacteria	234707
1547	Ga0495583_0013842	3300046506	Bacteria	4474
1548	Ga0495606_0000055	3300046507	Bacteria	199348
1549	Ga0495606_0002112	3300046507	Bacteria	24130
1550	Ga0495606_0004870	3300046507	Bacteria	13159
1551	Ga0495606_0050711	3300046507	Bacteria	2713
1552	Ga0495606_0058513	3300046507	Bacteria	2476
1553	Ga0495610_0007818	3300046512	Bacteria	7043
1554	Ga0495616_0004336	3300046513	Bacteria	8956
1555	Ga0495616_0018499	3300046513	Bacteria	3823
1556	Ga0495620_0000036	3300046515	Bacteria	115279
1557	Ga0495620_0000096	3300046515	Bacteria	70068
1558	Ga0495630_0058022	3300046517	Bacteria	2902
1559	Ga0495631_0008755	3300046518	Bacteria	5086
1560	Ga0495631_0080790	3300046518	Bacteria	1402
1561	Ga0495632_0004195	3300046519	Bacteria	9853
1562	Ga0495632_0006259	3300046519	Bacteria	7692
1563	Ga0495632_0009644	3300046519	Bacteria	5796
1564	Ga0495632_0134329	3300046519	Bacteria	1150
1565	Ga0495637_0002121	3300046520	Bacteria	11143
1566	Ga0495637_0011137	3300046520	Bacteria	4327
1567	Ga0495643_0001220	3300046522	Bacteria	24866
1568	Ga0495643_0002614	3300046522	Bacteria	14019
1569	Ga0495643_0003424	3300046522	Bacteria	11629
1570	Ga0495643_0012187	3300046522	Bacteria	5194
1571	Ga0495648_0002757	3300046524	Bacteria	15864
1572	Ga0495648_0007675	3300046524	Bacteria	8601
1573	Ga0495663_0006190	3300046525	Bacteria	3305
1574	Ga0495666_0024844	3300046526	Bacteria	2959
1575	Ga0495642_0001778	3300046528	Bacteria	9300
1576	Ga0495654_0000061	3300046530	Bacteria	130939
1577	Ga0495654_0001071	3300046530	Bacteria	19968
1578	Ga0495654_0001795	3300046530	Bacteria	14291
1579	Ga0495586_0018760	3300046535	Bacteria	3683
1580	Ga0495587_0007346	3300046536	Bacteria	7141
1581	Ga0495609_0000015	3300046538	Bacteria	322474
1582	Ga0495609_0000050	3300046538	Bacteria	154752
1583	Ga0495609_0000787	3300046538	Bacteria	23711
1584	Ga0495621_0002387	3300046539	Bacteria	5055
1585	Ga0495633_0000666	3300046558	Bacteria	31695
1586	Ga0495633_0022173	3300046558	Bacteria	3165
1587	Ga0495668_0000926	3300046616	Bacteria	32744
1588	Ga0495668_0017507	3300046616	Bacteria	4155
1589	Ga0495668_0049562	3300046616	Bacteria	2329
1590	Ga0495668_0057426	3300046616	Bacteria	2147
1591	Ga0495611_0001219	3300046648	Bacteria	13311
1592	Ga0495625_0000055	3300046660	Bacteria	186381
1593	Ga0495625_0000997	3300046660	Bacteria	37525
1594	Ga0495625_0114678	3300046660	Bacteria	1839
1595	Ga0495661_0000046	3300046665	Bacteria	148306
1596	Ga0495661_0000999	3300046665	Bacteria	25486
1597	Ga0495661_0001737	3300046665	Bacteria	17583
1598	Ga0495646_0019706	3300046680	Bacteria	4265
1599	Ga0495670_0002525	3300046691	Bacteria	9044
1600	Ga0495671_0001579	3300046692	Bacteria	15080
1601	Ga0495671_0005560	3300046692	Bacteria	7368
1602	Ga0495671_0005704	3300046692	Bacteria	7258
1603	Ga0495649_0003070	3300046694	Bacteria	11425
1604	Ga0495649_0005236	3300046694	Bacteria	8300
1605	Ga0495660_0000013	3300046810	Bacteria	350283
1606	Ga0495660_0001675	3300046810	Bacteria	14834
1607	Ga0495660_0011114	3300046810	Bacteria	5227
1608	Ga0495660_0011142	3300046810	Bacteria	5221
1609	Ga0495660_0082901	3300046810	Bacteria	1678
1610	Ga0495636_0002626	3300047318	Bacteria	6919
1611	Ga0495672_0000054	3300047320	Bacteria	230777
1612	Ga0495676_0000013	3300047321	Bacteria	213031
1613	Ga0495683_0000107	3300047323	Bacteria	85043
1614	Ga0495683_0000612	3300047323	Bacteria	26716
1615	Ga0495687_070996	3300047443	Bacteria	1396
1616	Ga0495679_000583	3300047446	Bacteria	25190
1617	Ga0495679_001076	3300047446	Bacteria	16546
1618	Ga0495679_051065	3300047446	Bacteria	1241
1619	Ga0495673_0006729	3300047469	Bacteria	6718
1620	Ga0495673_0009305	3300047469	Bacteria	5445
1621	Ga0495681_0027092	3300047470	Bacteria	2971
1622	Ga0495686_0000126	3300047472	Bacteria	157350
1623	Ga0495686_0025768	3300047472	Bacteria	3852
1624	Ga0495626_0000252	3300048091	Bacteria	61398
1625	Ga0495626_0001991	3300048091	Bacteria	15074
1626	Ga0496100_0194960	3300048903	Bacteria	1473
1627	Ga0496101_0000123	3300048904	Bacteria	75836
1628	Ga0496102_0008331	3300048905	Bacteria	8877
1629	Ga0496102_0035275	3300048905	Bacteria	4501
1630	Ga0496104_0003637	3300048907	Bacteria	13322
1631	Ga0496105_0002281	3300048908	Bacteria	13912
1632	Ga0496106_0033192	3300048909	Bacteria	3851
1633	Ga0496107_0065876	3300048910	Bacteria	2626
1634	Ga0496107_0121246	3300048910	Bacteria	1927
1635	Ga0496109_0069283	3300048912	Bacteria	3235
1636	Ga0496109_0088307	3300048912	Bacteria	2865
1637	Ga0496110_0001169	3300048913	Bacteria	18636
1638	Ga0496110_0010163	3300048913	Bacteria	7645
1639	Ga0496110_0191030	3300048913	Bacteria	1860
1640	Ga0496112_0009376	3300048915	Bacteria	8815
1641	Ga0496112_0355329	3300048915	Bacteria	1407
1642	Ga0496113_0025722	3300048916	Bacteria	4200
1643	Ga0496113_0175771	3300048916	Bacteria	1697
1644	Ga0496114_0116384	3300048917	Bacteria	2295
1645	Ga0496115_0250572	3300048918	Bacteria	1458
1646	Ga0496116_0000016	3300048919	Bacteria	555146
1647	Ga0496116_0000217	3300048919	Bacteria	108128
1648	Ga0496116_0000853	3300048919	Bacteria	38103
1649	Ga0496116_0016682	3300048919	Bacteria	5736
1650	Ga0496116_0140720	3300048919	Bacteria	1358
1651	Ga0496117_0000103	3300048920	Bacteria	189316
1652	Ga0496117_0001101	3300048920	Bacteria	40741
1653	Ga0496117_0002635	3300048920	Bacteria	22246
1654	Ga0496117_0003640	3300048920	Bacteria	17750
1655	Ga0496117_0004927	3300048920	Bacteria	14338
1656	Ga0496117_0005782	3300048920	Bacteria	12843
1657	Ga0496117_0006937	3300048920	Bacteria	11226
1658	Ga0496117_0010366	3300048920	Bacteria	8509
1659	Ga0496118_0000046	3300048921	Bacteria	271783
1660	Ga0496118_0001287	3300048921	Bacteria	38310
1661	Ga0496118_0001472	3300048921	Bacteria	35272
1662	Ga0496118_0001602	3300048921	Bacteria	33494
1663	Ga0496118_0002338	3300048921	Bacteria	25715
1664	Ga0496118_0002527	3300048921	Bacteria	24534
1665	Ga0496118_0004158	3300048921	Bacteria	17473
1666	Ga0496118_0005467	3300048921	Bacteria	14428
1667	Ga0496118_0006224	3300048921	Bacteria	13201
1668	Ga0496118_0011208	3300048921	Bacteria	8778
1669	Ga0496118_0023789	3300048921	Bacteria	5308
1670	Ga0496118_0074390	3300048921	Bacteria	2428
1671	Ga0496118_0084926	3300048921	Bacteria	2206
1672	Ga0496118_0124711	3300048921	Bacteria	1670
1673	Ga0496119_0000097	3300048922	Bacteria	127447
1674	Ga0496119_0000270	3300048922	Bacteria	73810
1675	Ga0496119_0000327	3300048922	Bacteria	66904
1676	Ga0496119_0000903	3300048922	Bacteria	38694
1677	Ga0496119_0001231	3300048922	Bacteria	31897
1678	Ga0496119_0027547	3300048922	Bacteria	3902
1679	Ga0496119_0028186	3300048922	Bacteria	3839
1680	Ga0496120_0000344	3300048923	Bacteria	76805
1681	Ga0496120_0000361	3300048923	Bacteria	73810
1682	Ga0496120_0000817	3300048923	Bacteria	44561
1683	Ga0496120_0000919	3300048923	Bacteria	40956
1684	Ga0496120_0001157	3300048923	Bacteria	33802
1685	Ga0496120_0002596	3300048923	Bacteria	17938
1686	Ga0496120_0002705	3300048923	Bacteria	17365
1687	Ga0496121_0000108	3300048924	Bacteria	188757
1688	Ga0496121_0000336	3300048924	Bacteria	97792
1689	Ga0496121_0001734	3300048924	Bacteria	35607
1690	Ga0496121_0003708	3300048924	Bacteria	21432
1691	Ga0496121_0008873	3300048924	Bacteria	11692
1692	Ga0496121_0277346	3300048924	Bacteria	1149
1693	Ga0496122_0000125	3300048925	Bacteria	179659
1694	Ga0496122_0001411	3300048925	Bacteria	38913
1695	Ga0496122_0002627	3300048925	Bacteria	25135
1696	Ga0496122_0003313	3300048925	Bacteria	21304
1697	Ga0496122_0004502	3300048925	Bacteria	17220
1698	Ga0496122_0010124	3300048925	Bacteria	9778
1699	Ga0496122_0018465	3300048925	Bacteria	6438
1700	Ga0496122_0035406	3300048925	Bacteria	4062
1701	Ga0496122_0054091	3300048925	Bacteria	3019
1702	Ga0496122_0091432	3300048925	Bacteria	2072
1703	Ga0496122_0115309	3300048925	Bacteria	1750
1704	Ga0496123_0000092	3300048926	Bacteria	179551
1705	Ga0496123_0000868	3300048926	Bacteria	48075
1706	Ga0496123_0001488	3300048926	Bacteria	32526
1707	Ga0496123_0002023	3300048926	Bacteria	26173
1708	Ga0496123_0003459	3300048926	Bacteria	17665
1709	Ga0496123_0004449	3300048926	Bacteria	14725
1710	Ga0496123_0004815	3300048926	Bacteria	13924
1711	Ga0496123_0012046	3300048926	Bacteria	7413
1712	Ga0496123_0071420	3300048926	Bacteria	2165
1713	Ga0496123_0139733	3300048926	Bacteria	1326
1714	Ga0496124_0000001	3300048927	Bacteria	1747840
1715	Ga0496124_0000034	3300048927	Bacteria	325332
1716	Ga0496124_0000286	3300048927	Bacteria	95771
1717	Ga0496124_0001111	3300048927	Bacteria	42338
1718	Ga0496124_0004469	3300048927	Bacteria	16318
1719	Ga0496124_0005234	3300048927	Bacteria	14713
1720	Ga0496124_0007498	3300048927	Bacteria	11584
1721	Ga0496124_0009621	3300048927	Bacteria	9906
1722	Ga0496124_0012070	3300048927	Bacteria	8574
1723	Ga0496124_0012814	3300048927	Bacteria	8237
1724	Ga0496124_0030752	3300048927	Bacteria	4759
1725	Ga0496124_0065399	3300048927	Bacteria	3032
1726	Ga0496124_0210252	3300048927	Bacteria	1472
1727	Ga0496125_0000180	3300048928	Bacteria	138952
1728	Ga0496125_0000456	3300048928	Bacteria	73903
1729	Ga0496125_0001375	3300048928	Bacteria	35721
1730	Ga0496125_0007506	3300048928	Bacteria	11590
1731	Ga0496125_0010132	3300048928	Bacteria	9560
1732	Ga0496125_0090381	3300048928	Bacteria	2298
1733	Ga0496125_0112703	3300048928	Bacteria	1964
1734	Ga0496126_0000109	3300048929	Bacteria	196717
1735	Ga0496126_0049366	3300048929	Bacteria	3842
1736	Ga0496126_0061950	3300048929	Bacteria	3358
1737	Ga0496126_0093269	3300048929	Bacteria	2644
1738	Ga0496126_0336398	3300048929	Bacteria	1238
1739	Ga0495678_000356	3300049459	Bacteria	47099
1740	Ga0495678_000821	3300049459	Bacteria	27837
1741	Ga0495678_026233	3300049459	Bacteria	2490
1742	Ga0501031_0001928	3300049568	Bacteria	13084
1743	Ga0501031_0003884	3300049568	Bacteria	9618
1744	Ga0501031_0026127	3300049568	Bacteria	3809
1745	Ga0501031_0026823	3300049568	Bacteria	3755
1746	Ga0501031_0056001	3300049568	Bacteria	2569
1747	Ga0501031_0059224	3300049568	Bacteria	2496
1748	Ga0501031_0060680	3300049568	Bacteria	2464
1749	Ga0501032_0017448	3300049569	Bacteria	5042
1750	Ga0501032_0023646	3300049569	Bacteria	4242
1751	Ga0501032_0027325	3300049569	Bacteria	3921
1752	Ga0501032_0040956	3300049569	Bacteria	3147
1753	Ga0501033_0002131	3300049570	Bacteria	17126
1754	Ga0501033_0004203	3300049570	Bacteria	11589
1755	Ga0501033_0004641	3300049570	Bacteria	10998
1756	Ga0501033_0021783	3300049570	Bacteria	4836
1757	Ga0501034_0000780	3300049571	Bacteria	47710
1758	Ga0501034_0002028	3300049571	Bacteria	25489
1759	Ga0501034_0002718	3300049571	Bacteria	20823
1760	Ga0501034_0019841	3300049571	Bacteria	6868
1761	Ga0501034_0061650	3300049571	Bacteria	3766
1762	Ga0501034_0069596	3300049571	Bacteria	3530
1763	Ga0501034_0072204	3300049571	Bacteria	3460
1764	Ga0501034_0088653	3300049571	Bacteria	3091
1765	Ga0501034_0094219	3300049571	Bacteria	2991
1766	Ga0501034_0119324	3300049571	Bacteria	2624
1767	Ga0501034_0139091	3300049571	Bacteria	2408
1768	Ga0501034_0143386	3300049571	Bacteria	2367
1769	Ga0501034_0280222	3300049571	Bacteria	1606
1770	Ga0501036_0045302	3300049572	Bacteria	3727
1771	Ga0501036_0130202	3300049572	Bacteria	2124
1772	Ga0501036_0271631	3300049572	Bacteria	1419
1773	Ga0501036_0346602	3300049572	Bacteria	1240
1774	Ga0501037_0013917	3300049573	Bacteria	5928
1775	Ga0501037_0014753	3300049573	Bacteria	5747
1776	Ga0501037_0021480	3300049573	Bacteria	4771
1777	Ga0501037_0021687	3300049573	Bacteria	4750
1778	Ga0501037_0084965	3300049573	Bacteria	2291
1779	Ga0501037_0085558	3300049573	Bacteria	2283
1780	Ga0501038_0013831	3300049574	Bacteria	7353
1781	Ga0501038_0020608	3300049574	Bacteria	5926
1782	Ga0501038_0053738	3300049574	Bacteria	3466
1783	Ga0501038_0061388	3300049574	Bacteria	3214
1784	Ga0501038_0090856	3300049574	Bacteria	2558
1785	Ga0501038_0119621	3300049574	Bacteria	2174
1786	Ga0501038_0137428	3300049574	Bacteria	2001
1787	Ga0501039_0003639	3300049575	Bacteria	11552
1788	Ga0501039_0015461	3300049575	Bacteria	5843
1789	Ga0501040_0079039	3300049576	Bacteria	2276
1790	Ga0501042_0063806	3300049578	Bacteria	2632
1791	Ga0501043_0026366	3300049579	Bacteria	4559
1792	Ga0501043_0044858	3300049579	Bacteria	3477
1793	Ga0501043_0091792	3300049579	Bacteria	2387
1794	Ga0501046_0000887	3300049580	Bacteria	29123
1795	Ga0501046_0019540	3300049580	Bacteria	5617
1796	Ga0501046_0052897	3300049580	Bacteria	3199
1797	Ga0501046_0068967	3300049580	Bacteria	2752
1798	Ga0501046_0192290	3300049580	Bacteria	1522
1799	Ga0501047_0004850	3300049581	Bacteria	12636
1800	Ga0501047_0006976	3300049581	Bacteria	10605
1801	Ga0501047_0010595	3300049581	Bacteria	8720
1802	Ga0501047_0037984	3300049581	Bacteria	4657
1803	Ga0501047_0057143	3300049581	Bacteria	3773
1804	Ga0501047_0070411	3300049581	Bacteria	3368
1805	Ga0501047_0081969	3300049581	Bacteria	3101
1806	Ga0501047_0083271	3300049581	Bacteria	3074
1807	Ga0501047_0084241	3300049581	Bacteria	3056
1808	Ga0501047_0105254	3300049581	Bacteria	2702
1809	Ga0501048_0004712	3300049582	Bacteria	10385
1810	Ga0501048_0008578	3300049582	Bacteria	7717
1811	Ga0501048_0014302	3300049582	Bacteria	5877
1812	Ga0501048_0016041	3300049582	Bacteria	5524
1813	Ga0501048_0026121	3300049582	Bacteria	4253
1814	Ga0501048_0054663	3300049582	Bacteria	2836
1815	Ga0501067_0002380	3300049583	Bacteria	10410
1816	Ga0501068_0000804	3300049584	Bacteria	16286
1817	Ga0501068_0012099	3300049584	Bacteria	4882
1818	Ga0501068_0067587	3300049584	Bacteria	2178
1819	Ga0501069_0000354	3300049585	Bacteria	20610
1820	Ga0501069_0001062	3300049585	Bacteria	13170
1821	Ga0501069_0006208	3300049585	Bacteria	6244
1822	Ga0501069_0033897	3300049585	Bacteria	2812
1823	Ga0501069_0090892	3300049585	Bacteria	1726
1824	Ga0501070_0000990	3300049586	Bacteria	25499
1825	Ga0501070_0004430	3300049586	Bacteria	12061
1826	Ga0501070_0007491	3300049586	Bacteria	9273
1827	Ga0501070_0013082	3300049586	Bacteria	6995
1828	Ga0501070_0021125	3300049586	Bacteria	5463
1829	Ga0501070_0024668	3300049586	Bacteria	5043
1830	Ga0501070_0040551	3300049586	Bacteria	3882
1831	Ga0501070_0046097	3300049586	Bacteria	3625
1832	Ga0501070_0046820	3300049586	Bacteria	3596
1833	Ga0501070_0049038	3300049586	Bacteria	3507
1834	Ga0501070_0049222	3300049586	Bacteria	3500
1835	Ga0501070_0110323	3300049586	Bacteria	2273
1836	Ga0501070_0206375	3300049586	Bacteria	1613
1837	Ga0501071_0004529	3300049587	Bacteria	8815
1838	Ga0501071_0013045	3300049587	Bacteria	5654
1839	Ga0501071_0061223	3300049587	Bacteria	2726
1840	Ga0501071_0145181	3300049587	Bacteria	1768
1841	Ga0501072_0038005	3300049588	Bacteria	3778
1842	Ga0501072_0068381	3300049588	Bacteria	2804
1843	Ga0501072_0190549	3300049588	Bacteria	1635
1844	Ga0501073_0004569	3300049589	Bacteria	10407
1845	Ga0501073_0010589	3300049589	Bacteria	6746
1846	Ga0501073_0012255	3300049589	Bacteria	6256
1847	Ga0501073_0013106	3300049589	Bacteria	6045
1848	Ga0501073_0021785	3300049589	Bacteria	4617
1849	Ga0501073_0063958	3300049589	Bacteria	2565
1850	Ga0501073_0100341	3300049589	Bacteria	2010
1851	Ga0501073_0102191	3300049589	Bacteria	1990
1852	Ga0501074_0003873	3300049590	Bacteria	10659
1853	Ga0501074_0005572	3300049590	Bacteria	9057
1854	Ga0501074_0007187	3300049590	Bacteria	8040
1855	Ga0501074_0018474	3300049590	Bacteria	5065
1856	Ga0501074_0021283	3300049590	Bacteria	4710
1857	Ga0501075_0249566	3300049591	Bacteria	1352
1858	Ga0501076_0002639	3300049592	Bacteria	12373
1859	Ga0501076_0006262	3300049592	Bacteria	8620
1860	Ga0501076_0073576	3300049592	Bacteria	2736
1861	Ga0501076_0150280	3300049592	Bacteria	1895
1862	Ga0501077_0009733	3300049593	Bacteria	5976
1863	Ga0501077_0013950	3300049593	Bacteria	5038
1864	Ga0501077_0084306	3300049593	Bacteria	2014
1865	Ga0501243_010447	3300049675	Bacteria	1448
1866	Ga0501079_0001458	3300049741	Bacteria	16725
1867	Ga0501079_0043135	3300049741	Bacteria	3481
1868	Ga0501079_0043783	3300049741	Bacteria	3455
1869	Ga0501080_0002386	3300049742	Bacteria	16388
1870	Ga0501080_0004525	3300049742	Bacteria	12393
1871	Ga0501080_0010807	3300049742	Bacteria	8353
1872	Ga0501080_0011052	3300049742	Bacteria	8261
1873	Ga0501080_0017094	3300049742	Bacteria	6699
1874	Ga0501080_0033502	3300049742	Bacteria	4794
1875	Ga0501080_0088983	3300049742	Bacteria	2868
1876	Ga0501080_0101265	3300049742	Bacteria	2672
1877	Ga0501080_0139114	3300049742	Bacteria	2245
1878	Ga0501080_0145729	3300049742	Bacteria	2189
1879	Ga0501081_0000145	3300049743	Bacteria	32074
1880	Ga0501081_0051600	3300049743	Bacteria	2836
1881	Ga0501083_0039664	3300049744	Bacteria	3197
1882	Ga0501083_0081510	3300049744	Bacteria	2145
1883	Ga0501083_0091870	3300049744	Bacteria	2004
1884	Ga0501266_004803	3300049763	Bacteria	1681
1885	Ga0501270_008187	3300049767	Bacteria	1315
1886	Ga0501035_0003258	3300049822	Bacteria	15554
1887	Ga0501035_0012330	3300049822	Bacteria	7902
1888	Ga0501035_0016032	3300049822	Bacteria	6915
1889	Ga0501035_0020825	3300049822	Bacteria	6025
1890	Ga0501035_0023801	3300049822	Bacteria	5619
1891	Ga0501035_0025236	3300049822	Bacteria	5448
1892	Ga0501035_0089582	3300049822	Bacteria	2709
1893	Ga0501035_0123869	3300049822	Bacteria	2257
1894	Ga0501044_0000616	3300049823	Bacteria	43073
1895	Ga0501044_0010612	3300049823	Bacteria	9993
1896	Ga0501044_0012277	3300049823	Bacteria	9273
1897	Ga0501044_0018645	3300049823	Bacteria	7432
1898	Ga0501044_0037769	3300049823	Bacteria	5046
1899	Ga0501044_0040009	3300049823	Bacteria	4888
1900	Ga0501044_0062561	3300049823	Bacteria	3804
1901	Ga0501044_0077028	3300049823	Bacteria	3382
1902	Ga0501044_0096030	3300049823	Bacteria	2986
1903	Ga0501044_0110989	3300049823	Bacteria	2750
1904	Ga0501044_0134824	3300049823	Bacteria	2461
1905	Ga0501044_0157408	3300049823	Bacteria	2250
1906	Ga0501044_0292483	3300049823	Bacteria	1560
1907	Ga0501045_0004342	3300049824	Bacteria	9771
1908	Ga0501045_0031114	3300049824	Bacteria	3865
1909	Ga0501226_000002	3300049853	Bacteria	426935
1910	nmdc:mga03n38_73_c1	3300050490	Bacteria	21270
1911	nmdc:mga00v17_12359_c1	3300050491	Bacteria	4710
1912	nmdc:mga00v17_1321_c1	3300050491	Bacteria	12979
1913	nmdc:mga00v17_395_c1	3300050491	Bacteria	24621
1914	nmdc:mga0yw44_23072_c1	3300050492	Bacteria	3501
1915	nmdc:mga0yw44_463_c1	3300050492	Bacteria	14410
1916	nmdc:mga0yw44_8890_c1	3300050492	Bacteria	5036
1917	nmdc:mga0k408_361_c1	3300050493	Bacteria	24992
1918	nmdc:mga06z11_314_c1	3300050494	Bacteria	18319
1919	nmdc:mga04h51_4950_c1	3300050495	Bacteria	3357
1920	nmdc:mga07m45_325_c1	3300050496	Bacteria	19332
1921	nmdc:mga05p37_17603_c1	3300050507	Bacteria	8624
1922	nmdc:mga05p37_58418_c1	3300050507	Bacteria	4751
1923	nmdc:mga09592_1438_c1	3300050508	Bacteria	19076
1924	nmdc:mga09592_185104_c1	3300050508	Bacteria	1802
1925	nmdc:mga09592_21437_c1	3300050508	Bacteria	5324
1926	nmdc:mga09592_6886_c1	3300050508	Bacteria	9246
1927	nmdc:mga09592_72509_c1	3300050508	Bacteria	2924
1928	nmdc:mga0qj67_30230_c1	3300050509	Bacteria	4214
1929	nmdc:mga0qj67_82644_c1	3300050509	Bacteria	2575
1930	nmdc:mga06r32_10406_c1	3300050510	Bacteria	8395
1931	nmdc:mga06r32_19976_c1	3300050510	Bacteria	6159
1932	nmdc:mga06r32_53688_c1	3300050510	Bacteria	3861
1933	nmdc:mga06r32_54314_c1	3300050510	Bacteria	3841
1934	nmdc:mga06r32_77008_c1	3300050510	Bacteria	3239
1935	nmdc:mga08y16_198819_c1	3300050511	Bacteria	2077
1936	nmdc:mga0n895_169384_c1	3300050512	Bacteria	2216
1937	nmdc:mga0rr50_142_c1	3300050513	Bacteria	39597
1938	nmdc:mga0rr50_228970_c1	3300050513	Bacteria	1537
1939	nmdc:mga0rr50_249339_c1	3300050513	Bacteria	1474
1940	nmdc:mga08x19_3010_c1	3300050514	Bacteria	10130
1941	nmdc:mga08x19_326_c1	3300050514	Bacteria	34401
1942	nmdc:mga08x19_66_c1	3300050514	Bacteria	105609
1943	nmdc:mga0sz30_92_c1	3300050516	Bacteria	34645
1944	Ga0495655_0000345	3300053083	Bacteria	8180
1945	Ga0500644_0000001	3300053088	Bacteria	529637
1946	Ga0500644_0034622	3300053088	Bacteria	1631
1947	Ga0500651_0000068	3300053093	Bacteria	67573
1948	Ga0500651_0005207	3300053093	Bacteria	7403
1949	Ga0500651_0006676	3300053093	Bacteria	6673
1950	Ga0500641_0000347	3300053096	Bacteria	17215
1951	Ga0500641_0030699	3300053096	Bacteria	2114
1952	Ga0500641_0085498	3300053096	Bacteria	1342
1953	Ga0500650_0000010	3300053098	Bacteria	98628
1954	Ga0500650_0000078	3300053098	Bacteria	27712
1955	Ga0500555_004274	3300053103	Bacteria	4064
1956	Ga0500555_009548	3300053103	Bacteria	2775
1957	Ga0500556_0000070	3300053104	Bacteria	101159
1958	Ga0500556_0000589	3300053104	Bacteria	23953
1959	Ga0500556_0040363	3300053104	Bacteria	1640
1960	Ga0500642_0004023	3300053130	Unclassified	4541
1961	Ga0500658_0016421	3300053134	Bacteria	2758
1962	Ga0500658_0079220	3300053134	Bacteria	1402
1963	Ga0500564_020508	3300053138	Bacteria	3025
1964	Ga0500568_0061386	3300053139	Bacteria	1454
1965	Ga0500577_0000002	3300053142	Bacteria	239615
1966	Ga0500588_0000238	3300053146	Bacteria	7887
1967	Ga0500588_0003558	3300053146	Bacteria	3301
1968	Ga0500604_0000965	3300053151	Bacteria	7986
1969	Ga0500604_0010434	3300053151	Bacteria	2487
1970	Ga0500616_0000018	3300053153	Bacteria	610976
1971	Ga0500616_0046177	3300053153	Bacteria	2316
1972	Ga0500622_0001827	3300053156	Bacteria	16127
1973	Ga0500622_0002455	3300053156	Bacteria	13369
1974	Ga0500622_0004386	3300053156	Bacteria	8894
1975	Ga0500634_0000078	3300053161	Bacteria	37746
1976	Ga0500656_005986	3300053732	Bacteria	1220
1977	Ga0501084_0009286	3300054114	Bacteria	8136
1978	Ga0501084_0059793	3300054114	Bacteria	3190
1979	Ga0501084_0072915	3300054114	Bacteria	2875
1980	Ga0501084_0356450	3300054114	Bacteria	1236
1981	Ga0590071_014679	3300059421	Bacteria	1838
1982	Ga0501082_0008551	3300060353	Bacteria	8831
1983	Ga0501082_0018568	3300060353	Bacteria	5993
1984	Ga0501082_0048132	3300060353	Bacteria	3674
1985	Ga0501082_0074924	3300060353	Bacteria	2915
1986	Ga0466962_0000153	3300061719	Bacteria	28888
1987	Ga0466962_0017208	3300061719	Bacteria	3482
1988	Ga0466962_0018947	3300061719	Bacteria	3306
1989	Ga0466962_0030318	3300061719	Bacteria	2590
1990	Ga0466962_0056429	3300061719	Bacteria	1876
1991	Ga0530510_0127686	3300061734	Bacteria	1869
1992	2510283924	2510065053	Bacteria	5005518
1993	2510293403	2510065055	Bacteria	5037935
1994	2510312895	2510065058	Bacteria	5005894
1995	2511256916	2511231004	Bacteria	6669789
1996	2511266945	2511231006	Bacteria	6794709
1997	2511272936	2511231007	Bacteria	6306603
1998	2511275918	2511231008	Bacteria	6624100
1999	2511291206	2511231010	Bacteria	6373152
2000	2511293785	2511231011	Bacteria	6149768
2001	2511300546	2511231012	Bacteria	6738011
2002	2511315520	2511231014	Bacteria	6462302
2003	2511320352	2511231015	Bacteria	6598026
2004	2511323581	2511231016	Bacteria	6704427
2005	2511330738	2511231017	Bacteria	6503007
2006	2511336816	2511231018	Bacteria	6436256
2007	2511342594	2511231019	Bacteria	6520662
2008	2511348096	2511231020	Bacteria	6115223
2009	2511357059	2511231021	Bacteria	7302637
2010	2511363194	2511231022	Bacteria	6719296
2011	2511369738	2511231023	Bacteria	6808468
2012	2511376744	2511231024	Bacteria	5835885
2013	2511381848	2511231025	Bacteria	5324661
2014	2511414931	2511231031	Bacteria	6558529
2015	2511434640	2511231035	Bacteria	5341610
2016	2511826779	2511231156	Bacteria	6845832
2017	2512324372	2512047018	Bacteria	6663241
2018	2513590289	2513237087	Bacteria	5817514
2019	2538427885	2537561728	Bacteria	5149301
2020	2554817262	2554235132	Bacteria	6772433
2021	2555245212	2554235231	Bacteria	5215788
2022	2555671983	2554235341	Bacteria	6867980
2023	2572254804	2571042365	Bacteria	3289345
2024	2578459669	2576861471	Bacteria	4648976
2025	2583794478	2582580891	Bacteria	6800976
2026	2585827826	2585427591	Bacteria	5482980
2027	2585830839	2585427592	Bacteria	5370892
2028	2595447435	2593339238	Bacteria	4182970
2029	2595450203	2593339239	Bacteria	4124669
2030	2597860063	2597489887	Bacteria	6666321
2031	2597862200	2597489888	Bacteria	6179543
2032	2597867923	2597489889	Bacteria	6297495
2033	2599329655	2599185155	Bacteria	5827168
2034	2599353853	2599185160	Bacteria	6844013
2035	2599360469	2599185161	Bacteria	6960462
2036	2599366791	2599185162	Bacteria	6957254
2037	2599373580	2599185163	Bacteria	6995158
2038	2599378961	2599185164	Bacteria	6841688
2039	2599386061	2599185165	Bacteria	6843250
2040	2599392439	2599185166	Bacteria	6959206
2041	2599397197	2599185167	Bacteria	6353609
2042	2599404205	2599185168	Bacteria	6997636
2043	2599449192	2599185179	Bacteria	6611171
2044	2599460687	2599185181	Bacteria	6844519
2045	2599470233	2599185182	Bacteria	6883168
2046	2599482902	2599185185	Bacteria	6652270
2047	2599489708	2599185186	Bacteria	6831633
2048	2599502868	2599185188	Bacteria	6164180
2049	2599508114	2599185189	Bacteria	5862825
2050	2599511066	2599185190	Bacteria	6285678
2051	2599519442	2599185191	Bacteria	6297582
2052	2599615104	2599185212	Bacteria	6765997
2053	2599771301	2599185248	Bacteria	6696816
2054	2599803394	2599185257	Bacteria	6492581
2055	2599879533	2599185288	Bacteria	6666191
2056	2599885927	2599185289	Bacteria	6778765
2057	2599890440	2599185290	Bacteria	6289611
2058	2599897641	2599185291	Bacteria	6775623
2059	2599928207	2599185299	Bacteria	4854625
2060	2599930105	2599185300	Bacteria	6062622
2061	2599945369	2599185302	Bacteria	5954930
2062	2599948032	2599185303	Bacteria	6512725
2063	2599955641	2599185304	Bacteria	5951361
2064	2599961009	2599185305	Bacteria	6748700
2065	2599969333	2599185306	Bacteria	6637356
2066	2599973371	2599185307	Bacteria	6194719
2067	2599980674	2599185308	Bacteria	6621546
2068	2599985754	2599185309	Bacteria	5969593
2069	2599990648	2599185310	Bacteria	6014457
2070	2599995966	2599185311	Bacteria	6354990
2071	2600001966	2599185312	Bacteria	5912071
2072	2600005693	2599185313	Bacteria	6658188
2073	2600014490	2599185314	Bacteria	6621749
2074	2600019061	2599185315	Bacteria	6771107
2075	2600025538	2599185316	Bacteria	6320029
2076	2600027846	2599185317	Bacteria	6435722
2077	2600033436	2599185318	Bacteria	6961590
2078	2600040278	2599185319	Bacteria	6637840
2079	2600049353	2599185320	Bacteria	5963263
2080	2600055758	2599185321	Bacteria	6764560
2081	2600061619	2599185322	Bacteria	6763055
2082	2600064238	2599185323	Bacteria	6688755
2083	2600073478	2599185324	Bacteria	6590677
2084	2600077313	2599185325	Bacteria	6324919
2085	2600213301	2599185356	Bacteria	6843884
2086	2600357013	2600254930	Bacteria	6431253
2087	2600365334	2600254931	Bacteria	6734225
2088	2600443491	2600254954	Bacteria	5100516
2089	2601625896	2600255283	Bacteria	6061572
2090	2601690796	2600255296	Bacteria	5784754
2091	2601773468	2600255313	Bacteria	6842543
2092	2601799716	2600255318	Bacteria	6383414
2093	2602009055	2600255389	Bacteria	5275336
2094	2606074099	2603880185	Bacteria	6379190
2095	2606126256	2603880199	Bacteria	6377649
2096	2608382949	2606217733	Bacteria	6360972
2097	2608670463	2608642108	Bacteria	4104624
2098	2621301655	2619619299	Bacteria	6649820
2099	2624482644	2623620443	Bacteria	6427864
2100	2624490291	2623620446	Bacteria	6500345
2101	2643841994	2643221565	Bacteria	6216018
2102	2643869017	2643221571	Bacteria	6228673
2103	2643905331	2643221579	Bacteria	4443405
2104	2643910583	2643221580	Bacteria	3816678
2105	2643915011	2643221581	Bacteria	3893603
2106	2643938511	2643221586	Bacteria	4446529
2107	2643955404	2643221589	Bacteria	6250934
2108	2643962936	2643221591	Bacteria	4397626
2109	2643973033	2643221593	Bacteria	6296053
2110	2644023756	2643221602	Bacteria	6249926
2111	2644079163	2643221612	Bacteria	4361984
2112	2644185901	2643221633	Bacteria	6733554
2113	2644285791	2643221650	Bacteria	7029547
2114	2644530537	2643221695	Bacteria	3441323
2115	2644623884	2643221713	Bacteria	6554480
2116	2644661368	2643221720	Bacteria	4694283
2117	2644693939	2643221727	Bacteria	4415595
2118	2644699448	2643221728	Bacteria	4797149
2119	2650900136	2648501693	Bacteria	5069560
2120	2652545185	2651869719	Bacteria	6047974
2121	2671089736	2667528170	Bacteria	6786960
2122	2671096432	2667528171	Bacteria	6900659
2123	2671106439	2667528173	Bacteria	5375747
2124	2671125632	2667528176	Bacteria	6724917
2125	2671771038	2671180172	Bacteria	6495783
2126	2677897538	2675903420	Bacteria	6247433
2127	2678265149	2675903515	Bacteria	6580491
2128	2686354376	2684622997	Bacteria	4624240
2129	2687578442	2687453129	Bacteria	4387428
2130	2687584401	2687453130	Bacteria	4227172
2131	2707098298	2706794495	Bacteria	4536932
2132	2715752028	2713897148	Bacteria	5883533
2133	2715755342	2713897149	Bacteria	6506249
2134	2718635856	2718217725	Bacteria	5758958
2135	2721025935	2718218334	Bacteria	4765486
2136	2723247092	2721755607	Bacteria	5841722
2137	2735834101	2734482264	Unclassified	5014763
2138	2738672708	2738541265	Bacteria	6594665
2139	2738689582	2738541271	Bacteria	5657310
2140	2738715964	2738541276	Bacteria	4690596
2141	2738751101	2738541282	Bacteria	6593925
2142	2738808991	2738541294	Bacteria	6925949
2143	2738860142	2738541303	Bacteria	6591772
2144	2738896351	2738541309	Bacteria	6926455
2145	2739196505	2738543004	Bacteria	6381073
2146	2739225511	2738543009	Bacteria	4944499
2147	2739257480	2738543015	Bacteria	6750701
2148	2739265356	2738543016	Bacteria	5657564
2149	2739289281	2738543020	Bacteria	5718238
2150	2739294593	2738543021	Bacteria	5718241
2151	2739314490	2738543025	Bacteria	6600348
2152	2743739597	2740892503	Bacteria	6855563
2153	2745005605	2744054620	Bacteria	6551379
2154	2747950875	2747842428	Bacteria	4689383
2155	2748019239	2747842501	Bacteria	5293829
2156	2765577637	2765235840	Bacteria	4663337
2157	2765585834	2765235841	Bacteria	6137024
2158	2774122102	2773857670	Bacteria	6407454
2159	2774131865	2773857672	Bacteria	4993178
2160	2774133525	2773857673	Bacteria	6513460
2161	2784262588	2784132063	Bacteria	6262788
2162	2784314347	2784132072	Bacteria	6596533
2163	2794595548	2791355520	Bacteria	5948615
2164	2807410025	2806310737	Bacteria	5751088
2165	2807458372	2806310745	Bacteria	5742165
2166	2808855834	2808606361	Bacteria	6136259
2167	2808905161	2808606373	Bacteria	4423627
2168	2808921958	2808606376	Bacteria	6248667
2169	2808933345	2808606377	Bacteria	6646337
2170	2808935915	2808606378	Bacteria	6177535
2171	2808942322	2808606379	Bacteria	5022697
2172	2808944079	2808606380	Bacteria	6248705
2173	2808955473	2808606381	Bacteria	6646461
2174	2808959693	2808606382	Bacteria	6841132
2175	2808964293	2808606383	Bacteria	6138645
2176	2808975129	2808606385	Bacteria	6711065
2177	2808991232	2808606388	Bacteria	6706662
2178	2808999181	2808606389	Bacteria	6138126
2179	2809124336	2808606414	Bacteria	4917181
2180	2809218550	2808606445	Bacteria	6057339
2181	2812368541	2811994881	Bacteria	6298475
2182	2816519414	2816332141	Bacteria	4436036
2183	2817488981	2816332298	Bacteria	6852809
2184	2819566031	2818991440	Bacteria	4774720
2185	2819654253	2818991456	Bacteria	6123676
2186	2819662609	2818991457	Bacteria	5323295
2187	2819701525	2818991464	Bacteria	6907494
2188	2823425101	2823421272	Bacteria	5372474
2189	2825655955	2825651385	Bacteria	6715909
2190	2826585547	2826581358	Bacteria	5963467
2191	2834028888	2834028612	Bacteria	6354979
2192	2834580869	2834578030	Bacteria	3530182
2193	2842392640	2842391507	Bacteria	4486072
2194	2842759594	2842757796	Bacteria	3981385
2195	2842809207	2842805378	Bacteria	5385175
2196	2842818193	2842815866	Bacteria	5947510
2197	2842830011	2842826826	Bacteria	5974129
2198	2842837499	2842832357	Bacteria	5959113
2199	2842839010	2842837860	Bacteria	6066181
2200	2842845283	2842843487	Bacteria	6004777
2201	2842853105	2842849001	Bacteria	5924277
2202	2842856359	2842854478	Bacteria	6143501
2203	2842917834	2842914999	Bacteria	4419378
2204	2842920513	2842918807	Bacteria	4289178
2205	2844532536	2844528606	Bacteria	4733806
2206	2844666148	2844665904	Bacteria	6817974
2207	2846543058	2846540461	Bacteria	5471451
2208	2847801227	2847797336	Bacteria	5176640
2209	2852106236	2852103415	Bacteria	5193810
2210	2852615620	2852612431	Bacteria	6885235
2211	2852652962	2852649853	Bacteria	4036942
2212	2852660611	2852657418	Bacteria	6472974
2213	2852670588	2852667396	Bacteria	6885555
2214	2852687656	2852684882	Bacteria	5463342
2215	2854602944	2854601825	Bacteria	4797592
2216	2855197019	2855195626	Bacteria	4927512
2217	2857444454	2857442823	Bacteria	4562550
2218	2858469622	2858466076	Bacteria	4722413
2219	2860344513	2860339153	Bacteria	6846989
2220	2860868923	2860867994	Bacteria	5645326
2221	2865018226	2865014394	Bacteria	4764573
2222	2871273617	2871272651	Bacteria	5042015
2223	2871284566	2871282230	Bacteria	4917173
2224	2874224494	2874220319	Bacteria	4594709
2225	2876605681	2876601092	Bacteria	5114497
2226	2878034574	2878029506	Bacteria	6418441
2227	2880235221	2880230671	Bacteria	6140320
2228	2881610920	2881609920	Bacteria	4405319
2229	2881715887	2881714928	Bacteria	2469486
2230	2884342077	2884338543	Bacteria	4610696
2231	2894417862	2894414249	Bacteria	4405451
2232	2895499482	2895498888	Bacteria	5283788
2233	2895512504	2895511927	Bacteria	6802080
2234	2895522515	2895522137	Bacteria	3284416
2235	2895525719	2895525241	Bacteria	3388457
2236	2900053652	2900051742	Bacteria	4985156
2237	2904466302	2904463128	Bacteria	4775606
2238	2904474416	2904474040	Bacteria	5504324
2239	2904521594	2904518522	Bacteria	6068986
2240	2904552998	2904550169	Bacteria	6221258
2241	2908447669	2908446538	Bacteria	6829095
2242	2912968123	2912963787	Bacteria	5646108
2243	2913041758	2913036834	Bacteria	6704877
2244	2916179913	2916178963	Bacteria	5265078
2245	2917075855	2917070673	Bacteria	6868303
2246	2917833808	2917832318	Bacteria	5346010
2247	2919069565	2919063839	Bacteria	6302690
2248	2919086040	2919085039	Bacteria	4532964
2249	2919091508	2919089067	Bacteria	4560942
2250	2919128131	2919125081	Bacteria	5385106
2251	2919132177	2919130084	Bacteria	5301837
2252	2919135081	2919134579	Bacteria	4480386
2253	2919150762	2919150387	Bacteria	5500879
2254	2919156638	2919155634	Bacteria	4860545
2255	2919388642	2919385768	Bacteria	5897293
2256	2919406752	2919404418	Bacteria	4232372
2257	2919459625	2919456309	Bacteria	6586567
2258	2919484699	2919481497	Bacteria	6907839
2259	2919490037	2919487758	Bacteria	5929766
2260	2919501818	2919501602	Bacteria	5286340
2261	2919514967	2919513703	Bacteria	3844312
2262	2919676410	2919675420	Bacteria	3969095
2263	2919692093	2919688452	Bacteria	4595932
2264	2919703745	2919697872	Bacteria	6553725
2265	2923158683	2923153595	Bacteria	6870622
2266	2923517443	2923516293	Bacteria	3716336
2267	2923522599	2923519811	Bacteria	6298479
2268	2923590403	2923586266	Bacteria	6565975
2269	2926063491	2926063275	Bacteria	5285848
2270	2927145636	2927143783	Bacteria	5504251
2271	2928498839	2928496128	Bacteria	4631123
2272	2929149076	2929144301	Bacteria	6622272
2273	2929190916	2929189879	Bacteria	5930554
2274	2929199085	2929195423	Bacteria	5325372
2275	2931373501	2931369376	Bacteria	6847892
2276	2931382100	2931380184	Bacteria	4455911
2277	2931391903	2931390751	Bacteria	6273349
2278	2931397283	2931396565	Bacteria	7251677
2279	2935356841	2935353572	Unclassified	6955622
2280	2937611139	2937610967	Bacteria	4618818
2281	2939592534	2939589442	Bacteria	4214238
2282	2939605210	2939602548	Bacteria	4950493
2283	2939624869	2939622612	Bacteria	4698046
2284	2939628786	2939626828	Bacteria	4695272
2285	2939636975	2939636861	Bacteria	6297853
2286	2939652599	2939651529	Bacteria	5895393
2287	2941474088	2941471342	Bacteria	5018624
2288	2941477418	2941475908	Bacteria	4145589
2289	2941492282	2941489479	Bacteria	6313767
2290	2945929664	2945928738	Bacteria	6053221
2291	2945954267	2945951305	Bacteria	4918162
2292	2945965915	2945961074	Bacteria	7342064
2293	2946011950	2946006987	Bacteria	6705746
2294	2946029161	2946027586	Bacteria	6049274
2295	2947235709	2947233263	Bacteria	6439278
2296	2953995797	2953994433	Bacteria	4303959
2297	2961051258	2961047084	Bacteria	4594415
2298	2961065545	2961064222	Bacteria	4749990
2299	2969309370	2969304461	Bacteria	6601805
2300	2974289271	2974289157	Bacteria	6080362
2301	2974301294	2974298342	Bacteria	4840922
2302	2974310110	2974307012	Bacteria	4172388
2303	2977250844	2977247770	Bacteria	4160543
2304	2978976751	2978975091	Bacteria	4704313
2305	2984287486	2984286254	Bacteria	6702062
2306	2984498054	2984494565	Bacteria	5000175
2307	2984503771	2984499530	Bacteria	5020881
2308	2984507647	2984504281	Bacteria	5262371
2309	2984514669	2984514374	Bacteria	4172479
2310	2987608083	2987605356	Bacteria	4187822
2311	2988730679	2988728565	Bacteria	6124362
2312	2990264432	2990261002	Bacteria	4919493
2313	2995949948	2995948881	Bacteria	6358104
2314	2998144631	2998139840	Bacteria	6073514
2315	3007254066	3007252601	Bacteria	4559114
2316	3007317195	3007315729	Bacteria	5076637
2317	3007398314	3007395558	Bacteria	6755444
2318	3007420567	3007419365	Bacteria	7026924
2319	3007516395	3007511990	Bacteria	6481491
2320	3007615679	3007614139	Bacteria	6053559
2321	3007622754	3007619802	Bacteria	6411688
2322	3007723959	3007718800	Bacteria	5971527
2323	3007858386	3007855910	Bacteria	5637581
2324	3007866098	3007861166	Bacteria	6045338
2325	3007867581	3007866637	Bacteria	5899198
2326	3007873285	3007872151	Bacteria	5268868
2327	637322399	637000220	Bacteria	7074893
2328	640487037	640427133	Bacteria	4567418
2329	651174909	651053060	Bacteria	4689946
2330	8001525632	8001522603	Bacteria	4726425
2331	8002871204	8002869464	Bacteria	3588529
2332	8003015210	8003014200	Bacteria	4059994
2333	8015559717	8015556637	Bacteria	3582323
2334	8015692769	8015687852	Bacteria	6613826
2335	8016730213	8016728285	Bacteria	5263933
2336	8016737210	8016733728	Bacteria	5274317
2337	8019502411	8019499862	Bacteria	5169538
2338	8019773639	8019769354	Bacteria	6924660
2339	8019782080	8019775933	Bacteria	6858656
2340	8021622608	8021622325	Bacteria	4844743
2341	8021627552	8021626552	Bacteria	4665214
2342	8021650245	8021648035	Bacteria	4772378
2343	8029996248	8029995093	Bacteria	5990776
2344	8034963075	8034962539	Bacteria	4884839
2345	8052495568	8052494512	Bacteria	5765634
2346	8054290112	8054285046	Bacteria	6919322
2347	8054352673	8054347763	Bacteria	5901107
2348	8054358682	8054357960	Bacteria	2867777
2349	8054504500	8054503363	Bacteria	6101651
2350	8054933097	8054929484	Bacteria	5599761
2351	8055697519	8055693939	Bacteria	4772047
2352	8055776003	8055770955	Bacteria	6827675
2353	8055818930	8055817908	Bacteria	6609162
2354	8055883793	8055878733	Bacteria	5907058
2355	8056117270	8056115690	Bacteria	5527654
2356	8056125028	8056120720	Bacteria	5758328
2357	8056130873	8056125926	Bacteria	6228218
2358	8056132821	8056131705	Bacteria	6107031
2359	8056138419	8056137416	Bacteria	6147080
2360	8056144313	8056143049	Bacteria	6307666
2361	8056149014	8056148874	Bacteria	6479865
2362	8056155652	8056155041	Bacteria	6486948
2363	8056161320	8056161164	Bacteria	6106669
2364	8056171925	8056166840	Bacteria	5820959
2365	8056172606	8056172158	Bacteria	6133900
2366	8056179763	8056177738	Bacteria	6748268
2367	8056574425	8056569372	Bacteria	5997322
2368	8057162014	8057160832	Bacteria	3268302
2369	8057804887	8057798959	Bacteria	6713499
2370	Ga0307407_10094486
2371	MRS2a_Contig_63
2372	SwRhRL2b_contig_1105253
2373	SwRhRL2b_contig_676791
2374	JGI24736J21556_1007421
2375	JGI25156J39149_1000763
2376	JGI25156J39149_1002791
2377	JGI25162J39368_1001084
2378	JGI25162J39368_1002516
2379	JGI25157J39369_1000213
2380	JGI25157J39369_1000829
2381	JGI25163J39215_1000001
2382	JGI25163J39215_1000880
2383	JGI25164J39214_1000001
2384	JGI25164J39214_1000135
2385	JGI25164J39214_1001202
2386	JGI25164J39214_1001204
2387	JGI25152J39213_1000190
2388	JGI25150J39212_1000138
2389	JGI25151J46595_10000048
2390	JGI25151J46595_10000382
2391	JGI25406J46586_10003896
2392	JGI25406J46586_10005488
2393	JGI25165J46597_1000057
2394	JGI25165J46597_1002165
2395	JGI25165J46597_1002167
2396	JGI25153J46596_10000241
2397	rootH2_10006349
2398	rootH2_10268922
2399	rootL2_10013355
2400	rootH1_10179880
2401	Ga0006562J51391_1000525
2402	Ga0055538_1000004
2403	Ga0055538_1000036
2404	Ga0055539_1000004
2405	Ga0055539_1000047
2406	Ga0055539_1001313
2407	Ga0055533_1000007
2408	Ga0055533_1000058
2409	Ga0055533_1007238
2410	Ga0055532_1000234
2411	Ga0055525_1000007
2412	Ga0055525_1000113
2413	Ga0055525_1000124
2414	Ga0055525_1000184
2415	Ga0055527_1000094
2416	Ga0055527_1000180
2417	Ga0055527_1005482
2418	Ga0055535_1000421
2419	Ga0055535_1000807
2420	Ga0055535_1002047
2421	Ga0055535_1002095
2422	Ga0055542_1000312
2423	Ga0055542_1000326
2424	Ga0055542_1001929
2425	Ga0055542_1001976
2426	Ga0055529_1000137
2427	Ga0055529_1000434
2428	Ga0055529_1000893
2429	Ga0055526_1002585
2430	Ga0055537_1000270
2431	Ga0055537_1000884
2432	Ga0055524_1000005
2433	Ga0055536_1002013
2434	Ga0055536_1008200
2435	Ga0055536_1029241
2436	Ga0055536_1029304
2437	Ga0055534_1000002
2438	Ga0055534_1000187
2439	Ga0055528_1000002
2440	Ga0055528_1001833
2441	Ga0055530_10001485
2442	Ga0055530_10004669
2443	Ga0055530_10004676
2444	Ga0055540_1000363
2445	Ga0055540_1003931
2446	Ga0055540_1003941
2447	Ga0055531_10000348
2448	Ga0055531_10005465
2449	Ga0055531_10008944
2450	Ga0055541_1000004
2451	Ga0055541_1000034
2452	Ga0058692_1000032
2453	Ga0058692_1000037
2454	Ga0058692_1000783
2455	Ga0058692_1001581
2456	Ga0058692_1005124
2457	Ga0058692_1017455
2458	Ga0065714_10000563
2459	Ga0065714_10003117
2460	Ga0065714_10004344
2461	Ga0065704_10000476
2462	Ga0065704_10001720
2463	Ga0065704_10009233
2464	Ga0065704_10013896
2465	Ga0065704_10018606
2466	Ga0065704_10070132
2467	Ga0065704_10073599
2468	Ga0065704_10125537
2469	Ga0065704_10189551
2470	Ga0065712_10000146
2471	Ga0065712_10004871
2472	Ga0065712_10075242
2473	Ga0065712_10102956
2474	Ga0065712_10145274
2475	Ga0065712_10159572
2476	Ga0065715_10004965
2477	Ga0065715_10105027
2478	Ga0065707_10082076
2479	Ga0065707_10087110
2480	Ga0070658_10011586
2481	Ga0070658_10014463
2482	Ga0070658_10051284
2483	Ga0070658_10081269
2484	Ga0070658_10199025
2485	Ga0070676_10000003
2486	Ga0070676_10000200
2487	Ga0070683_100009144
2488	Ga0070683_100012737
2489	Ga0070683_100042529
2490	Ga0070683_100131422
2491	Ga0070690_100002111
2492	Ga0070670_100000017
2493	Ga0070670_100012303
2494	Ga0070670_100026164
2495	Ga0070670_100045099
2496	Ga0070670_100175103
2497	Ga0070670_100321070
2498	Ga0070677_10002103
2499	Ga0068869_100025331
2500	Ga0070666_10013077
2501	Ga0070666_10016809
2502	Ga0070666_10064950
2503	Ga0070680_100000033
2504	Ga0070680_100007344
2505	Ga0070680_100010140
2506	Ga0070680_100106269
2507	Ga0070680_100107458
2508	Ga0070682_100000010
2509	Ga0070682_100012319
2510	Ga0070682_100016238
2511	Ga0070682_100025280
2512	Ga0070682_100059422
2513	Ga0070682_100105075
2514	Ga0068868_100001011
2515	Ga0068868_100221076
2516	Ga0070660_100009393
2517	Ga0070660_100066995
2518	Ga0070689_100001646
2519	Ga0070689_100006887
2520	Ga0070689_100010067
2521	Ga0070691_10000705
2522	Ga0070691_10040552
2523	Ga0070687_100007699
2524	Ga0070661_100000152
2525	Ga0070661_100002022
2526	Ga0070661_100017350
2527	Ga0070661_100059879
2528	Ga0070692_10014446
2529	Ga0070668_100002651
2530	Ga0070668_100003416
2531	Ga0070668_100006359
2532	Ga0070668_100011223
2533	Ga0070668_100091912
2534	Ga0070668_100100682
2535	Ga0070668_100103594
2536	Ga0070669_100001632
2537	Ga0070669_100004176
2538	Ga0070669_100005702
2539	Ga0070669_100021348
2540	Ga0070669_100170924
2541	Ga0070675_100002542
2542	Ga0070675_100023685
2543	Ga0070675_100031612
2544	Ga0070675_100175591
2545	Ga0070671_100000032
2546	Ga0070671_100002723
2547	Ga0070671_100012026
2548	Ga0070671_100079088
2549	Ga0070674_100001153
2550	Ga0070674_100002386
2551	Ga0070674_100016581
2552	Ga0070674_100017347
2553	Ga0070673_100001949
2554	Ga0070673_100097382
2555	Ga0070673_100105178
2556	Ga0070673_100121457
2557	Ga0070688_100002556
2558	Ga0070688_100005687
2559	Ga0070688_100243847
2560	Ga0070659_100039765
2561	Ga0070659_100112421
2562	Ga0070667_100000091
2563	Ga0070667_100000184
2564	Ga0070667_100004862
2565	Ga0070667_100007577
2566	Ga0070667_100039135
2567	Ga0070667_100054242
2568	Ga0070667_100088280
2569	Ga0070667_100263554
2570	Ga0070703_10051111
2571	Ga0070709_10007470
2572	Ga0070714_100004437
2573	Ga0070713_100003198
2574	Ga0070713_100140271
2575	Ga0070713_100288440
2576	Ga0070710_10043881
2577	Ga0070701_10001965
2578	Ga0070711_100022575
2579	Ga0070711_100038637
2580	Ga0070705_100006181
2581	Ga0070705_100009902
2582	Ga0070705_100038683
2583	Ga0070700_100035342
2584	Ga0070700_100035520
2585	Ga0070694_100015940
2586	Ga0070663_100049802
2587	Ga0070663_100295463
2588	Ga0070678_100000873
2589	Ga0070678_100004180
2590	Ga0070678_100025717
2591	Ga0070678_100188584
2592	Ga0070662_100002336
2593	Ga0070662_100017832
2594	Ga0070662_100018279
2595	Ga0070662_100046535
2596	Ga0070681_10000231
2597	Ga0070681_10003742
2598	Ga0070681_10004886
2599	Ga0070681_10008772
2600	Ga0070681_10010910
2601	Ga0070681_10032932
2602	Ga0070681_10055146
2603	Ga0070681_10109988
2604	Ga0070681_10176964
2605	Ga0070681_10344316
2606	Ga0068867_100002636
2607	Ga0070685_10000016
2608	Ga0070685_10004841
2609	Ga0070685_10019928
2610	Ga0070706_100049704
2611	Ga0070706_100080423
2612	Ga0070698_100069321
2613	Ga0070699_100000004
2614	Ga0070699_100011960
2615	Ga0070699_100014559
2616	Ga0070699_100022641
2617	Ga0070679_100002362
2618	Ga0070679_100008695
2619	Ga0070679_100012434
2620	Ga0070679_100036391
2621	Ga0070679_100063743
2622	Ga0070679_100123136
2623	Ga0070679_100207125
2624	Ga0070684_100001693
2625	Ga0070684_100430285
2626	Ga0070697_100000413
2627	Ga0070697_100052375
2628	Ga0068853_100002810
2629	Ga0068853_100003992
2630	Ga0068853_100009575
2631	Ga0068853_100047274
2632	Ga0068853_100080418
2633	Ga0068853_100181540
2634	Ga0068853_100242966
2635	Ga0068853_100245651
2636	Ga0070672_100001239
2637	Ga0070672_100001777
2638	Ga0070672_100002261
2639	Ga0070672_100055733
2640	Ga0070672_100090827
2641	Ga0070686_100038718
2642	Ga0070695_100011659
2643	Ga0070696_100000221
2644	Ga0070696_100003227
2645	Ga0070696_100006775
2646	Ga0070696_100008595
2647	Ga0070693_100007267
2648	Ga0070693_100008377
2649	Ga0070693_100014491
2650	Ga0070693_100018052
2651	Ga0070665_100000092
2652	Ga0070665_100000726
2653	Ga0070665_100002581
2654	Ga0070665_100003573
2655	Ga0070665_100003735
2656	Ga0070665_100005780
2657	Ga0070665_100005905
2658	Ga0070665_100008952
2659	Ga0070665_100012130
2660	Ga0070665_100012849
2661	Ga0070665_100033222
2662	Ga0070665_100045517
2663	Ga0070665_100075209
2664	Ga0070665_100086852
2665	Ga0070665_100111469
2666	Ga0070665_100130736
2667	Ga0070665_100207772
2668	Ga0070665_100383712
2669	Ga0070704_100016762
2670	Ga0068855_100006468
2671	Ga0068855_100030035
2672	Ga0068855_100063707
2673	Ga0068855_100109891
2674	Ga0068855_100119277
2675	Ga0068855_100129328
2676	Ga0068855_100196220
2677	Ga0068855_100460996
2678	Ga0070664_100042182
2679	Ga0070664_100044383
2680	Ga0070664_100058870
2681	Ga0070664_100131593
2682	Ga0070664_100382244
2683	Ga0068857_100036427
2684	Ga0068857_100045003
2685	Ga0068854_100005117
2686	Ga0068854_100022957
2687	Ga0068854_100046963
2688	Ga0068854_100054265
2689	Ga0068854_100123247
2690	Ga0068854_100138863
2691	Ga0068854_100238205
2692	Ga0068856_100000639
2693	Ga0068856_100001721
2694	Ga0068856_100028809
2695	Ga0068856_100035946
2696	Ga0068856_100041467
2697	Ga0070702_100006861
2698	Ga0070702_100108954
2699	Ga0068852_100005134
2700	Ga0068852_100009359
2701	Ga0068852_100013010
2702	Ga0068852_100026399
2703	Ga0068852_100163760
2704	Ga0068859_100007477
2705	Ga0068859_100054203
2706	Ga0068859_100075153
2707	Ga0068859_100274475
2708	Ga0068859_100304180
2709	Ga0068859_100415467
2710	Ga0068864_100000008
2711	Ga0068864_100000029
2712	Ga0068864_100026073
2713	Ga0068866_10096129
2714	Ga0068861_100004868
2715	Ga0068861_100014526
2716	Ga0068861_100093127
2717	Ga0068851_10000152
2718	Ga0068851_10000956
2719	Ga0068851_10002254
2720	Ga0068851_10015571
2721	Ga0068851_10021460
2722	Ga0068870_10003894
2723	Ga0068870_10005974
2724	Ga0068870_10011358
2725	Ga0068863_100033135
2726	Ga0068863_100040516
2727	Ga0068863_100116113
2728	Ga0068863_100196465
2729	Ga0068858_100000592
2730	Ga0068858_100002497
2731	Ga0068858_100045992
2732	Ga0068858_100050030
2733	Ga0068858_100069878
2734	Ga0068858_100082088
2735	Ga0068858_100087974
2736	Ga0068858_100153710
2737	Ga0068860_100000729
2738	Ga0068860_100017924
2739	Ga0068860_100026369
2740	Ga0068860_100040914
2741	Ga0068860_100185262
2742	Ga0068860_100231567
2743	Ga0068860_100247877
2744	Ga0068860_100382023
2745	Ga0068862_100003493
2746	Ga0068862_100008743
2747	Ga0081455_10000679
2748	Ga0081455_10006489
2749	Ga0081455_10024101
2750	Ga0081540_1066220
2751	Ga0081539_10000006
2752	Ga0081539_10000078
2753	Ga0070717_10000237
2754	Ga0070717_10014174
2755	Ga0075365_10010950
2756	Ga0075365_10014187
2757	Ga0075365_10049979
2758	Ga0075368_10026400
2759	Ga0075363_100002315
2760	Ga0075364_10000194
2761	Ga0075364_10000594
2762	Ga0075364_10015021
2763	Ga0075364_10016378
2764	Ga0075364_10031329
2765	Ga0075432_10003876
2766	Ga0070716_100219069
2767	Ga0070712_100063288
2768	Ga0070712_100070548
2769	Ga0070712_100171452
2770	Ga0075367_10007375
2771	Ga0075367_10035704
2772	Ga0075369_10000114
2773	Ga0075427_10000184
2774	Ga0075366_10005771
2775	Ga0097621_100001594
2776	Ga0097621_100019022
2777	Ga0097621_100038516
2778	Ga0097621_100040739
2779	Ga0097621_100047781
2780	Ga0097621_100121967
2781	Ga0097621_100243823
2782	Ga0075370_10000249
2783	Ga0068871_100000187
2784	Ga0068871_100061017
2785	Ga0068871_100061751
2786	Ga0068871_100067917
2787	Ga0068871_100150506
2788	Ga0068871_100257162
2789	Ga0075428_100002550
2790	Ga0075430_100001093
2791	Ga0075430_100005749
2792	Ga0075430_100030468
2793	Ga0075431_100000014
2794	Ga0075431_100022419
2795	Ga0075433_10238225
2796	Ga0075434_100381193
2797	Ga0075429_100001449
2798	Ga0075429_100002488
2799	Ga0075429_100087268
2800	Ga0075429_100192941
2801	Ga0068865_100054203
2802	Ga0068865_100197539
2803	Ga0075436_100003359
2804	Ga0075436_100012836
2805	Ga0097620_100007478
2806	Ga0097620_100054202
2807	Ga0097620_100075153
2808	Ga0097620_100274481
2809	Ga0097620_100304186
2810	Ga0097620_100415450
2811	Ga0099823_1002160
2812	Ga0099823_1045624
2813	Ga0099826_10030774
2814	Ga0075435_100000180
2815	Ga0075435_100084233
2816	Ga0099794_10004973
2817	Ga0105251_10000004
2818	Ga0105251_10000192
2819	Ga0105251_10002884
2820	Ga0105251_10003555
2821	Ga0105251_10005870
2822	Ga0105251_10006959
2823	Ga0105251_10007390
2824	Ga0105251_10007819
2825	Ga0105251_10013831
2826	Ga0105251_10050750
2827	Ga0105251_10107651
2828	Ga0105244_10000293
2829	Ga0105244_10001043
2830	Ga0105244_10002697
2831	Ga0105244_10005126
2832	Ga0105244_10142279
2833	Ga0105244_10148643
2834	Ga0105250_10000376
2835	Ga0105250_10001838
2836	Ga0105250_10006433
2837	Ga0105250_10041176
2838	Ga0105250_10057579
2839	Ga0105250_10072138
2840	Ga0105240_10000239
2841	Ga0105240_10000425
2842	Ga0105240_10001884
2843	Ga0105240_10024741
2844	Ga0105240_10047403
2845	Ga0105240_10054647
2846	Ga0105240_10246896
2847	Ga0105240_10299364
2848	Ga0105240_10399617
2849	Ga0111539_10020948
2850	Ga0105245_10005587
2851	Ga0105245_10119069
2852	Ga0105247_10023329
2853	Ga0105247_10028029
2854	Ga0105247_10053722
2855	Ga0105247_10123544
2856	Ga0114129_10001674
2857	Ga0114129_10056145
2858	Ga0105243_10002016
2859	Ga0105243_10002762
2860	Ga0105243_10007906
2861	Ga0105243_10008935
2862	Ga0105243_10051043
2863	Ga0105243_10092274
2864	Ga0105243_10146701
2865	Ga0105241_10014772
2866	Ga0105241_10139005
2867	Ga0105241_10285428
2868	Ga0105241_10349854
2869	Ga0105242_10001040
2870	Ga0105242_10101772
2871	Ga0105242_10114625
2872	Ga0105248_10001607
2873	Ga0105248_10001989
2874	Ga0105248_10003695
2875	Ga0105248_10158393
2876	Ga0105248_10168970
2877	Ga0105248_10353491
2878	Ga0105237_10001329
2879	Ga0105237_10001989
2880	Ga0105237_10002874
2881	Ga0105237_10022941
2882	Ga0105237_10046333
2883	Ga0105237_10091917
2884	Ga0105237_10104192
2885	Ga0105237_10153249
2886	Ga0105238_10000760
2887	Ga0105238_10003249
2888	Ga0105238_10021594
2889	Ga0105238_10021685
2890	Ga0105238_10045967
2891	Ga0105238_10152017
2892	Ga0105249_10015163
2893	Ga0105249_10018919
2894	Ga0105249_10054550
2895	Ga0105249_10068006
2896	Ga0105249_10170758
2897	Ga0105249_10175107
2898	Ga0105249_10295618
2899	Ga0105032_100571
2900	Ga0105029_100746
2901	Ga0105239_10001952
2902	Ga0105239_10028570
2903	Ga0105239_10029453
2904	Ga0105239_10146291
2905	Ga0105239_10239261
2906	Ga0105239_10329702
2907	Ga0105239_10456250
2908	Ga0105246_10002790
2909	Ga0105246_10009344
2910	Ga0105246_10012293
2911	Ga0105246_10060365
2912	Ga0105246_10132713
2913	Ga0105246_10152445
2914	Ga0105246_10356107
2915	Ga0157373_10011236
2916	Ga0157373_10047796
2917	Ga0157373_10232961
2918	Ga0157371_10000020
2919	Ga0157371_10000461
2920	Ga0157371_10000790
2921	Ga0157371_10002383
2922	Ga0157371_10004229
2923	Ga0157371_10004820
2924	Ga0157371_10005049
2925	Ga0157371_10008728
2926	Ga0157371_10155557
2927	Ga0157371_10260135
2928	Ga0157370_10000452
2929	Ga0157370_10008259
2930	Ga0157370_10010220
2931	Ga0157370_10017410
2932	Ga0157370_10025172
2933	Ga0157370_10031758
2934	Ga0157370_10034559
2935	Ga0157370_10197779
2936	Ga0157370_10240595
2937	Ga0157370_10250068
2938	Ga0157370_10331699
2939	Ga0157369_10002184
2940	Ga0157369_10023569
2941	Ga0157369_10044930
2942	Ga0157369_10078398
2943	Ga0157369_10207631
2944	Ga0157369_10281982
2945	Ga0157369_10361252
2946	Ga0157369_10407091
2947	Ga0157369_10424073
2948	Ga0157374_10055027
2949	Ga0157378_10025328
2950	Ga0157378_10071214
2951	Ga0157378_10091846
2952	Ga0157378_10134895
2953	Ga0157378_10169886
2954	Ga0157378_10486013
2955	Ga0163162_10000017
2956	Ga0163162_10072410
2957	Ga0163162_10132501
2958	Ga0157372_10000885
2959	Ga0157372_10006013
2960	Ga0157372_10008464
2961	Ga0157372_10011691
2962	Ga0157372_10044332
2963	Ga0157372_10054880
2964	Ga0157372_10146121
2965	Ga0157372_10157212
2966	Ga0157372_10199462
2967	Ga0157372_10207567
2968	Ga0157372_10624234
2969	Ga0157375_10000014
2970	Ga0157375_10001966
2971	Ga0157375_10028219
2972	Ga0157375_10125409
2973	Ga0157375_10271795
2974	Ga0157375_10293664
2975	Ga0157375_10539702
2976	Ga0163163_10000061
2977	Ga0163163_10038297
2978	Ga0163163_10039314
2979	Ga0163163_10074600
2980	Ga0163163_10128926
2981	Ga0157380_10000190
2982	Ga0157380_10008956
2983	Ga0157380_10054098
2984	Ga0182008_10000084
2985	Ga0182008_10026390
2986	Ga0157379_10013595
2987	Ga0157379_10118898
2988	Ga0157379_10141918
2989	Ga0157376_10207953
2990	Ga0157376_10211146
2991	Ga0182006_1002046
2992	Ga0182006_1025580
2993	Ga0182006_1046130
2994	Ga0182007_10000060
2995	Ga0182005_1000421
2996	Ga0182005_1014360
2997	Ga0183369_1018
2998	Ga0183360_10001
2999	Ga0163161_10064216
3000	Ga0197907_11300396
3001	Ga0206356_10105888
3002	Ga0213872_10002256
3003	Ga0213872_10002918
3004	Ga0213872_10007213
3005	Ga0213872_10015339
3006	Ga0213876_10000125
3007	Ga0213876_10082647
3008	Ga0213875_10000027
3009	Ga0213875_10053367
3010	Ga0213871_10009080
3011	Ga0209760_100044
3012	Ga0209760_100085
3013	Ga0209760_100291
3014	Ga0209784_100001
3015	Ga0209784_100050
3016	Ga0209566_100001
3017	Ga0209566_100063
3018	Ga0209674_100002
3019	Ga0209674_100079
3020	Ga0209674_100084
3021	Ga0209672_100005
3022	Ga0209672_100055
3023	Ga0209672_100189
3024	Ga0209672_101422
3025	Ga0209147_100083
3026	Ga0209563_100008
3027	Ga0209563_100045
3028	Ga0209563_100084
3029	Ga0209563_100632
3030	Ga0207427_100002
3031	Ga0207427_100007
3032	Ga0207427_100038
3033	Ga0207427_100053
3034	Ga0209437_100006
3035	Ga0209437_100009
3036	Ga0209437_100046
3037	Ga0209437_100063
3038	Ga0209437_100108
3039	Ga0209258_100006
3040	Ga0209258_100055
3041	Ga0209258_100113
3042	Ga0209258_100135
3043	Ga0209258_100152
3044	Ga0207425_1000040
3045	Ga0207425_1002601
3046	Ga0209646_1000359
3047	Ga0209646_1001074
3048	Ga0209026_1000055
3049	Ga0209026_1000510
3050	Ga0209677_100004
3051	Ga0209677_100047
3052	Ga0209677_100899
3053	Ga0209148_1000012
3054	Ga0209148_1000014
3055	Ga0209148_1000058
3056	Ga0209148_1000102
3057	Ga0209759_1000159
3058	Ga0209759_1000267
3059	Ga0209759_1000386
3060	Ga0209129_1000011
3061	Ga0209233_1000059
3062	Ga0209233_1000074
3063	Ga0209233_1000125
3064	Ga0209233_1000516
3065	Ga0209233_1000779
3066	Ga0209233_1003072
3067	Ga0209565_1000001
3068	Ga0209565_1000472
3069	Ga0209455_1000008
3070	Ga0209455_1000014
3071	Ga0209455_1000018
3072	Ga0209673_1000001
3073	Ga0209673_1000032
3074	Ga0209130_1009595
3075	Ga0209130_1009724
3076	Ga0209675_1000001
3077	Ga0209675_1000020
3078	Ga0209676_1000006
3079	Ga0209676_1000010
3080	Ga0209676_1000027
3081	Ga0209676_1000131
3082	Ga0209676_1000181
3083	Ga0209676_1000504
3084	Ga0209676_1000541
3085	Ga0209676_1002017
3086	Ga0209676_1004055
3087	Ga0209676_1004400
3088	Ga0209676_1005322
3089	Ga0209676_1005977
3090	Ga0209025_1000002
3091	Ga0209025_1000006
3092	Ga0209025_1001895
3093	Ga0209025_1003736
3094	Ga0209564_1000001
3095	Ga0209564_1000210
3096	Ga0209758_1000003
3097	Ga0209758_1019052
3098	Ga0209050_1000019
3099	Ga0209050_1000027
3100	Ga0209050_1001000
3101	Ga0209050_1001606
3102	Ga0209050_1002093
3103	Ga0209050_1005828
3104	Ga0209050_1006379
3105	Ga0209256_1000006
3106	Ga0209256_1002997
3107	Ga0207426_1009164
3108	Ga0209051_1000065
3109	Ga0209051_1000504
3110	Ga0209051_1001179
3111	Ga0209051_1004963
3112	Ga0209051_1012764
3113	Ga0209257_1000067
3114	Ga0209257_1000086
3115	Ga0209257_1000119
3116	Ga0209257_1000197
3117	Ga0209257_1001869
3118	Ga0209257_1003148
3119	Ga0209257_1005527
3120	Ga0209257_1005529
3121	Ga0209257_1005904
3122	Ga0207697_10048006
3123	Ga0207656_10000130
3124	Ga0207656_10000248
3125	Ga0207656_10030929
3126	Ga0207656_10059384
3127	Ga0207696_1000022
3128	Ga0207696_1000054
3129	Ga0207696_1000093
3130	Ga0207696_1000203
3131	Ga0207696_1000210
3132	Ga0207696_1000213
3133	Ga0207696_1000384
3134	Ga0207696_1007881
3135	Ga0207655_1000005
3136	Ga0207655_1000015
3137	Ga0207655_1000311
3138	Ga0207655_1000617
3139	Ga0207655_1001239
3140	Ga0207655_1001289
3141	Ga0207655_1002487
3142	Ga0207655_1004103
3143	Ga0207655_1004110
3144	Ga0207655_1004943
3145	Ga0207655_1005319
3146	Ga0207655_1006657
3147	Ga0207655_1007459
3148	Ga0207655_1007637
3149	Ga0207655_1007750
3150	Ga0207655_1029198
3151	Ga0207655_1057751
3152	Ga0207713_1000007
3153	Ga0207713_1000013
3154	Ga0207713_1000068
3155	Ga0207713_1000244
3156	Ga0207713_1000374
3157	Ga0207713_1001566
3158	Ga0207713_1002224
3159	Ga0207713_1004208
3160	Ga0207713_1006723
3161	Ga0207713_1014645
3162	Ga0207713_1020468
3163	Ga0207713_1038674
3164	Ga0207682_10000049
3165	Ga0207710_10005021
3166	Ga0207710_10009208
3167	Ga0207680_10003931
3168	Ga0207680_10044024
3169	Ga0207680_10045420
3170	Ga0207647_10000020
3171	Ga0207647_10000262
3172	Ga0207647_10003416
3173	Ga0207647_10017447
3174	Ga0207699_10223586
3175	Ga0207699_10397202
3176	Ga0207645_10000003
3177	Ga0207643_10007303
3178	Ga0207705_10000087
3179	Ga0207705_10000153
3180	Ga0207705_10005926
3181	Ga0207705_10006901
3182	Ga0207705_10061475
3183	Ga0207705_10093844
3184	Ga0207684_10172494
3185	Ga0207654_10019154
3186	Ga0207654_10069430
3187	Ga0207707_10000075
3188	Ga0207707_10000148
3189	Ga0207707_10000799
3190	Ga0207707_10000906
3191	Ga0207707_10002373
3192	Ga0207707_10010226
3193	Ga0207707_10027296
3194	Ga0207707_10038947
3195	Ga0207707_10050849
3196	Ga0207707_10085657
3197	Ga0207707_10100291
3198	Ga0207707_10313653
3199	Ga0207695_10000082
3200	Ga0207695_10000859
3201	Ga0207695_10001984
3202	Ga0207695_10011480
3203	Ga0207695_10012672
3204	Ga0207695_10025730
3205	Ga0207695_10025909
3206	Ga0207695_10077466
3207	Ga0207695_10180837
3208	Ga0207695_10278794
3209	Ga0207695_10314894
3210	Ga0207695_10436752
3211	Ga0207671_10000121
3212	Ga0207671_10000665
3213	Ga0207671_10027768
3214	Ga0207671_10056887
3215	Ga0207671_10105580
3216	Ga0207671_10218622
3217	Ga0207693_10067775
3218	Ga0207693_10070958
3219	Ga0207663_10002414
3220	Ga0207660_10000970
3221	Ga0207660_10001074
3222	Ga0207660_10001268
3223	Ga0207660_10003248
3224	Ga0207660_10006489
3225	Ga0207660_10039513
3226	Ga0207660_10067017
3227	Ga0207660_10176185
3228	Ga0207657_10012801
3229	Ga0207657_10014104
3230	Ga0207657_10019332
3231	Ga0207657_10114774
3232	Ga0207657_10158515
3233	Ga0207657_10176960
3234	Ga0207649_10000004
3235	Ga0207649_10003540
3236	Ga0207649_10040932
3237	Ga0207649_10065098
3238	Ga0207649_10131693
3239	Ga0207652_10000017
3240	Ga0207652_10000040
3241	Ga0207652_10000418
3242	Ga0207652_10000741
3243	Ga0207652_10008742
3244	Ga0207652_10015518
3245	Ga0207652_10036821
3246	Ga0207652_10041476
3247	Ga0207652_10047858
3248	Ga0207652_10058924
3249	Ga0207646_10002861
3250	Ga0207681_10000173
3251	Ga0207681_10001160
3252	Ga0207681_10016143
3253	Ga0207681_10022975
3254	Ga0207681_10081037
3255	Ga0207681_10089599
3256	Ga0207681_10157130
3257	Ga0207694_10000412
3258	Ga0207694_10008601
3259	Ga0207694_10010001
3260	Ga0207694_10073264
3261	Ga0207694_10092388
3262	Ga0207694_10114523
3263	Ga0207694_10199382
3264	Ga0207650_10000003
3265	Ga0207650_10002038
3266	Ga0207650_10010026
3267	Ga0207650_10016767
3268	Ga0207650_10037073
3269	Ga0207650_10045395
3270	Ga0207650_10280051
3271	Ga0207659_10001245
3272	Ga0207659_10021072
3273	Ga0207659_10033777
3274	Ga0207687_10004161
3275	Ga0207687_10071421
3276	Ga0207700_10006747
3277	Ga0207664_10008387
3278	Ga0207664_10014460
3279	Ga0207644_10000014
3280	Ga0207644_10004481
3281	Ga0207644_10021392
3282	Ga0207644_10137674
3283	Ga0207690_10000494
3284	Ga0207690_10001282
3285	Ga0207690_10031758
3286	Ga0207690_10154125
3287	Ga0207690_10231292
3288	Ga0207706_10003057
3289	Ga0207706_10006038
3290	Ga0207706_10012827
3291	Ga0207706_10028324
3292	Ga0207686_10034933
3293	Ga0207709_10000224
3294	Ga0207709_10000792
3295	Ga0207709_10001009
3296	Ga0207709_10002087
3297	Ga0207709_10013845
3298	Ga0207709_10158183
3299	Ga0207670_10026959
3300	Ga0207670_10036211
3301	Ga0207670_10084609
3302	Ga0207670_10158523
3303	Ga0207669_10015503
3304	Ga0207669_10028588
3305	Ga0207669_10053185
3306	Ga0207704_10038905
3307	Ga0207704_10061140
3308	Ga0207665_10018979
3309	Ga0207691_10000387
3310	Ga0207691_10001603
3311	Ga0207691_10004502
3312	Ga0207691_10004786
3313	Ga0207691_10006299
3314	Ga0207691_10016900
3315	Ga0207691_10031270
3316	Ga0207691_10106967
3317	Ga0207711_10000939
3318	Ga0207711_10065045
3319	Ga0207711_10126078
3320	Ga0207689_10011462
3321	Ga0207689_10011479
3322	Ga0207689_10048435
3323	Ga0207661_10021711
3324	Ga0207661_10049844
3325	Ga0207661_10090906
3326	Ga0207661_10095223
3327	Ga0207661_10208002
3328	Ga0207679_10000043
3329	Ga0207679_10004434
3330	Ga0207679_10019343
3331	Ga0207679_10057596
3332	Ga0207667_10000675
3333	Ga0207667_10001331
3334	Ga0207667_10002419
3335	Ga0207667_10003364
3336	Ga0207667_10021240
3337	Ga0207667_10026555
3338	Ga0207667_10035305
3339	Ga0207667_10082691
3340	Ga0207667_10164855
3341	Ga0207667_10292912
3342	Ga0207651_10080379
3343	Ga0207651_10318395
3344	Ga0207712_10000395
3345	Ga0207712_10013603
3346	Ga0207712_10024486
3347	Ga0207712_10216637
3348	Ga0207712_10315618
3349	Ga0207668_10007682
3350	Ga0207668_10008274
3351	Ga0207668_10010152
3352	Ga0207668_10013028
3353	Ga0207668_10021564
3354	Ga0207668_10022638
3355	Ga0207668_10023374
3356	Ga0207668_10026252
3357	Ga0207640_10001728
3358	Ga0207640_10004723
3359	Ga0207640_10054086
3360	Ga0207640_10096783
3361	Ga0207640_10110958
3362	Ga0207640_10237328
3363	Ga0207640_10263917
3364	Ga0207658_10000012
3365	Ga0207658_10000245
3366	Ga0207658_10001744
3367	Ga0207658_10007986
3368	Ga0207658_10040929
3369	Ga0207658_10048750
3370	Ga0207677_10000008
3371	Ga0207677_10001774
3372	Ga0207703_10000576
3373	Ga0207703_10016979
3374	Ga0207703_10056158
3375	Ga0207703_10067367
3376	Ga0207703_10070214
3377	Ga0207703_10107170
3378	Ga0207703_10109250
3379	Ga0207703_10124572
3380	Ga0207703_10384742
3381	Ga0207639_10000024
3382	Ga0207639_10000429
3383	Ga0207639_10001589
3384	Ga0207639_10006869
3385	Ga0207639_10010999
3386	Ga0207639_10022001
3387	Ga0207639_10033730
3388	Ga0207639_10057558
3389	Ga0207639_10168161
3390	Ga0207639_10274919
3391	Ga0207678_10013058
3392	Ga0207678_10068493
3393	Ga0207678_10193842
3394	Ga0207678_10416105
3395	Ga0207708_10012140
3396	Ga0207708_10034495
3397	Ga0207708_10055505
3398	Ga0207708_10077462
3399	Ga0207702_10000155
3400	Ga0207702_10014043
3401	Ga0207702_10024166
3402	Ga0207702_10124308
3403	Ga0207641_10024285
3404	Ga0207641_10072269
3405	Ga0207641_10159004
3406	Ga0207648_10000605
3407	Ga0207648_10026946
3408	Ga0207648_10036045
3409	Ga0207648_10045833
3410	Ga0207648_10052902
3411	Ga0207676_10000003
3412	Ga0207676_10000070
3413	Ga0207676_10138128
3414	Ga0207674_10010601
3415	Ga0207674_10019860
3416	Ga0207674_10140696
3417	Ga0207674_10250276
3418	Ga0207675_100009143
3419	Ga0207675_100027650
3420	Ga0207675_100052996
3421	Ga0207675_100054807
3422	Ga0207675_100061557
3423	Ga0207675_100078348
3424	Ga0207675_100078379
3425	Ga0207675_100138186
3426	Ga0207683_10000005
3427	Ga0207683_10010458
3428	Ga0207683_10011093
3429	Ga0207683_10035345
3430	Ga0207683_10054930
3431	Ga0207683_10067932
3432	Ga0207683_10068007
3433	Ga0207683_10253678
3434	Ga0207698_10003709
3435	Ga0207698_10004132
3436	Ga0207698_10018515
3437	Ga0207698_10027609
3438	Ga0207698_10140631
3439	Ga0207698_10170768
3440	Ga0207698_10331398
3441	Ga0209281_1000015
3442	Ga0209281_1001253
3443	Ga0209389_1000002
3444	Ga0209389_1039782
3445	Ga0209371_1000028
3446	Ga0209371_1000053
3447	Ga0209371_1000055
3448	Ga0209371_1000096
3449	Ga0209371_1000372
3450	Ga0209371_1000383
3451	Ga0209371_1000393
3452	Ga0209371_1000886
3453	Ga0209371_1001326
3454	Ga0209371_1001917
3455	Ga0209371_1004830
3456	Ga0209969_1002097
3457	Ga0209967_1004455
3458	Ga0209981_1006357
3459	Ga0210000_1001840
3460	Ga0209999_1001530
3461	Ga0209982_1001316
3462	Ga0209982_1002763
3463	Ga0209970_1002461
3464	Ga0209970_1003229
3465	Ga0209983_1000734
3466	Ga0209983_1001878
3467	Ga0209983_1010422
3468	Ga0209971_1000263
3469	Ga0209971_1001937
3470	Ga0209813_10013154
3471	Ga0209974_10000936
3472	Ga0209974_10057215
3473	Ga0207428_10015119
3474	Ga0207428_10125850
3475	Ga0207428_10262208
3476	Ga0268266_10000001
3477	Ga0268266_10000008
3478	Ga0268266_10000351
3479	Ga0268266_10002049
3480	Ga0268266_10004501
3481	Ga0268266_10007953
3482	Ga0268266_10016101
3483	Ga0268266_10017481
3484	Ga0268266_10081895
3485	Ga0268266_10118592
3486	Ga0268266_10157861
3487	Ga0268266_10191937
3488	Ga0268266_10221220
3489	Ga0268265_10000238
3490	Ga0268265_10010569
3491	Ga0268265_10020952
3492	Ga0268265_10131304
3493	Ga0268264_10000009
3494	Ga0268264_10009455
3495	Ga0268264_10037377
3496	Ga0268264_10062001
3497	Ga0268264_10312818
3498	Ga0268264_10377258
3499	Ga0268264_10437605
3500	Ga0265334_10000005
3501	Ga0265334_10000055
3502	Ga0265334_10008909
3503	Ga0265318_10006014
3504	Ga0265323_10000092
3505	Ga0265323_10022424
3506	Ga0265322_10000318
3507	Ga0307515_10018143
3508	Ga0307515_10240103
3509	Ga0265338_10012530
3510	Ga0265338_10013943
3511	Ga0265338_10020660
3512	Ga0265338_10038824
3513	Ga0265338_10046681
3514	Ga0265338_10067136
3515	Ga0265338_10078863
3516	Ga0268256_1000030
3517	Ga0268256_1000053
3518	Ga0268256_1000054
3519	Ga0268256_1000086
3520	Ga0268256_1000316
3521	Ga0268256_1000347
3522	Ga0268256_1000384
3523	Ga0268256_1001022
3524	Ga0268256_1003519
3525	Ga0307511_10000048
3526	Ga0307511_10105523
3527	Ga0316177_1040214
3528	Ga0316176_1226866
3529	Ga0314311_1077855
3530	Ga0314311_1098321
3531	Ga0316178_1061620
3532	Ga0265332_10023267
3533	Ga0265320_10006593
3534	Ga0265320_10053556
3535	Ga0265325_10001456
3536	Ga0265325_10003046
3537	Ga0265325_10012192
3538	Ga0265340_10046100
3539	Ga0265339_10000839
3540	Ga0265339_10001900
3541	Ga0265339_10033861
3542	Ga0265331_10005707
3543	Ga0265327_10000050
3544	Ga0265327_10000686
3545	Ga0265327_10003233
3546	Ga0265327_10055346
3547	Ga0265327_10082641
3548	Ga0265316_10014740
3549	Ga0265316_10057360
3550	Ga0265316_10138016
3551	Ga0307513_10003153
3552	Ga0307513_10009635
3553	Ga0307513_10011253
3554	Ga0307513_10013985
3555	Ga0307513_10114999
3556	Ga0307513_10116313
3557	Ga0307513_10151784
3558	Ga0307509_10000803
3559	Ga0307509_10187296
3560	Ga0307408_100000020
3561	Ga0307408_100008855
3562	Ga0265313_10000157
3563	Ga0265313_10000285
3564	Ga0265313_10003134
3565	Ga0265313_10011118
3566	Ga0307514_10087132
3567	Ga0316575_10002292
3568	Ga0316575_10018222
3569	Ga0316575_10052454
3570	Ga0316579_10000314
3571	Ga0316579_10002675
3572	Ga0316579_10004615
3573	Ga0316579_10014182
3574	Ga0316579_10044328
3575	Ga0265314_10001951
3576	Ga0265314_10016816
3577	Ga0265314_10044236
3578	Ga0265342_10000223
3579	Ga0265342_10009087
3580	Ga0265342_10011729
3581	Ga0265342_10020541
3582	Ga0316576_10002990
3583	Ga0316576_10005553
3584	Ga0316576_10007808
3585	Ga0316576_10009657
3586	Ga0316576_10020790
3587	Ga0316576_10050561
3588	Ga0316576_10051602
3589	Ga0316576_10056812
3590	Ga0316576_10077524
3591	Ga0316576_10110491
3592	Ga0316576_10121372
3593	Ga0316578_10000370
3594	Ga0316578_10004657
3595	Ga0316578_10014656
3596	Ga0307516_10040204
3597	Ga0307405_10033582
3598	Ga0307405_10038439
3599	Ga0316577_10000223
3600	Ga0316577_10000344
3601	Ga0316577_10000644
3602	Ga0316577_10004466
3603	Ga0316577_10006163
3604	Ga0316577_10025724
3605	Ga0316577_10049713
3606	Ga0307413_10053876
3607	Ga0307413_10099593
3608	Ga0307413_10123215
3609	Ga0307413_10144998
3610	Ga0307413_10218949
3611	Ga0307410_10015095
3612	Ga0307410_10022754
3613	Ga0307410_10058477
3614	Ga0307410_10142513
3615	Ga0307406_10007418
3616	Ga0307406_10018163
3617	Ga0307406_10058472
3618	Ga0307406_10083468
3619	Ga0307406_10086704
3620	Ga0307406_10098513
3621	Ga0307407_10003636
3622	Ga0307407_10048132
3623	Ga0307412_10147349
3624	Ga0307409_100000732
3625	Ga0307409_100056073
3626	Ga0307409_100080605
3627	Ga0307409_100091404
3628	Ga0307416_100035612
3629	Ga0307416_100071096
3630	Ga0307416_100073357
3631	Ga0307414_10008201
3632	Ga0307414_10049423
3633	Ga0307414_10059649
3634	Ga0307414_10074968
3635	Ga0307414_10077203
3636	Ga0307414_10107686
3637	Ga0307414_10108878
3638	Ga0307414_10175296
3639	Ga0307414_10245636
3640	Ga0307414_10309415
3641	Ga0307414_10463390
3642	Ga0307411_10001016
3643	Ga0307411_10012786
3644	Ga0307411_10235981
3645	Ga0307411_10259440
3646	Ga0307415_100009622
3647	Ga0307415_100112633
3648	Ga0307415_100219485
3649	Ga0316583_10003257
3650	Ga0316583_10007471
3651	Ga0316585_10000533
3652	Ga0316585_10004220
3653	Ga0316585_10025372
3654	Ga0316580_10000173
3655	Ga0316593_10000597
3656	Ga0316593_10003204
3657	Ga0316593_10031255
3658	Ga0316593_10035202
3659	Ga0373926_0005667
3660	Ga0373932_0041024
3661	Ga0373956_0028701
3662	Ga0373946_0017116
3663	Ga0316574_0001355
3664	Ga0316574_0003909
3665	Ga0316574_0004949
3666	Ga0316574_0008403
3667	Ga0316574_0009069
3668	Ga0316574_0010536
3669	Ga0316574_0012253
3670	Ga0316574_0015345
3671	Ga0316574_0016881
3672	Ga0316574_0019082
3673	Ga0316574_0020157
3674	Ga0316574_0053937
3675	Ga0316574_0055368
3676	Ga0373931_0026984
3677	Ga0373927_0000001
3678	Ga0373927_0000497
3679	Ga0373933_0023786
3680	Ga0373933_0117258
3681	Ga0373937_0021774
3682	Ga0373937_0026796
3683	Ga0373937_0124512
3684	Ga0373937_0165534
3685	Ga0373937_0264512
3686	Ga0316582_0001233
3687	Ga0316582_0001903
3688	Ga0316582_0005900
3689	Ga0316582_0011958
3690	Ga0316582_0020379
3691	Ga0316582_0025140
3692	Ga0316582_0028240
3693	Ga0316582_0050463
3694	Ga0316582_0116443
3695	Ga0316582_0212138
3696	Ga0316582_0233157
3697	Ga0316584_0007781
3698	Ga0316584_0008226
3699	Ga0316584_0010288
3700	Ga0316584_0011067
3701	Ga0316584_0012611
3702	Ga0316584_0014632
3703	Ga0316584_0015152
3704	Ga0316584_0032840
3705	Ga0316584_0037482
3706	Ga0316584_0074587
3707	Ga0316584_0096406
3708	Ga0316584_0099737
3709	Ga0316584_0169501
3710	Ga0316584_0178465
3711	Ga0373925_0001873
3712	Ga0373925_0059430
3713	Ga0373925_0267982
3714	Ga0395899_0000081
3715	Ga0395899_0005214
3716	Ga0395899_0014609
3717	Ga0395899_0018037
3718	Ga0395899_0067968
3719	Ga0395900_0000024
3720	Ga0395900_0006880
3721	Ga0395900_0017919
3722	Ga0395900_0020257
3723	Ga0395900_0041563
3724	Ga0395900_0077135
3725	Ga0395900_0087119
3726	Ga0395900_0124560
3727	Ga0395900_0174301
3728	Ga0395900_0238896
3729	Ga0395898_0000044
3730	Ga0395898_0000132
3731	Ga0395898_0072784
3732	Ga0395898_0110601
3733	Ga0395898_0131980
3734	Ga0395898_0151247
3735	Ga0395905_0000436
3736	Ga0395905_0004628
3737	Ga0395905_0029306
3738	Ga0395905_0129243
3739	Ga0395905_0199430
3740	Ga0316581_0001082
3741	Ga0316581_0006262
3742	Ga0316581_0039891
3743	Ga0436364_0446012
3744	Ga0436364_0449818
3745	Ga0436364_0628810
3746	Ga0436364_0710305
3747	Ga0436364_0931849
3748	Ga0436364_1175804
3749	Ga0436364_1238290
3750	Ga0395901_0013273
3751	Ga0395901_0024951
3752	Ga0395901_0073303
3753	Ga0395901_0137225
3754	Ga0395901_0302237
3755	Ga0237819_00853
3756	Ga0237819_01136
3757	Ga0237819_05564
3758	Ga0400484_09238
3759	Ga0400484_42261
3760	Ga0400490_10834
3761	Ga0400488_02598
3762	Ga0400488_59213
3763	Ga0400483_046648
3764	Ga0400483_048940
3765	Ga0400483_088143
3766	Ga0400483_218937
3767	Ga0400483_224464
3768	Ga0400483_253768
3769	Ga0400483_290698
3770	Ga0400487_22360
3771	Ga0237816_00761
3772	Ga0436365_0215846
3773	Ga0436365_0360171
3774	Ga0436365_0462933
3775	Ga0436365_1119503
3776	Ga0436365_1322600
3777	Ga0436365_1430109
3778	Ga0436365_1713844
3779	Ga0436361_0029807
3780	Ga0436361_0193594
3781	Ga0436361_0297903
3782	Ga0436361_0446792
3783	Ga0436361_0729555
3784	Ga0436363_0375975
3785	Ga0436363_1415861
3786	Ga0436362_0336022
3787	Ga0436362_0423328
3788	Ga0436362_0791946
3789	Ga0439436_0001140
3790	Ga0439436_0004285
3791	Ga0439438_000003
3792	Ga0439438_000957
3793	Ga0439438_018033
3794	Ga0439447_000887
3795	Ga0439447_001393
3796	Ga0439447_003845
3797	Ga0439466_0000002
3798	Ga0451793_1857627
3799	Ga0451797_0274168
3800	Ga0451797_0912495
3801	Ga0451800_0576752
3802	Ga0451806_279283
3803	Ga0451804_0115246
3804	Ga0451807_0585596
3805	Ga0451807_0634797
3806	Ga0451837_0582815
3807	Ga0451843_0365125
3808	Ga0439448_0010077
3809	Ga0439432_001994
3810	Ga0439432_005988
3811	Ga0439432_010887
3812	Ga0439432_027591
3813	Ga0439449_0001853
3814	Ga0439449_0006794
3815	Ga0439449_0038361
3816	Ga0439452_000004
3817	Ga0439456_000447
3818	Ga0439456_015545
3819	Ga0439462_0022880
3820	Ga0439463_000398
3821	Ga0439463_009060
3822	Ga0450911_000023
3823	Ga0450902_000375
3824	Ga0450904_000874
3825	Ga0450907_000111
3826	Ga0450907_001439
3827	Ga0439446_0003799
3828	Ga0439435_0005080
3829	Ga0439460_0021660
3830	Ga0451577_0008930
3831	Ga0451577_0113445
3832	Ga0451577_0239325
3833	Ga0451577_0361447
3834	Ga0466969_0000960
3835	Ga0466969_0014103
3836	Ga0466969_0015224
3837	Ga0466972_0006413
3838	Ga0453683_0000017
3839	Ga0453683_0008072
3840	Ga0466965_0001344
3841	Ga0466966_0005086
3842	Ga0466966_0029397
3843	Ga0466961_0005884
3844	Ga0466961_0019003
3845	Ga0466964_0006646
3846	Ga0466964_0014639
3847	Ga0466964_0076182
3848	Ga0453684_0000316
3849	Ga0453684_0001076
3850	Ga0453684_0006694
3851	Ga0453684_0010490
3852	Ga0453684_0058656
3853	Ga0453684_0065068
3854	Ga0453684_0114270
3855	Ga0453684_0149461
3856	Ga0453684_0179861
3857	Ga0453684_0206048
3858	Ga0453684_0214640
3859	Ga0453684_0308949
3860	Ga0453684_0333312
3861	Ga0466971_0000025
3862	Ga0466971_0001123
3863	Ga0466971_0006335
3864	Ga0466971_0028919
3865	Ga0466968_0033961
3866	Ga0466970_0012472
3867	Ga0466970_0072443
3868	Ga0466957_0034917
3869	Ga0466957_0036876
3870	Ga0466957_0042287
3871	Ga0466959_0000254
3872	Ga0466959_0009961
3873	Ga0466959_0010127
3874	Ga0466959_0019425
3875	Ga0466959_0031054
3876	Ga0466959_0135231
3877	Ga0451576_0000001
3878	Ga0451576_0000128
3879	Ga0451576_0000197
3880	Ga0451576_0000267
3881	Ga0451576_0002564
3882	Ga0451576_0037311
3883	Ga0451576_0062608
3884	Ga0451576_0189878
3885	Ga0451576_0302931
3886	Ga0451576_0351318
3887	Ga0466958_0004333
3888	Ga0466958_0056097
3889	Ga0466967_0196446
3890	Ga0495627_014099
3891	Ga0495590_0007330
3892	Ga0495591_000015
3893	Ga0495591_000024
3894	Ga0495591_001361
3895	Ga0495591_002424
3896	Ga0495591_008674
3897	Ga0495638_0001599
3898	Ga0495638_0001921
3899	Ga0495651_0089801
3900	Ga0495650_0000004
3901	Ga0495650_0000996
3902	Ga0495650_0018564
3903	Ga0495580_0027978
3904	Ga0495605_0000016
3905	Ga0495605_0001211
3906	Ga0495605_0001789
3907	Ga0495605_0007714
3908	Ga0495584_0008633
3909	Ga0495585_0007984
3910	Ga0495585_0008051
3911	Ga0495585_0029967
3912	Ga0495594_0003833
3913	Ga0495607_0003388
3914	Ga0495607_0036069
3915	Ga0495583_0000041
3916	Ga0495583_0013842
3917	Ga0495606_0000055
3918	Ga0495606_0002112
3919	Ga0495606_0004870
3920	Ga0495606_0050711
3921	Ga0495606_0058513
3922	Ga0495610_0007818
3923	Ga0495616_0004336
3924	Ga0495616_0018499
3925	Ga0495620_0000036
3926	Ga0495620_0000096
3927	Ga0495630_0058022
3928	Ga0495631_0008755
3929	Ga0495631_0080790
3930	Ga0495632_0004195
3931	Ga0495632_0006259
3932	Ga0495632_0009644
3933	Ga0495632_0134329
3934	Ga0495637_0002121
3935	Ga0495637_0011137
3936	Ga0495643_0001220
3937	Ga0495643_0002614
3938	Ga0495643_0003424
3939	Ga0495643_0012187
3940	Ga0495648_0002757
3941	Ga0495648_0007675
3942	Ga0495663_0006190
3943	Ga0495666_0024844
3944	Ga0495642_0001778
3945	Ga0495654_0000061
3946	Ga0495654_0001071
3947	Ga0495654_0001795
3948	Ga0495586_0018760
3949	Ga0495587_0007346
3950	Ga0495609_0000015
3951	Ga0495609_0000050
3952	Ga0495609_0000787
3953	Ga0495621_0002387
3954	Ga0495633_0000666
3955	Ga0495633_0022173
3956	Ga0495668_0000926
3957	Ga0495668_0017507
3958	Ga0495668_0049562
3959	Ga0495668_0057426
3960	Ga0495611_0001219
3961	Ga0495625_0000055
3962	Ga0495625_0000997
3963	Ga0495625_0114678
3964	Ga0495661_0000046
3965	Ga0495661_0000999
3966	Ga0495661_0001737
3967	Ga0495646_0019706
3968	Ga0495670_0002525
3969	Ga0495671_0001579
3970	Ga0495671_0005560
3971	Ga0495671_0005704
3972	Ga0495649_0003070
3973	Ga0495649_0005236
3974	Ga0495660_0000013
3975	Ga0495660_0001675
3976	Ga0495660_0011114
3977	Ga0495660_0011142
3978	Ga0495660_0082901
3979	Ga0495636_0002626
3980	Ga0495672_0000054
3981	Ga0495676_0000013
3982	Ga0495683_0000107
3983	Ga0495683_0000612
3984	Ga0495687_070996
3985	Ga0495679_000583
3986	Ga0495679_001076
3987	Ga0495679_051065
3988	Ga0495673_0006729
3989	Ga0495673_0009305
3990	Ga0495681_0027092
3991	Ga0495686_0000126
3992	Ga0495686_0025768
3993	Ga0495626_0000252
3994	Ga0495626_0001991
3995	Ga0496100_0194960
3996	Ga0496101_0000123
3997	Ga0496102_0008331
3998	Ga0496102_0035275
3999	Ga0496104_0003637
4000	Ga0496105_0002281
4001	Ga0496106_0033192
4002	Ga0496107_0065876
4003	Ga0496107_0121246
4004	Ga0496109_0069283
4005	Ga0496109_0088307
4006	Ga0496110_0001169
4007	Ga0496110_0010163
4008	Ga0496110_0191030
4009	Ga0496112_0009376
4010	Ga0496112_0355329
4011	Ga0496113_0025722
4012	Ga0496113_0175771
4013	Ga0496114_0116384
4014	Ga0496115_0250572
4015	Ga0496116_0000016
4016	Ga0496116_0000217
4017	Ga0496116_0000853
4018	Ga0496116_0016682
4019	Ga0496116_0140720
4020	Ga0496117_0000103
4021	Ga0496117_0001101
4022	Ga0496117_0002635
4023	Ga0496117_0003640
4024	Ga0496117_0004927
4025	Ga0496117_0005782
4026	Ga0496117_0006937
4027	Ga0496117_0010366
4028	Ga0496118_0000046
4029	Ga0496118_0001287
4030	Ga0496118_0001472
4031	Ga0496118_0001602
4032	Ga0496118_0002338
4033	Ga0496118_0002527
4034	Ga0496118_0004158
4035	Ga0496118_0005467
4036	Ga0496118_0006224
4037	Ga0496118_0011208
4038	Ga0496118_0023789
4039	Ga0496118_0074390
4040	Ga0496118_0084926
4041	Ga0496118_0124711
4042	Ga0496119_0000097
4043	Ga0496119_0000270
4044	Ga0496119_0000327
4045	Ga0496119_0000903
4046	Ga0496119_0001231
4047	Ga0496119_0027547
4048	Ga0496119_0028186
4049	Ga0496120_0000344
4050	Ga0496120_0000361
4051	Ga0496120_0000817
4052	Ga0496120_0000919
4053	Ga0496120_0001157
4054	Ga0496120_0002596
4055	Ga0496120_0002705
4056	Ga0496121_0000108
4057	Ga0496121_0000336
4058	Ga0496121_0001734
4059	Ga0496121_0003708
4060	Ga0496121_0008873
4061	Ga0496121_0277346
4062	Ga0496122_0000125
4063	Ga0496122_0001411
4064	Ga0496122_0002627
4065	Ga0496122_0003313
4066	Ga0496122_0004502
4067	Ga0496122_0010124
4068	Ga0496122_0018465
4069	Ga0496122_0035406
4070	Ga0496122_0054091
4071	Ga0496122_0091432
4072	Ga0496122_0115309
4073	Ga0496123_0000092
4074	Ga0496123_0000868
4075	Ga0496123_0001488
4076	Ga0496123_0002023
4077	Ga0496123_0003459
4078	Ga0496123_0004449
4079	Ga0496123_0004815
4080	Ga0496123_0012046
4081	Ga0496123_0071420
4082	Ga0496123_0139733
4083	Ga0496124_0000001
4084	Ga0496124_0000034
4085	Ga0496124_0000286
4086	Ga0496124_0001111
4087	Ga0496124_0004469
4088	Ga0496124_0005234
4089	Ga0496124_0007498
4090	Ga0496124_0009621
4091	Ga0496124_0012070
4092	Ga0496124_0012814
4093	Ga0496124_0030752
4094	Ga0496124_0065399
4095	Ga0496124_0210252
4096	Ga0496125_0000180
4097	Ga0496125_0000456
4098	Ga0496125_0001375
4099	Ga0496125_0007506
4100	Ga0496125_0010132
4101	Ga0496125_0090381
4102	Ga0496125_0112703
4103	Ga0496126_0000109
4104	Ga0496126_0049366
4105	Ga0496126_0061950
4106	Ga0496126_0093269
4107	Ga0496126_0336398
4108	Ga0495678_000356
4109	Ga0495678_000821
4110	Ga0495678_026233
4111	Ga0501031_0001928
4112	Ga0501031_0003884
4113	Ga0501031_0026127
4114	Ga0501031_0026823
4115	Ga0501031_0056001
4116	Ga0501031_0059224
4117	Ga0501031_0060680
4118	Ga0501032_0017448
4119	Ga0501032_0023646
4120	Ga0501032_0027325
4121	Ga0501032_0040956
4122	Ga0501033_0002131
4123	Ga0501033_0004203
4124	Ga0501033_0004641
4125	Ga0501033_0021783
4126	Ga0501034_0000780
4127	Ga0501034_0002028
4128	Ga0501034_0002718
4129	Ga0501034_0019841
4130	Ga0501034_0061650
4131	Ga0501034_0069596
4132	Ga0501034_0072204
4133	Ga0501034_0088653
4134	Ga0501034_0094219
4135	Ga0501034_0119324
4136	Ga0501034_0139091
4137	Ga0501034_0143386
4138	Ga0501034_0280222
4139	Ga0501036_0045302
4140	Ga0501036_0130202
4141	Ga0501036_0271631
4142	Ga0501036_0346602
4143	Ga0501037_0013917
4144	Ga0501037_0014753
4145	Ga0501037_0021480
4146	Ga0501037_0021687
4147	Ga0501037_0084965
4148	Ga0501037_0085558
4149	Ga0501038_0013831
4150	Ga0501038_0020608
4151	Ga0501038_0053738
4152	Ga0501038_0061388
4153	Ga0501038_0090856
4154	Ga0501038_0119621
4155	Ga0501038_0137428
4156	Ga0501039_0003639
4157	Ga0501039_0015461
4158	Ga0501040_0079039
4159	Ga0501042_0063806
4160	Ga0501043_0026366
4161	Ga0501043_0044858
4162	Ga0501043_0091792
4163	Ga0501046_0000887
4164	Ga0501046_0019540
4165	Ga0501046_0052897
4166	Ga0501046_0068967
4167	Ga0501046_0192290
4168	Ga0501047_0004850
4169	Ga0501047_0006976
4170	Ga0501047_0010595
4171	Ga0501047_0037984
4172	Ga0501047_0057143
4173	Ga0501047_0070411
4174	Ga0501047_0081969
4175	Ga0501047_0083271
4176	Ga0501047_0084241
4177	Ga0501047_0105254
4178	Ga0501048_0004712
4179	Ga0501048_0008578
4180	Ga0501048_0014302
4181	Ga0501048_0016041
4182	Ga0501048_0026121
4183	Ga0501048_0054663
4184	Ga0501067_0002380
4185	Ga0501068_0000804
4186	Ga0501068_0012099
4187	Ga0501068_0067587
4188	Ga0501069_0000354
4189	Ga0501069_0001062
4190	Ga0501069_0006208
4191	Ga0501069_0033897
4192	Ga0501069_0090892
4193	Ga0501070_0000990
4194	Ga0501070_0004430
4195	Ga0501070_0007491
4196	Ga0501070_0013082
4197	Ga0501070_0021125
4198	Ga0501070_0024668
4199	Ga0501070_0040551
4200	Ga0501070_0046097
4201	Ga0501070_0046820
4202	Ga0501070_0049038
4203	Ga0501070_0049222
4204	Ga0501070_0110323
4205	Ga0501070_0206375
4206	Ga0501071_0004529
4207	Ga0501071_0013045
4208	Ga0501071_0061223
4209	Ga0501071_0145181
4210	Ga0501072_0038005
4211	Ga0501072_0068381
4212	Ga0501072_0190549
4213	Ga0501073_0004569
4214	Ga0501073_0010589
4215	Ga0501073_0012255
4216	Ga0501073_0013106
4217	Ga0501073_0021785
4218	Ga0501073_0063958
4219	Ga0501073_0100341
4220	Ga0501073_0102191
4221	Ga0501074_0003873
4222	Ga0501074_0005572
4223	Ga0501074_0007187
4224	Ga0501074_0018474
4225	Ga0501074_0021283
4226	Ga0501075_0249566
4227	Ga0501076_0002639
4228	Ga0501076_0006262
4229	Ga0501076_0073576
4230	Ga0501076_0150280
4231	Ga0501077_0009733
4232	Ga0501077_0013950
4233	Ga0501077_0084306
4234	Ga0501243_010447
4235	Ga0501079_0001458
4236	Ga0501079_0043135
4237	Ga0501079_0043783
4238	Ga0501080_0002386
4239	Ga0501080_0004525
4240	Ga0501080_0010807
4241	Ga0501080_0011052
4242	Ga0501080_0017094
4243	Ga0501080_0033502
4244	Ga0501080_0088983
4245	Ga0501080_0101265
4246	Ga0501080_0139114
4247	Ga0501080_0145729
4248	Ga0501081_0000145
4249	Ga0501081_0051600
4250	Ga0501083_0039664
4251	Ga0501083_0081510
4252	Ga0501083_0091870
4253	Ga0501266_004803
4254	Ga0501270_008187
4255	Ga0501035_0003258
4256	Ga0501035_0012330
4257	Ga0501035_0016032
4258	Ga0501035_0020825
4259	Ga0501035_0023801
4260	Ga0501035_0025236
4261	Ga0501035_0089582
4262	Ga0501035_0123869
4263	Ga0501044_0000616
4264	Ga0501044_0010612
4265	Ga0501044_0012277
4266	Ga0501044_0018645
4267	Ga0501044_0037769
4268	Ga0501044_0040009
4269	Ga0501044_0062561
4270	Ga0501044_0077028
4271	Ga0501044_0096030
4272	Ga0501044_0110989
4273	Ga0501044_0134824
4274	Ga0501044_0157408
4275	Ga0501044_0292483
4276	Ga0501045_0004342
4277	Ga0501045_0031114
4278	Ga0501226_000002
4279	nmdc:mga03n38_73_c1
4280	nmdc:mga00v17_12359_c1
4281	nmdc:mga00v17_1321_c1
4282	nmdc:mga00v17_395_c1
4283	nmdc:mga0yw44_23072_c1
4284	nmdc:mga0yw44_463_c1
4285	nmdc:mga0yw44_8890_c1
4286	nmdc:mga0k408_361_c1
4287	nmdc:mga06z11_314_c1
4288	nmdc:mga04h51_4950_c1
4289	nmdc:mga07m45_325_c1
4290	nmdc:mga05p37_17603_c1
4291	nmdc:mga05p37_58418_c1
4292	nmdc:mga09592_1438_c1
4293	nmdc:mga09592_185104_c1
4294	nmdc:mga09592_21437_c1
4295	nmdc:mga09592_6886_c1
4296	nmdc:mga09592_72509_c1
4297	nmdc:mga0qj67_30230_c1
4298	nmdc:mga0qj67_82644_c1
4299	nmdc:mga06r32_10406_c1
4300	nmdc:mga06r32_19976_c1
4301	nmdc:mga06r32_53688_c1
4302	nmdc:mga06r32_54314_c1
4303	nmdc:mga06r32_77008_c1
4304	nmdc:mga08y16_198819_c1
4305	nmdc:mga0n895_169384_c1
4306	nmdc:mga0rr50_142_c1
4307	nmdc:mga0rr50_228970_c1
4308	nmdc:mga0rr50_249339_c1
4309	nmdc:mga08x19_3010_c1
4310	nmdc:mga08x19_326_c1
4311	nmdc:mga08x19_66_c1
4312	nmdc:mga0sz30_92_c1
4313	Ga0495655_0000345
4314	Ga0500644_0000001
4315	Ga0500644_0034622
4316	Ga0500651_0000068
4317	Ga0500651_0005207
4318	Ga0500651_0006676
4319	Ga0500641_0000347
4320	Ga0500641_0030699
4321	Ga0500641_0085498
4322	Ga0500650_0000010
4323	Ga0500650_0000078
4324	Ga0500555_004274
4325	Ga0500555_009548
4326	Ga0500556_0000070
4327	Ga0500556_0000589
4328	Ga0500556_0040363
4329	Ga0500642_0004023
4330	Ga0500658_0016421
4331	Ga0500658_0079220
4332	Ga0500564_020508
4333	Ga0500568_0061386
4334	Ga0500577_0000002
4335	Ga0500588_0000238
4336	Ga0500588_0003558
4337	Ga0500604_0000965
4338	Ga0500604_0010434
4339	Ga0500616_0000018
4340	Ga0500616_0046177
4341	Ga0500622_0001827
4342	Ga0500622_0002455
4343	Ga0500622_0004386
4344	Ga0500634_0000078
4345	Ga0500656_005986
4346	Ga0501084_0009286
4347	Ga0501084_0059793
4348	Ga0501084_0072915
4349	Ga0501084_0356450
4350	Ga0590071_014679
4351	Ga0501082_0008551
4352	Ga0501082_0018568
4353	Ga0501082_0048132
4354	Ga0501082_0074924
4355	Ga0466962_0000153
4356	Ga0466962_0017208
4357	Ga0466962_0018947
4358	Ga0466962_0030318
4359	Ga0466962_0056429
4360	Ga0530510_0127686
4361	2510283924
4362	2510293403
4363	2510312895
4364	2511256916
4365	2511266945
4366	2511272936
4367	2511275918
4368	2511291206
4369	2511293785
4370	2511300546
4371	2511315520
4372	2511320352
4373	2511323581
4374	2511330738
4375	2511336816
4376	2511342594
4377	2511348096
4378	2511357059
4379	2511363194
4380	2511369738
4381	2511376744
4382	2511381848
4383	2511414931
4384	2511434640
4385	2511826779
4386	2512324372
4387	2513590289
4388	2538427885
4389	2554817262
4390	2555245212
4391	2555671983
4392	2572254804
4393	2578459669
4394	2583794478
4395	2585827826
4396	2585830839
4397	2595447435
4398	2595450203
4399	2597860063
4400	2597862200
4401	2597867923
4402	2599329655
4403	2599353853
4404	2599360469
4405	2599366791
4406	2599373580
4407	2599378961
4408	2599386061
4409	2599392439
4410	2599397197
4411	2599404205
4412	2599449192
4413	2599460687
4414	2599470233
4415	2599482902
4416	2599489708
4417	2599502868
4418	2599508114
4419	2599511066
4420	2599519442
4421	2599615104
4422	2599771301
4423	2599803394
4424	2599879533
4425	2599885927
4426	2599890440
4427	2599897641
4428	2599928207
4429	2599930105
4430	2599945369
4431	2599948032
4432	2599955641
4433	2599961009
4434	2599969333
4435	2599973371
4436	2599980674
4437	2599985754
4438	2599990648
4439	2599995966
4440	2600001966
4441	2600005693
4442	2600014490
4443	2600019061
4444	2600025538
4445	2600027846
4446	2600033436
4447	2600040278
4448	2600049353
4449	2600055758
4450	2600061619
4451	2600064238
4452	2600073478
4453	2600077313
4454	2600213301
4455	2600357013
4456	2600365334
4457	2600443491
4458	2601625896
4459	2601690796
4460	2601773468
4461	2601799716
4462	2602009055
4463	2606074099
4464	2606126256
4465	2608382949
4466	2608670463
4467	2621301655
4468	2624482644
4469	2624490291
4470	2643841994
4471	2643869017
4472	2643905331
4473	2643910583
4474	2643915011
4475	2643938511
4476	2643955404
4477	2643962936
4478	2643973033
4479	2644023756
4480	2644079163
4481	2644185901
4482	2644285791
4483	2644530537
4484	2644623884
4485	2644661368
4486	2644693939
4487	2644699448
4488	2650900136
4489	2652545185
4490	2671089736
4491	2671096432
4492	2671106439
4493	2671125632
4494	2671771038
4495	2677897538
4496	2678265149
4497	2686354376
4498	2687578442
4499	2687584401
4500	2707098298
4501	2715752028
4502	2715755342
4503	2718635856
4504	2721025935
4505	2723247092
4506	2735834101
4507	2738672708
4508	2738689582
4509	2738715964
4510	2738751101
4511	2738808991
4512	2738860142
4513	2738896351
4514	2739196505
4515	2739225511
4516	2739257480
4517	2739265356
4518	2739289281
4519	2739294593
4520	2739314490
4521	2743739597
4522	2745005605
4523	2747950875
4524	2748019239
4525	2765577637
4526	2765585834
4527	2774122102
4528	2774131865
4529	2774133525
4530	2784262588
4531	2784314347
4532	2794595548
4533	2807410025
4534	2807458372
4535	2808855834
4536	2808905161
4537	2808921958
4538	2808933345
4539	2808935915
4540	2808942322
4541	2808944079
4542	2808955473
4543	2808959693
4544	2808964293
4545	2808975129
4546	2808991232
4547	2808999181
4548	2809124336
4549	2809218550
4550	2812368541
4551	2816519414
4552	2817488981
4553	2819566031
4554	2819654253
4555	2819662609
4556	2819701525
4557	2823425101
4558	2825655955
4559	2826585547
4560	2834028888
4561	2834580869
4562	2842392640
4563	2842759594
4564	2842809207
4565	2842818193
4566	2842830011
4567	2842837499
4568	2842839010
4569	2842845283
4570	2842853105
4571	2842856359
4572	2842917834
4573	2842920513
4574	2844532536
4575	2844666148
4576	2846543058
4577	2847801227
4578	2852106236
4579	2852615620
4580	2852652962
4581	2852660611
4582	2852670588
4583	2852687656
4584	2854602944
4585	2855197019
4586	2857444454
4587	2858469622
4588	2860344513
4589	2860868923
4590	2865018226
4591	2871273617
4592	2871284566
4593	2874224494
4594	2876605681
4595	2878034574
4596	2880235221
4597	2881610920
4598	2881715887
4599	2884342077
4600	2894417862
4601	2895499482
4602	2895512504
4603	2895522515
4604	2895525719
4605	2900053652
4606	2904466302
4607	2904474416
4608	2904521594
4609	2904552998
4610	2908447669
4611	2912968123
4612	2913041758
4613	2916179913
4614	2917075855
4615	2917833808
4616	2919069565
4617	2919086040
4618	2919091508
4619	2919128131
4620	2919132177
4621	2919135081
4622	2919150762
4623	2919156638
4624	2919388642
4625	2919406752
4626	2919459625
4627	2919484699
4628	2919490037
4629	2919501818
4630	2919514967
4631	2919676410
4632	2919692093
4633	2919703745
4634	2923158683
4635	2923517443
4636	2923522599
4637	2923590403
4638	2926063491
4639	2927145636
4640	2928498839
4641	2929149076
4642	2929190916
4643	2929199085
4644	2931373501
4645	2931382100
4646	2931391903
4647	2931397283
4648	2935356841
4649	2937611139
4650	2939592534
4651	2939605210
4652	2939624869
4653	2939628786
4654	2939636975
4655	2939652599
4656	2941474088
4657	2941477418
4658	2941492282
4659	2945929664
4660	2945954267
4661	2945965915
4662	2946011950
4663	2946029161
4664	2947235709
4665	2953995797
4666	2961051258
4667	2961065545
4668	2969309370
4669	2974289271
4670	2974301294
4671	2974310110
4672	2977250844
4673	2978976751
4674	2984287486
4675	2984498054
4676	2984503771
4677	2984507647
4678	2984514669
4679	2987608083
4680	2988730679
4681	2990264432
4682	2995949948
4683	2998144631
4684	3007254066
4685	3007317195
4686	3007398314
4687	3007420567
4688	3007516395
4689	3007615679
4690	3007622754
4691	3007723959
4692	3007858386
4693	3007866098
4694	3007867581
4695	3007873285
4696	637322399
4697	640487037
4698	651174909
4699	8001525632
4700	8002871204
4701	8003015210
4702	8015559717
4703	8015692769
4704	8016730213
4705	8016737210
4706	8019502411
4707	8019773639
4708	8019782080
4709	8021622608
4710	8021627552
4711	8021650245
4712	8029996248
4713	8034963075
4714	8052495568
4715	8054290112
4716	8054352673
4717	8054358682
4718	8054504500
4719	8054933097
4720	8055697519
4721	8055776003
4722	8055818930
4723	8055883793
4724	8056117270
4725	8056125028
4726	8056130873
4727	8056132821
4728	8056138419
4729	8056144313
4730	8056149014
4731	8056155652
4732	8056161320
4733	8056171925
4734	8056172606
4735	8056179763
4736	8056574425
4737	8057162014
4738	8057804887

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10555

MraY_sig1

Phospho-N-acetylmuramoyl-pentapeptide-transferase signature 1

104

116

0.91 PF00953

Glycos_transf_4

Glycosyl transferase family 4

134

321

0.9 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
8cxr-assembly4.cif.gz_D	crystal structure of mray bound to a sphaerimicin analogue	0.9841	24	358
8cxr-assembly1.cif.gz_A	crystal structure of mray bound to a sphaerimicin analogue	0.9825	25	358
6oyz-assembly1.cif.gz_A	crystal structure of mray bound to capuramycin	0.9811	25	358
6oyz-assembly2.cif.gz_C	crystal structure of mray bound to capuramycin	0.9791	25	358
8cxr-assembly4.cif.gz_D	crystal structure of mray bound to a sphaerimicin analogue	0.9744	24	358

ID	Description	Score	Start	End	Superfamily
af_A4I8T7_15_628_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.364	137	260	1.20.1250.20
af_H2KZD1_54_276_1.20.144.10	Mainly Alpha;Up-down Bundle;Vanadium-containing Chloroperoxidase; domain 1;Phosphatidic acid phosphatase type 2/haloperoxidase	0.3256	135	287	1.20.144.10
af_Q8WSV6_55_300_1.20.1260.140	Mainly Alpha;Up-down Bundle;Ferritin;Alternative oxidase	0.3235	143	358	1.20.1260.140
af_Q9Y115_49_173_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.3232	174	339	1.20.1250.20
af_Q9Y115_49_173_1.20.1250.20	Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains	0.3147	174	339	1.20.1250.20

ID	Description	Score	Start	End	GO Terms
AF-A0A7Y8RU87-F1-model_v4	Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13)	0.9988	74	249	GO:0005886 GO:0008360 GO:0008963 GO:0009252 GO:0046872 GO:0051301 GO:0051992 GO:0071555
AF-A0A3S1VV32-F1-model_v4	deleted	0.9976	191	343
AF-A0A661FIK3-F1-model_v4	Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13)	0.9969	69	360	GO:0005886 GO:0008360 GO:0008963 GO:0009252 GO:0046872 GO:0051301 GO:0051992 GO:0071555
AF-A0A1F6SX96-F1-model_v4	Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13)	0.9961	74	360	GO:0005886 GO:0008360 GO:0008963 GO:0009252 GO:0046872 GO:0051301 GO:0071555
AF-A0A1X0N8X3-F1-model_v4	Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13)	0.9957	209	360	GO:0005886 GO:0008360 GO:0008963 GO:0009252 GO:0046872 GO:0051301 GO:0071555

F496744

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF10555

MraY_sig1

Phospho-N-acetylmuramoyl-pentapeptide-transferase signature 1

104

116

0.91

PF00953

Glycos_transf_4

Glycosyl transferase family 4

134

321

0.9

Structural Annotation

Top 5 Hits

Map