metagRoot

F496745

General Info

Members	Datasets	Scaffolds	Average Seq Length
2369	826	4738	275

Family's Representative Sequence

Representative Sequence	3300041512\|Ga0451853_0782180\|Ga0451853_0782180_287_1123
Length	259
Sequence	MSRPANPVTLPLAQYVPVHFLLAVADGVATVTLNRPERKNPLTFESYRELTDFFRACAFDDEVKTVVVTGAGGNFSSGGDVFEIIGPLVKMDTKGLTAFTRMTGDLVKAMRACPQPIVAAVGGICAKVAFLFNKVGLAGCDMGACAILPRIIGQSRASELLYTGRFMTAEEGERWGFFSRIVAPDQVLSEAQALARQVTEGPTFANTMTKRMLAMEWAMSVEEAIEAEAVAQALCMTTADFARAFEAFSNKARPVFQGN

Samples

	Sample ID	Description	Type	Environment
1	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
2	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
3	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
4	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
5	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
6	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
7	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
8	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
9	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
10	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
11	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
12	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
13	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
14	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
15	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
16	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
17	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
18	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
19	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
20	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
21	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
22	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
23	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
24	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
25	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
26	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
27	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
28	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
29	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
30	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
31	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
32	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
33	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
34	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
35	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
36	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
37	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
38	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
39	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
40	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
41	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
42	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
43	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
44	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
45	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
46	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
47	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
48	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
49	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
50	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
51	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
52	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
53	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
54	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
55	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
56	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
57	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
58	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
59	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
60	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
61	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
62	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
63	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
64	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
65	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
66	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
67	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
68	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
69	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
70	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
71	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
72	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
73	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
74	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
75	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
76	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
77	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
78	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
79	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
80	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
81	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
82	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
83	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
84	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
85	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
86	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
87	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
88	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
89	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
90	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
91	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
92	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
93	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
94	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
95	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
96	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
97	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
98	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
99	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
100	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
101	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
102	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
103	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
104	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
105	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
106	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
107	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
108	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
109	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
110	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
111	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
112	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
113	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
114	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
115	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
116	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
117	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
118	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
119	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
120	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
121	3300006941	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW	Metagenome	Nodule
122	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
123	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
124	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
125	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
126	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
127	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
128	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
129	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
130	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
131	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
132	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
133	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
134	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
135	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
136	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
137	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
138	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
139	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
140	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
141	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
142	3300012507	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610	Metagenome	Rhizosphere
143	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
144	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
145	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
146	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
147	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
148	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
149	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
150	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
151	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
152	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
153	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
154	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
155	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
156	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
157	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
158	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
159	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
160	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
161	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
162	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
163	3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Metagenome	Nodule
164	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
165	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
166	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
167	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
168	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
169	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
170	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
171	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
172	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
173	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
174	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
175	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
176	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
177	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
178	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
179	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
180	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
181	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
182	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
183	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
184	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
185	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
186	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
187	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
188	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
189	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
190	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
191	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
192	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
257	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
258	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
259	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
260	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
261	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
264	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
266	3300028016	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1	Metagenome	Rhizosphere
267	3300028023	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5	Metagenome	Rhizosphere
268	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
270	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
271	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
272	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
273	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
274	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
275	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
276	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
277	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
278	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
279	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
280	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
281	3300030760	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
282	3300030878	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
283	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
284	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
285	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
286	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
287	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
288	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
289	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
290	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
291	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
292	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
293	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
294	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
295	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
296	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
297	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
298	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
299	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
300	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
301	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
302	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
303	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
304	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
305	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
306	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
307	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
308	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
309	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
310	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
311	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
312	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
313	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
314	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
315	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
316	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
317	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
318	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
319	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
320	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
321	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
322	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
323	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
324	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
325	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
326	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
327	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
328	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
329	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
330	3300036459	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
331	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
332	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
333	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
334	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
335	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
336	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
337	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
338	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
339	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
340	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
341	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
342	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
343	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
344	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
345	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
346	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
347	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
348	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
349	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
350	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
351	3300042124	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423	Metagenome	Rhizosphere
352	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
353	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
354	3300042142	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610	Metagenome	Rhizosphere
355	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
356	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
357	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
358	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
359	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
360	3300042530	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047	Metagenome	Rhizosphere
361	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
362	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
363	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
364	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
365	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
366	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
367	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
368	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
369	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
370	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
371	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
372	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
373	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
374	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
375	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
376	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
377	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
378	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
379	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
380	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
381	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
382	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
383	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
384	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
385	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
386	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
387	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
388	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
389	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
390	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
391	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
392	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
393	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
394	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
395	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
396	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
397	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
398	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
399	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
400	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
401	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
402	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
403	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
404	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
405	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
406	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
407	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
408	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
409	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
410	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
411	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
412	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
413	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
414	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
415	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
416	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
417	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
418	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
419	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
420	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
421	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
422	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
423	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
424	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
425	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
426	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
427	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
428	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
429	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
430	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
431	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
432	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
433	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
434	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
435	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
436	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
437	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
438	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
439	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
440	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
441	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
442	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
443	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
444	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
445	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
446	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
447	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
448	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
449	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
450	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
451	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
452	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
453	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
454	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
455	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
456	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
457	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
458	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
459	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
460	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
461	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
462	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
463	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
464	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
465	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
466	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
467	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
468	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
469	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
470	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
471	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
472	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
473	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
474	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
475	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
476	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
477	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
478	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
479	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
480	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
481	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
482	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
483	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
484	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
485	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
486	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
487	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
488	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
489	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
490	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
491	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
492	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
493	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
494	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
495	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
496	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
497	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
498	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
499	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
500	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
501	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
502	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
503	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
504	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
505	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
506	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
507	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
508	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
509	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
510	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
511	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
512	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
513	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
514	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
515	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
516	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
517	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
518	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
519	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
520	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
521	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
522	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
523	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
524	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
525	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
526	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
527	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
528	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
529	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
530	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
531	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
532	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
533	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
534	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
535	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
536	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
537	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
538	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
539	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
540	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
541	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
542	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
543	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
544	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
545	3300053095	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere	Metagenome	Endosphere
546	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
547	3300053099	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere	Metagenome	Endosphere
548	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
549	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
550	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
551	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
552	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
553	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
554	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
555	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
556	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
557	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
558	3300053128	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere	Metagenome	Endosphere
559	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
560	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
561	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
562	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
563	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
564	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
565	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
566	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
567	3300053145	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere	Metagenome	Endosphere
568	3300053147	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere	Metagenome	Endosphere
569	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
570	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
571	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
572	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
573	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
574	3300053159	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere	Metagenome	Endosphere
575	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
576	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
577	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
578	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
579	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
580	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
581	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
582	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
583	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
584	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
585	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
586	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
587	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
588	2507262055	Bradyrhizobium sp. WSM1417	Isolate	Nodule
589	2508501009	Bradyrhizobium sp. WSM471	Isolate	Nodule
590	2508501042	Bradyrhizobium sp. WSM1253	Isolate	Nodule
591	2508501050	Microvirga lupini Lut6	Isolate	Nodule
592	2508501114	Microvirga lotononidis WSM3557	Isolate	Nodule
593	2508501128	Bradyrhizobium sp. ARR65	Isolate	Nodule
594	2511231028	Bradyrhizobium sp. YR681	Isolate	Rhizosphere
595	2513237092	Bradyrhizobium sp. WSM1743	Isolate	Nodule
596	2513237094	Bradyrhizobium sp. WSM3983	Isolate	Nodule
597	2513237095	Bradyrhizobium diazoefficiens USDA 122	Isolate	Nodule
598	2513237101	Bradyrhizobium murdochi WSM1741	Isolate	Nodule
599	2513237102	Bradyrhizobium japonicum USDA 135	Isolate	Nodule
600	2513237104	Bradyrhizobium sp. EC3.3	Isolate	Nodule
601	2513237139	Bradyrhizobium ottawaense USDA 4	Isolate	Nodule
602	2513237141	Bradyrhizobium sp. TV2a.2	Isolate	Nodule
603	2513237161	Bradyrhizobium sp. WSM2793	Isolate	Nodule
604	2515154112	Bradyrhizobium sp. WSM4349	Isolate	Nodule
605	2517093001	Bradyrhizobium japonicum USDA 124	Isolate	Nodule
606	2524023205	Bradyrhizobium sp. Cp5.3	Isolate	Nodule
607	2528768022	Bradyrhizobium japonicum USDA 123	Isolate	Nodule
608	2547132374	Acidovorax radicis N35	Isolate	Unclassified
609	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
610	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
611	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
612	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
613	2602042107	Bradyrhizobium sp. NFR13	Isolate	Rhizoplane
614	2617270735	Bradyrhizobium shewense ERR11	Isolate	Nodule
615	2617270741	Bradyrhizobium yuanmingense CCBAU 10071	Isolate	Nodule
616	2643221570	Acidovorax sp. Root568	Isolate	Unclassified
617	2643221596	Acidovorax sp. Root70	Isolate	Unclassified
618	2643221611	Acidovorax sp. Root219	Isolate	Unclassified
619	2643221652	Acidovorax sp. Root402	Isolate	Unclassified
620	2643221654	Rhizobacter sp. Root404	Isolate	Unclassified
621	2643221717	Acidovorax sp. Root267	Isolate	Unclassified
622	2721755523	Delftia sp. HK171	Isolate	Unclassified
623	2721755755	Bradyrhizobium icense LMTR 13	Isolate	Nodule
624	2738541337	Pelomonas sp. BT06	Isolate	Unclassified
625	2744054633	Bradyrhizobium neotropicale BR 10247	Isolate	Unclassified
626	2773857925	Microvirga vignae BR3299	Isolate	Unclassified
627	2775506901	Microvirga ossetica V5/3m	Isolate	Unclassified
628	2791355196	Bradyrhizobium sp. Y36	Isolate	Nodule
629	2791355199
630	2802429603	Bradyrhizobium ottawaense L2	Isolate	Nodule
631	2816332527	Bradyrhizobium diazoefficiens Y21	Isolate	Nodule
632	2818991446	Variovorax sp. 1180	Isolate	Unclassified
633	2821443989	Inquilinus ginsengisoli 584	Isolate	Unclassified
634	2824600985	Bradyrhizobium sp.HAMBI 2135	Isolate	Unclassified
635	2824609381	Bradyrhizobium sp. HAMBI 2134	Isolate	Unclassified
636	2824617872	Bradyrhizobium sp. HAMBI 2133	Isolate	Unclassified
637	2824626560	Bradyrhizobium sp. HAMBI 2149	Isolate	Unclassified
638	2824635225	Bradyrhizobium sp. HAMBI 2136	Isolate	Unclassified
639	2824644064	Bradyrhizobium sp. HAMBI 2137	Isolate	Unclassified
640	2824653114	Bradyrhizobium sp. HAMBI 2142	Isolate	Unclassified
641	2824661429	Bradyrhizobium sp. HAMBI 2115	Isolate	Unclassified
642	2824671348	Bradyrhizobium sp. HAMBI 2125	Isolate	Unclassified
643	2824679649	Bradyrhizobium sp.HAMBI 2116	Isolate	Unclassified
644	2824687955	Bradyrhizobium sp. HAMBI 2126	Isolate	Unclassified
645	2824696289	Bradyrhizobium sp. HAMBI 2127	Isolate	Unclassified
646	2824704595	Bradyrhizobium sp. HAMBI 2150	Isolate	Unclassified
647	2824714736	Bradyrhizobium sp. HAMBI 2151	Isolate	Unclassified
648	2824723954	Bradyrhizobium sp. HAMBI 2152	Isolate	Unclassified
649	2824732956	Bradyrhizobium sp. HAMBI 2153	Isolate	Unclassified
650	2824746037	Bradyrhizobium sp. HAMBI 2299	Isolate	Unclassified
651	2824753945	Bradyrhizobium sp. HAMBI 2128	Isolate	Unclassified
652	2824763712	Bradyrhizobium sp. HAMBI 2129	Isolate	Unclassified
653	2824773399	Bradyrhizobium sp. HAMBI 2130	Isolate	Unclassified
654	2831265667	Variovorax guangxiensis DSM 27352	Isolate	Rhizosphere
655	2835312727	Microvirga calopogonii CCBAU 65841	Isolate	Nodule
656	2838054893	Variovorax guangxiensis 34/80	Isolate	Nodule
657	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
658	2841941048	Bradyrhizobium sp. SBR1B	Isolate	Nodule
659	2841949485	Bradyrhizobium sp. ERR14	Isolate	Nodule
660	2841957949	Bradyrhizobium sp. CIR1	Isolate	Nodule
661	2841966195	Bradyrhizobium sp. CIR18	Isolate	Nodule
662	2841974524	Bradyrhizobium sp. CIR48	Isolate	Nodule
663	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
664	2842038055	Bradyrhizobium centrosematis SEMIA 424	Isolate	Nodule
665	2842045827	Bradyrhizobium centrosematis SEMIA 431	Isolate	Nodule
666	2842733646	Variovorax sp. R-72446	Isolate	Unclassified
667	2842747753	Variovorax sp. R-72060	Isolate	Unclassified
668	2844315083	Bradyrhizobium guangzhouense CCBAU 51670	Isolate	Unclassified
669	2844533157	Inquilinus sp. R-72501 v. 2	Isolate	Unclassified
670	2847930680	Bradyrhizobium zhanjiangense CCBAU 51778	Isolate	Unclassified
671	2847939898	Bradyrhizobium ottawaense OO99	Isolate	Unclassified
672	2849076700	Bradyrhizobium symbiodeficiens 85S1MB	Isolate	Nodule
673	2857509624	Bradyrhizobium sp. R-73088	Isolate	Unclassified
674	2857524615	Tardiphaga sp. R-73074	Isolate	Unclassified
675	2874590934	Bradyrhizobium canariense UBMA181	Isolate	Nodule
676	2874604998	Bradyrhizobium sp. LMTR 3	Isolate	Nodule
677	2874612657	Bradyrhizobium forestalis INPA54B	Isolate	Nodule
678	2874620515	Bradyrhizobium nanningense CCBAU 53390	Isolate	Unclassified
679	2874628541	Bradyrhizobium betae Opo-243	Isolate	Unclassified
680	2874645413	Bradyrhizobium canariense UBMA122	Isolate	Nodule
681	2876761206	Bradyrhizobium centrolobii BR 10245	Isolate	Nodule
682	2876771140	Bradyrhizobium canariense UBMA192	Isolate	Nodule
683	2876808645	Bradyrhizobium algeriense RST89	Isolate	Unclassified
684	2876818435	Bradyrhizobium canariense UBMA195	Isolate	Nodule
685	2879074833	Bradyrhizobium canariense UBMA171	Isolate	Nodule
686	2879083081	Bradyrhizobium zhanjiangense CCBAU 51787	Isolate	Unclassified
687	2879099564	Bradyrhizobium japonicum UBMA197	Isolate	Nodule
688	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
689	2879127579	Bradyrhizobium canariense UBMA052	Isolate	Nodule
690	2879142872	Bradyrhizobium canariense UBMA061	Isolate	Nodule
691	2881364244	Bradyrhizobium sp. RP6	Isolate	Unclassified
692	2881665667	Bradyrhizobium vignae LMG 28791	Isolate	Unclassified
693	2881927736	Candidimonas sp. SYP-B2681	Isolate	Rhizosphere
694	2882456835	Microvirga sp. KLBC 81	Isolate	Unclassified
695	2884298095	Microvirga thermotolerans HR1	Isolate	Rhizosphere
696	2885198086	Variovorax sp. 679	Isolate	Unclassified
697	2885211737	Variovorax sp. 553	Isolate	Unclassified
698	2885366525	Bradyrhizobium sp. LVM 105	Isolate	Unclassified
699	2885409591	Bradyrhizobium sp. NAS80.1	Isolate	Unclassified
700	2885427238	Sphingomonas mesophila SYSUP0001	Isolate	Stem Tuber
701	2888388044	Bradyrhizobium cosmicum 58S1	Isolate	Unclassified
702	2888419890	Bradyrhizobium sp. 1(2017) 63S1MB	Isolate	Unclassified
703	2889033259	Bradyrhizobium sp. CCBAU 051011	Isolate	Unclassified
704	2893066018	Tardiphaga sp. P9-11	Isolate	Unclassified
705	2894232714	Microvirga tunisiensis Lmie10	Isolate	Nodule
706	2896429255	Sphingomonas rhizophila KACC 19189	Isolate	Rhizosphere
707	2899924645	Variovorax sp. 369	Isolate	Unclassified
708	2903727486	Bradyrhizobium guangzhouense CCBAU 53424	Isolate	Unclassified
709	2904449895	Variovorax sp. 1763	Isolate	Rhizosphere
710	2904666416	Bradyrhizobium nanningense CCBAU 51757	Isolate	Unclassified
711	2904711408	Bradyrhizobium sp. USDA 3456	Isolate	Unclassified
712	2906602504	Bradyrhizobium guangzhouense CCBAU 53426	Isolate	Unclassified
713	2906626472	Bradyrhizobium hipponense aSej3	Isolate	Unclassified
714	2906643746	Bradyrhizobium genosp. SA-3 Rp7b	Isolate	Unclassified
715	2908775508	Bradyrhizobium sp. SUTN9-2	Isolate	Unclassified
716	2919073203	Tardiphaga robiniae 1155	Isolate	Unclassified
717	2922361189	Bradyrhizobium australiense WSM 1791	Isolate	Nodule
718	2922368715
719	2922386360	Bradyrhizobium archetypum WSM 1744	Isolate	Nodule
720	2922393267	Bradyrhizobium sp. WBAH10	Isolate	Nodule
721	2928037797	Variovorax sp. 1126	Isolate	Unclassified
722	2928044640	Variovorax sp. 1128	Isolate	Unclassified
723	2928051484	Variovorax sp. 1133	Isolate	Unclassified
724	2928064002	Variovorax sp. 1140	Isolate	Rhizosphere
725	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
726	2929615660	Bradyrhizobium japonicum TXVA	Isolate	Nodule
727	2929624759	Bradyrhizobium japonicum TXEA	Isolate	Nodule
728	2932784394	Bradyrhizobium sp. S3.2.12	Isolate	Nodule
729	2932794094	Bradyrhizobium sp. S3.2.6	Isolate	Nodule
730	2932801729	Bradyrhizobium sp. S3.3.6	Isolate	Nodule
731	2932809354	Bradyrhizobium sp. S3.5.5	Isolate	Nodule
732	2932818245	Bradyrhizobium sp. S3.9.1	Isolate	Nodule
733	2932828146	Bradyrhizobium sp. S3.9.2	Isolate	Nodule
734	2933577622	Bradyrhizobium japonicum SEMIA 417	Isolate	Nodule
735	2935608549	Bradyrhizobium sp. RT6a	Isolate	Nodule
736	2935616580	Bradyrhizobium sp. RT7a	Isolate	Nodule
737	2935638405	Bradyrhizobium sp. JR19.8	Isolate	Nodule
738	2935648319	Bradyrhizobium sp. JR4.3	Isolate	Nodule
739	2935656913	Bradyrhizobium sp. JR5.3	Isolate	Nodule
740	2935665750	Bradyrhizobium sp. JR7.2	Isolate	Nodule
741	2935675223	Bradyrhizobium sp. LA2.1	Isolate	Nodule
742	2935684952	Bradyrhizobium sp. LA3.X	Isolate	Nodule
743	2935694250	Bradyrhizobium sp. LA6.1	Isolate	Nodule
744	2935703347	Bradyrhizobium sp. LA6.10	Isolate	Nodule
745	2935713505	Bradyrhizobium sp. LA6.12	Isolate	Nodule
746	2935722832	Bradyrhizobium sp. LA6.3	Isolate	Nodule
747	2935732158	Bradyrhizobium sp. LA6.4	Isolate	Nodule
748	2935741537	Bradyrhizobium sp. LA6.7	Isolate	Nodule
749	2935750917	Bradyrhizobium sp. LA6.8	Isolate	Nodule
750	2935760218	Bradyrhizobium sp. LA7.1	Isolate	Nodule
751	2935769743	Bradyrhizobium sp. LB12.1	Isolate	Nodule
752	2935777560	Bradyrhizobium sp. LB14.3	Isolate	Nodule
753	2935785616	Bradyrhizobium sp. LB5.2	Isolate	Nodule
754	2935793552	Bradyrhizobium sp. LB8.2	Isolate	Nodule
755	2935801545	Bradyrhizobium sp. RT10b	Isolate	Nodule
756	2935810662	Bradyrhizobium sp. RT3a	Isolate	Nodule
757	2935819856	Bradyrhizobium sp. RT3b	Isolate	Nodule
758	2935827899	Bradyrhizobium sp. RT4a	Isolate	Nodule
759	2935837841	Bradyrhizobium sp. RT4b	Isolate	Nodule
760	2935847175	Bradyrhizobium sp. RT5a	Isolate	Nodule
761	2935855204	Bradyrhizobium sp. RT7b	Isolate	Nodule
762	2935864058	Bradyrhizobium sp. RT9a	Isolate	Nodule
763	2935873716	Bradyrhizobium sp. RT9b	Isolate	Nodule
764	2935883170	Bradyrhizobium sp. S3.12.5	Isolate	Nodule
765	2935908558	Bradyrhizobium sp. F1.1.1	Isolate	Nodule
766	2935916978	Bradyrhizobium sp. F1.13.3	Isolate	Nodule
767	2935926038	Bradyrhizobium sp. F1.2.1	Isolate	Nodule
768	2935934488	Bradyrhizobium sp. F1.2.2	Isolate	Nodule
769	2935942939	Bradyrhizobium sp. F1.2.6	Isolate	Nodule
770	2935951376	Bradyrhizobium sp. F1.2.8	Isolate	Nodule
771	2935959822	Bradyrhizobium sp. F1.4.3	Isolate	Nodule
772	2935967501	Bradyrhizobium sp. F1.6.2	Isolate	Nodule
773	2935975950	Bradyrhizobium sp. GM2.2	Isolate	Nodule
774	2935984226	Bradyrhizobium sp. i1.15.2	Isolate	Nodule
775	2935992306	Bradyrhizobium sp. I1.7.5	Isolate	Nodule
776	2936002035	Bradyrhizobium sp. I1.8.5	Isolate	Nodule
777	2936011229	Bradyrhizobium sp. JR1.1	Isolate	Nodule
778	2936019824	Bradyrhizobium sp. JR1.5	Isolate	Nodule
779	2936028420	Bradyrhizobium sp. JR1.7	Isolate	Nodule
780	2936037263	Bradyrhizobium sp. JR18.2	Isolate	Nodule
781	2936046547	Bradyrhizobium sp. JR3.12	Isolate	Nodule
782	2936055302	Bradyrhizobium sp. JR4.1	Isolate	Nodule
783	2940556831	Bradyrhizobium sp. LA8.1	Isolate	Nodule
784	2941531003	Bradyrhizobium sp. LB11.1	Isolate	Nodule
785	2941538514	Bradyrhizobium sp. RT11b	Isolate	Nodule
786	2990710928	Acidovorax delafieldii SLBN-75	Isolate	Rhizosphere
787	3005483717	Bradyrhizobium agreste CNPSo 4010	Isolate	Unclassified
788	3005506211	Bradyrhizobium diazoefficiens SZCCT0449	Isolate	Unclassified
789	3005587118	Bradyrhizobium glycinis CNPSo 4016	Isolate	Unclassified
790	3005594810	Bradyrhizobium sp. CCBAU 53340	Isolate	Nodule
791	3005710791	Bradyrhizobium genosp. B BDV5040	Isolate	Unclassified
792	3005718088	Bradyrhizobium sp. CCBAU 53338	Isolate	Nodule
793	8006926726	Bradyrhizobium guangdongense SM32	Isolate	Unclassified
794	8006964411	Bradyrhizobium sp. sBnM-33	Isolate	Nodule
795	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
796	8006994254	Bradyrhizobium sp. sGM-13	Isolate	Nodule
797	8016511872	Bradyrhizobium sp. S3.14.4	Isolate	Nodule
798	8016522445	Bradyrhizobium sp. LM6.9	Isolate	Nodule
799	8016530956	Bradyrhizobium sp. LM6.11	Isolate	Nodule
800	8016539877	Bradyrhizobium sp. LM6.10	Isolate	Nodule
801	8016548790	Bradyrhizobium sp. LM3.6	Isolate	Nodule
802	8016557553	Bradyrhizobium sp. LM3.4	Isolate	Nodule
803	8016566248	Bradyrhizobium sp. LM3.2	Isolate	Nodule
804	8016575299	Bradyrhizobium sp. LM2.9	Isolate	Nodule
805	8016583857	Bradyrhizobium sp. LM2.7	Isolate	Nodule
806	8016595262	Bradyrhizobium sp. LM2.3	Isolate	Nodule
807	8016603502	Bradyrhizobium sp. LB7.2	Isolate	Nodule
808	8016613128	Bradyrhizobium sp. LB7.1	Isolate	Nodule
809	8016622563	Bradyrhizobium sp. LB13.1	Isolate	Nodule
810	8016630954	Bradyrhizobium sp. F1.13.1	Isolate	Nodule
811	8017057580	Bradyrhizobium sp. S3.7.6	Isolate	Nodule
812	8019530166	Bradyrhizobium sp. LM4.3	Isolate	Nodule
813	8019538911	Bradyrhizobium sp. LB9.1b	Isolate	Nodule
814	8019576017	Bradyrhizobium sp. i1.7.7	Isolate	Nodule
815	8019586578	Bradyrhizobium sp. i1.4.4	Isolate	Nodule
816	8019597564	Bradyrhizobium sp. i1.3.6	Isolate	Nodule
817	8019629233	Bradyrhizobium sp. GM6.1	Isolate	Nodule
818	8019638758	Bradyrhizobium sp. GM5.1	Isolate	Nodule
819	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
820	8019659431	Bradyrhizobium sp. GM22.5	Isolate	Nodule
821	8019668869	Bradyrhizobium sp. GM2.4	Isolate	Nodule
822	8019678201	Bradyrhizobium sp. GM0.4	Isolate	Nodule
823	8019687851	Bradyrhizobium sp. F1.13.4	Isolate	Nodule
824	8055742211	Bradyrhizobium japonicum 5038	Isolate	Nodule
825	8056673599	Bradyrhizobium hereditatis WSM 1738	Isolate	Nodule
826	8056967851	Bradyrhizobium zhengyangense WYCCWR 12678	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	89.69
Metatranscriptomes	0.3
Isolates	10.01

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	11.4
Nodule	6.96
Rhizoplane	3.93
Rhizosphere	69.48
Stem	0
Stem Tuber	0.04
Unclassified	0.04

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0451853_0782180	3300041512	Bacteria	1909
2	JGI24739J22299_10011385	3300001989	Bacteria	3285
3	JGI24739J22299_10025926	3300001989	Bacteria	2060
4	JGI24737J22298_10003686	3300001990	Bacteria	5395
5	JGI24743J22301_10002134	3300001991	Bacteria	2921
6	JGI24735J21928_10027784	3300002067	Bacteria	1694
7	JGI25152J39213_1003814	3300002773	Bacteria	4994
8	JGI25150J39212_1002872	3300002774	Bacteria	4172
9	JGI25151J46595_10000332	3300003187	Bacteria	50552
10	JGI25151J46595_10002370	3300003187	Bacteria	11431
11	JGI25406J46586_10000224	3300003203	Bacteria	25048
12	JGI25406J46586_10001185	3300003203	Bacteria	12280
13	JGI25165J46597_1004828	3300003214	Bacteria	2754
14	JGI25153J46596_10000110	3300003215	Bacteria	93591
15	JGI25153J46596_10000161	3300003215	Bacteria	67388
16	JGI25153J46596_10000725	3300003215	Bacteria	20204
17	JGI25153J46596_10001735	3300003215	Bacteria	12943
18	JGI25153J46596_10003973	3300003215	Bacteria	8090
19	JGI25153J46596_10033295	3300003215	Bacteria	1703
20	rootL2_10023171	3300003322	Bacteria	1561
21	JGI25160J50197_1002211	3300003354	Bacteria	9140
22	JGI25160J50197_1002809	3300003354	Bacteria	7972
23	JGI25160J50197_1008188	3300003354	Bacteria	4006
24	JGI25161J50226_1009901	3300003374	Bacteria	1316
25	Ga0006562J51391_1115764	3300003578	Bacteria	3454
26	Ga0006562J51391_1115765	3300003578	Bacteria	1470
27	JGI25404J52841_10004559	3300003659	Bacteria	2816
28	Ga0055535_1000874	3300003761	Bacteria	21113
29	Ga0055542_1000003	3300003762	Bacteria	582721
30	Ga0055526_1000102	3300003771	Bacteria	74957
31	Ga0055526_1000104	3300003771	Bacteria	73451
32	Ga0055536_1003234	3300003781	Bacteria	8824
33	Ga0055534_1006690	3300003784	Bacteria	2866
34	Ga0055530_10000292	3300003791	Bacteria	45623
35	Ga0055540_1023025	3300003792	Bacteria	1578
36	Ga0055531_10004166	3300003794	Bacteria	8916
37	Ga0055531_10022600	3300003794	Bacteria	2390
38	Ga0055531_10024346	3300003794	Bacteria	2237
39	Ga0055543_1002636	3300004625	Bacteria	5777
40	Ga0055543_1009855	3300004625	Bacteria	2030
41	Ga0065165_1000244	3300005262	Bacteria	93411
42	Ga0065165_1000368	3300005262	Bacteria	73904
43	Ga0065165_1005521	3300005262	Bacteria	7066
44	Ga0065165_1024612	3300005262	Bacteria	2018
45	Ga0065715_10001629	3300005293	Bacteria	12037
46	Ga0070658_10000029	3300005327	Bacteria	156910
47	Ga0070658_10009418	3300005327	Bacteria	7846
48	Ga0070658_10036717	3300005327	Bacteria	3949
49	Ga0070658_10056840	3300005327	Bacteria	3181
50	Ga0070658_10062936	3300005327	Bacteria	3024
51	Ga0070676_10107924	3300005328	Bacteria	1729
52	Ga0070683_100016648	3300005329	Bacteria	6487
53	Ga0070683_100019922	3300005329	Bacteria	5964
54	Ga0070683_100161233	3300005329	Bacteria	2128
55	Ga0070683_100544406	3300005329	Bacteria	1110
56	Ga0070690_100284451	3300005330	Bacteria	1181
57	Ga0070670_100009818	3300005331	Bacteria	8176
58	Ga0070670_100033220	3300005331	Bacteria	4445
59	Ga0070670_100061218	3300005331	Bacteria	3232
60	Ga0070677_10009599	3300005333	Bacteria	3287
61	Ga0070677_10019880	3300005333	Bacteria	2439
62	Ga0070677_10021259	3300005333	Bacteria	2378
63	Ga0070677_10139572	3300005333	Bacteria	1116
64	Ga0068869_100103869	3300005334	Bacteria	2153
65	Ga0068869_100313676	3300005334	Bacteria	1270
66	Ga0068869_100491093	3300005334	Bacteria	1023
67	Ga0070666_10107047	3300005335	Bacteria	1932
68	Ga0070666_10145219	3300005335	Bacteria	1654
69	Ga0070666_10234772	3300005335	Bacteria	1296
70	Ga0070680_100001995	3300005336	Bacteria	15024
71	Ga0070680_100053429	3300005336	Bacteria	3298
72	Ga0070680_100086504	3300005336	Bacteria	2591
73	Ga0070680_100099818	3300005336	Bacteria	2409
74	Ga0070680_100184215	3300005336	Bacteria	1759
75	Ga0070680_100195563	3300005336	Bacteria	1705
76	Ga0068868_100000005	3300005338	Bacteria	132403
77	Ga0068868_100008462	3300005338	Bacteria	7368
78	Ga0068868_100061484	3300005338	Bacteria	2975
79	Ga0068868_100159091	3300005338	Bacteria	1864
80	Ga0068868_100203468	3300005338	Bacteria	1652
81	Ga0070660_100003340	3300005339	Bacteria	11025
82	Ga0070660_100003372	3300005339	Bacteria	10987
83	Ga0070660_100027919	3300005339	Bacteria	4217
84	Ga0070660_100053813	3300005339	Bacteria	3105
85	Ga0070660_100087222	3300005339	Bacteria	2456
86	Ga0070660_100101200	3300005339	Bacteria	2283
87	Ga0070660_100176875	3300005339	Bacteria	1726
88	Ga0070660_100452773	3300005339	Bacteria	1065
89	Ga0070689_100269658	3300005340	Bacteria	1409
90	Ga0070689_100400099	3300005340	Bacteria	1161
91	Ga0070691_10002854	3300005341	Bacteria	7735
92	Ga0070687_100134621	3300005343	Bacteria	1431
93	Ga0070661_100012406	3300005344	Bacteria	5962
94	Ga0070661_100040022	3300005344	Bacteria	3418
95	Ga0070661_100076796	3300005344	Bacteria	2462
96	Ga0070661_100082171	3300005344	Bacteria	2379
97	Ga0070661_100316497	3300005344	Bacteria	1218
98	Ga0070661_100457904	3300005344	Bacteria	1016
99	Ga0070692_10001329	3300005345	Bacteria	8896
100	Ga0070668_100002567	3300005347	Bacteria	13355
101	Ga0070668_100084992	3300005347	Bacteria	2486
102	Ga0070668_100086608	3300005347	Bacteria	2463
103	Ga0070668_100115435	3300005347	Bacteria	2140
104	Ga0070668_100158902	3300005347	Bacteria	1833
105	Ga0070668_100199720	3300005347	Bacteria	1641
106	Ga0070668_100461574	3300005347	Bacteria	1094
107	Ga0070668_100470019	3300005347	Bacteria	1084
108	Ga0070669_100003020	3300005353	Bacteria	12112
109	Ga0070669_100018096	3300005353	Bacteria	5033
110	Ga0070669_100025367	3300005353	Bacteria	4257
111	Ga0070669_100061056	3300005353	Bacteria	2769
112	Ga0070669_100248902	3300005353	Bacteria	1414
113	Ga0070669_100322007	3300005353	Bacteria	1249
114	Ga0070669_100353281	3300005353	Bacteria	1194
115	Ga0070669_100419944	3300005353	Bacteria	1097
116	Ga0070669_100596703	3300005353	Bacteria	925
117	Ga0070675_100001425	3300005354	Bacteria	17561
118	Ga0070675_100012081	3300005354	Bacteria	6768
119	Ga0070675_100033049	3300005354	Bacteria	4191
120	Ga0070675_100229226	3300005354	Bacteria	1620
121	Ga0070675_100269558	3300005354	Bacteria	1494
122	Ga0070675_100398498	3300005354	Bacteria	1227
123	Ga0070671_100116660	3300005355	Bacteria	2245
124	Ga0070671_100311675	3300005355	Bacteria	1340
125	Ga0070674_100018354	3300005356	Bacteria	4422
126	Ga0070674_100024025	3300005356	Bacteria	3953
127	Ga0070674_100229094	3300005356	Bacteria	1449
128	Ga0070673_100007540	3300005364	Bacteria	7190
129	Ga0070673_100053106	3300005364	Bacteria	3181
130	Ga0070673_100062072	3300005364	Bacteria	2968
131	Ga0070673_100276446	3300005364	Bacteria	1471
132	Ga0070673_100328445	3300005364	Bacteria	1352
133	Ga0070673_100365801	3300005364	Bacteria	1283
134	Ga0070688_100127320	3300005365	Bacteria	1713
135	Ga0070688_100139361	3300005365	Bacteria	1646
136	Ga0070688_100562113	3300005365	Bacteria	869
137	Ga0070659_100000011	3300005366	Bacteria	185903
138	Ga0070659_100000968	3300005366	Bacteria	21135
139	Ga0070659_100006463	3300005366	Bacteria	8464
140	Ga0070659_100021021	3300005366	Bacteria	4964
141	Ga0070659_100026467	3300005366	Bacteria	4464
142	Ga0070659_100045117	3300005366	Bacteria	3453
143	Ga0070659_100096750	3300005366	Bacteria	2372
144	Ga0070659_100108965	3300005366	Bacteria	2235
145	Ga0070659_100184351	3300005366	Bacteria	1714
146	Ga0070659_100247864	3300005366	Bacteria	1476
147	Ga0070659_100377970	3300005366	Bacteria	1193
148	Ga0070667_100022671	3300005367	Bacteria	5206
149	Ga0070667_100023212	3300005367	Bacteria	5146
150	Ga0070667_100410524	3300005367	Bacteria	1234
151	Ga0070667_100435448	3300005367	Bacteria	1197
152	Ga0070709_10001991	3300005434	Bacteria	11124
153	Ga0070709_10132374	3300005434	Bacteria	1704
154	Ga0070714_100042921	3300005435	Bacteria	3822
155	Ga0070714_100130606	3300005435	Bacteria	2245
156	Ga0070714_100192269	3300005435	Bacteria	1863
157	Ga0070714_100628752	3300005435	Bacteria	1032
158	Ga0070713_100000921	3300005436	Bacteria	18747
159	Ga0070713_100018458	3300005436	Bacteria	5301
160	Ga0070713_100020170	3300005436	Bacteria	5105
161	Ga0070713_100034285	3300005436	Bacteria	4076
162	Ga0070713_100047162	3300005436	Bacteria	3540
163	Ga0070713_100048195	3300005436	Bacteria	3506
164	Ga0070713_100049692	3300005436	Bacteria	3461
165	Ga0070710_10000965	3300005437	Bacteria	13640
166	Ga0070710_10002824	3300005437	Bacteria	8279
167	Ga0070711_100001902	3300005439	Bacteria	11671
168	Ga0070711_100009556	3300005439	Bacteria	5981
169	Ga0070711_100012353	3300005439	Bacteria	5331
170	Ga0070711_100015153	3300005439	Bacteria	4874
171	Ga0070711_100016194	3300005439	Bacteria	4731
172	Ga0070711_100151945	3300005439	Bacteria	1747
173	Ga0070711_100308984	3300005439	Bacteria	1260
174	Ga0070694_100004766	3300005444	Bacteria	8168
175	Ga0070694_100285477	3300005444	Bacteria	1260
176	Ga0070694_100501941	3300005444	Bacteria	965
177	Ga0070708_100138030	3300005445	Bacteria	2260
178	Ga0070663_100081745	3300005455	Bacteria	2375
179	Ga0070663_100109870	3300005455	Bacteria	2070
180	Ga0070663_100147387	3300005455	Bacteria	1802
181	Ga0070663_100255185	3300005455	Bacteria	1389
182	Ga0070663_100352031	3300005455	Bacteria	1193
183	Ga0070678_100018801	3300005456	Bacteria	4486
184	Ga0070678_100041156	3300005456	Bacteria	3274
185	Ga0070678_100073083	3300005456	Bacteria	2572
186	Ga0070678_100101718	3300005456	Bacteria	2228
187	Ga0070678_100192228	3300005456	Bacteria	1679
188	Ga0070678_100215430	3300005456	Bacteria	1593
189	Ga0070678_100428401	3300005456	Bacteria	1155
190	Ga0070678_100517960	3300005456	Bacteria	1055
191	Ga0070678_100520181	3300005456	Bacteria	1052
192	Ga0070662_100004215	3300005457	Bacteria	9058
193	Ga0070662_100013471	3300005457	Bacteria	5442
194	Ga0070662_100017872	3300005457	Bacteria	4786
195	Ga0070662_100047168	3300005457	Bacteria	3098
196	Ga0070662_100064068	3300005457	Bacteria	2690
197	Ga0070662_100099585	3300005457	Bacteria	2197
198	Ga0070662_100178278	3300005457	Bacteria	1673
199	Ga0070662_100229187	3300005457	Bacteria	1485
200	Ga0070662_100310415	3300005457	Bacteria	1284
201	Ga0070662_100337326	3300005457	Bacteria	1232
202	Ga0070681_10028028	3300005458	Bacteria	5661
203	Ga0070681_10041251	3300005458	Bacteria	4625
204	Ga0070681_10046096	3300005458	Bacteria	4359
205	Ga0070681_10107243	3300005458	Bacteria	2734
206	Ga0070681_10195409	3300005458	Bacteria	1942
207	Ga0068867_100000285	3300005459	Bacteria	33321
208	Ga0068867_100033571	3300005459	Bacteria	3717
209	Ga0068867_100075533	3300005459	Bacteria	2528
210	Ga0068867_100108796	3300005459	Bacteria	2126
211	Ga0068867_100301498	3300005459	Bacteria	1321
212	Ga0068867_100349792	3300005459	Bacteria	1233
213	Ga0070685_10065060	3300005466	Bacteria	2146
214	Ga0070706_100220047	3300005467	Bacteria	1772
215	Ga0070707_100042282	3300005468	Bacteria	4363
216	Ga0070707_100043146	3300005468	Bacteria	4318
217	Ga0070707_100064812	3300005468	Bacteria	3509
218	Ga0070707_100101632	3300005468	Bacteria	2786
219	Ga0070699_100008958	3300005518	Bacteria	8670
220	Ga0070679_100000007	3300005530	Bacteria	195373
221	Ga0070679_100003827	3300005530	Bacteria	13814
222	Ga0070679_100021536	3300005530	Bacteria	6295
223	Ga0070679_100032253	3300005530	Bacteria	5180
224	Ga0070679_100036859	3300005530	Bacteria	4855
225	Ga0070679_100067766	3300005530	Bacteria	3559
226	Ga0070679_100102813	3300005530	Bacteria	2843
227	Ga0070679_100287187	3300005530	Bacteria	1597
228	Ga0070679_100341473	3300005530	Bacteria	1445
229	Ga0070679_100369681	3300005530	Bacteria	1381
230	Ga0070679_100654731	3300005530	Bacteria	993
231	Ga0070684_100041168	3300005535	Bacteria	3982
232	Ga0070697_100016393	3300005536	Bacteria	5826
233	Ga0070697_100337114	3300005536	Bacteria	1301
234	Ga0068853_100017303	3300005539	Bacteria	5951
235	Ga0068853_100064981	3300005539	Bacteria	3165
236	Ga0068853_100092671	3300005539	Bacteria	2658
237	Ga0068853_100180221	3300005539	Bacteria	1916
238	Ga0068853_100218220	3300005539	Bacteria	1741
239	Ga0068853_100595522	3300005539	Bacteria	1050
240	Ga0070672_100001070	3300005543	Bacteria	16660
241	Ga0070672_100080622	3300005543	Bacteria	2608
242	Ga0070672_100135539	3300005543	Bacteria	2027
243	Ga0070672_100142885	3300005543	Bacteria	1975
244	Ga0070672_100360406	3300005543	Bacteria	1241
245	Ga0070686_100074623	3300005544	Bacteria	2229
246	Ga0070686_100535947	3300005544	Bacteria	914
247	Ga0070696_100011158	3300005546	Bacteria	6011
248	Ga0070696_100013451	3300005546	Bacteria	5491
249	Ga0070696_100077454	3300005546	Bacteria	2350
250	Ga0070696_100114521	3300005546	Bacteria	1945
251	Ga0070693_100069589	3300005547	Bacteria	2069
252	Ga0070693_100247563	3300005547	Bacteria	1180
253	Ga0070665_100000380	3300005548	Bacteria	65676
254	Ga0070665_100013089	3300005548	Bacteria	8353
255	Ga0070665_100025378	3300005548	Bacteria	5972
256	Ga0070665_100027447	3300005548	Bacteria	5735
257	Ga0070665_100051209	3300005548	Bacteria	4141
258	Ga0070665_100059843	3300005548	Bacteria	3818
259	Ga0070665_100095605	3300005548	Bacteria	2976
260	Ga0070665_100188831	3300005548	Bacteria	2061
261	Ga0070665_100190426	3300005548	Bacteria	2052
262	Ga0070665_100207744	3300005548	Bacteria	1959
263	Ga0070665_100215214	3300005548	Bacteria	1922
264	Ga0070665_100330690	3300005548	Bacteria	1528
265	Ga0070665_100522529	3300005548	Bacteria	1198
266	Ga0068855_100004718	3300005563	Bacteria	16648
267	Ga0068855_100007683	3300005563	Bacteria	13027
268	Ga0068855_100019660	3300005563	Bacteria	8111
269	Ga0068855_100032183	3300005563	Bacteria	6262
270	Ga0068855_100043191	3300005563	Bacteria	5341
271	Ga0068855_100057975	3300005563	Bacteria	4538
272	Ga0068855_100082424	3300005563	Bacteria	3728
273	Ga0068855_100138623	3300005563	Bacteria	2774
274	Ga0068855_100629260	3300005563	Bacteria	1155
275	Ga0070664_100004242	3300005564	Bacteria	11532
276	Ga0070664_100044608	3300005564	Bacteria	3743
277	Ga0070664_100063796	3300005564	Bacteria	3141
278	Ga0070664_100102590	3300005564	Bacteria	2489
279	Ga0070664_100280293	3300005564	Bacteria	1503
280	Ga0070664_100341577	3300005564	Bacteria	1360
281	Ga0070664_100353660	3300005564	Bacteria	1337
282	Ga0070664_100446003	3300005564	Bacteria	1188
283	Ga0070664_100760195	3300005564	Bacteria	905
284	Ga0068857_100053451	3300005577	Bacteria	3583
285	Ga0068857_100054029	3300005577	Bacteria	3563
286	Ga0068857_100068647	3300005577	Bacteria	3155
287	Ga0068854_100040820	3300005578	Bacteria	3275
288	Ga0068854_100079018	3300005578	Bacteria	2425
289	Ga0068854_100189799	3300005578	Bacteria	1609
290	Ga0068854_100221032	3300005578	Bacteria	1499
291	Ga0068854_100261181	3300005578	Bacteria	1386
292	Ga0068854_100264672	3300005578	Bacteria	1378
293	Ga0068856_100000147	3300005614	Bacteria	71694
294	Ga0068856_100005034	3300005614	Bacteria	13085
295	Ga0068856_100069833	3300005614	Bacteria	3474
296	Ga0068856_100162305	3300005614	Bacteria	2245
297	Ga0068856_100196095	3300005614	Bacteria	2033
298	Ga0068856_100330638	3300005614	Bacteria	1541
299	Ga0068856_100473303	3300005614	Bacteria	1273
300	Ga0070702_100086925	3300005615	Bacteria	1887
301	Ga0068852_100022132	3300005616	Bacteria	5092
302	Ga0068852_100030238	3300005616	Bacteria	4456
303	Ga0068852_100035255	3300005616	Bacteria	4171
304	Ga0068852_100040905	3300005616	Bacteria	3915
305	Ga0068852_100050969	3300005616	Bacteria	3550
306	Ga0068852_100148554	3300005616	Bacteria	2177
307	Ga0068852_100173399	3300005616	Bacteria	2023
308	Ga0068852_100180522	3300005616	Bacteria	1985
309	Ga0068852_100215312	3300005616	Bacteria	1824
310	Ga0068859_100005527	3300005617	Bacteria	12872
311	Ga0068859_100050860	3300005617	Bacteria	4163
312	Ga0068859_100057981	3300005617	Bacteria	3900
313	Ga0068859_100125347	3300005617	Bacteria	2637
314	Ga0068859_100269639	3300005617	Bacteria	1794
315	Ga0068864_100023922	3300005618	Bacteria	5134
316	Ga0068864_100071279	3300005618	Bacteria	3025
317	Ga0068864_100094335	3300005618	Bacteria	2645
318	Ga0068864_100153816	3300005618	Bacteria	2086
319	Ga0068864_100713358	3300005618	Bacteria	980
320	Ga0068866_10054748	3300005718	Bacteria	2046
321	Ga0068861_100037014	3300005719	Bacteria	3626
322	Ga0068861_100153652	3300005719	Bacteria	1891
323	Ga0068861_100184415	3300005719	Bacteria	1739
324	Ga0068851_10007825	3300005834	Bacteria	4920
325	Ga0068851_10009284	3300005834	Bacteria	4565
326	Ga0068851_10183801	3300005834	Bacteria	1159
327	Ga0068863_100015315	3300005841	Bacteria	7369
328	Ga0068863_100526180	3300005841	Bacteria	1166
329	Ga0068858_100011350	3300005842	Bacteria	8412
330	Ga0068858_100030269	3300005842	Bacteria	5027
331	Ga0068858_100118424	3300005842	Bacteria	2476
332	Ga0068858_100141648	3300005842	Bacteria	2257
333	Ga0068858_100258344	3300005842	Bacteria	1655
334	Ga0068858_100617325	3300005842	Bacteria	1052
335	Ga0068860_100000302	3300005843	Bacteria	68581
336	Ga0068860_100037214	3300005843	Bacteria	4658
337	Ga0068860_100037514	3300005843	Bacteria	4639
338	Ga0068860_100139851	3300005843	Bacteria	2326
339	Ga0068860_100218011	3300005843	Bacteria	1852
340	Ga0068860_100418110	3300005843	Bacteria	1328
341	Ga0068860_100449261	3300005843	Bacteria	1281
342	Ga0068862_100033548	3300005844	Bacteria	4340
343	Ga0068862_100046319	3300005844	Bacteria	3710
344	Ga0068862_100056187	3300005844	Bacteria	3372
345	Ga0068862_100066590	3300005844	Bacteria	3104
346	Ga0068862_100541415	3300005844	Bacteria	1110
347	Ga0081455_10000715	3300005937	Bacteria	43119
348	Ga0081455_10069205	3300005937	Bacteria	2936
349	Ga0081455_10167403	3300005937	Bacteria	1678
350	Ga0081540_1000085	3300005983	Bacteria	99716
351	Ga0081540_1005117	3300005983	Bacteria	9833
352	Ga0081540_1005134	3300005983	Bacteria	9805
353	Ga0081540_1006569	3300005983	Bacteria	8439
354	Ga0081540_1014622	3300005983	Bacteria	5017
355	Ga0081540_1014909	3300005983	Bacteria	4945
356	Ga0081540_1022082	3300005983	Bacteria	3765
357	Ga0081540_1024701	3300005983	Bacteria	3480
358	Ga0081540_1032477	3300005983	Bacteria	2851
359	Ga0081540_1082270	3300005983	Bacteria	1445
360	Ga0081539_10000115	3300005985	Bacteria	188623
361	Ga0081539_10000172	3300005985	Bacteria	151505
362	Ga0081539_10000199	3300005985	Bacteria	139305
363	Ga0081539_10000785	3300005985	Bacteria	61844
364	Ga0081539_10105036	3300005985	Bacteria	1432
365	Ga0081539_10199651	3300005985	Bacteria	925
366	Ga0070717_10001544	3300006028	Bacteria	15960
367	Ga0070717_10004489	3300006028	Bacteria	10079
368	Ga0070717_10039248	3300006028	Bacteria	3852
369	Ga0070717_10062109	3300006028	Bacteria	3098
370	Ga0070717_10114498	3300006028	Bacteria	2304
371	Ga0070717_10431354	3300006028	Bacteria	1186
372	Ga0075365_10014062	3300006038	Bacteria	4806
373	Ga0075365_10021071	3300006038	Bacteria	4058
374	Ga0075365_10028542	3300006038	Bacteria	3559
375	Ga0075365_10031524	3300006038	Bacteria	3401
376	Ga0075365_10059673	3300006038	Bacteria	2543
377	Ga0075365_10209485	3300006038	Bacteria	1366
378	Ga0075365_10210133	3300006038	Bacteria	1364
379	Ga0075365_10282271	3300006038	Bacteria	1168
380	Ga0075368_10005521	3300006042	Bacteria	4356
381	Ga0075368_10013315	3300006042	Bacteria	3019
382	Ga0075368_10017067	3300006042	Bacteria	2713
383	Ga0075363_100004092	3300006048	Bacteria	6320
384	Ga0075363_100009121	3300006048	Bacteria	4656
385	Ga0075363_100088365	3300006048	Bacteria	1703
386	Ga0075363_100099858	3300006048	Bacteria	1605
387	Ga0075364_10005255	3300006051	Bacteria	7513
388	Ga0075364_10013415	3300006051	Bacteria	5036
389	Ga0075364_10052670	3300006051	Bacteria	2660
390	Ga0075364_10069176	3300006051	Bacteria	2322
391	Ga0075432_10007816	3300006058	Bacteria	3645
392	Ga0075432_10019337	3300006058	Bacteria	2326
393	Ga0070715_10002681	3300006163	Bacteria	5512
394	Ga0070716_100001142	3300006173	Bacteria	11707
395	Ga0070716_100014236	3300006173	Bacteria	4072
396	Ga0070716_100046158	3300006173	Bacteria	2450
397	Ga0070716_100097542	3300006173	Bacteria	1794
398	Ga0070716_100100009	3300006173	Bacteria	1775
399	Ga0070712_100024007	3300006175	Bacteria	4034
400	Ga0070712_100067121	3300006175	Bacteria	2552
401	Ga0070712_100286863	3300006175	Bacteria	1328
402	Ga0075362_10019216	3300006177	Bacteria	2838
403	Ga0075362_10042466	3300006177	Bacteria	2010
404	Ga0075362_10046250	3300006177	Bacteria	1935
405	Ga0075362_10077020	3300006177	Bacteria	1532
406	Ga0075362_10093559	3300006177	Bacteria	1398
407	Ga0075367_10022968	3300006178	Bacteria	3504
408	Ga0075367_10050940	3300006178	Bacteria	2446
409	Ga0075367_10069015	3300006178	Bacteria	2121
410	Ga0075369_10001488	3300006186	Bacteria	7991
411	Ga0075369_10045018	3300006186	Bacteria	1897
412	Ga0075369_10045822	3300006186	Bacteria	1881
413	Ga0075369_10131036	3300006186	Bacteria	1139
414	Ga0075366_10005712	3300006195	Bacteria	6752
415	Ga0075366_10013458	3300006195	Bacteria	4659
416	Ga0097621_100002807	3300006237	Bacteria	11929
417	Ga0097621_100033028	3300006237	Bacteria	4117
418	Ga0097621_100137832	3300006237	Bacteria	2083
419	Ga0097621_100158478	3300006237	Bacteria	1944
420	Ga0075370_10006725	3300006353	Bacteria	5801
421	Ga0075370_10016448	3300006353	Bacteria	3980
422	Ga0075370_10032898	3300006353	Bacteria	2901
423	Ga0075370_10061359	3300006353	Bacteria	2142
424	Ga0068871_100031492	3300006358	Bacteria	4183
425	Ga0068871_100035550	3300006358	Bacteria	3960
426	Ga0068871_100079198	3300006358	Bacteria	2718
427	Ga0068871_100122118	3300006358	Bacteria	2201
428	Ga0068871_100211413	3300006358	Bacteria	1678
429	Ga0068871_100320609	3300006358	Bacteria	1364
430	Ga0075428_100001052	3300006844	Bacteria	29310
431	Ga0075428_100039764	3300006844	Bacteria	5176
432	Ga0075428_100164641	3300006844	Bacteria	2406
433	Ga0075428_100707426	3300006844	Bacteria	1073
434	Ga0075430_100000534	3300006846	Bacteria	28676
435	Ga0075430_100029014	3300006846	Bacteria	4697
436	Ga0075431_100000254	3300006847	Bacteria	40759
437	Ga0075431_100032436	3300006847	Bacteria	5382
438	Ga0075431_100545098	3300006847	Bacteria	1148
439	Ga0075433_10003127	3300006852	Bacteria	12750
440	Ga0075433_10037592	3300006852	Bacteria	4177
441	Ga0075433_10431746	3300006852	Bacteria	1161
442	Ga0075434_100002106	3300006871	Bacteria	17308
443	Ga0075429_100000200	3300006880	Bacteria	39608
444	Ga0075429_100006359	3300006880	Bacteria	10222
445	Ga0075429_100419214	3300006880	Bacteria	1172
446	Ga0068865_100006815	3300006881	Bacteria	6996
447	Ga0068865_100033834	3300006881	Bacteria	3424
448	Ga0068865_100072880	3300006881	Bacteria	2440
449	Ga0068865_100119517	3300006881	Bacteria	1957
450	Ga0068865_100192161	3300006881	Bacteria	1580
451	Ga0068865_100395507	3300006881	Bacteria	1131
452	Ga0097620_100005527	3300006931	Bacteria	12872
453	Ga0097620_100050860	3300006931	Bacteria	4163
454	Ga0097620_100057981	3300006931	Bacteria	3900
455	Ga0097620_100125338	3300006931	Bacteria	2637
456	Ga0097620_100269638	3300006931	Bacteria	1794
457	Ga0099825_1027246	3300006941	Bacteria	2929
458	Ga0099824_1016349	3300006942	Bacteria	6749
459	Ga0079104_1000724	3300006946	Bacteria	29488
460	Ga0075435_100016695	3300007076	Bacteria	5538
461	Ga0075435_100119440	3300007076	Bacteria	2199
462	Ga0075435_100152299	3300007076	Bacteria	1945
463	Ga0075435_100170922	3300007076	Bacteria	1833
464	Ga0099794_10008728	3300007265	Bacteria	4221
465	Ga0105250_10112414	3300009092	Bacteria	1116
466	Ga0105240_10004412	3300009093	Bacteria	21461
467	Ga0105240_10008091	3300009093	Bacteria	15101
468	Ga0105240_10008642	3300009093	Bacteria	14552
469	Ga0105240_10010045	3300009093	Bacteria	13330
470	Ga0105240_10012019	3300009093	Bacteria	12001
471	Ga0105240_10015247	3300009093	Bacteria	10456
472	Ga0105240_10017488	3300009093	Bacteria	9663
473	Ga0105240_10034973	3300009093	Bacteria	6478
474	Ga0105240_10090434	3300009093	Bacteria	3741
475	Ga0105240_10090511	3300009093	Bacteria	3739
476	Ga0105240_10106678	3300009093	Bacteria	3397
477	Ga0105240_10108292	3300009093	Bacteria	3367
478	Ga0105240_10471305	3300009093	Bacteria	1401
479	Ga0105240_10760145	3300009093	Bacteria	1053
480	Ga0111539_10000564	3300009094	Bacteria	47420
481	Ga0111539_10012366	3300009094	Bacteria	10699
482	Ga0111539_10070747	3300009094	Bacteria	4118
483	Ga0111539_10082393	3300009094	Bacteria	3784
484	Ga0111539_10089824	3300009094	Bacteria	3610
485	Ga0111539_10094281	3300009094	Bacteria	3516
486	Ga0111539_10193811	3300009094	Bacteria	2370
487	Ga0111539_10244053	3300009094	Bacteria	2091
488	Ga0111539_10313824	3300009094	Bacteria	1825
489	Ga0105245_10040531	3300009098	Bacteria	4150
490	Ga0105245_10163250	3300009098	Bacteria	2115
491	Ga0105245_10189152	3300009098	Bacteria	1971
492	Ga0105245_10229063	3300009098	Bacteria	1796
493	Ga0105245_10543751	3300009098	Bacteria	1183
494	Ga0105247_10073195	3300009101	Bacteria	2146
495	Ga0105247_10108294	3300009101	Bacteria	1785
496	Ga0105247_10122189	3300009101	Bacteria	1689
497	Ga0114129_10000401	3300009147	Bacteria	50696
498	Ga0114129_10011646	3300009147	Bacteria	12519
499	Ga0114129_10226999	3300009147	Bacteria	2516
500	Ga0114129_10647731	3300009147	Bacteria	1364
501	Ga0105243_10001009	3300009148	Bacteria	26043
502	Ga0105243_10006328	3300009148	Bacteria	9146
503	Ga0105243_10108321	3300009148	Bacteria	2319
504	Ga0105243_10285668	3300009148	Bacteria	1488
505	Ga0105243_10324969	3300009148	Bacteria	1403
506	Ga0105243_10457638	3300009148	Bacteria	1199
507	Ga0105243_10512711	3300009148	Bacteria	1139
508	Ga0105243_10590422	3300009148	Bacteria	1068
509	Ga0105241_10004915	3300009174	Bacteria	9852
510	Ga0105241_10024079	3300009174	Bacteria	4521
511	Ga0105241_10072272	3300009174	Bacteria	2680
512	Ga0105241_10145832	3300009174	Bacteria	1931
513	Ga0105242_10002274	3300009176	Bacteria	15171
514	Ga0105242_10012513	3300009176	Bacteria	6532
515	Ga0105242_10141549	3300009176	Bacteria	2088
516	Ga0105242_10264759	3300009176	Bacteria	1554
517	Ga0105242_10324652	3300009176	Bacteria	1413
518	Ga0105242_10334141	3300009176	Bacteria	1394
519	Ga0105242_10652965	3300009176	Bacteria	1023
520	Ga0105248_10028788	3300009177	Bacteria	6192
521	Ga0105248_10041091	3300009177	Bacteria	5184
522	Ga0105248_10089860	3300009177	Bacteria	3458
523	Ga0105248_10111773	3300009177	Bacteria	3081
524	Ga0105248_10392028	3300009177	Bacteria	1564
525	Ga0105248_10552465	3300009177	Bacteria	1299
526	Ga0105248_10576570	3300009177	Bacteria	1269
527	Ga0105237_10000892	3300009545	Bacteria	40254
528	Ga0105237_10006394	3300009545	Bacteria	13075
529	Ga0105237_10007390	3300009545	Bacteria	12032
530	Ga0105237_10087486	3300009545	Bacteria	3105
531	Ga0105237_10097877	3300009545	Bacteria	2925
532	Ga0105237_10119279	3300009545	Bacteria	2632
533	Ga0105237_10125521	3300009545	Bacteria	2561
534	Ga0105237_10138637	3300009545	Bacteria	2427
535	Ga0105237_10362669	3300009545	Bacteria	1453
536	Ga0105237_10492705	3300009545	Bacteria	1232
537	Ga0105238_10018146	3300009551	Bacteria	7155
538	Ga0105238_10021641	3300009551	Bacteria	6550
539	Ga0105238_10024436	3300009551	Bacteria	6159
540	Ga0105238_10026218	3300009551	Bacteria	5939
541	Ga0105238_10113334	3300009551	Bacteria	2691
542	Ga0105238_10192185	3300009551	Bacteria	2017
543	Ga0105238_10206214	3300009551	Bacteria	1942
544	Ga0105238_10242693	3300009551	Bacteria	1779
545	Ga0105238_10396505	3300009551	Bacteria	1373
546	Ga0105238_10450042	3300009551	Bacteria	1285
547	Ga0105238_10520468	3300009551	Bacteria	1192
548	Ga0105249_10006166	3300009553	Bacteria	10404
549	Ga0105249_10153100	3300009553	Bacteria	2222
550	Ga0105249_10246814	3300009553	Bacteria	1768
551	Ga0105249_10280156	3300009553	Bacteria	1665
552	Ga0099796_10023926	3300010159	Bacteria	1912
553	Ga0105239_10006372	3300010375	Bacteria	13711
554	Ga0105239_10031875	3300010375	Bacteria	5792
555	Ga0105239_10038605	3300010375	Bacteria	5234
556	Ga0105239_10039382	3300010375	Bacteria	5179
557	Ga0105239_10083653	3300010375	Bacteria	3514
558	Ga0105239_10384083	3300010375	Bacteria	1588
559	Ga0105239_10838527	3300010375	Bacteria	1054
560	Ga0105246_10003387	3300011119	Bacteria	9655
561	Ga0105246_10025946	3300011119	Bacteria	3822
562	Ga0105246_10074656	3300011119	Bacteria	2398
563	Ga0105246_10094126	3300011119	Bacteria	2166
564	Ga0105246_10140827	3300011119	Bacteria	1813
565	Ga0157342_1008141	3300012507	Bacteria	1032
566	Ga0157373_10029298	3300013100	Bacteria	3965
567	Ga0157373_10049807	3300013100	Bacteria	2984
568	Ga0157373_10053043	3300013100	Bacteria	2883
569	Ga0157371_10066941	3300013102	Bacteria	2543
570	Ga0157370_10002015	3300013104	Bacteria	24961
571	Ga0157370_10038514	3300013104	Bacteria	4624
572	Ga0157370_10068482	3300013104	Bacteria	3354
573	Ga0157370_10084692	3300013104	Bacteria	2979
574	Ga0157370_10144763	3300013104	Bacteria	2213
575	Ga0157370_10239308	3300013104	Bacteria	1680
576	Ga0157369_10012743	3300013105	Bacteria	9534
577	Ga0157369_10016806	3300013105	Bacteria	8224
578	Ga0157369_10066983	3300013105	Bacteria	3862
579	Ga0157369_10332266	3300013105	Bacteria	1579
580	Ga0157374_10004594	3300013296	Bacteria	11576
581	Ga0157374_10007579	3300013296	Bacteria	9262
582	Ga0157374_10035746	3300013296	Bacteria	4546
583	Ga0157374_10173041	3300013296	Bacteria	2107
584	Ga0157374_10199058	3300013296	Bacteria	1961
585	Ga0157374_10227860	3300013296	Bacteria	1830
586	Ga0157374_10403583	3300013296	Bacteria	1364
587	Ga0157378_10032048	3300013297	Bacteria	4643
588	Ga0157378_10053721	3300013297	Bacteria	3587
589	Ga0157378_10101211	3300013297	Bacteria	2632
590	Ga0157378_10169792	3300013297	Bacteria	2045
591	Ga0163162_10007077	3300013306	Bacteria	10885
592	Ga0163162_10029211	3300013306	Bacteria	5456
593	Ga0163162_10080781	3300013306	Bacteria	3320
594	Ga0163162_10140829	3300013306	Bacteria	2525
595	Ga0163162_10395262	3300013306	Bacteria	1515
596	Ga0157372_10057177	3300013307	Bacteria	4360
597	Ga0157372_10092400	3300013307	Bacteria	3442
598	Ga0157372_10355368	3300013307	Bacteria	1707
599	Ga0157372_10720877	3300013307	Bacteria	1160
600	Ga0157375_10016147	3300013308	Bacteria	6697
601	Ga0157375_10068425	3300013308	Bacteria	3553
602	Ga0157375_10115048	3300013308	Bacteria	2793
603	Ga0157375_10123080	3300013308	Bacteria	2706
604	Ga0157375_10232686	3300013308	Bacteria	2002
605	Ga0157375_10635269	3300013308	Bacteria	1225
606	Ga0163163_10005130	3300014325	Bacteria	11291
607	Ga0163163_10128078	3300014325	Bacteria	2577
608	Ga0163163_10227834	3300014325	Bacteria	1913
609	Ga0163163_10251131	3300014325	Bacteria	1819
610	Ga0163163_10266619	3300014325	Bacteria	1764
611	Ga0163163_10311256	3300014325	Bacteria	1628
612	Ga0163163_10559056	3300014325	Bacteria	1207
613	Ga0157380_10543291	3300014326	Bacteria	1138
614	Ga0182008_10001406	3300014497	Bacteria	16196
615	Ga0182008_10034814	3300014497	Bacteria	2524
616	Ga0157377_10000226	3300014745	Bacteria	29529
617	Ga0157377_10285272	3300014745	Bacteria	1084
618	Ga0157379_10006804	3300014968	Bacteria	9883
619	Ga0157379_10006836	3300014968	Bacteria	9858
620	Ga0157379_10207663	3300014968	Bacteria	1772
621	Ga0157376_10019350	3300014969	Bacteria	5246
622	Ga0157376_10276079	3300014969	Bacteria	1581
623	Ga0163161_10009467	3300017792	Bacteria	6742
624	Ga0163161_10100605	3300017792	Bacteria	2151
625	Ga0206354_11011613	3300020081	Bacteria	3396
626	Ga0206353_10844025	3300020082	Bacteria	6329
627	Ga0214544_1000055	3300021320	Bacteria	133217
628	Ga0214542_1003337	3300021321	Bacteria	32859
629	Ga0214542_1026901	3300021321	Bacteria	2723
630	Ga0214545_1000028	3300021324	Bacteria	127957
631	Ga0214545_1026201	3300021324	Bacteria	3213
632	Ga0214543_1000044	3300021327	Bacteria	158132
633	Ga0214543_1028673	3300021327	Bacteria	2600
634	Ga0213873_10000702	3300021358	Bacteria	5450
635	Ga0213873_10022236	3300021358	Bacteria	1500
636	Ga0213872_10000018	3300021361	Bacteria	175951
637	Ga0213872_10002065	3300021361	Bacteria	12162
638	Ga0213872_10011223	3300021361	Bacteria	4243
639	Ga0213872_10053333	3300021361	Bacteria	1834
640	Ga0213872_10064933	3300021361	Bacteria	1648
641	Ga0213874_10000116	3300021377	Bacteria	13265
642	Ga0213876_10000739	3300021384	Bacteria	22677
643	Ga0213876_10077582	3300021384	Bacteria	1755
644	Ga0213876_10085625	3300021384	Bacteria	1668
645	Ga0213876_10110427	3300021384	Bacteria	1460
646	Ga0213876_10136138	3300021384	Bacteria	1307
647	Ga0213871_10040830	3300021441	Bacteria	1245
648	Ga0209672_100460	3300025228	Bacteria	23072
649	Ga0209147_100840	3300025229	Bacteria	14431
650	Ga0209258_100015	3300025242	Bacteria	706310
651	Ga0207425_1000244	3300025245	Bacteria	41649
652	Ga0207425_1002150	3300025245	Bacteria	7207
653	Ga0209677_100280	3300025253	Bacteria	34034
654	Ga0209677_103878	3300025253	Bacteria	4589
655	Ga0209148_1000028	3300025254	Bacteria	582773
656	Ga0209148_1000224	3300025254	Bacteria	92967
657	Ga0209129_1000049	3300025258	Bacteria	268086
658	Ga0209129_1000908	3300025258	Bacteria	18128
659	Ga0209129_1010353	3300025258	Bacteria	2336
660	Ga0209233_1001356	3300025261	Bacteria	9764
661	Ga0209233_1003282	3300025261	Bacteria	5737
662	Ga0209233_1024180	3300025261	Bacteria	1524
663	Ga0209565_1000862	3300025263	Bacteria	16807
664	Ga0209565_1001345	3300025263	Bacteria	11184
665	Ga0209455_1000635	3300025272	Bacteria	21604
666	Ga0209455_1008356	3300025272	Bacteria	2820
667	Ga0209673_1000477	3300025273	Bacteria	66849
668	Ga0209673_1002692	3300025273	Bacteria	11833
669	Ga0209130_1000267	3300025284	Bacteria	65435
670	Ga0209130_1003103	3300025284	Bacteria	7411
671	Ga0209130_1005512	3300025284	Bacteria	4362
672	Ga0209675_1005805	3300025291	Bacteria	5081
673	Ga0209676_1000026	3300025292	Bacteria	574599
674	Ga0209676_1000137	3300025292	Bacteria	179437
675	Ga0209676_1016289	3300025292	Bacteria	2691
676	Ga0209025_1000265	3300025294	Bacteria	123182
677	Ga0209025_1000481	3300025294	Bacteria	77405
678	Ga0209025_1002411	3300025294	Bacteria	19909
679	Ga0209025_1035647	3300025294	Bacteria	2244
680	Ga0209025_1039009	3300025294	Bacteria	2079
681	Ga0209564_1000023	3300025295	Bacteria	555102
682	Ga0209564_1000141	3300025295	Bacteria	179852
683	Ga0209564_1000936	3300025295	Bacteria	37836
684	Ga0209564_1001368	3300025295	Bacteria	25567
685	Ga0209564_1001413	3300025295	Bacteria	24762
686	Ga0209564_1016873	3300025295	Bacteria	2880
687	Ga0209564_1031662	3300025295	Bacteria	1610
688	Ga0209564_1033997	3300025295	Bacteria	1504
689	Ga0209758_1000075	3300025297	Bacteria	271585
690	Ga0209758_1000087	3300025297	Bacteria	254384
691	Ga0209758_1000135	3300025297	Bacteria	177753
692	Ga0209758_1001472	3300025297	Bacteria	27590
693	Ga0209758_1002263	3300025297	Bacteria	19964
694	Ga0209758_1003895	3300025297	Bacteria	13047
695	Ga0209758_1004550	3300025297	Bacteria	11455
696	Ga0209758_1006443	3300025297	Bacteria	8432
697	Ga0209758_1009361	3300025297	Bacteria	6104
698	Ga0209758_1012485	3300025297	Bacteria	4751
699	Ga0209758_1014095	3300025297	Bacteria	4288
700	Ga0209758_1035129	3300025297	Bacteria	1980
701	Ga0209050_1000015	3300025298	Bacteria	759102
702	Ga0209050_1038483	3300025298	Bacteria	1363
703	Ga0209256_1000129	3300025299	Bacteria	163766
704	Ga0209256_1000330	3300025299	Bacteria	79958
705	Ga0209256_1000604	3300025299	Bacteria	49837
706	Ga0209256_1006248	3300025299	Bacteria	6406
707	Ga0207426_1000160	3300025302	Bacteria	174540
708	Ga0207426_1000171	3300025302	Bacteria	163766
709	Ga0207426_1000185	3300025302	Bacteria	154146
710	Ga0207426_1000287	3300025302	Bacteria	100566
711	Ga0207426_1000289	3300025302	Bacteria	99963
712	Ga0207426_1002426	3300025302	Bacteria	11930
713	Ga0207426_1047672	3300025302	Bacteria	1291
714	Ga0209051_1000010	3300025303	Bacteria	641298
715	Ga0209051_1027886	3300025303	Bacteria	2241
716	Ga0209257_1000026	3300025304	Bacteria	723225
717	Ga0209257_1000382	3300025304	Bacteria	88368
718	Ga0207697_10008917	3300025315	Bacteria	4358
719	Ga0207697_10013135	3300025315	Bacteria	3459
720	Ga0207697_10029703	3300025315	Bacteria	2238
721	Ga0207697_10071932	3300025315	Bacteria	1449
722	Ga0207682_10002804	3300025893	Bacteria	7709
723	Ga0207682_10138857	3300025893	Bacteria	1089
724	Ga0207692_10008762	3300025898	Bacteria	4201
725	Ga0207692_10030805	3300025898	Bacteria	2562
726	Ga0207692_10278002	3300025898	Bacteria	1012
727	Ga0207642_10120723	3300025899	Bacteria	1351
728	Ga0207710_10018385	3300025900	Bacteria	2972
729	Ga0207688_10011258	3300025901	Bacteria	4868
730	Ga0207688_10045160	3300025901	Bacteria	2457
731	Ga0207688_10094381	3300025901	Bacteria	1721
732	Ga0207688_10101948	3300025901	Bacteria	1658
733	Ga0207647_10000181	3300025904	Bacteria	50570
734	Ga0207647_10008822	3300025904	Bacteria	7197
735	Ga0207647_10028859	3300025904	Bacteria	3598
736	Ga0207647_10050867	3300025904	Bacteria	2564
737	Ga0207647_10052761	3300025904	Bacteria	2509
738	Ga0207647_10249175	3300025904	Bacteria	1019
739	Ga0207647_10254112	3300025904	Bacteria	1007
740	Ga0207685_10000117	3300025905	Bacteria	11992
741	Ga0207699_10000561	3300025906	Bacteria	18332
742	Ga0207699_10002981	3300025906	Bacteria	8050
743	Ga0207699_10345747	3300025906	Bacteria	1049
744	Ga0207645_10021282	3300025907	Bacteria	4231
745	Ga0207645_10027095	3300025907	Bacteria	3703
746	Ga0207645_10070297	3300025907	Bacteria	2239
747	Ga0207645_10102883	3300025907	Bacteria	1844
748	Ga0207645_10114768	3300025907	Bacteria	1745
749	Ga0207643_10056467	3300025908	Bacteria	2233
750	Ga0207705_10000002	3300025909	Bacteria	2046852
751	Ga0207705_10002417	3300025909	Bacteria	14410
752	Ga0207705_10014317	3300025909	Bacteria	5708
753	Ga0207705_10029640	3300025909	Bacteria	3901
754	Ga0207705_10038453	3300025909	Bacteria	3426
755	Ga0207705_10087687	3300025909	Bacteria	2276
756	Ga0207705_10088868	3300025909	Bacteria	2260
757	Ga0207705_10143894	3300025909	Bacteria	1782
758	Ga0207705_10224070	3300025909	Bacteria	1429
759	Ga0207705_10231313	3300025909	Bacteria	1406
760	Ga0207705_10313401	3300025909	Bacteria	1205
761	Ga0207705_10482578	3300025909	Bacteria	962
762	Ga0207684_10039712	3300025910	Bacteria	3991
763	Ga0207684_10111434	3300025910	Bacteria	2342
764	Ga0207684_10125240	3300025910	Bacteria	2204
765	Ga0207654_10019399	3300025911	Bacteria	3588
766	Ga0207654_10020194	3300025911	Bacteria	3528
767	Ga0207654_10173564	3300025911	Bacteria	1402
768	Ga0207654_10250098	3300025911	Bacteria	1188
769	Ga0207707_10007110	3300025912	Bacteria	9751
770	Ga0207707_10016413	3300025912	Bacteria	6459
771	Ga0207707_10054341	3300025912	Bacteria	3486
772	Ga0207707_10058645	3300025912	Bacteria	3350
773	Ga0207707_10091506	3300025912	Bacteria	2658
774	Ga0207707_10098243	3300025912	Bacteria	2559
775	Ga0207707_10105844	3300025912	Bacteria	2459
776	Ga0207707_10248773	3300025912	Bacteria	1544
777	Ga0207707_10356729	3300025912	Bacteria	1259
778	Ga0207695_10000029	3300025913	Bacteria	548364
779	Ga0207695_10004391	3300025913	Bacteria	19276
780	Ga0207695_10006972	3300025913	Bacteria	14506
781	Ga0207695_10035319	3300025913	Bacteria	5423
782	Ga0207695_10091535	3300025913	Bacteria	3055
783	Ga0207695_10106653	3300025913	Bacteria	2788
784	Ga0207695_10155990	3300025913	Bacteria	2217
785	Ga0207695_10243096	3300025913	Bacteria	1701
786	Ga0207671_10005591	3300025914	Bacteria	11545
787	Ga0207671_10015933	3300025914	Bacteria	5861
788	Ga0207671_10025983	3300025914	Bacteria	4392
789	Ga0207671_10036268	3300025914	Bacteria	3657
790	Ga0207671_10091344	3300025914	Bacteria	2294
791	Ga0207671_10132033	3300025914	Bacteria	1917
792	Ga0207671_10163587	3300025914	Bacteria	1724
793	Ga0207671_10248068	3300025914	Bacteria	1399
794	Ga0207671_10260703	3300025914	Bacteria	1364
795	Ga0207671_10322926	3300025914	Bacteria	1222
796	Ga0207693_10000326	3300025915	Bacteria	44051
797	Ga0207693_10005581	3300025915	Bacteria	10467
798	Ga0207693_10053622	3300025915	Bacteria	3164
799	Ga0207693_10097801	3300025915	Bacteria	2302
800	Ga0207693_10228311	3300025915	Bacteria	1462
801	Ga0207663_10000362	3300025916	Bacteria	19744
802	Ga0207663_10010962	3300025916	Bacteria	4845
803	Ga0207663_10012171	3300025916	Bacteria	4642
804	Ga0207663_10172511	3300025916	Bacteria	1537
805	Ga0207660_10001628	3300025917	Bacteria	15062
806	Ga0207660_10036788	3300025917	Bacteria	3405
807	Ga0207660_10049154	3300025917	Bacteria	2987
808	Ga0207660_10065702	3300025917	Bacteria	2622
809	Ga0207660_10108315	3300025917	Bacteria	2086
810	Ga0207660_10250685	3300025917	Bacteria	1397
811	Ga0207660_10298469	3300025917	Bacteria	1282
812	Ga0207662_10094697	3300025918	Bacteria	1842
813	Ga0207662_10122103	3300025918	Bacteria	1635
814	Ga0207657_10000659	3300025919	Bacteria	36733
815	Ga0207657_10001814	3300025919	Bacteria	23056
816	Ga0207657_10005795	3300025919	Bacteria	12876
817	Ga0207657_10006465	3300025919	Bacteria	12143
818	Ga0207657_10007485	3300025919	Bacteria	11190
819	Ga0207657_10013513	3300025919	Bacteria	8007
820	Ga0207657_10020740	3300025919	Bacteria	6202
821	Ga0207657_10036996	3300025919	Bacteria	4364
822	Ga0207657_10039797	3300025919	Bacteria	4173
823	Ga0207657_10044542	3300025919	Bacteria	3900
824	Ga0207657_10048009	3300025919	Bacteria	3729
825	Ga0207657_10054494	3300025919	Bacteria	3458
826	Ga0207657_10064044	3300025919	Bacteria	3140
827	Ga0207657_10089783	3300025919	Bacteria	2565
828	Ga0207649_10041654	3300025920	Bacteria	2796
829	Ga0207649_10053618	3300025920	Bacteria	2507
830	Ga0207649_10092968	3300025920	Bacteria	1978
831	Ga0207649_10200893	3300025920	Bacteria	1408
832	Ga0207649_10254929	3300025920	Bacteria	1265
833	Ga0207649_10394928	3300025920	Bacteria	1034
834	Ga0207652_10000001	3300025921	Bacteria	1006643
835	Ga0207652_10013066	3300025921	Bacteria	6720
836	Ga0207652_10023863	3300025921	Bacteria	5072
837	Ga0207652_10026596	3300025921	Bacteria	4821
838	Ga0207652_10054634	3300025921	Bacteria	3433
839	Ga0207652_10059606	3300025921	Bacteria	3291
840	Ga0207652_10158790	3300025921	Bacteria	2026
841	Ga0207652_10236329	3300025921	Bacteria	1647
842	Ga0207652_10310722	3300025921	Bacteria	1423
843	Ga0207652_10447979	3300025921	Bacteria	1164
844	Ga0207652_10489822	3300025921	Bacteria	1107
845	Ga0207646_10005973	3300025922	Bacteria	12696
846	Ga0207646_10068196	3300025922	Bacteria	3177
847	Ga0207646_10106774	3300025922	Bacteria	2512
848	Ga0207646_10128892	3300025922	Bacteria	2276
849	Ga0207681_10002516	3300025923	Bacteria	11651
850	Ga0207681_10016135	3300025923	Bacteria	4666
851	Ga0207681_10040964	3300025923	Bacteria	3085
852	Ga0207681_10075463	3300025923	Bacteria	2365
853	Ga0207681_10239877	3300025923	Bacteria	1411
854	Ga0207681_10259592	3300025923	Bacteria	1360
855	Ga0207681_10454771	3300025923	Bacteria	1042
856	Ga0207681_10458556	3300025923	Bacteria	1038
857	Ga0207681_10535428	3300025923	Bacteria	962
858	Ga0207694_10002889	3300025924	Bacteria	13820
859	Ga0207694_10007413	3300025924	Bacteria	8320
860	Ga0207694_10048259	3300025924	Bacteria	3294
861	Ga0207694_10184916	3300025924	Bacteria	1691
862	Ga0207694_10232074	3300025924	Bacteria	1507
863	Ga0207694_10247543	3300025924	Bacteria	1458
864	Ga0207694_10261222	3300025924	Bacteria	1418
865	Ga0207650_10008732	3300025925	Bacteria	6921
866	Ga0207650_10037599	3300025925	Bacteria	3528
867	Ga0207650_10071022	3300025925	Bacteria	2618
868	Ga0207659_10000728	3300025926	Bacteria	19479
869	Ga0207659_10023583	3300025926	Bacteria	4109
870	Ga0207659_10025581	3300025926	Bacteria	3968
871	Ga0207659_10052290	3300025926	Bacteria	2909
872	Ga0207659_10059700	3300025926	Bacteria	2742
873	Ga0207659_10209002	3300025926	Bacteria	1563
874	Ga0207687_10066128	3300025927	Bacteria	2569
875	Ga0207687_10128342	3300025927	Bacteria	1907
876	Ga0207687_10290627	3300025927	Bacteria	1313
877	Ga0207687_10300079	3300025927	Bacteria	1294
878	Ga0207700_10023512	3300025928	Bacteria	4250
879	Ga0207700_10033458	3300025928	Bacteria	3678
880	Ga0207700_10063462	3300025928	Bacteria	2809
881	Ga0207700_10068438	3300025928	Bacteria	2721
882	Ga0207700_10101172	3300025928	Bacteria	2299
883	Ga0207664_10001455	3300025929	Bacteria	15548
884	Ga0207664_10054799	3300025929	Bacteria	3161
885	Ga0207664_10077877	3300025929	Bacteria	2687
886	Ga0207664_10145266	3300025929	Bacteria	2011
887	Ga0207664_10168261	3300025929	Bacteria	1874
888	Ga0207664_10174619	3300025929	Bacteria	1841
889	Ga0207644_10207584	3300025931	Bacteria	1547
890	Ga0207644_10630620	3300025931	Bacteria	891
891	Ga0207690_10000005	3300025932	Bacteria	581199
892	Ga0207690_10002077	3300025932	Bacteria	12273
893	Ga0207690_10023248	3300025932	Bacteria	3867
894	Ga0207690_10111848	3300025932	Bacteria	1969
895	Ga0207690_10159624	3300025932	Bacteria	1680
896	Ga0207690_10202669	3300025932	Bacteria	1508
897	Ga0207690_10208624	3300025932	Bacteria	1488
898	Ga0207690_10261763	3300025932	Bacteria	1340
899	Ga0207690_10423770	3300025932	Bacteria	1065
900	Ga0207706_10002491	3300025933	Bacteria	17939
901	Ga0207706_10012557	3300025933	Bacteria	7713
902	Ga0207706_10028060	3300025933	Bacteria	5029
903	Ga0207706_10046173	3300025933	Bacteria	3857
904	Ga0207706_10054774	3300025933	Bacteria	3519
905	Ga0207706_10060522	3300025933	Bacteria	3335
906	Ga0207706_10066703	3300025933	Bacteria	3167
907	Ga0207706_10081504	3300025933	Bacteria	2843
908	Ga0207706_10124927	3300025933	Bacteria	2263
909	Ga0207706_10206678	3300025933	Bacteria	1721
910	Ga0207706_10237268	3300025933	Bacteria	1594
911	Ga0207706_10249811	3300025933	Bacteria	1550
912	Ga0207706_10432815	3300025933	Bacteria	1139
913	Ga0207706_10522637	3300025933	Bacteria	1023
914	Ga0207686_10003755	3300025934	Bacteria	8149
915	Ga0207686_10031355	3300025934	Bacteria	3155
916	Ga0207686_10521112	3300025934	Bacteria	925
917	Ga0207709_10001388	3300025935	Bacteria	16960
918	Ga0207709_10003465	3300025935	Bacteria	9360
919	Ga0207709_10018084	3300025935	Bacteria	3943
920	Ga0207709_10109204	3300025935	Bacteria	1846
921	Ga0207709_10158082	3300025935	Bacteria	1578
922	Ga0207670_10186242	3300025936	Bacteria	1567
923	Ga0207670_10336348	3300025936	Bacteria	1192
924	Ga0207669_10007280	3300025937	Bacteria	5104
925	Ga0207669_10057454	3300025937	Bacteria	2369
926	Ga0207669_10137518	3300025937	Bacteria	1690
927	Ga0207669_10252765	3300025937	Bacteria	1313
928	Ga0207704_10012151	3300025938	Bacteria	4265
929	Ga0207704_10016958	3300025938	Bacteria	3761
930	Ga0207704_10265710	3300025938	Bacteria	1296
931	Ga0207665_10000194	3300025939	Bacteria	40747
932	Ga0207665_10028096	3300025939	Bacteria	3715
933	Ga0207665_10155356	3300025939	Bacteria	1642
934	Ga0207691_10004302	3300025940	Bacteria	13826
935	Ga0207691_10013936	3300025940	Bacteria	7670
936	Ga0207691_10047595	3300025940	Bacteria	3935
937	Ga0207691_10057577	3300025940	Bacteria	3536
938	Ga0207691_10059944	3300025940	Bacteria	3460
939	Ga0207691_10080680	3300025940	Bacteria	2926
940	Ga0207691_10223872	3300025940	Bacteria	1630
941	Ga0207711_10052734	3300025941	Bacteria	3487
942	Ga0207711_10062894	3300025941	Bacteria	3203
943	Ga0207711_10252160	3300025941	Bacteria	1621
944	Ga0207711_10544084	3300025941	Bacteria	1083
945	Ga0207689_10031582	3300025942	Bacteria	4408
946	Ga0207689_10050489	3300025942	Bacteria	3429
947	Ga0207689_10063968	3300025942	Bacteria	3027
948	Ga0207689_10205324	3300025942	Bacteria	1627
949	Ga0207689_10225223	3300025942	Bacteria	1550
950	Ga0207689_10359730	3300025942	Bacteria	1210
951	Ga0207689_10417005	3300025942	Bacteria	1120
952	Ga0207661_10026021	3300025944	Bacteria	4454
953	Ga0207661_10033925	3300025944	Bacteria	3964
954	Ga0207661_10047181	3300025944	Bacteria	3418
955	Ga0207661_10207545	3300025944	Bacteria	1725
956	Ga0207661_10470036	3300025944	Bacteria	1147
957	Ga0207679_10016166	3300025945	Bacteria	4948
958	Ga0207679_10071622	3300025945	Bacteria	2615
959	Ga0207679_10080112	3300025945	Bacteria	2492
960	Ga0207679_10100558	3300025945	Bacteria	2260
961	Ga0207679_10327661	3300025945	Bacteria	1328
962	Ga0207679_10462479	3300025945	Bacteria	1127
963	Ga0207667_10002854	3300025949	Bacteria	21441
964	Ga0207667_10004603	3300025949	Bacteria	16917
965	Ga0207667_10018732	3300025949	Bacteria	7753
966	Ga0207667_10024903	3300025949	Bacteria	6561
967	Ga0207667_10026378	3300025949	Bacteria	6349
968	Ga0207667_10064921	3300025949	Bacteria	3809
969	Ga0207667_10078368	3300025949	Bacteria	3425
970	Ga0207667_10085761	3300025949	Bacteria	3259
971	Ga0207667_10092539	3300025949	Bacteria	3123
972	Ga0207667_10122480	3300025949	Bacteria	2679
973	Ga0207667_10364303	3300025949	Bacteria	1474
974	Ga0207667_10433782	3300025949	Bacteria	1336
975	Ga0207667_10527027	3300025949	Bacteria	1196
976	Ga0207651_10060955	3300025960	Bacteria	2621
977	Ga0207651_10062185	3300025960	Bacteria	2600
978	Ga0207651_10275366	3300025960	Bacteria	1388
979	Ga0207651_10586741	3300025960	Bacteria	973
980	Ga0207712_10002025	3300025961	Bacteria	13300
981	Ga0207712_10063785	3300025961	Bacteria	2624
982	Ga0207712_10153755	3300025961	Bacteria	1780
983	Ga0207712_10245022	3300025961	Bacteria	1446
984	Ga0207668_10000580	3300025972	Bacteria	22885
985	Ga0207668_10020304	3300025972	Bacteria	4218
986	Ga0207668_10077701	3300025972	Bacteria	2394
987	Ga0207668_10163641	3300025972	Bacteria	1736
988	Ga0207668_10184124	3300025972	Bacteria	1650
989	Ga0207668_10385701	3300025972	Bacteria	1180
990	Ga0207668_10392227	3300025972	Bacteria	1171
991	Ga0207668_10445639	3300025972	Bacteria	1104
992	Ga0207640_10000024	3300025981	Bacteria	154876
993	Ga0207640_10179941	3300025981	Bacteria	1584
994	Ga0207658_10137690	3300025986	Bacteria	1971
995	Ga0207658_10197868	3300025986	Bacteria	1675
996	Ga0207677_10000845	3300026023	Bacteria	17515
997	Ga0207677_10030563	3300026023	Bacteria	3440
998	Ga0207677_10030598	3300026023	Bacteria	3438
999	Ga0207677_10376047	3300026023	Bacteria	1198
1000	Ga0207677_10388963	3300026023	Bacteria	1179
1001	Ga0207677_10498893	3300026023	Bacteria	1052
1002	Ga0207703_10006101	3300026035	Bacteria	9641
1003	Ga0207703_10042309	3300026035	Bacteria	3654
1004	Ga0207703_10045380	3300026035	Bacteria	3535
1005	Ga0207703_10051821	3300026035	Bacteria	3329
1006	Ga0207703_10073678	3300026035	Bacteria	2825
1007	Ga0207703_10092531	3300026035	Bacteria	2545
1008	Ga0207703_10170664	3300026035	Bacteria	1913
1009	Ga0207703_10411687	3300026035	Bacteria	1256
1010	Ga0207639_10039358	3300026041	Bacteria	3522
1011	Ga0207639_10205196	3300026041	Bacteria	1693
1012	Ga0207639_10209611	3300026041	Bacteria	1677
1013	Ga0207639_10399122	3300026041	Bacteria	1238
1014	Ga0207678_10033232	3300026067	Bacteria	4495
1015	Ga0207678_10046104	3300026067	Bacteria	3770
1016	Ga0207678_10054300	3300026067	Bacteria	3450
1017	Ga0207678_10063670	3300026067	Bacteria	3169
1018	Ga0207678_10073540	3300026067	Bacteria	2929
1019	Ga0207678_10109704	3300026067	Bacteria	2354
1020	Ga0207678_10117286	3300026067	Bacteria	2271
1021	Ga0207678_10162784	3300026067	Bacteria	1905
1022	Ga0207678_10244407	3300026067	Bacteria	1537
1023	Ga0207702_10001454	3300026078	Bacteria	23549
1024	Ga0207702_10008316	3300026078	Bacteria	8762
1025	Ga0207702_10031585	3300026078	Bacteria	4414
1026	Ga0207702_10082530	3300026078	Bacteria	2795
1027	Ga0207702_10084485	3300026078	Bacteria	2764
1028	Ga0207702_10139034	3300026078	Bacteria	2195
1029	Ga0207641_10006863	3300026088	Bacteria	9527
1030	Ga0207641_10020003	3300026088	Bacteria	5495
1031	Ga0207641_10258004	3300026088	Bacteria	1631
1032	Ga0207648_10000421	3300026089	Bacteria	46603
1033	Ga0207648_10006730	3300026089	Bacteria	11400
1034	Ga0207648_10030619	3300026089	Bacteria	4763
1035	Ga0207648_10042420	3300026089	Bacteria	3993
1036	Ga0207648_10059352	3300026089	Bacteria	3336
1037	Ga0207648_10095094	3300026089	Bacteria	2606
1038	Ga0207648_10109752	3300026089	Bacteria	2422
1039	Ga0207648_10155281	3300026089	Bacteria	2020
1040	Ga0207648_10163445	3300026089	Bacteria	1967
1041	Ga0207676_10015791	3300026095	Bacteria	5459
1042	Ga0207676_10071808	3300026095	Bacteria	2780
1043	Ga0207676_10072113	3300026095	Bacteria	2775
1044	Ga0207676_10166326	3300026095	Bacteria	1917
1045	Ga0207676_10245714	3300026095	Bacteria	1608
1046	Ga0207676_10282285	3300026095	Bacteria	1508
1047	Ga0207674_10011986	3300026116	Bacteria	9715
1048	Ga0207674_10018313	3300026116	Bacteria	7615
1049	Ga0207674_10020525	3300026116	Bacteria	7135
1050	Ga0207674_10063613	3300026116	Bacteria	3724
1051	Ga0207674_10074616	3300026116	Bacteria	3403
1052	Ga0207674_10081339	3300026116	Bacteria	3241
1053	Ga0207674_10090990	3300026116	Bacteria	3042
1054	Ga0207674_10234157	3300026116	Bacteria	1784
1055	Ga0207675_100005114	3300026118	Bacteria	12627
1056	Ga0207675_100099163	3300026118	Bacteria	2744
1057	Ga0207675_100162835	3300026118	Bacteria	2129
1058	Ga0207675_100273012	3300026118	Bacteria	1641
1059	Ga0207675_100381844	3300026118	Bacteria	1385
1060	Ga0207683_10000315	3300026121	Bacteria	44025
1061	Ga0207683_10009082	3300026121	Bacteria	8471
1062	Ga0207683_10015224	3300026121	Bacteria	6546
1063	Ga0207683_10016322	3300026121	Bacteria	6320
1064	Ga0207683_10021620	3300026121	Bacteria	5513
1065	Ga0207683_10044648	3300026121	Bacteria	3874
1066	Ga0207683_10083870	3300026121	Bacteria	2832
1067	Ga0207683_10611465	3300026121	Bacteria	1009
1068	Ga0207698_10029514	3300026142	Bacteria	3930
1069	Ga0207698_10066764	3300026142	Bacteria	2833
1070	Ga0207698_10160760	3300026142	Bacteria	1964
1071	Ga0207698_10200440	3300026142	Bacteria	1787
1072	Ga0207698_10218767	3300026142	Bacteria	1719
1073	Ga0207698_10266847	3300026142	Bacteria	1575
1074	Ga0207698_10684116	3300026142	Bacteria	1019
1075	Ga0209281_1000020	3300027111	Bacteria	575972
1076	Ga0209389_1000137	3300027296	Bacteria	63287
1077	Ga0209389_1000353	3300027296	Bacteria	27634
1078	Ga0209589_1003439	3300027357	Bacteria	27634
1079	Ga0209489_100192	3300027361	Bacteria	98028
1080	Ga0209489_107326	3300027361	Bacteria	16591
1081	Ga0209489_107331	3300027361	Bacteria	16585
1082	Ga0209700_100046	3300027363	Bacteria	159296
1083	Ga0209588_1010085	3300027671	Bacteria	2835
1084	Ga0209971_1013049	3300027682	Bacteria	1969
1085	Ga0209971_1056487	3300027682	Bacteria	949
1086	Ga0209813_10002651	3300027866	Bacteria	4113
1087	Ga0209813_10029173	3300027866	Bacteria	1614
1088	Ga0209813_10097043	3300027866	Bacteria	998
1089	Ga0209974_10003984	3300027876	Bacteria	5282
1090	Ga0209974_10066018	3300027876	Bacteria	1229
1091	Ga0207428_10000094	3300027907	Bacteria	123649
1092	Ga0207428_10006429	3300027907	Bacteria	10850
1093	Ga0207428_10036101	3300027907	Bacteria	4035
1094	Ga0207428_10134025	3300027907	Bacteria	1894
1095	Ga0207428_10150755	3300027907	Bacteria	1770
1096	Ga0207428_10288383	3300027907	Bacteria	1217
1097	Ga0265354_1002569	3300028016	Bacteria	2218
1098	Ga0265357_1002524	3300028023	Bacteria	1506
1099	Ga0268266_10000256	3300028379	Bacteria	89436
1100	Ga0268266_10005499	3300028379	Bacteria	11797
1101	Ga0268266_10007711	3300028379	Bacteria	9662
1102	Ga0268266_10009538	3300028379	Bacteria	8542
1103	Ga0268266_10048979	3300028379	Bacteria	3622
1104	Ga0268266_10049467	3300028379	Bacteria	3605
1105	Ga0268266_10096350	3300028379	Bacteria	2600
1106	Ga0268266_10126627	3300028379	Bacteria	2280
1107	Ga0268266_10169766	3300028379	Bacteria	1979
1108	Ga0268266_10347521	3300028379	Bacteria	1393
1109	Ga0268266_10381941	3300028379	Bacteria	1329
1110	Ga0268265_10018992	3300028380	Bacteria	4773
1111	Ga0268265_10042854	3300028380	Bacteria	3360
1112	Ga0268265_10050537	3300028380	Bacteria	3133
1113	Ga0268265_10181056	3300028380	Bacteria	1810
1114	Ga0268265_10395865	3300028380	Bacteria	1275
1115	Ga0268264_10000020	3300028381	Bacteria	483593
1116	Ga0268264_10001404	3300028381	Bacteria	22509
1117	Ga0268264_10025359	3300028381	Bacteria	4844
1118	Ga0268264_10070120	3300028381	Bacteria	2967
1119	Ga0268264_10073701	3300028381	Bacteria	2898
1120	Ga0268264_10254179	3300028381	Bacteria	1634
1121	Ga0268264_10473321	3300028381	Bacteria	1217
1122	Ga0268264_10498821	3300028381	Bacteria	1187
1123	Ga0268264_10538420	3300028381	Bacteria	1144
1124	Ga0265337_1001859	3300028556	Bacteria	10076
1125	Ga0265334_10000410	3300028573	Bacteria	22501
1126	Ga0265334_10045433	3300028573	Bacteria	1701
1127	Ga0265323_10000658	3300028653	Bacteria	18872
1128	Ga0265336_10000063	3300028666	Bacteria	98413
1129	Ga0307517_10000235	3300028786	Bacteria	93944
1130	Ga0307515_10037902	3300028794	Bacteria	7731
1131	Ga0307515_10144305	3300028794	Bacteria	2532
1132	Ga0307515_10170842	3300028794	Bacteria	2168
1133	Ga0307515_10414548	3300028794	Bacteria	969
1134	Ga0265338_10000154	3300028800	Bacteria	125708
1135	Ga0265324_10002963	3300029957	Bacteria	8307
1136	Ga0307511_10033177	3300030521	Bacteria	4564
1137	Ga0316182_1443699	3300030745	Bacteria	1552
1138	Ga0265762_1010074	3300030760	Bacteria	1688
1139	Ga0265770_1000021	3300030878	Bacteria	15470
1140	Ga0265330_10147348	3300031235	Bacteria	1000
1141	Ga0265332_10001225	3300031238	Bacteria	14836
1142	Ga0265332_10059636	3300031238	Bacteria	1633
1143	Ga0265328_10028391	3300031239	Bacteria	2093
1144	Ga0265328_10106874	3300031239	Bacteria	1039
1145	Ga0265340_10000669	3300031247	Bacteria	19187
1146	Ga0265340_10024686	3300031247	Bacteria	3051
1147	Ga0265340_10087769	3300031247	Bacteria	1457
1148	Ga0265340_10159875	3300031247	Bacteria	1024
1149	Ga0265339_10000253	3300031249	Bacteria	42950
1150	Ga0265339_10024827	3300031249	Bacteria	3449
1151	Ga0265331_10005905	3300031250	Bacteria	7323
1152	Ga0265331_10024351	3300031250	Bacteria	3063
1153	Ga0265316_10205982	3300031344	Bacteria	1456
1154	Ga0307513_10089608	3300031456	Bacteria	3140
1155	Ga0307513_10128769	3300031456	Bacteria	2481
1156	Ga0307513_10182218	3300031456	Bacteria	1962
1157	Ga0307513_10206786	3300031456	Bacteria	1798
1158	Ga0307513_10360338	3300031456	Bacteria	1199
1159	Ga0307509_10065496	3300031507	Bacteria	3815
1160	Ga0307509_10196714	3300031507	Bacteria	1858
1161	Ga0307509_10248650	3300031507	Bacteria	1564
1162	Ga0307408_100042559	3300031548	Bacteria	3227
1163	Ga0307408_100060812	3300031548	Bacteria	2755
1164	Ga0307408_100065368	3300031548	Bacteria	2667
1165	Ga0307408_100160546	3300031548	Bacteria	1785
1166	Ga0307408_100269743	3300031548	Bacteria	1412
1167	Ga0307408_100277982	3300031548	Bacteria	1393
1168	Ga0265313_10021048	3300031595	Bacteria	3577
1169	Ga0307508_10000025	3300031616	Bacteria	174642
1170	Ga0307508_10077767	3300031616	Bacteria	2897
1171	Ga0307508_10117852	3300031616	Bacteria	2257
1172	Ga0265314_10005071	3300031711	Bacteria	12001
1173	Ga0265314_10021311	3300031711	Bacteria	4986
1174	Ga0265314_10029059	3300031711	Bacteria	4113
1175	Ga0265314_10104302	3300031711	Bacteria	1816
1176	Ga0265342_10000039	3300031712	Bacteria	140091
1177	Ga0265342_10000131	3300031712	Bacteria	82968
1178	Ga0265342_10003931	3300031712	Bacteria	11934
1179	Ga0265342_10069837	3300031712	Bacteria	2050
1180	Ga0265342_10130696	3300031712	Bacteria	1407
1181	Ga0316576_10012107	3300031727	Bacteria	5688
1182	Ga0307516_10015801	3300031730	Bacteria	7927
1183	Ga0307405_10006215	3300031731	Bacteria	5855
1184	Ga0307405_10007256	3300031731	Bacteria	5526
1185	Ga0307405_10028119	3300031731	Bacteria	3270
1186	Ga0307405_10030253	3300031731	Bacteria	3173
1187	Ga0307405_10073494	3300031731	Bacteria	2208
1188	Ga0307405_10094951	3300031731	Bacteria	1984
1189	Ga0307405_10219086	3300031731	Bacteria	1395
1190	Ga0307405_10315549	3300031731	Bacteria	1192
1191	Ga0316577_10046142	3300031733	Bacteria	2434
1192	Ga0307413_10004158	3300031824	Bacteria	6248
1193	Ga0307413_10047505	3300031824	Bacteria	2560
1194	Ga0307413_10054751	3300031824	Bacteria	2423
1195	Ga0307413_10060657	3300031824	Bacteria	2329
1196	Ga0307413_10070387	3300031824	Bacteria	2199
1197	Ga0307413_10115877	3300031824	Bacteria	1804
1198	Ga0307413_10274282	3300031824	Bacteria	1264
1199	Ga0307413_10301388	3300031824	Bacteria	1215
1200	Ga0307410_10000933	3300031852	Bacteria	12527
1201	Ga0307410_10006512	3300031852	Bacteria	6307
1202	Ga0307410_10024224	3300031852	Bacteria	3789
1203	Ga0307410_10036744	3300031852	Bacteria	3193
1204	Ga0307410_10046366	3300031852	Bacteria	2899
1205	Ga0307410_10110690	3300031852	Bacteria	1987
1206	Ga0307410_10129125	3300031852	Bacteria	1854
1207	Ga0307410_10142856	3300031852	Bacteria	1773
1208	Ga0307410_10143467	3300031852	Bacteria	1769
1209	Ga0307410_10209595	3300031852	Bacteria	1492
1210	Ga0307410_10309948	3300031852	Bacteria	1248
1211	Ga0307410_10320733	3300031852	Bacteria	1229
1212	Ga0307410_10337658	3300031852	Bacteria	1200
1213	Ga0307406_10014184	3300031901	Bacteria	4580
1214	Ga0307406_10049555	3300031901	Bacteria	2658
1215	Ga0307406_10051333	3300031901	Bacteria	2618
1216	Ga0307406_10058492	3300031901	Bacteria	2477
1217	Ga0307406_10068791	3300031901	Bacteria	2313
1218	Ga0307406_10120650	3300031901	Bacteria	1822
1219	Ga0307406_10139191	3300031901	Bacteria	1715
1220	Ga0307406_10207649	3300031901	Bacteria	1447
1221	Ga0307406_10483789	3300031901	Bacteria	1000
1222	Ga0307407_10001131	3300031903	Bacteria	9350
1223	Ga0307407_10015574	3300031903	Bacteria	3764
1224	Ga0307407_10023172	3300031903	Bacteria	3235
1225	Ga0307407_10042870	3300031903	Bacteria	2540
1226	Ga0307407_10149980	3300031903	Bacteria	1514
1227	Ga0307407_10250701	3300031903	Bacteria	1213
1228	Ga0307412_10002229	3300031911	Bacteria	10749
1229	Ga0307412_10024471	3300031911	Bacteria	3727
1230	Ga0307412_10034503	3300031911	Bacteria	3224
1231	Ga0307412_10046829	3300031911	Bacteria	2836
1232	Ga0307412_10066764	3300031911	Bacteria	2439
1233	Ga0307412_10099944	3300031911	Bacteria	2049
1234	Ga0307412_10206278	3300031911	Bacteria	1496
1235	Ga0307412_10443495	3300031911	Bacteria	1067
1236	Ga0307409_100005340	3300031995	Bacteria	7377
1237	Ga0307409_100006358	3300031995	Bacteria	6933
1238	Ga0307409_100025009	3300031995	Bacteria	4179
1239	Ga0307409_100026079	3300031995	Bacteria	4115
1240	Ga0307409_100046719	3300031995	Bacteria	3280
1241	Ga0307409_100059146	3300031995	Bacteria	2981
1242	Ga0307409_100073405	3300031995	Bacteria	2728
1243	Ga0307409_100150518	3300031995	Bacteria	2019
1244	Ga0307409_100361686	3300031995	Bacteria	1373
1245	Ga0307409_100390151	3300031995	Bacteria	1326
1246	Ga0307409_100441286	3300031995	Bacteria	1254
1247	Ga0307409_100476430	3300031995	Bacteria	1210
1248	Ga0307416_100003734	3300032002	Bacteria	9036
1249	Ga0307416_100007023	3300032002	Bacteria	7104
1250	Ga0307416_100011217	3300032002	Bacteria	5958
1251	Ga0307416_100016114	3300032002	Bacteria	5182
1252	Ga0307416_100027070	3300032002	Bacteria	4238
1253	Ga0307416_100093739	3300032002	Bacteria	2587
1254	Ga0307416_100133243	3300032002	Bacteria	2242
1255	Ga0307416_100166963	3300032002	Bacteria	2043
1256	Ga0307416_100194922	3300032002	Bacteria	1915
1257	Ga0307416_100236820	3300032002	Bacteria	1765
1258	Ga0307416_100284635	3300032002	Bacteria	1632
1259	Ga0307416_100363962	3300032002	Bacteria	1469
1260	Ga0307416_100471455	3300032002	Bacteria	1313
1261	Ga0307416_100592689	3300032002	Bacteria	1187
1262	Ga0307414_10000931	3300032004	Bacteria	14968
1263	Ga0307414_10005926	3300032004	Bacteria	6768
1264	Ga0307414_10020194	3300032004	Bacteria	4146
1265	Ga0307414_10026614	3300032004	Bacteria	3725
1266	Ga0307414_10046289	3300032004	Bacteria	2985
1267	Ga0307414_10061749	3300032004	Bacteria	2655
1268	Ga0307414_10076603	3300032004	Bacteria	2431
1269	Ga0307414_10081124	3300032004	Bacteria	2374
1270	Ga0307414_10089507	3300032004	Bacteria	2281
1271	Ga0307414_10160109	3300032004	Bacteria	1787
1272	Ga0307414_10211147	3300032004	Bacteria	1586
1273	Ga0307414_10219148	3300032004	Bacteria	1561
1274	Ga0307414_10244514	3300032004	Bacteria	1487
1275	Ga0307414_10298064	3300032004	Bacteria	1362
1276	Ga0307411_10007133	3300032005	Bacteria	5661
1277	Ga0307411_10011246	3300032005	Bacteria	4819
1278	Ga0307411_10018655	3300032005	Bacteria	3986
1279	Ga0307411_10051801	3300032005	Bacteria	2680
1280	Ga0307411_10107970	3300032005	Bacteria	1984
1281	Ga0307411_10122203	3300032005	Bacteria	1886
1282	Ga0307411_10141433	3300032005	Bacteria	1775
1283	Ga0307411_10147510	3300032005	Bacteria	1743
1284	Ga0307411_10236948	3300032005	Bacteria	1426
1285	Ga0307411_10269047	3300032005	Bacteria	1350
1286	Ga0307411_10341206	3300032005	Bacteria	1217
1287	Ga0307411_10356027	3300032005	Bacteria	1195
1288	Ga0307411_10368417	3300032005	Bacteria	1177
1289	Ga0307415_100007681	3300032126	Bacteria	5920
1290	Ga0307415_100029071	3300032126	Bacteria	3527
1291	Ga0307415_100033565	3300032126	Bacteria	3333
1292	Ga0307415_100043110	3300032126	Bacteria	3007
1293	Ga0307415_100046152	3300032126	Bacteria	2925
1294	Ga0307415_100055671	3300032126	Bacteria	2707
1295	Ga0307415_100084756	3300032126	Bacteria	2275
1296	Ga0307415_100140143	3300032126	Bacteria	1846
1297	Ga0307415_100155561	3300032126	Bacteria	1765
1298	Ga0307507_10130911	3300033179	Bacteria	1963
1299	Ga0307510_10033677	3300033180	Bacteria	5750
1300	Ga0307510_10050374	3300033180	Bacteria	4419
1301	Ga0307510_10117291	3300033180	Bacteria	2380
1302	Ga0307510_10148617	3300033180	Bacteria	1968
1303	Ga0373926_0023239	3300035083	Bacteria	2153
1304	Ga0373928_0016902	3300035084	Bacteria	1497
1305	Ga0373923_0057453	3300035111	Bacteria	1645
1306	Ga0373923_0100956	3300035111	Bacteria	1272
1307	Ga0373923_0168469	3300035111	Bacteria	1002
1308	Ga0373936_0007123	3300035113	Bacteria	4207
1309	Ga0373945_0002208	3300035116	Bacteria	6085
1310	Ga0373945_0010335	3300035116	Bacteria	3072
1311	Ga0373945_0056084	3300035116	Bacteria	1460
1312	Ga0373956_0013934	3300035119	Bacteria	3351
1313	Ga0373957_0006378	3300035120	Bacteria	3713
1314	Ga0373946_0013149	3300035171	Bacteria	3107
1315	Ga0373955_0035945	3300035172	Bacteria	2626
1316	Ga0373955_0168120	3300035172	Bacteria	1297
1317	Ga0316574_0048820	3300035398	Bacteria	2630
1318	Ga0373924_0020428	3300035410	Bacteria	2574
1319	Ga0373924_0051011	3300035410	Bacteria	1715
1320	Ga0373931_0005114	3300035691	Bacteria	6039
1321	Ga0373931_0111394	3300035691	Bacteria	1553
1322	Ga0373931_0180427	3300035691	Bacteria	1250
1323	Ga0373931_0301184	3300035691	Bacteria	990
1324	Ga0373935_0003467	3300035692	Bacteria	9166
1325	Ga0373935_0054250	3300035692	Bacteria	2551
1326	Ga0373935_0098227	3300035692	Bacteria	1927
1327	Ga0373935_0165473	3300035692	Bacteria	1510
1328	Ga0373927_0010081	3300035695	Bacteria	6325
1329	Ga0373927_0064985	3300035695	Bacteria	2360
1330	Ga0373927_0067413	3300035695	Bacteria	2316
1331	Ga0373927_0088419	3300035695	Bacteria	2011
1332	Ga0373927_0108420	3300035695	Bacteria	1809
1333	Ga0373933_0000225	3300035724	Bacteria	37547
1334	Ga0373933_0076538	3300035724	Bacteria	2044
1335	Ga0373947_0002642	3300035725	Bacteria	10769
1336	Ga0373947_0008433	3300035725	Bacteria	5938
1337	Ga0373947_0014002	3300035725	Bacteria	4597
1338	Ga0373947_0091764	3300035725	Bacteria	1895
1339	Ga0373937_0054286	3300036401	Bacteria	3676
1340	Ga0373937_0059352	3300036401	Bacteria	3516
1341	Ga0373937_0064661	3300036401	Bacteria	3365
1342	Ga0373937_0310771	3300036401	Bacteria	1491
1343	Ga0373937_0655142	3300036401	Bacteria	996
1344	Ga0372808_004872	3300036459	Bacteria	1740
1345	Ga0316582_0183242	3300036647	Bacteria	1425
1346	Ga0316584_0014162	3300036712	Bacteria	5668
1347	Ga0373925_0032363	3300037068	Bacteria	3849
1348	Ga0373925_0077195	3300037068	Bacteria	2527
1349	Ga0373925_0084812	3300037068	Bacteria	2414
1350	Ga0373925_0107674	3300037068	Bacteria	2150
1351	Ga0373925_0112446	3300037068	Bacteria	2105
1352	Ga0373925_0177630	3300037068	Bacteria	1684
1353	Ga0373925_0241683	3300037068	Bacteria	1446
1354	Ga0395899_0010129	3300037312	Bacteria	7228
1355	Ga0395899_0011973	3300037312	Bacteria	6646
1356	Ga0395899_0021576	3300037312	Bacteria	4884
1357	Ga0395899_0072835	3300037312	Bacteria	2513
1358	Ga0395899_0095033	3300037312	Bacteria	2156
1359	Ga0395900_0000943	3300037418	Bacteria	37925
1360	Ga0395900_0005612	3300037418	Bacteria	13121
1361	Ga0395900_0008466	3300037418	Bacteria	10577
1362	Ga0395900_0024575	3300037418	Bacteria	6169
1363	Ga0395900_0031192	3300037418	Bacteria	5475
1364	Ga0395900_0098011	3300037418	Bacteria	3012
1365	Ga0395900_0098863	3300037418	Bacteria	2998
1366	Ga0395900_0131609	3300037418	Bacteria	2563
1367	Ga0395900_0145422	3300037418	Bacteria	2424
1368	Ga0395900_0147368	3300037418	Bacteria	2406
1369	Ga0395900_0231566	3300037418	Bacteria	1858
1370	Ga0395900_0341476	3300037418	Bacteria	1473
1371	Ga0395898_0002974	3300037466	Bacteria	19263
1372	Ga0395898_0022005	3300037466	Bacteria	6458
1373	Ga0395898_0030996	3300037466	Bacteria	5347
1374	Ga0395898_0054338	3300037466	Bacteria	3908
1375	Ga0395898_0335949	3300037466	Bacteria	1441
1376	Ga0395898_0449775	3300037466	Bacteria	1227
1377	Ga0395905_0001191	3300037471	Bacteria	32527
1378	Ga0395905_0001314	3300037471	Bacteria	30557
1379	Ga0395905_0003656	3300037471	Bacteria	16314
1380	Ga0395905_0027387	3300037471	Bacteria	5375
1381	Ga0395905_0109426	3300037471	Bacteria	2594
1382	Ga0395905_0118840	3300037471	Bacteria	2484
1383	Ga0395905_0125672	3300037471	Bacteria	2411
1384	Ga0395905_0130273	3300037471	Bacteria	2366
1385	Ga0395905_0140385	3300037471	Bacteria	2273
1386	Ga0395905_0207970	3300037471	Bacteria	1834
1387	Ga0395905_0219105	3300037471	Bacteria	1781
1388	Ga0395905_0380779	3300037471	Bacteria	1305
1389	Ga0436364_0806555	3300037853	Bacteria	2926
1390	Ga0436364_1062405	3300037853	Bacteria	1116
1391	Ga0395901_0000320	3300038443	Bacteria	59479
1392	Ga0395901_0001973	3300038443	Bacteria	21111
1393	Ga0395901_0002693	3300038443	Bacteria	17903
1394	Ga0395901_0033917	3300038443	Bacteria	5271
1395	Ga0395901_0065739	3300038443	Bacteria	3776
1396	Ga0395901_0083304	3300038443	Bacteria	3343
1397	Ga0395901_0115492	3300038443	Bacteria	2819
1398	Ga0395901_0139345	3300038443	Bacteria	2549
1399	Ga0395901_0380884	3300038443	Bacteria	1452
1400	Ga0395901_0563583	3300038443	Bacteria	1153
1401	Ga0436365_0876968	3300039437	Bacteria	38690
1402	Ga0436365_1019011	3300039437	Bacteria	1012
1403	Ga0436365_1030657	3300039437	Bacteria	25086
1404	Ga0436365_1251026	3300039437	Bacteria	1590
1405	Ga0436365_1541048	3300039437	Bacteria	2214
1406	Ga0436360_0318167	3300039438	Bacteria	3918
1407	Ga0436360_0336060	3300039438	Bacteria	2967
1408	Ga0436361_0151792	3300039447	Bacteria	3109
1409	Ga0436361_0259732	3300039447	Bacteria	2075
1410	Ga0436361_0303744	3300039447	Bacteria	2150
1411	Ga0436361_0336849	3300039447	Bacteria	2327
1412	Ga0436361_0523670	3300039447	Bacteria	2056
1413	Ga0436361_0677882	3300039447	Bacteria	228834
1414	Ga0436361_0869861	3300039447	Bacteria	12333
1415	Ga0436361_0950110	3300039447	Bacteria	1550
1416	Ga0436361_1071877	3300039447	Bacteria	3879
1417	Ga0436363_0634802	3300039450	Bacteria	44772
1418	Ga0436363_1153269	3300039450	Bacteria	906
1419	Ga0436363_1261345	3300039450	Bacteria	12716
1420	Ga0436363_1610649	3300039450	Bacteria	5773
1421	Ga0436362_0379214	3300039453	Bacteria	7269
1422	Ga0436362_0423859	3300039453	Bacteria	1604
1423	Ga0439439_0003872	3300041406	Bacteria	3331
1424	Ga0451837_1440309	3300041494	Bacteria	962
1425	Ga0451839_1350009	3300041496	Bacteria	871
1426	Ga0439445_0000421	3300042004	Bacteria	8524
1427	Ga0439449_0112431	3300042007	Bacteria	1009
1428	Ga0450920_016702	3300042122	Bacteria	1400
1429	Ga0450922_003443	3300042124	Bacteria	1458
1430	Ga0450923_002117	3300042125	Bacteria	2786
1431	Ga0450898_000749	3300042134	Bacteria	3978
1432	Ga0450905_003404	3300042142	Bacteria	2091
1433	Ga0439446_0039325	3300042156	Bacteria	1389
1434	Ga0439446_0044634	3300042156	Bacteria	1312
1435	Ga0439434_0008290	3300042435	Bacteria	3047
1436	Ga0439435_0002525	3300042436	Bacteria	3656
1437	Ga0439435_0017240	3300042436	Bacteria	1822
1438	Ga0439444_0001098	3300042437	Bacteria	3373
1439	Ga0439459_0024458	3300042438	Bacteria	1185
1440	Ga0450916_001478	3300042530	Bacteria	2358
1441	Ga0466969_0002344	3300044656	Bacteria	10115
1442	Ga0466969_0016377	3300044656	Bacteria	3879
1443	Ga0466972_0039915	3300044658	Bacteria	2289
1444	Ga0466972_0100953	3300044658	Bacteria	1365
1445	Ga0466965_0036286	3300044683	Bacteria	2418
1446	Ga0466965_0112543	3300044683	Bacteria	1400
1447	Ga0466965_0167058	3300044683	Bacteria	1156
1448	Ga0466965_0174577	3300044683	Bacteria	1132
1449	Ga0466966_0000229	3300044684	Bacteria	37407
1450	Ga0466966_0018263	3300044684	Bacteria	4627
1451	Ga0466966_0035952	3300044684	Bacteria	3199
1452	Ga0466966_0084161	3300044684	Bacteria	1979
1453	Ga0466966_0246989	3300044684	Bacteria	1075
1454	Ga0466961_0000029	3300044693	Bacteria	86710
1455	Ga0466963_0000376	3300044694	Bacteria	20368
1456	Ga0466963_0034650	3300044694	Bacteria	3286
1457	Ga0466963_0175690	3300044694	Bacteria	1494
1458	Ga0466964_0022821	3300044706	Bacteria	2430
1459	Ga0466964_0140606	3300044706	Bacteria	1109
1460	Ga0466971_0009429	3300044719	Bacteria	4262
1461	Ga0466971_0013597	3300044719	Bacteria	3576
1462	Ga0466971_0067718	3300044719	Bacteria	1619
1463	Ga0466968_0007268	3300044735	Bacteria	4209
1464	Ga0466968_0162575	3300044735	Bacteria	1031
1465	Ga0466970_0006059	3300044765	Bacteria	6030
1466	Ga0466970_0048706	3300044765	Bacteria	2260
1467	Ga0466957_0006077	3300044842	Bacteria	6816
1468	Ga0466957_0006659	3300044842	Bacteria	6533
1469	Ga0466957_0018120	3300044842	Bacteria	4130
1470	Ga0466957_0114925	3300044842	Bacteria	1710
1471	Ga0466957_0227562	3300044842	Bacteria	1233
1472	Ga0466960_0128241	3300044901	Bacteria	1336
1473	Ga0466959_0000533	3300045049	Bacteria	22053
1474	Ga0466959_0003809	3300045049	Bacteria	9999
1475	Ga0466959_0019883	3300045049	Bacteria	4942
1476	Ga0466959_0176034	3300045049	Bacteria	1498
1477	Ga0466958_0001039	3300045836	Bacteria	12689
1478	Ga0466958_0029823	3300045836	Bacteria	3237
1479	Ga0466967_0030661	3300045976	Bacteria	4515
1480	Ga0495592_0013467	3300046454	Bacteria	6222
1481	Ga0495592_0086216	3300046454	Bacteria	2262
1482	Ga0495592_0185120	3300046454	Bacteria	1415
1483	Ga0495603_0000237	3300046455	Bacteria	28782
1484	Ga0495603_0001754	3300046455	Bacteria	12775
1485	Ga0495603_0011365	3300046455	Bacteria	5391
1486	Ga0495603_0025069	3300046455	Bacteria	3607
1487	Ga0495603_0038759	3300046455	Bacteria	2857
1488	Ga0495603_0040610	3300046455	Bacteria	2784
1489	Ga0495603_0059521	3300046455	Bacteria	2258
1490	Ga0495629_0000772	3300046459	Bacteria	25859
1491	Ga0495629_0002337	3300046459	Bacteria	14606
1492	Ga0495629_0031955	3300046459	Bacteria	3727
1493	Ga0495629_0056707	3300046459	Bacteria	2739
1494	Ga0495629_0170919	3300046459	Bacteria	1508
1495	Ga0495629_0178254	3300046459	Bacteria	1473
1496	Ga0495638_0004143	3300046460	Bacteria	11070
1497	Ga0495638_0004606	3300046460	Bacteria	10435
1498	Ga0495638_0005372	3300046460	Bacteria	9553
1499	Ga0495638_0041430	3300046460	Bacteria	2913
1500	Ga0495638_0198653	3300046460	Bacteria	1133
1501	Ga0495641_0012966	3300046461	Bacteria	4617
1502	Ga0495651_0011651	3300046462	Bacteria	6759
1503	Ga0495651_0098891	3300046462	Bacteria	2176
1504	Ga0495651_0143868	3300046462	Bacteria	1726
1505	Ga0495653_0022036	3300046463	Bacteria	5156
1506	Ga0495653_0027863	3300046463	Bacteria	4521
1507	Ga0495653_0217635	3300046463	Bacteria	1286
1508	Ga0495650_0000230	3300046471	Bacteria	114025
1509	Ga0495650_0025394	3300046471	Bacteria	2778
1510	Ga0495580_0004214	3300046472	Bacteria	12092
1511	Ga0495580_0052612	3300046472	Bacteria	2875
1512	Ga0495582_0000209	3300046473	Bacteria	32511
1513	Ga0495582_0014036	3300046473	Bacteria	4410
1514	Ga0495582_0041407	3300046473	Bacteria	2538
1515	Ga0495605_0000071	3300046474	Bacteria	135203
1516	Ga0495605_0116685	3300046474	Bacteria	1213
1517	Ga0495605_0123331	3300046474	Bacteria	1173
1518	Ga0495639_0000387	3300046475	Bacteria	20931
1519	Ga0495662_0002150	3300046476	Bacteria	9897
1520	Ga0495662_0065754	3300046476	Bacteria	1753
1521	Ga0495664_0001615	3300046477	Bacteria	11993
1522	Ga0495664_0020289	3300046477	Bacteria	3832
1523	Ga0495664_0036970	3300046477	Bacteria	2880
1524	Ga0495664_0164827	3300046477	Bacteria	1345
1525	Ga0495664_0224499	3300046477	Bacteria	1137
1526	Ga0495584_0112301	3300046491	Bacteria	1379
1527	Ga0495585_0063354	3300046492	Bacteria	2029
1528	Ga0495585_0083407	3300046492	Bacteria	1730
1529	Ga0495594_0000342	3300046499	Bacteria	23227
1530	Ga0495594_0053255	3300046499	Bacteria	2229
1531	Ga0495594_0245976	3300046499	Bacteria	1019
1532	Ga0495596_0075093	3300046500	Bacteria	1313
1533	Ga0495596_0096815	3300046500	Bacteria	1146
1534	Ga0495607_0054467	3300046501	Bacteria	2305
1535	Ga0495606_0000077	3300046507	Bacteria	166824
1536	Ga0495606_0002837	3300046507	Bacteria	19219
1537	Ga0495606_0021044	3300046507	Bacteria	4787
1538	Ga0495606_0022784	3300046507	Bacteria	4552
1539	Ga0495606_0176234	3300046507	Bacteria	1236
1540	Ga0495608_0018247	3300046511	Bacteria	4842
1541	Ga0495608_0030836	3300046511	Bacteria	3627
1542	Ga0495610_0004699	3300046512	Bacteria	9973
1543	Ga0495610_0018192	3300046512	Bacteria	3977
1544	Ga0495610_0029652	3300046512	Bacteria	2878
1545	Ga0495610_0046624	3300046512	Bacteria	2137
1546	Ga0495618_0013641	3300046514	Bacteria	4944
1547	Ga0495618_0092392	3300046514	Bacteria	1935
1548	Ga0495618_0170990	3300046514	Bacteria	1383
1549	Ga0495628_0022291	3300046516	Bacteria	5203
1550	Ga0495628_0053583	3300046516	Bacteria	3183
1551	Ga0495630_0001378	3300046517	Bacteria	16750
1552	Ga0495630_0017390	3300046517	Bacteria	5267
1553	Ga0495630_0108191	3300046517	Bacteria	2106
1554	Ga0495631_0030198	3300046518	Bacteria	2460
1555	Ga0495632_0060728	3300046519	Bacteria	1836
1556	Ga0495632_0075713	3300046519	Bacteria	1610
1557	Ga0495643_0008539	3300046522	Bacteria	6470
1558	Ga0495643_0050056	3300046522	Bacteria	2251
1559	Ga0495644_0008390	3300046523	Bacteria	3979
1560	Ga0495644_0042265	3300046523	Bacteria	1716
1561	Ga0495648_0003600	3300046524	Bacteria	13558
1562	Ga0495648_0067174	3300046524	Bacteria	2098
1563	Ga0495648_0073583	3300046524	Bacteria	1972
1564	Ga0495648_0131370	3300046524	Bacteria	1331
1565	Ga0495648_0221562	3300046524	Bacteria	932
1566	Ga0495648_0223705	3300046524	Bacteria	926
1567	Ga0495663_0000244	3300046525	Bacteria	21549
1568	Ga0495663_0004640	3300046525	Bacteria	3850
1569	Ga0495663_0005899	3300046525	Bacteria	3391
1570	Ga0495663_0035860	3300046525	Bacteria	1491
1571	Ga0495642_0044451	3300046528	Bacteria	1813
1572	Ga0495652_0005332	3300046529	Bacteria	12122
1573	Ga0495652_0015193	3300046529	Bacteria	6893
1574	Ga0495652_0048216	3300046529	Bacteria	3651
1575	Ga0495652_0250060	3300046529	Bacteria	1314
1576	Ga0495665_0000280	3300046531	Bacteria	25894
1577	Ga0495640_0001578	3300046533	Bacteria	17975
1578	Ga0495640_0009615	3300046533	Bacteria	7520
1579	Ga0495640_0092149	3300046533	Bacteria	1999
1580	Ga0495587_0080106	3300046536	Bacteria	1893
1581	Ga0495587_0089701	3300046536	Bacteria	1776
1582	Ga0495598_0031078	3300046537	Bacteria	1501
1583	Ga0495621_0001420	3300046539	Bacteria	6202
1584	Ga0495621_0003194	3300046539	Bacteria	4494
1585	Ga0495621_0005820	3300046539	Bacteria	3565
1586	Ga0495597_0024441	3300046542	Bacteria	2789
1587	Ga0495597_0046672	3300046542	Bacteria	1919
1588	Ga0495645_0003978	3300046543	Bacteria	10080
1589	Ga0495645_0026670	3300046543	Bacteria	4194
1590	Ga0495645_0128905	3300046543	Bacteria	1775
1591	Ga0495622_0003837	3300046557	Bacteria	7020
1592	Ga0495622_0054002	3300046557	Bacteria	1864
1593	Ga0495633_0000682	3300046558	Bacteria	31296
1594	Ga0495667_0010850	3300046559	Bacteria	6159
1595	Ga0495667_0021239	3300046559	Bacteria	4380
1596	Ga0495667_0031330	3300046559	Bacteria	3569
1597	Ga0495667_0124426	3300046559	Bacteria	1664
1598	Ga0495656_0001211	3300046615	Bacteria	8402
1599	Ga0495656_0022169	3300046615	Bacteria	2484
1600	Ga0495656_0033251	3300046615	Bacteria	2104
1601	Ga0495668_0000064	3300046616	Bacteria	180583
1602	Ga0495668_0003739	3300046616	Bacteria	11175
1603	Ga0495668_0004733	3300046616	Bacteria	9533
1604	Ga0495668_0020880	3300046616	Bacteria	3761
1605	Ga0495668_0063027	3300046616	Bacteria	2042
1606	Ga0495634_0000865	3300046642	Bacteria	29129
1607	Ga0495634_0041615	3300046642	Bacteria	3120
1608	Ga0495634_0090070	3300046642	Bacteria	1993
1609	Ga0495634_0106789	3300046642	Bacteria	1804
1610	Ga0495625_0046907	3300046660	Bacteria	3116
1611	Ga0495625_0098424	3300046660	Bacteria	2012
1612	Ga0495625_0123908	3300046660	Bacteria	1756
1613	Ga0495625_0354240	3300046660	Bacteria	927
1614	Ga0495635_0001610	3300046663	Bacteria	15179
1615	Ga0495635_0003974	3300046663	Bacteria	10282
1616	Ga0495635_0113873	3300046663	Bacteria	1846
1617	Ga0495659_0009267	3300046664	Bacteria	3140
1618	Ga0495659_0104545	3300046664	Bacteria	1100
1619	Ga0495661_0070986	3300046665	Bacteria	2036
1620	Ga0495657_0004288	3300046675	Bacteria	11387
1621	Ga0495657_0027394	3300046675	Bacteria	4022
1622	Ga0495657_0036159	3300046675	Bacteria	3415
1623	Ga0495657_0072961	3300046675	Bacteria	2237
1624	Ga0495599_0000895	3300046678	Bacteria	16666
1625	Ga0495599_0042087	3300046678	Bacteria	2867
1626	Ga0495599_0044019	3300046678	Bacteria	2800
1627	Ga0495599_0071169	3300046678	Bacteria	2171
1628	Ga0495599_0138971	3300046678	Bacteria	1507
1629	Ga0495623_0023407	3300046679	Bacteria	3987
1630	Ga0495623_0037031	3300046679	Bacteria	3124
1631	Ga0495623_0075975	3300046679	Bacteria	2085
1632	Ga0495623_0140412	3300046679	Bacteria	1438
1633	Ga0495646_0102307	3300046680	Unclassified	1641
1634	Ga0495647_0000763	3300046681	Bacteria	9576
1635	Ga0495658_0001222	3300046683	Bacteria	13486
1636	Ga0495658_0090814	3300046683	Bacteria	1808
1637	Ga0495669_0000425	3300046684	Bacteria	20076
1638	Ga0495669_0003790	3300046684	Bacteria	6209
1639	Ga0495669_0038102	3300046684	Bacteria	2129
1640	Ga0495669_0045924	3300046684	Bacteria	1948
1641	Ga0495669_0063315	3300046684	Bacteria	1677
1642	Ga0495669_0091178	3300046684	Bacteria	1407
1643	Ga0495613_0058134	3300046689	Bacteria	2839
1644	Ga0495613_0164536	3300046689	Bacteria	1576
1645	Ga0495624_0001082	3300046690	Bacteria	21523
1646	Ga0495670_0002809	3300046691	Bacteria	8614
1647	Ga0495670_0018241	3300046691	Bacteria	3455
1648	Ga0495670_0074944	3300046691	Bacteria	1717
1649	Ga0495670_0165554	3300046691	Bacteria	1163
1650	Ga0495671_0102447	3300046692	Bacteria	1399
1651	Ga0495671_0147660	3300046692	Bacteria	1145
1652	Ga0495649_0136631	3300046694	Bacteria	1292
1653	Ga0495589_0196479	3300046794	Bacteria	953
1654	Ga0495600_0001516	3300046809	Bacteria	12897
1655	Ga0495600_0008985	3300046809	Bacteria	6157
1656	Ga0495600_0026432	3300046809	Bacteria	3745
1657	Ga0495600_0081749	3300046809	Bacteria	2108
1658	Ga0495600_0298963	3300046809	Bacteria	1016
1659	Ga0495581_0000969	3300047315	Bacteria	15425
1660	Ga0495581_0055226	3300047315	Bacteria	2292
1661	Ga0495581_0083192	3300047315	Bacteria	1854
1662	Ga0495604_0005690	3300047317	Bacteria	9884
1663	Ga0495604_0009731	3300047317	Bacteria	7602
1664	Ga0495604_0047249	3300047317	Bacteria	3353
1665	Ga0495604_0109157	3300047317	Bacteria	2020
1666	Ga0495604_0110793	3300047317	Bacteria	2002
1667	Ga0495604_0315607	3300047317	Bacteria	1046
1668	Ga0495674_0004372	3300047319	Bacteria	13583
1669	Ga0495674_0144466	3300047319	Bacteria	1998
1670	Ga0495674_0160871	3300047319	Bacteria	1879
1671	Ga0495674_0164583	3300047319	Bacteria	1854
1672	Ga0495674_0256672	3300047319	Bacteria	1437
1673	Ga0495674_0418134	3300047319	Bacteria	1080
1674	Ga0495676_0009743	3300047321	Bacteria	8733
1675	Ga0495676_0024919	3300047321	Bacteria	5170
1676	Ga0495676_0095906	3300047321	Bacteria	2206
1677	Ga0495680_0007239	3300047322	Bacteria	10218
1678	Ga0495680_0014577	3300047322	Bacteria	6804
1679	Ga0495680_0158436	3300047322	Bacteria	1645
1680	Ga0495687_004926	3300047443	Bacteria	8741
1681	Ga0495675_0378012	3300047444	Bacteria	829
1682	Ga0495677_0012274	3300047445	Bacteria	3126
1683	Ga0495677_0022919	3300047445	Bacteria	2266
1684	Ga0495677_0049355	3300047445	Bacteria	1547
1685	Ga0495685_054974	3300047447	Bacteria	1347
1686	Ga0495673_0003053	3300047469	Bacteria	11253
1687	Ga0495673_0037524	3300047469	Bacteria	2212
1688	Ga0495684_0028329	3300047471	Bacteria	4301
1689	Ga0495684_0034887	3300047471	Bacteria	3859
1690	Ga0495684_0040228	3300047471	Bacteria	3584
1691	Ga0495684_0122080	3300047471	Bacteria	1961
1692	Ga0495686_0004694	3300047472	Bacteria	11086
1693	Ga0495686_0018170	3300047472	Bacteria	4724
1694	Ga0495686_0029770	3300047472	Bacteria	3550
1695	Ga0495686_0098577	3300047472	Bacteria	1766
1696	Ga0495686_0101275	3300047472	Bacteria	1737
1697	Ga0495686_0102627	3300047472	Bacteria	1723
1698	Ga0495593_0000238	3300047673	Bacteria	29664
1699	Ga0495602_0054399	3300048088	Bacteria	3534
1700	Ga0495602_0072832	3300048088	Bacteria	2927
1701	Ga0495602_0088952	3300048088	Bacteria	2569
1702	Ga0495602_0308361	3300048088	Bacteria	1156
1703	Ga0495614_0050431	3300048089	Bacteria	1783
1704	Ga0495615_0026386	3300048090	Bacteria	1356
1705	Ga0495626_0043133	3300048091	Bacteria	2117
1706	Ga0496100_0057279	3300048903	Bacteria	2552
1707	Ga0496100_0420706	3300048903	Bacteria	1020
1708	Ga0496101_0107022	3300048904	Bacteria	2100
1709	Ga0496102_0001874	3300048905	Bacteria	18120
1710	Ga0496102_0014235	3300048905	Bacteria	6912
1711	Ga0496102_0023662	3300048905	Bacteria	5458
1712	Ga0496102_0027582	3300048905	Bacteria	5071
1713	Ga0496102_0063502	3300048905	Bacteria	3382
1714	Ga0496102_0068985	3300048905	Bacteria	3245
1715	Ga0496102_0130845	3300048905	Bacteria	2348
1716	Ga0496102_0262361	3300048905	Bacteria	1629
1717	Ga0496102_0519316	3300048905	Bacteria	1113
1718	Ga0496103_0005154	3300048906	Bacteria	7868
1719	Ga0496103_0013419	3300048906	Bacteria	4858
1720	Ga0496103_0091118	3300048906	Bacteria	1924
1721	Ga0496103_0113947	3300048906	Bacteria	1719
1722	Ga0496104_0002350	3300048907	Bacteria	16350
1723	Ga0496104_0004135	3300048907	Bacteria	12598
1724	Ga0496104_0032406	3300048907	Bacteria	4863
1725	Ga0496104_0063581	3300048907	Bacteria	3500
1726	Ga0496104_0066816	3300048907	Bacteria	3414
1727	Ga0496104_0086027	3300048907	Bacteria	3001
1728	Ga0496104_0109245	3300048907	Bacteria	2651
1729	Ga0496104_0513955	3300048907	Bacteria	1109
1730	Ga0496105_0005457	3300048908	Bacteria	9648
1731	Ga0496105_0006033	3300048908	Bacteria	9265
1732	Ga0496105_0031458	3300048908	Bacteria	4350
1733	Ga0496105_0037552	3300048908	Bacteria	3988
1734	Ga0496105_0051057	3300048908	Bacteria	3417
1735	Ga0496105_0103946	3300048908	Bacteria	2346
1736	Ga0496105_0109410	3300048908	Bacteria	2281
1737	Ga0496105_0179667	3300048908	Bacteria	1733
1738	Ga0496106_0005572	3300048909	Bacteria	9321
1739	Ga0496106_0032730	3300048909	Bacteria	3878
1740	Ga0496106_0037383	3300048909	Bacteria	3632
1741	Ga0496106_0100459	3300048909	Bacteria	2243
1742	Ga0496106_0456658	3300048909	Bacteria	1026
1743	Ga0496107_0012285	3300048910	Bacteria	5977
1744	Ga0496107_0024590	3300048910	Bacteria	4261
1745	Ga0496107_0048206	3300048910	Bacteria	3068
1746	Ga0496107_0150166	3300048910	Bacteria	1723
1747	Ga0496108_0004499	3300048911	Bacteria	11230
1748	Ga0496108_0054660	3300048911	Bacteria	3350
1749	Ga0496109_0069006	3300048912	Bacteria	3241
1750	Ga0496109_0084752	3300048912	Bacteria	2924
1751	Ga0496109_0089390	3300048912	Bacteria	2847
1752	Ga0496109_0092516	3300048912	Bacteria	2797
1753	Ga0496109_0278350	3300048912	Bacteria	1577
1754	Ga0496109_0311404	3300048912	Bacteria	1485
1755	Ga0496110_0060294	3300048913	Bacteria	3345
1756	Ga0496110_0124160	3300048913	Bacteria	2328
1757	Ga0496110_0140750	3300048913	Bacteria	2181
1758	Ga0496110_0175342	3300048913	Bacteria	1946
1759	Ga0496110_0521775	3300048913	Bacteria	1081
1760	Ga0496111_0023618	3300048914	Bacteria	4318
1761	Ga0496111_0105454	3300048914	Bacteria	2074
1762	Ga0496111_0197704	3300048914	Bacteria	1495
1763	Ga0496111_0218049	3300048914	Bacteria	1417
1764	Ga0496111_0253803	3300048914	Bacteria	1305
1765	Ga0496112_0000111	3300048915	Bacteria	50958
1766	Ga0496112_0033792	3300048915	Bacteria	4973
1767	Ga0496112_0036737	3300048915	Bacteria	4779
1768	Ga0496112_0042124	3300048915	Bacteria	4467
1769	Ga0496112_0077684	3300048915	Bacteria	3283
1770	Ga0496112_0113093	3300048915	Bacteria	2685
1771	Ga0496112_0150135	3300048915	Bacteria	2297
1772	Ga0496112_0254947	3300048915	Bacteria	1705
1773	Ga0496112_0369215	3300048915	Bacteria	1376
1774	Ga0496113_0063987	3300048916	Bacteria	2780
1775	Ga0496113_0247281	3300048916	Bacteria	1423
1776	Ga0496113_0309761	3300048916	Bacteria	1265
1777	Ga0496113_0318990	3300048916	Bacteria	1245
1778	Ga0496113_0634733	3300048916	Bacteria	854
1779	Ga0496114_0000006	3300048917	Bacteria	472921
1780	Ga0496114_0010915	3300048917	Bacteria	7240
1781	Ga0496114_0015072	3300048917	Bacteria	6216
1782	Ga0496114_0050568	3300048917	Bacteria	3459
1783	Ga0496114_0153699	3300048917	Bacteria	1997
1784	Ga0496114_0386513	3300048917	Bacteria	1239
1785	Ga0496115_0058680	3300048918	Bacteria	3097
1786	Ga0496115_0065612	3300048918	Bacteria	2932
1787	Ga0496115_0087107	3300048918	Bacteria	2548
1788	Ga0496115_0098033	3300048918	Bacteria	2400
1789	Ga0496115_0105574	3300048918	Bacteria	2312
1790	Ga0496115_0145985	3300048918	Bacteria	1952
1791	Ga0496115_0152980	3300048918	Bacteria	1905
1792	Ga0496115_0289354	3300048918	Bacteria	1344
1793	Ga0496115_0365111	3300048918	Bacteria	1176
1794	Ga0496115_0450644	3300048918	Bacteria	1039
1795	Ga0496116_0000520	3300048919	Bacteria	51826
1796	Ga0496116_0017386	3300048919	Bacteria	5582
1797	Ga0496117_0028383	3300048920	Bacteria	4335
1798	Ga0496117_0056829	3300048920	Bacteria	2722
1799	Ga0496117_0073645	3300048920	Bacteria	2278
1800	Ga0496117_0178549	3300048920	Bacteria	1223
1801	Ga0496117_0229023	3300048920	Bacteria	1028
1802	Ga0496118_0010974	3300048921	Bacteria	8903
1803	Ga0496118_0027793	3300048921	Bacteria	4778
1804	Ga0496118_0041819	3300048921	Bacteria	3623
1805	Ga0496118_0060350	3300048921	Bacteria	2816
1806	Ga0496118_0109313	3300048921	Bacteria	1840
1807	Ga0496119_0011955	3300048922	Bacteria	7113
1808	Ga0496119_0012495	3300048922	Bacteria	6889
1809	Ga0496119_0028314	3300048922	Bacteria	3826
1810	Ga0496119_0070076	3300048922	Bacteria	2058
1811	Ga0496120_0061168	3300048923	Bacteria	2103
1812	Ga0496121_0001361	3300048924	Bacteria	41683
1813	Ga0496121_0001375	3300048924	Bacteria	41255
1814	Ga0496121_0009848	3300048924	Bacteria	10908
1815	Ga0496121_0010696	3300048924	Bacteria	10297
1816	Ga0496121_0024520	3300048924	Bacteria	5765
1817	Ga0496121_0029624	3300048924	Bacteria	5054
1818	Ga0496121_0045348	3300048924	Bacteria	3779
1819	Ga0496121_0053239	3300048924	Bacteria	3392
1820	Ga0496121_0074732	3300048924	Bacteria	2709
1821	Ga0496121_0074837	3300048924	Bacteria	2707
1822	Ga0496121_0105948	3300048924	Bacteria	2156
1823	Ga0496121_0139284	3300048924	Bacteria	1802
1824	Ga0496121_0174499	3300048924	Bacteria	1558
1825	Ga0496121_0264212	3300048924	Bacteria	1186
1826	Ga0496122_0000317	3300048925	Bacteria	105883
1827	Ga0496122_0064643	3300048925	Bacteria	2660
1828	Ga0496122_0100311	3300048925	Bacteria	1938
1829	Ga0496123_0000264	3300048926	Bacteria	105015
1830	Ga0496123_0044466	3300048926	Bacteria	3037
1831	Ga0496123_0055971	3300048926	Bacteria	2583
1832	Ga0496123_0107425	3300048926	Bacteria	1605
1833	Ga0496124_0010052	3300048927	Bacteria	9651
1834	Ga0496124_0016823	3300048927	Bacteria	6932
1835	Ga0496124_0030133	3300048927	Bacteria	4821
1836	Ga0496124_0067619	3300048927	Bacteria	2973
1837	Ga0496124_0365101	3300048927	Bacteria	1016
1838	Ga0496125_0000202	3300048928	Bacteria	125963
1839	Ga0496125_0001999	3300048928	Bacteria	27642
1840	Ga0496125_0011066	3300048928	Bacteria	9055
1841	Ga0496125_0015391	3300048928	Bacteria	7403
1842	Ga0496125_0015510	3300048928	Bacteria	7364
1843	Ga0496125_0043334	3300048928	Bacteria	3821
1844	Ga0496125_0115642	3300048928	Bacteria	1928
1845	Ga0496125_0178586	3300048928	Bacteria	1417
1846	Ga0496125_0208981	3300048928	Bacteria	1269
1847	Ga0496125_0260186	3300048928	Bacteria	1088
1848	Ga0496126_0004835	3300048929	Bacteria	15796
1849	Ga0496126_0012757	3300048929	Bacteria	8588
1850	Ga0496126_0013430	3300048929	Bacteria	8329
1851	Ga0496126_0031523	3300048929	Bacteria	5007
1852	Ga0496126_0060578	3300048929	Bacteria	3403
1853	Ga0496126_0076633	3300048929	Bacteria	2967
1854	Ga0496126_0086531	3300048929	Bacteria	2762
1855	Ga0496126_0086623	3300048929	Bacteria	2760
1856	Ga0496126_0087691	3300048929	Bacteria	2742
1857	Ga0496126_0106036	3300048929	Bacteria	2453
1858	Ga0496126_0109568	3300048929	Bacteria	2407
1859	Ga0496126_0114059	3300048929	Bacteria	2351
1860	Ga0496126_0131831	3300048929	Bacteria	2159
1861	Ga0496126_0175520	3300048929	Bacteria	1823
1862	Ga0496126_0197717	3300048929	Bacteria	1699
1863	Ga0496126_0250560	3300048929	Bacteria	1476
1864	Ga0495682_0009656	3300049460	Bacteria	3761
1865	Ga0495682_0089185	3300049460	Bacteria	1108
1866	Ga0501031_0001272	3300049568	Bacteria	15446
1867	Ga0501031_0009736	3300049568	Bacteria	6258
1868	Ga0501032_0000257	3300049569	Bacteria	44325
1869	Ga0501032_0002207	3300049569	Bacteria	15325
1870	Ga0501032_0017662	3300049569	Bacteria	5007
1871	Ga0501033_0000124	3300049570	Bacteria	74731
1872	Ga0501033_0000244	3300049570	Bacteria	52231
1873	Ga0501034_0000159	3300049571	Bacteria	127397
1874	Ga0501034_0015413	3300049571	Bacteria	7856
1875	Ga0501034_0041167	3300049571	Bacteria	4674
1876	Ga0501034_0041285	3300049571	Bacteria	4667
1877	Ga0501034_0089183	3300049571	Bacteria	3082
1878	Ga0501034_0094099	3300049571	Bacteria	2993
1879	Ga0501036_0000039	3300049572	Bacteria	83065
1880	Ga0501036_0007815	3300049572	Bacteria	8747
1881	Ga0501037_0000247	3300049573	Bacteria	46080
1882	Ga0501037_0001386	3300049573	Bacteria	17773
1883	Ga0501037_0030882	3300049573	Bacteria	3957
1884	Ga0501038_0000041	3300049574	Bacteria	120557
1885	Ga0501038_0000207	3300049574	Bacteria	50307
1886	Ga0501038_0193738	3300049574	Bacteria	1634
1887	Ga0501039_0000064	3300049575	Bacteria	83415
1888	Ga0501039_0000148	3300049575	Bacteria	47789
1889	Ga0501039_0019776	3300049575	Bacteria	5162
1890	Ga0501040_0018578	3300049576	Bacteria	4616
1891	Ga0501041_0361396	3300049577	Bacteria	918
1892	Ga0501042_0026466	3300049578	Bacteria	4076
1893	Ga0501042_0065421	3300049578	Bacteria	2598
1894	Ga0501043_0000202	3300049579	Bacteria	54441
1895	Ga0501043_0030154	3300049579	Bacteria	4261
1896	Ga0501043_0032864	3300049579	Bacteria	4080
1897	Ga0501043_0236760	3300049579	Bacteria	1409
1898	Ga0501046_0000185	3300049580	Bacteria	63459
1899	Ga0501046_0047426	3300049580	Bacteria	3406
1900	Ga0501046_0063676	3300049580	Bacteria	2879
1901	Ga0501046_0224003	3300049580	Bacteria	1391
1902	Ga0501047_0000154	3300049581	Bacteria	83424
1903	Ga0501047_0000288	3300049581	Bacteria	57965
1904	Ga0501047_0000392	3300049581	Bacteria	49114
1905	Ga0501047_0002801	3300049581	Bacteria	16556
1906	Ga0501048_0000536	3300049582	Bacteria	26743
1907	Ga0501048_0074941	3300049582	Bacteria	2387
1908	Ga0501067_0000896	3300049583	Bacteria	16010
1909	Ga0501067_0016856	3300049583	Bacteria	4035
1910	Ga0501067_0065527	3300049583	Bacteria	2011
1911	Ga0501067_0304339	3300049583	Bacteria	888
1912	Ga0501068_0002219	3300049584	Bacteria	10329
1913	Ga0501068_0009442	3300049584	Bacteria	5459
1914	Ga0501069_0003631	3300049585	Bacteria	7945
1915	Ga0501069_0017962	3300049585	Bacteria	3815
1916	Ga0501070_0000175	3300049586	Bacteria	59483
1917	Ga0501070_0000557	3300049586	Bacteria	34014
1918	Ga0501070_0003774	3300049586	Bacteria	13087
1919	Ga0501070_0125744	3300049586	Bacteria	2119
1920	Ga0501070_0161410	3300049586	Bacteria	1848
1921	Ga0501071_0026378	3300049587	Bacteria	4078
1922	Ga0501071_0306570	3300049587	Bacteria	1204
1923	Ga0501072_0001033	3300049588	Bacteria	20627
1924	Ga0501072_0172336	3300049588	Bacteria	1727
1925	Ga0501072_0241408	3300049588	Bacteria	1439
1926	Ga0501073_0000034	3300049589	Bacteria	95224
1927	Ga0501073_0109839	3300049589	Bacteria	1913
1928	Ga0501074_0002163	3300049590	Bacteria	13619
1929	Ga0501074_0014736	3300049590	Bacteria	5686
1930	Ga0501074_0067981	3300049590	Bacteria	2561
1931	Ga0501076_0003638	3300049592	Bacteria	10831
1932	Ga0501076_0184579	3300049592	Bacteria	1701
1933	Ga0501249_004258	3300049679	Bacteria	2904
1934	Ga0501079_0000773	3300049741	Bacteria	21906
1935	Ga0501079_0165115	3300049741	Bacteria	1727
1936	Ga0501079_0321504	3300049741	Bacteria	1211
1937	Ga0501080_0000805	3300049742	Bacteria	25642
1938	Ga0501080_0001103	3300049742	Bacteria	22242
1939	Ga0501080_0190860	3300049742	Bacteria	1882
1940	Ga0501080_0213623	3300049742	Bacteria	1767
1941	Ga0501081_0028882	3300049743	Bacteria	3745
1942	Ga0501083_0000118	3300049744	Bacteria	54096
1943	Ga0501035_0000137	3300049822	Bacteria	89273
1944	Ga0501035_0000155	3300049822	Bacteria	84012
1945	Ga0501035_0013576	3300049822	Bacteria	7516
1946	Ga0501035_0185462	3300049822	Bacteria	1791
1947	Ga0501044_0000393	3300049823	Bacteria	54257
1948	Ga0501044_0000431	3300049823	Bacteria	51668
1949	Ga0501044_0043652	3300049823	Bacteria	4657
1950	Ga0501044_0048505	3300049823	Bacteria	4386
1951	Ga0501044_0184415	3300049823	Bacteria	2052
1952	Ga0501044_0273692	3300049823	Bacteria	1623
1953	Ga0501045_0005484	3300049824	Bacteria	8780
1954	Ga0501045_0011293	3300049824	Bacteria	6269
1955	Ga0501045_0370025	3300049824	Bacteria	1067
1956	nmdc:mga03683_18717_c1	3300050489	Bacteria	2636
1957	nmdc:mga03683_213821_c1	3300050489	Bacteria	888
1958	nmdc:mga03683_79709_c1	3300050489	Bacteria	1412
1959	nmdc:mga03n38_11501_c1	3300050490	Bacteria	3301
1960	nmdc:mga00v17_47706_c1	3300050491	Bacteria	2595
1961	nmdc:mga00v17_49102_c1	3300050491	Bacteria	2559
1962	nmdc:mga00v17_5677_c1	3300050491	Bacteria	6588
1963	nmdc:mga0yw44_10115_c1	3300050492	Bacteria	4804
1964	nmdc:mga0yw44_244705_c1	3300050492	Bacteria	1193
1965	nmdc:mga0yw44_49878_c1	3300050492	Bacteria	2528
1966	nmdc:mga0yw44_67720_c1	3300050492	Bacteria	2207
1967	nmdc:mga0yw44_87100_c1	3300050492	Bacteria	1968
1968	nmdc:mga0k408_151890_c1	3300050493	Bacteria	1379
1969	nmdc:mga0k408_26106_c1	3300050493	Bacteria	3311
1970	nmdc:mga0k408_72426_c1	3300050493	Bacteria	2012
1971	nmdc:mga0k408_97542_c1	3300050493	Bacteria	1731
1972	nmdc:mga06z11_140673_c1	3300050494	Bacteria	1364
1973	nmdc:mga06z11_172160_c1	3300050494	Bacteria	1244
1974	nmdc:mga06z11_269336_c1	3300050494	Bacteria	1007
1975	nmdc:mga06z11_5709_c1	3300050494	Bacteria	5013
1976	nmdc:mga06z11_5831_c1	3300050494	Bacteria	4972
1977	nmdc:mga06z11_62884_c1	3300050494	Bacteria	1539
1978	nmdc:mga07m45_110346_c1	3300050496	Bacteria	1584
1979	nmdc:mga07m45_26891_c1	3300050496	Bacteria	3165
1980	nmdc:mga07m45_7680_c1	3300050496	Bacteria	5223
1981	nmdc:mga05p37_168433_c1	3300050507	Bacteria	2673
1982	nmdc:mga05p37_213047_c1	3300050507	Bacteria	2334
1983	nmdc:mga05p37_293_c1	3300050507	Bacteria	52375
1984	nmdc:mga05p37_296873_c1	3300050507	Bacteria	1921
1985	nmdc:mga05p37_3152_c1	3300050507	Bacteria	19188
1986	nmdc:mga09592_1602_c1	3300050508	Bacteria	18242
1987	nmdc:mga09592_306541_c1	3300050508	Bacteria	1376
1988	nmdc:mga09592_347162_c1	3300050508	Bacteria	1284
1989	nmdc:mga09592_8789_c1	3300050508	Bacteria	8220
1990	nmdc:mga0qj67_1524_c1	3300050509	Bacteria	16254
1991	nmdc:mga0qj67_17595_c2	3300050509	Bacteria	4150
1992	nmdc:mga0qj67_237550_c1	3300050509	Bacteria	1478
1993	nmdc:mga06r32_139_c1	3300050510	Bacteria	54112
1994	nmdc:mga06r32_392781_c1	3300050510	Bacteria	1369
1995	nmdc:mga06r32_70_c1	3300050510	Bacteria	66330
1996	nmdc:mga06r32_8345_c1	3300050510	Bacteria	9325
1997	nmdc:mga08y16_210988_c1	3300050511	Bacteria	2011
1998	nmdc:mga08y16_36453_c1	3300050511	Bacteria	5166
1999	nmdc:mga08y16_43379_c1	3300050511	Bacteria	4713
2000	nmdc:mga08y16_6788_c1	3300050511	Bacteria	12011
2001	nmdc:mga08y16_81_c1	3300050511	Bacteria	81573
2002	nmdc:mga08y16_88943_c1	3300050511	Bacteria	3218
2003	nmdc:mga08y16_93500_c1	3300050511	Bacteria	3132
2004	nmdc:mga0n895_2094_c1	3300050512	Bacteria	15379
2005	nmdc:mga0n895_262777_c1	3300050512	Bacteria	1751
2006	nmdc:mga0n895_40277_c1	3300050512	Bacteria	4538
2007	nmdc:mga0rr50_108497_c1	3300050513	Bacteria	2193
2008	nmdc:mga0rr50_15563_c1	3300050513	Bacteria	5024
2009	nmdc:mga0rr50_555731_c1	3300050513	Bacteria	977
2010	nmdc:mga0rr50_59994_c1	3300050513	Bacteria	2859
2011	nmdc:mga0a205_17040_c1	3300050515	Bacteria	6801
2012	nmdc:mga0a205_29441_c1	3300050515	Bacteria	5255
2013	nmdc:mga0a205_294871_c2	3300050515	Bacteria	1058
2014	nmdc:mga0a205_31493_c1	3300050515	Bacteria	5081
2015	nmdc:mga0a205_830_c1	3300050515	Bacteria	25159
2016	nmdc:mga0sz30_15323_c1	3300050516	Bacteria	3028
2017	nmdc:mga0sz30_3996_c1	3300050516	Bacteria	5311
2018	Ga0495601_0296932	3300053077	Bacteria	1053
2019	Ga0495612_0034855	3300053078	Bacteria	2038
2020	Ga0495612_0079508	3300053078	Bacteria	1377
2021	Ga0500610_0000004	3300053079	Bacteria	139897
2022	Ga0495655_0054562	3300053083	Bacteria	1070
2023	Ga0495595_0070503	3300053084	Bacteria	1651
2024	Ga0495619_0015826	3300053085	Bacteria	4775
2025	Ga0495619_0048033	3300053085	Bacteria	2812
2026	Ga0495619_0127345	3300053085	Bacteria	1748
2027	Ga0500578_0028483	3300053086	Bacteria	3587
2028	Ga0500643_000037	3300053087	Bacteria	180821
2029	Ga0500643_027503	3300053087	Bacteria	1768
2030	Ga0500643_028911	3300053087	Bacteria	1710
2031	Ga0500646_0011894	3300053090	Bacteria	2242
2032	Ga0500647_0040972	3300053091	Bacteria	2222
2033	Ga0500651_0001199	3300053093	Bacteria	12870
2034	Ga0500651_0080305	3300053093	Bacteria	2020
2035	Ga0500566_0000166	3300053094	Bacteria	33843
2036	Ga0500566_0001046	3300053094	Bacteria	16010
2037	Ga0500566_0001772	3300053094	Bacteria	12687
2038	Ga0500566_0002306	3300053094	Bacteria	11289
2039	Ga0500566_0085084	3300053094	Bacteria	1754
2040	Ga0500566_0100525	3300053094	Bacteria	1586
2041	Ga0500640_000873	3300053095	Bacteria	8371
2042	Ga0500640_047604	3300053095	Bacteria	1880
2043	Ga0500641_0010047	3300053096	Bacteria	3412
2044	Ga0500641_0014080	3300053096	Bacteria	2947
2045	Ga0500641_0025121	3300053096	Bacteria	2303
2046	Ga0500641_0156289	3300053096	Bacteria	984
2047	Ga0500654_077221	3300053099	Bacteria	1579
2048	Ga0500554_000266	3300053102	Bacteria	11311
2049	Ga0500555_000550	3300053103	Bacteria	14953
2050	Ga0500556_0000089	3300053104	Bacteria	84468
2051	Ga0500557_000047	3300053105	Bacteria	59226
2052	Ga0500562_003706	3300053108	Bacteria	3842
2053	Ga0500572_000474	3300053111	Bacteria	13955
2054	Ga0500572_000614	3300053111	Bacteria	11989
2055	Ga0500572_007111	3300053111	Bacteria	2583
2056	Ga0500595_000891	3300053119	Bacteria	17010
2057	Ga0500595_002669	3300053119	Bacteria	8673
2058	Ga0500595_004982	3300053119	Bacteria	5863
2059	Ga0500595_007131	3300053119	Bacteria	4668
2060	Ga0500607_009772	3300053121	Bacteria	5757
2061	Ga0500608_000206	3300053122	Bacteria	23563
2062	Ga0500608_030294	3300053122	Bacteria	2564
2063	Ga0500614_002313	3300053123	Bacteria	4270
2064	Ga0500626_064744	3300053128	Bacteria	1632
2065	Ga0500642_0000050	3300053130	Bacteria	79050
2066	Ga0500642_0000071	3300053130	Bacteria	55663
2067	Ga0500652_000004	3300053131	Bacteria	173428
2068	Ga0500652_009694	3300053131	Bacteria	3269
2069	Ga0500655_004071	3300053133	Bacteria	2633
2070	Ga0500658_0023361	3300053134	Bacteria	2360
2071	Ga0500658_0091606	3300053134	Bacteria	1315
2072	Ga0500658_0213137	3300053134	Bacteria	884
2073	Ga0500559_0000136	3300053136	Bacteria	56922
2074	Ga0500559_0001651	3300053136	Bacteria	12343
2075	Ga0500559_0002659	3300053136	Bacteria	9097
2076	Ga0500559_0003297	3300053136	Bacteria	8005
2077	Ga0500559_0008736	3300053136	Bacteria	4419
2078	Ga0500568_0001309	3300053139	Bacteria	16339
2079	Ga0500568_0021334	3300053139	Bacteria	2788
2080	Ga0500568_0026208	3300053139	Bacteria	2449
2081	Ga0500568_0101520	3300053139	Bacteria	1079
2082	Ga0500573_0120136	3300053140	Bacteria	1463
2083	Ga0500577_0000632	3300053142	Bacteria	9019
2084	Ga0500577_0081718	3300053142	Bacteria	1290
2085	Ga0500586_002729	3300053145	Bacteria	4048
2086	Ga0500589_091596	3300053147	Bacteria	1338
2087	Ga0500603_000501	3300053150	Bacteria	9959
2088	Ga0500603_001014	3300053150	Bacteria	6610
2089	Ga0500603_008704	3300053150	Bacteria	2259
2090	Ga0500604_0000021	3300053151	Bacteria	72909
2091	Ga0500604_0017071	3300053151	Bacteria	2004
2092	Ga0500604_0026562	3300053151	Bacteria	1670
2093	Ga0500604_0113034	3300053151	Bacteria	903
2094	Ga0500616_0000026	3300053153	Bacteria	454314
2095	Ga0500616_0009002	3300053153	Bacteria	6115
2096	Ga0500616_0094571	3300053153	Bacteria	1472
2097	Ga0500622_0001149	3300053156	Bacteria	22026
2098	Ga0500622_0001752	3300053156	Bacteria	16718
2099	Ga0500622_0134081	3300053156	Bacteria	1188
2100	Ga0500627_0055392	3300053158	Bacteria	1736
2101	Ga0500630_002780	3300053159	Bacteria	8437
2102	Ga0500633_0004613	3300053160	Bacteria	3184
2103	Ga0500638_023402	3300053162	Bacteria	2936
2104	Ga0500638_030195	3300053162	Bacteria	2609
2105	Ga0500638_051323	3300053162	Bacteria	1994
2106	Ga0500638_078689	3300053162	Bacteria	1568
2107	Ga0500639_000112	3300053163	Bacteria	38789
2108	Ga0500636_0000880	3300053177	Bacteria	16096
2109	Ga0500636_0002910	3300053177	Bacteria	9590
2110	Ga0500636_0023543	3300053177	Bacteria	3640
2111	Ga0500636_0023642	3300053177	Bacteria	3633
2112	Ga0500636_0051194	3300053177	Bacteria	2428
2113	Ga0500636_0094499	3300053177	Bacteria	1708
2114	Ga0500636_0167953	3300053177	Bacteria	1189
2115	Ga0500637_0000240	3300053178	Bacteria	20394
2116	Ga0500637_0000582	3300053178	Bacteria	14362
2117	Ga0500637_0159389	3300053178	Bacteria	1301
2118	Ga0500637_0197576	3300053178	Bacteria	1146
2119	Ga0500625_001064	3300053729	Bacteria	8854
2120	Ga0500645_071404	3300053730	Bacteria	996
2121	Ga0500596_001425	3300053735	Bacteria	4835
2122	Ga0500596_016115	3300053735	Bacteria	1123
2123	Ga0500601_000014	3300053737	Bacteria	41972
2124	Ga0501084_0002041	3300054114	Bacteria	16122
2125	Ga0500661_003063	3300055283	Bacteria	3142
2126	Ga0500661_015619	3300055283	Bacteria	1361
2127	Ga0501082_0002604	3300060353	Bacteria	15767
2128	Ga0501082_0013466	3300060353	Bacteria	7025
2129	Ga0501082_0644965	3300060353	Bacteria	927
2130	Ga0466962_0067511	3300061719	Bacteria	1707
2131	2507510600	2507262055	Bacteria	8048963
2132	2508544402	2508501009	Bacteria	7784016
2133	2508697457	2508501042	Bacteria	8719808
2134	2508729086	2508501050	Bacteria	9633614
2135	2509078107	2508501114	Bacteria	7082538
2136	2509148597	2508501128	Bacteria	8613869
2137	2511396329	2511231028	Bacteria	8046582
2138	2513628811	2513237092	Bacteria	8341956
2139	2513640206	2513237094	Bacteria	8789602
2140	2513650757	2513237095	Bacteria	8976980
2141	2513693819	2513237101	Bacteria	7952346
2142	2513703836	2513237102	Bacteria	7703324
2143	2513715866	2513237104	Bacteria	10034502
2144	2513877756	2513237139	Bacteria	8737671
2145	2513888396	2513237141	Bacteria	8496279
2146	2514015053	2513237161	Bacteria	8871253
2147	2515628652	2515154112	Bacteria	8294334
2148	2517105524	2517093001	Bacteria	9002274
2149	2524437003	2524023205	Bacteria	8918781
2150	2528852294	2528768022	Bacteria	10457665
2151	2548499503	2547132374	Bacteria	5530232
2152	2599621953	2599185214	Bacteria	8209958
2153	2599676883	2599185226	Bacteria	8233575
2154	2599685145	2599185227	Bacteria	8246414
2155	2599691463	2599185229	Bacteria	8216126
2156	2603862518	2602042107	Bacteria	6226103
2157	2617350017	2617270735	Bacteria	9163226
2158	2617378696	2617270741	Bacteria	8201522
2159	2643866332	2643221570	Bacteria	5103772
2160	2643994320	2643221596	Bacteria	5006805
2161	2644072492	2643221611	Bacteria	6820941
2162	2644293153	2643221652	Bacteria	5140275
2163	2644301996	2643221654	Bacteria	5273570
2164	2644648167	2643221717	Bacteria	5676132
2165	2722883059	2721755523	Bacteria	6430384
2166	2723843391	2721755755	Bacteria	8322773
2167	2739058078	2738541337	Bacteria	6183410
2168	2745076167	2744054633	Bacteria	8678936
2169	2774874419	2773857925	Bacteria	6472445
2170	2776258954	2775506901	Bacteria	9631051
2171	2793063365	2791355196	Bacteria	7323613
2172	2793077883
2173	2805917116	2802429603	Bacteria	8777136
2174	2818243561	2816332527	Bacteria	8933356
2175	2819598028	2818991446	Bacteria	7757362
2176	2821445689	2821443989	Bacteria	7658172
2177	2824603912	2824600985	Bacteria	8488197
2178	2824612553	2824609381	Bacteria	8672835
2179	2824621729	2824617872	Bacteria	8814715
2180	2824630802	2824626560	Bacteria	8813858
2181	2824637433	2824635225	Bacteria	8785348
2182	2824646318	2824644064	Bacteria	8743947
2183	2824655616	2824653114	Bacteria	8493680
2184	2824662432	2824661429	Bacteria	9877870
2185	2824676057	2824671348	Bacteria	8369588
2186	2824682334	2824679649	Bacteria	8248951
2187	2824692180	2824687955	Bacteria	8360029
2188	2824696588	2824696289	Bacteria	8335049
2189	2824705700	2824704595	Bacteria	9667483
2190	2824717482	2824714736	Bacteria	8717648
2191	2824726722	2824723954	Bacteria	8758240
2192	2824733677	2824732956	Bacteria	7810675
2193	2824747965	2824746037	Bacteria	7911610
2194	2824756382	2824753945	Bacteria	9787441
2195	2824764067	2824763712	Bacteria	9792355
2196	2824776743	2824773399	Bacteria	8360218
2197	2831269018	2831265667	Bacteria	7184833
2198	2835312738	2835312727	Bacteria	7413381
2199	2838058444	2838054893	Bacteria	7451788
2200	2838125400	2838122688	Bacteria	8803140
2201	2841941940	2841941048	Bacteria	8688029
2202	2841951374	2841949485	Bacteria	8680857
2203	2841958943	2841957949	Bacteria	8652217
2204	2841968627	2841966195	Bacteria	8673214
2205	2841976172	2841974524	Bacteria	8931498
2206	2841987537	2841983080	Bacteria	8395090
2207	2842045090	2842038055	Bacteria	8002051
2208	2842049249	2842045827	Bacteria	8006841
2209	2842737871	2842733646	Bacteria	5716726
2210	2842752769	2842747753	Bacteria	5578255
2211	2844317328	2844315083	Bacteria	8138177
2212	2844533805	2844533157	Bacteria	7517899
2213	2847934033	2847930680	Bacteria	9342022
2214	2847944691	2847939898	Bacteria	8606328
2215	2849081082	2849076700	Bacteria	7039503
2216	2857516145	2857509624	Bacteria	7472071
2217	2857529858	2857524615	Bacteria	6615449
2218	2874594760	2874590934	Bacteria	8299676
2219	2874611697	2874604998	Bacteria	7834745
2220	2874612938	2874612657	Bacteria	8252029
2221	2874620663	2874620515	Bacteria	8290088
2222	2874634739	2874628541	Bacteria	8630250
2223	2874646879	2874645413	Bacteria	8214782
2224	2876769398	2876761206	Bacteria	10111113
2225	2876774398	2876771140	Bacteria	8287509
2226	2876812112	2876808645	Bacteria	8824342
2227	2876822812	2876818435	Bacteria	8274608
2228	2879078552	2879074833	Bacteria	8279565
2229	2879086879	2879083081	Bacteria	8587928
2230	2879109764	2879099564	Bacteria	10442239
2231	2879114936	2879110137	Bacteria	8907982
2232	2879129882	2879127579	Bacteria	8294491
2233	2879146207	2879142872	Bacteria	8267021
2234	2881369194	2881364244	Bacteria	7710352
2235	2881667627	2881665667	Bacteria	8175609
2236	2881929255	2881927736	Bacteria	3993927
2237	2882459310	2882456835	Bacteria	6863978
2238	2884300091	2884298095	Bacteria	3823049
2239	2885203815	2885198086	Bacteria	7212419
2240	2885217850	2885211737	Bacteria	7212420
2241	2885367421	2885366525	Bacteria	8326213
2242	2885417659	2885409591	Bacteria	9235467
2243	2885427301	2885427238	Bacteria	2291351
2244	2888388637	2888388044	Bacteria	7304136
2245	2888422631	2888419890	Bacteria	7857137
2246	2889037713	2889033259	Bacteria	9099371
2247	2893069495	2893066018	Bacteria	6158120
2248	2894237226	2894232714	Bacteria	8834183
2249	2896429293	2896429255	Bacteria	2557483
2250	2899929447	2899924645	Bacteria	7487985
2251	2903733286	2903727486	Bacteria	8281579
2252	2904451061	2904449895	Bacteria	6927402
2253	2904666586	2904666416	Bacteria	8226587
2254	2904720350	2904711408	Bacteria	9771557
2255	2906606252	2906602504	Bacteria	8295279
2256	2906634091	2906626472	Bacteria	8826946
2257	2906647538	2906643746	Bacteria	8722424
2258	2908778269	2908775508	Bacteria	8092255
2259	2919077286	2919073203	Bacteria	6531949
2260	2922361660	2922361189	Bacteria	7436256
2261	2922371965
2262	2922387086	2922386360	Bacteria	7017218
2263	2922399294	2922393267	Bacteria	8285685
2264	2928040109	2928037797	Bacteria	7273642
2265	2928047142	2928044640	Bacteria	7271509
2266	2928057655	2928051484	Bacteria	7773759
2267	2928067963	2928064002	Bacteria	7419480
2268	2928072536	2928070936	Bacteria	8062541
2269	2929616693	2929615660	Bacteria	9193770
2270	2929625437	2929624759	Bacteria	9339455
2271	2932793113	2932784394	Bacteria	9704911
2272	2932801245	2932794094	Bacteria	7915132
2273	2932803627	2932801729	Bacteria	7987968
2274	2932814581	2932809354	Bacteria	9135765
2275	2932824646	2932818245	Bacteria	9955613
2276	2932836573	2932828146	Bacteria	9745859
2277	2933578024	2933577622	Bacteria	9116884
2278	2935610667	2935608549	Bacteria	8203142
2279	2935623306	2935616580	Bacteria	9032984
2280	2935646696	2935638405	Bacteria	10015038
2281	2935652438	2935648319	Bacteria	8801166
2282	2935661020	2935656913	Bacteria	8965014
2283	2935672634	2935665750	Bacteria	9571747
2284	2935682507	2935675223	Bacteria	9928132
2285	2935691711	2935684952	Bacteria	9590419
2286	2935699580	2935694250	Bacteria	9291695
2287	2935707817	2935703347	Bacteria	10242284
2288	2935719545	2935713505	Bacteria	9608509
2289	2935728853	2935722832	Bacteria	9608746
2290	2935737905	2935732158	Bacteria	9706831
2291	2935747280	2935741537	Bacteria	9707219
2292	2935757919	2935750917	Bacteria	9590372
2293	2935761712	2935760218	Bacteria	9817913
2294	2935770553	2935769743	Bacteria	7878163
2295	2935782786	2935777560	Bacteria	8077691
2296	2935787162	2935785616	Bacteria	7962367
2297	2935795210	2935793552	Bacteria	8012592
2298	2935810092	2935801545	Bacteria	9301974
2299	2935819024	2935810662	Bacteria	9401221
2300	2935820164	2935819856	Bacteria	8261050
2301	2935835963	2935827899	Bacteria	10038562
2302	2935844913	2935837841	Bacteria	9454360
2303	2935849825	2935847175	Bacteria	8228321
2304	2935861694	2935855204	Bacteria	9035059
2305	2935870733	2935864058	Bacteria	9784707
2306	2935881394	2935873716	Bacteria	9632195
2307	2935887898	2935883170	Bacteria	7964738
2308	2935914485	2935908558	Bacteria	8568796
2309	2935919035	2935916978	Bacteria	9113783
2310	2935932134	2935926038	Bacteria	8601059
2311	2935940732	2935934488	Bacteria	8602579
2312	2935948681	2935942939	Bacteria	8599779
2313	2935957212	2935951376	Bacteria	8602333
2314	2935963642	2935959822	Bacteria	7869783
2315	2935973816	2935967501	Bacteria	8603075
2316	2935979688	2935975950	Bacteria	8347125
2317	2935988943	2935984226	Bacteria	8302647
2318	2936000424	2935992306	Bacteria	9802711
2319	2936005441	2936002035	Bacteria	9362176
2320	2936015077	2936011229	Bacteria	8801034
2321	2936023222	2936019824	Bacteria	8804134
2322	2936032325	2936028420	Bacteria	8965941
2323	2936041980	2936037263	Bacteria	9446081
2324	2936050186	2936046547	Bacteria	8903709
2325	2936061106	2936055302	Bacteria	8785755
2326	2940564169	2940556831	Bacteria	9590747
2327	2941535150	2941531003	Bacteria	7653939
2328	2941546720	2941538514	Bacteria	9402094
2329	2990714387	2990710928	Bacteria	5002431
2330	3005486324	3005483717	Bacteria	7877331
2331	3005512151	3005506211	Bacteria	6943378
2332	3005593652	3005587118	Bacteria	7794411
2333	3005597024	3005594810	Bacteria	8716512
2334	3005713096	3005710791	Bacteria	7622528
2335	3005720456	3005718088	Bacteria	8283608
2336	8006932403	8006926726	Bacteria	6749210
2337	8006966769	8006964411	Bacteria	8966052
2338	8006984723	8006984368	Bacteria	9651211
2339	8006994714	8006994254	Bacteria	8309700
2340	8016515709	8016511872	Bacteria	9921665
2341	8016523274	8016522445	Bacteria	8156687
2342	8016536764	8016530956	Bacteria	8155261
2343	8016541039	8016539877	Bacteria	8155419
2344	8016552215	8016548790	Bacteria	8155074
2345	8016560594	8016557553	Bacteria	8154380
2346	8016566427	8016566248	Bacteria	8158151
2347	8016579175	8016575299	Bacteria	8154085
2348	8016590069	8016583857	Bacteria	10421953
2349	8016598489	8016595262	Bacteria	8149947
2350	8016612648	8016603502	Bacteria	8731218
2351	8016621174	8016613128	Bacteria	8794220
2352	8016628847	8016622563	Bacteria	7999408
2353	8016633374	8016630954	Bacteria	9217207
2354	8017060790	8017057580	Bacteria	10023680
2355	8019536464	8019530166	Bacteria	8155624
2356	8019542985	8019538911	Bacteria	7872763
2357	8019580313	8019576017	Bacteria	10049540
2358	8019588032	8019586578	Bacteria	10212056
2359	8019603305	8019597564	Bacteria	10041141
2360	8019636458	8019629233	Bacteria	8687553
2361	8019643176	8019638758	Bacteria	9062356
2362	8019656007	8019648815	Bacteria	10014479
2363	8019664238	8019659431	Bacteria	8577854
2364	8019673822	8019668869	Bacteria	8791617
2365	8019682283	8019678201	Bacteria	8863603
2366	8019687984	8019687851	Bacteria	8712826
2367	8055748339	8055742211	Bacteria	9226248
2368	8056680811	8056673599	Bacteria	7871253
2369	8056971961	8056967851	Bacteria	9038162
2370	Ga0451853_0782180
2371	JGI24739J22299_10011385
2372	JGI24739J22299_10025926
2373	JGI24737J22298_10003686
2374	JGI24743J22301_10002134
2375	JGI24735J21928_10027784
2376	JGI25152J39213_1003814
2377	JGI25150J39212_1002872
2378	JGI25151J46595_10000332
2379	JGI25151J46595_10002370
2380	JGI25406J46586_10000224
2381	JGI25406J46586_10001185
2382	JGI25165J46597_1004828
2383	JGI25153J46596_10000110
2384	JGI25153J46596_10000161
2385	JGI25153J46596_10000725
2386	JGI25153J46596_10001735
2387	JGI25153J46596_10003973
2388	JGI25153J46596_10033295
2389	rootL2_10023171
2390	JGI25160J50197_1002211
2391	JGI25160J50197_1002809
2392	JGI25160J50197_1008188
2393	JGI25161J50226_1009901
2394	Ga0006562J51391_1115764
2395	Ga0006562J51391_1115765
2396	JGI25404J52841_10004559
2397	Ga0055535_1000874
2398	Ga0055542_1000003
2399	Ga0055526_1000102
2400	Ga0055526_1000104
2401	Ga0055536_1003234
2402	Ga0055534_1006690
2403	Ga0055530_10000292
2404	Ga0055540_1023025
2405	Ga0055531_10004166
2406	Ga0055531_10022600
2407	Ga0055531_10024346
2408	Ga0055543_1002636
2409	Ga0055543_1009855
2410	Ga0065165_1000244
2411	Ga0065165_1000368
2412	Ga0065165_1005521
2413	Ga0065165_1024612
2414	Ga0065715_10001629
2415	Ga0070658_10000029
2416	Ga0070658_10009418
2417	Ga0070658_10036717
2418	Ga0070658_10056840
2419	Ga0070658_10062936
2420	Ga0070676_10107924
2421	Ga0070683_100016648
2422	Ga0070683_100019922
2423	Ga0070683_100161233
2424	Ga0070683_100544406
2425	Ga0070690_100284451
2426	Ga0070670_100009818
2427	Ga0070670_100033220
2428	Ga0070670_100061218
2429	Ga0070677_10009599
2430	Ga0070677_10019880
2431	Ga0070677_10021259
2432	Ga0070677_10139572
2433	Ga0068869_100103869
2434	Ga0068869_100313676
2435	Ga0068869_100491093
2436	Ga0070666_10107047
2437	Ga0070666_10145219
2438	Ga0070666_10234772
2439	Ga0070680_100001995
2440	Ga0070680_100053429
2441	Ga0070680_100086504
2442	Ga0070680_100099818
2443	Ga0070680_100184215
2444	Ga0070680_100195563
2445	Ga0068868_100000005
2446	Ga0068868_100008462
2447	Ga0068868_100061484
2448	Ga0068868_100159091
2449	Ga0068868_100203468
2450	Ga0070660_100003340
2451	Ga0070660_100003372
2452	Ga0070660_100027919
2453	Ga0070660_100053813
2454	Ga0070660_100087222
2455	Ga0070660_100101200
2456	Ga0070660_100176875
2457	Ga0070660_100452773
2458	Ga0070689_100269658
2459	Ga0070689_100400099
2460	Ga0070691_10002854
2461	Ga0070687_100134621
2462	Ga0070661_100012406
2463	Ga0070661_100040022
2464	Ga0070661_100076796
2465	Ga0070661_100082171
2466	Ga0070661_100316497
2467	Ga0070661_100457904
2468	Ga0070692_10001329
2469	Ga0070668_100002567
2470	Ga0070668_100084992
2471	Ga0070668_100086608
2472	Ga0070668_100115435
2473	Ga0070668_100158902
2474	Ga0070668_100199720
2475	Ga0070668_100461574
2476	Ga0070668_100470019
2477	Ga0070669_100003020
2478	Ga0070669_100018096
2479	Ga0070669_100025367
2480	Ga0070669_100061056
2481	Ga0070669_100248902
2482	Ga0070669_100322007
2483	Ga0070669_100353281
2484	Ga0070669_100419944
2485	Ga0070669_100596703
2486	Ga0070675_100001425
2487	Ga0070675_100012081
2488	Ga0070675_100033049
2489	Ga0070675_100229226
2490	Ga0070675_100269558
2491	Ga0070675_100398498
2492	Ga0070671_100116660
2493	Ga0070671_100311675
2494	Ga0070674_100018354
2495	Ga0070674_100024025
2496	Ga0070674_100229094
2497	Ga0070673_100007540
2498	Ga0070673_100053106
2499	Ga0070673_100062072
2500	Ga0070673_100276446
2501	Ga0070673_100328445
2502	Ga0070673_100365801
2503	Ga0070688_100127320
2504	Ga0070688_100139361
2505	Ga0070688_100562113
2506	Ga0070659_100000011
2507	Ga0070659_100000968
2508	Ga0070659_100006463
2509	Ga0070659_100021021
2510	Ga0070659_100026467
2511	Ga0070659_100045117
2512	Ga0070659_100096750
2513	Ga0070659_100108965
2514	Ga0070659_100184351
2515	Ga0070659_100247864
2516	Ga0070659_100377970
2517	Ga0070667_100022671
2518	Ga0070667_100023212
2519	Ga0070667_100410524
2520	Ga0070667_100435448
2521	Ga0070709_10001991
2522	Ga0070709_10132374
2523	Ga0070714_100042921
2524	Ga0070714_100130606
2525	Ga0070714_100192269
2526	Ga0070714_100628752
2527	Ga0070713_100000921
2528	Ga0070713_100018458
2529	Ga0070713_100020170
2530	Ga0070713_100034285
2531	Ga0070713_100047162
2532	Ga0070713_100048195
2533	Ga0070713_100049692
2534	Ga0070710_10000965
2535	Ga0070710_10002824
2536	Ga0070711_100001902
2537	Ga0070711_100009556
2538	Ga0070711_100012353
2539	Ga0070711_100015153
2540	Ga0070711_100016194
2541	Ga0070711_100151945
2542	Ga0070711_100308984
2543	Ga0070694_100004766
2544	Ga0070694_100285477
2545	Ga0070694_100501941
2546	Ga0070708_100138030
2547	Ga0070663_100081745
2548	Ga0070663_100109870
2549	Ga0070663_100147387
2550	Ga0070663_100255185
2551	Ga0070663_100352031
2552	Ga0070678_100018801
2553	Ga0070678_100041156
2554	Ga0070678_100073083
2555	Ga0070678_100101718
2556	Ga0070678_100192228
2557	Ga0070678_100215430
2558	Ga0070678_100428401
2559	Ga0070678_100517960
2560	Ga0070678_100520181
2561	Ga0070662_100004215
2562	Ga0070662_100013471
2563	Ga0070662_100017872
2564	Ga0070662_100047168
2565	Ga0070662_100064068
2566	Ga0070662_100099585
2567	Ga0070662_100178278
2568	Ga0070662_100229187
2569	Ga0070662_100310415
2570	Ga0070662_100337326
2571	Ga0070681_10028028
2572	Ga0070681_10041251
2573	Ga0070681_10046096
2574	Ga0070681_10107243
2575	Ga0070681_10195409
2576	Ga0068867_100000285
2577	Ga0068867_100033571
2578	Ga0068867_100075533
2579	Ga0068867_100108796
2580	Ga0068867_100301498
2581	Ga0068867_100349792
2582	Ga0070685_10065060
2583	Ga0070706_100220047
2584	Ga0070707_100042282
2585	Ga0070707_100043146
2586	Ga0070707_100064812
2587	Ga0070707_100101632
2588	Ga0070699_100008958
2589	Ga0070679_100000007
2590	Ga0070679_100003827
2591	Ga0070679_100021536
2592	Ga0070679_100032253
2593	Ga0070679_100036859
2594	Ga0070679_100067766
2595	Ga0070679_100102813
2596	Ga0070679_100287187
2597	Ga0070679_100341473
2598	Ga0070679_100369681
2599	Ga0070679_100654731
2600	Ga0070684_100041168
2601	Ga0070697_100016393
2602	Ga0070697_100337114
2603	Ga0068853_100017303
2604	Ga0068853_100064981
2605	Ga0068853_100092671
2606	Ga0068853_100180221
2607	Ga0068853_100218220
2608	Ga0068853_100595522
2609	Ga0070672_100001070
2610	Ga0070672_100080622
2611	Ga0070672_100135539
2612	Ga0070672_100142885
2613	Ga0070672_100360406
2614	Ga0070686_100074623
2615	Ga0070686_100535947
2616	Ga0070696_100011158
2617	Ga0070696_100013451
2618	Ga0070696_100077454
2619	Ga0070696_100114521
2620	Ga0070693_100069589
2621	Ga0070693_100247563
2622	Ga0070665_100000380
2623	Ga0070665_100013089
2624	Ga0070665_100025378
2625	Ga0070665_100027447
2626	Ga0070665_100051209
2627	Ga0070665_100059843
2628	Ga0070665_100095605
2629	Ga0070665_100188831
2630	Ga0070665_100190426
2631	Ga0070665_100207744
2632	Ga0070665_100215214
2633	Ga0070665_100330690
2634	Ga0070665_100522529
2635	Ga0068855_100004718
2636	Ga0068855_100007683
2637	Ga0068855_100019660
2638	Ga0068855_100032183
2639	Ga0068855_100043191
2640	Ga0068855_100057975
2641	Ga0068855_100082424
2642	Ga0068855_100138623
2643	Ga0068855_100629260
2644	Ga0070664_100004242
2645	Ga0070664_100044608
2646	Ga0070664_100063796
2647	Ga0070664_100102590
2648	Ga0070664_100280293
2649	Ga0070664_100341577
2650	Ga0070664_100353660
2651	Ga0070664_100446003
2652	Ga0070664_100760195
2653	Ga0068857_100053451
2654	Ga0068857_100054029
2655	Ga0068857_100068647
2656	Ga0068854_100040820
2657	Ga0068854_100079018
2658	Ga0068854_100189799
2659	Ga0068854_100221032
2660	Ga0068854_100261181
2661	Ga0068854_100264672
2662	Ga0068856_100000147
2663	Ga0068856_100005034
2664	Ga0068856_100069833
2665	Ga0068856_100162305
2666	Ga0068856_100196095
2667	Ga0068856_100330638
2668	Ga0068856_100473303
2669	Ga0070702_100086925
2670	Ga0068852_100022132
2671	Ga0068852_100030238
2672	Ga0068852_100035255
2673	Ga0068852_100040905
2674	Ga0068852_100050969
2675	Ga0068852_100148554
2676	Ga0068852_100173399
2677	Ga0068852_100180522
2678	Ga0068852_100215312
2679	Ga0068859_100005527
2680	Ga0068859_100050860
2681	Ga0068859_100057981
2682	Ga0068859_100125347
2683	Ga0068859_100269639
2684	Ga0068864_100023922
2685	Ga0068864_100071279
2686	Ga0068864_100094335
2687	Ga0068864_100153816
2688	Ga0068864_100713358
2689	Ga0068866_10054748
2690	Ga0068861_100037014
2691	Ga0068861_100153652
2692	Ga0068861_100184415
2693	Ga0068851_10007825
2694	Ga0068851_10009284
2695	Ga0068851_10183801
2696	Ga0068863_100015315
2697	Ga0068863_100526180
2698	Ga0068858_100011350
2699	Ga0068858_100030269
2700	Ga0068858_100118424
2701	Ga0068858_100141648
2702	Ga0068858_100258344
2703	Ga0068858_100617325
2704	Ga0068860_100000302
2705	Ga0068860_100037214
2706	Ga0068860_100037514
2707	Ga0068860_100139851
2708	Ga0068860_100218011
2709	Ga0068860_100418110
2710	Ga0068860_100449261
2711	Ga0068862_100033548
2712	Ga0068862_100046319
2713	Ga0068862_100056187
2714	Ga0068862_100066590
2715	Ga0068862_100541415
2716	Ga0081455_10000715
2717	Ga0081455_10069205
2718	Ga0081455_10167403
2719	Ga0081540_1000085
2720	Ga0081540_1005117
2721	Ga0081540_1005134
2722	Ga0081540_1006569
2723	Ga0081540_1014622
2724	Ga0081540_1014909
2725	Ga0081540_1022082
2726	Ga0081540_1024701
2727	Ga0081540_1032477
2728	Ga0081540_1082270
2729	Ga0081539_10000115
2730	Ga0081539_10000172
2731	Ga0081539_10000199
2732	Ga0081539_10000785
2733	Ga0081539_10105036
2734	Ga0081539_10199651
2735	Ga0070717_10001544
2736	Ga0070717_10004489
2737	Ga0070717_10039248
2738	Ga0070717_10062109
2739	Ga0070717_10114498
2740	Ga0070717_10431354
2741	Ga0075365_10014062
2742	Ga0075365_10021071
2743	Ga0075365_10028542
2744	Ga0075365_10031524
2745	Ga0075365_10059673
2746	Ga0075365_10209485
2747	Ga0075365_10210133
2748	Ga0075365_10282271
2749	Ga0075368_10005521
2750	Ga0075368_10013315
2751	Ga0075368_10017067
2752	Ga0075363_100004092
2753	Ga0075363_100009121
2754	Ga0075363_100088365
2755	Ga0075363_100099858
2756	Ga0075364_10005255
2757	Ga0075364_10013415
2758	Ga0075364_10052670
2759	Ga0075364_10069176
2760	Ga0075432_10007816
2761	Ga0075432_10019337
2762	Ga0070715_10002681
2763	Ga0070716_100001142
2764	Ga0070716_100014236
2765	Ga0070716_100046158
2766	Ga0070716_100097542
2767	Ga0070716_100100009
2768	Ga0070712_100024007
2769	Ga0070712_100067121
2770	Ga0070712_100286863
2771	Ga0075362_10019216
2772	Ga0075362_10042466
2773	Ga0075362_10046250
2774	Ga0075362_10077020
2775	Ga0075362_10093559
2776	Ga0075367_10022968
2777	Ga0075367_10050940
2778	Ga0075367_10069015
2779	Ga0075369_10001488
2780	Ga0075369_10045018
2781	Ga0075369_10045822
2782	Ga0075369_10131036
2783	Ga0075366_10005712
2784	Ga0075366_10013458
2785	Ga0097621_100002807
2786	Ga0097621_100033028
2787	Ga0097621_100137832
2788	Ga0097621_100158478
2789	Ga0075370_10006725
2790	Ga0075370_10016448
2791	Ga0075370_10032898
2792	Ga0075370_10061359
2793	Ga0068871_100031492
2794	Ga0068871_100035550
2795	Ga0068871_100079198
2796	Ga0068871_100122118
2797	Ga0068871_100211413
2798	Ga0068871_100320609
2799	Ga0075428_100001052
2800	Ga0075428_100039764
2801	Ga0075428_100164641
2802	Ga0075428_100707426
2803	Ga0075430_100000534
2804	Ga0075430_100029014
2805	Ga0075431_100000254
2806	Ga0075431_100032436
2807	Ga0075431_100545098
2808	Ga0075433_10003127
2809	Ga0075433_10037592
2810	Ga0075433_10431746
2811	Ga0075434_100002106
2812	Ga0075429_100000200
2813	Ga0075429_100006359
2814	Ga0075429_100419214
2815	Ga0068865_100006815
2816	Ga0068865_100033834
2817	Ga0068865_100072880
2818	Ga0068865_100119517
2819	Ga0068865_100192161
2820	Ga0068865_100395507
2821	Ga0097620_100005527
2822	Ga0097620_100050860
2823	Ga0097620_100057981
2824	Ga0097620_100125338
2825	Ga0097620_100269638
2826	Ga0099825_1027246
2827	Ga0099824_1016349
2828	Ga0079104_1000724
2829	Ga0075435_100016695
2830	Ga0075435_100119440
2831	Ga0075435_100152299
2832	Ga0075435_100170922
2833	Ga0099794_10008728
2834	Ga0105250_10112414
2835	Ga0105240_10004412
2836	Ga0105240_10008091
2837	Ga0105240_10008642
2838	Ga0105240_10010045
2839	Ga0105240_10012019
2840	Ga0105240_10015247
2841	Ga0105240_10017488
2842	Ga0105240_10034973
2843	Ga0105240_10090434
2844	Ga0105240_10090511
2845	Ga0105240_10106678
2846	Ga0105240_10108292
2847	Ga0105240_10471305
2848	Ga0105240_10760145
2849	Ga0111539_10000564
2850	Ga0111539_10012366
2851	Ga0111539_10070747
2852	Ga0111539_10082393
2853	Ga0111539_10089824
2854	Ga0111539_10094281
2855	Ga0111539_10193811
2856	Ga0111539_10244053
2857	Ga0111539_10313824
2858	Ga0105245_10040531
2859	Ga0105245_10163250
2860	Ga0105245_10189152
2861	Ga0105245_10229063
2862	Ga0105245_10543751
2863	Ga0105247_10073195
2864	Ga0105247_10108294
2865	Ga0105247_10122189
2866	Ga0114129_10000401
2867	Ga0114129_10011646
2868	Ga0114129_10226999
2869	Ga0114129_10647731
2870	Ga0105243_10001009
2871	Ga0105243_10006328
2872	Ga0105243_10108321
2873	Ga0105243_10285668
2874	Ga0105243_10324969
2875	Ga0105243_10457638
2876	Ga0105243_10512711
2877	Ga0105243_10590422
2878	Ga0105241_10004915
2879	Ga0105241_10024079
2880	Ga0105241_10072272
2881	Ga0105241_10145832
2882	Ga0105242_10002274
2883	Ga0105242_10012513
2884	Ga0105242_10141549
2885	Ga0105242_10264759
2886	Ga0105242_10324652
2887	Ga0105242_10334141
2888	Ga0105242_10652965
2889	Ga0105248_10028788
2890	Ga0105248_10041091
2891	Ga0105248_10089860
2892	Ga0105248_10111773
2893	Ga0105248_10392028
2894	Ga0105248_10552465
2895	Ga0105248_10576570
2896	Ga0105237_10000892
2897	Ga0105237_10006394
2898	Ga0105237_10007390
2899	Ga0105237_10087486
2900	Ga0105237_10097877
2901	Ga0105237_10119279
2902	Ga0105237_10125521
2903	Ga0105237_10138637
2904	Ga0105237_10362669
2905	Ga0105237_10492705
2906	Ga0105238_10018146
2907	Ga0105238_10021641
2908	Ga0105238_10024436
2909	Ga0105238_10026218
2910	Ga0105238_10113334
2911	Ga0105238_10192185
2912	Ga0105238_10206214
2913	Ga0105238_10242693
2914	Ga0105238_10396505
2915	Ga0105238_10450042
2916	Ga0105238_10520468
2917	Ga0105249_10006166
2918	Ga0105249_10153100
2919	Ga0105249_10246814
2920	Ga0105249_10280156
2921	Ga0099796_10023926
2922	Ga0105239_10006372
2923	Ga0105239_10031875
2924	Ga0105239_10038605
2925	Ga0105239_10039382
2926	Ga0105239_10083653
2927	Ga0105239_10384083
2928	Ga0105239_10838527
2929	Ga0105246_10003387
2930	Ga0105246_10025946
2931	Ga0105246_10074656
2932	Ga0105246_10094126
2933	Ga0105246_10140827
2934	Ga0157342_1008141
2935	Ga0157373_10029298
2936	Ga0157373_10049807
2937	Ga0157373_10053043
2938	Ga0157371_10066941
2939	Ga0157370_10002015
2940	Ga0157370_10038514
2941	Ga0157370_10068482
2942	Ga0157370_10084692
2943	Ga0157370_10144763
2944	Ga0157370_10239308
2945	Ga0157369_10012743
2946	Ga0157369_10016806
2947	Ga0157369_10066983
2948	Ga0157369_10332266
2949	Ga0157374_10004594
2950	Ga0157374_10007579
2951	Ga0157374_10035746
2952	Ga0157374_10173041
2953	Ga0157374_10199058
2954	Ga0157374_10227860
2955	Ga0157374_10403583
2956	Ga0157378_10032048
2957	Ga0157378_10053721
2958	Ga0157378_10101211
2959	Ga0157378_10169792
2960	Ga0163162_10007077
2961	Ga0163162_10029211
2962	Ga0163162_10080781
2963	Ga0163162_10140829
2964	Ga0163162_10395262
2965	Ga0157372_10057177
2966	Ga0157372_10092400
2967	Ga0157372_10355368
2968	Ga0157372_10720877
2969	Ga0157375_10016147
2970	Ga0157375_10068425
2971	Ga0157375_10115048
2972	Ga0157375_10123080
2973	Ga0157375_10232686
2974	Ga0157375_10635269
2975	Ga0163163_10005130
2976	Ga0163163_10128078
2977	Ga0163163_10227834
2978	Ga0163163_10251131
2979	Ga0163163_10266619
2980	Ga0163163_10311256
2981	Ga0163163_10559056
2982	Ga0157380_10543291
2983	Ga0182008_10001406
2984	Ga0182008_10034814
2985	Ga0157377_10000226
2986	Ga0157377_10285272
2987	Ga0157379_10006804
2988	Ga0157379_10006836
2989	Ga0157379_10207663
2990	Ga0157376_10019350
2991	Ga0157376_10276079
2992	Ga0163161_10009467
2993	Ga0163161_10100605
2994	Ga0206354_11011613
2995	Ga0206353_10844025
2996	Ga0214544_1000055
2997	Ga0214542_1003337
2998	Ga0214542_1026901
2999	Ga0214545_1000028
3000	Ga0214545_1026201
3001	Ga0214543_1000044
3002	Ga0214543_1028673
3003	Ga0213873_10000702
3004	Ga0213873_10022236
3005	Ga0213872_10000018
3006	Ga0213872_10002065
3007	Ga0213872_10011223
3008	Ga0213872_10053333
3009	Ga0213872_10064933
3010	Ga0213874_10000116
3011	Ga0213876_10000739
3012	Ga0213876_10077582
3013	Ga0213876_10085625
3014	Ga0213876_10110427
3015	Ga0213876_10136138
3016	Ga0213871_10040830
3017	Ga0209672_100460
3018	Ga0209147_100840
3019	Ga0209258_100015
3020	Ga0207425_1000244
3021	Ga0207425_1002150
3022	Ga0209677_100280
3023	Ga0209677_103878
3024	Ga0209148_1000028
3025	Ga0209148_1000224
3026	Ga0209129_1000049
3027	Ga0209129_1000908
3028	Ga0209129_1010353
3029	Ga0209233_1001356
3030	Ga0209233_1003282
3031	Ga0209233_1024180
3032	Ga0209565_1000862
3033	Ga0209565_1001345
3034	Ga0209455_1000635
3035	Ga0209455_1008356
3036	Ga0209673_1000477
3037	Ga0209673_1002692
3038	Ga0209130_1000267
3039	Ga0209130_1003103
3040	Ga0209130_1005512
3041	Ga0209675_1005805
3042	Ga0209676_1000026
3043	Ga0209676_1000137
3044	Ga0209676_1016289
3045	Ga0209025_1000265
3046	Ga0209025_1000481
3047	Ga0209025_1002411
3048	Ga0209025_1035647
3049	Ga0209025_1039009
3050	Ga0209564_1000023
3051	Ga0209564_1000141
3052	Ga0209564_1000936
3053	Ga0209564_1001368
3054	Ga0209564_1001413
3055	Ga0209564_1016873
3056	Ga0209564_1031662
3057	Ga0209564_1033997
3058	Ga0209758_1000075
3059	Ga0209758_1000087
3060	Ga0209758_1000135
3061	Ga0209758_1001472
3062	Ga0209758_1002263
3063	Ga0209758_1003895
3064	Ga0209758_1004550
3065	Ga0209758_1006443
3066	Ga0209758_1009361
3067	Ga0209758_1012485
3068	Ga0209758_1014095
3069	Ga0209758_1035129
3070	Ga0209050_1000015
3071	Ga0209050_1038483
3072	Ga0209256_1000129
3073	Ga0209256_1000330
3074	Ga0209256_1000604
3075	Ga0209256_1006248
3076	Ga0207426_1000160
3077	Ga0207426_1000171
3078	Ga0207426_1000185
3079	Ga0207426_1000287
3080	Ga0207426_1000289
3081	Ga0207426_1002426
3082	Ga0207426_1047672
3083	Ga0209051_1000010
3084	Ga0209051_1027886
3085	Ga0209257_1000026
3086	Ga0209257_1000382
3087	Ga0207697_10008917
3088	Ga0207697_10013135
3089	Ga0207697_10029703
3090	Ga0207697_10071932
3091	Ga0207682_10002804
3092	Ga0207682_10138857
3093	Ga0207692_10008762
3094	Ga0207692_10030805
3095	Ga0207692_10278002
3096	Ga0207642_10120723
3097	Ga0207710_10018385
3098	Ga0207688_10011258
3099	Ga0207688_10045160
3100	Ga0207688_10094381
3101	Ga0207688_10101948
3102	Ga0207647_10000181
3103	Ga0207647_10008822
3104	Ga0207647_10028859
3105	Ga0207647_10050867
3106	Ga0207647_10052761
3107	Ga0207647_10249175
3108	Ga0207647_10254112
3109	Ga0207685_10000117
3110	Ga0207699_10000561
3111	Ga0207699_10002981
3112	Ga0207699_10345747
3113	Ga0207645_10021282
3114	Ga0207645_10027095
3115	Ga0207645_10070297
3116	Ga0207645_10102883
3117	Ga0207645_10114768
3118	Ga0207643_10056467
3119	Ga0207705_10000002
3120	Ga0207705_10002417
3121	Ga0207705_10014317
3122	Ga0207705_10029640
3123	Ga0207705_10038453
3124	Ga0207705_10087687
3125	Ga0207705_10088868
3126	Ga0207705_10143894
3127	Ga0207705_10224070
3128	Ga0207705_10231313
3129	Ga0207705_10313401
3130	Ga0207705_10482578
3131	Ga0207684_10039712
3132	Ga0207684_10111434
3133	Ga0207684_10125240
3134	Ga0207654_10019399
3135	Ga0207654_10020194
3136	Ga0207654_10173564
3137	Ga0207654_10250098
3138	Ga0207707_10007110
3139	Ga0207707_10016413
3140	Ga0207707_10054341
3141	Ga0207707_10058645
3142	Ga0207707_10091506
3143	Ga0207707_10098243
3144	Ga0207707_10105844
3145	Ga0207707_10248773
3146	Ga0207707_10356729
3147	Ga0207695_10000029
3148	Ga0207695_10004391
3149	Ga0207695_10006972
3150	Ga0207695_10035319
3151	Ga0207695_10091535
3152	Ga0207695_10106653
3153	Ga0207695_10155990
3154	Ga0207695_10243096
3155	Ga0207671_10005591
3156	Ga0207671_10015933
3157	Ga0207671_10025983
3158	Ga0207671_10036268
3159	Ga0207671_10091344
3160	Ga0207671_10132033
3161	Ga0207671_10163587
3162	Ga0207671_10248068
3163	Ga0207671_10260703
3164	Ga0207671_10322926
3165	Ga0207693_10000326
3166	Ga0207693_10005581
3167	Ga0207693_10053622
3168	Ga0207693_10097801
3169	Ga0207693_10228311
3170	Ga0207663_10000362
3171	Ga0207663_10010962
3172	Ga0207663_10012171
3173	Ga0207663_10172511
3174	Ga0207660_10001628
3175	Ga0207660_10036788
3176	Ga0207660_10049154
3177	Ga0207660_10065702
3178	Ga0207660_10108315
3179	Ga0207660_10250685
3180	Ga0207660_10298469
3181	Ga0207662_10094697
3182	Ga0207662_10122103
3183	Ga0207657_10000659
3184	Ga0207657_10001814
3185	Ga0207657_10005795
3186	Ga0207657_10006465
3187	Ga0207657_10007485
3188	Ga0207657_10013513
3189	Ga0207657_10020740
3190	Ga0207657_10036996
3191	Ga0207657_10039797
3192	Ga0207657_10044542
3193	Ga0207657_10048009
3194	Ga0207657_10054494
3195	Ga0207657_10064044
3196	Ga0207657_10089783
3197	Ga0207649_10041654
3198	Ga0207649_10053618
3199	Ga0207649_10092968
3200	Ga0207649_10200893
3201	Ga0207649_10254929
3202	Ga0207649_10394928
3203	Ga0207652_10000001
3204	Ga0207652_10013066
3205	Ga0207652_10023863
3206	Ga0207652_10026596
3207	Ga0207652_10054634
3208	Ga0207652_10059606
3209	Ga0207652_10158790
3210	Ga0207652_10236329
3211	Ga0207652_10310722
3212	Ga0207652_10447979
3213	Ga0207652_10489822
3214	Ga0207646_10005973
3215	Ga0207646_10068196
3216	Ga0207646_10106774
3217	Ga0207646_10128892
3218	Ga0207681_10002516
3219	Ga0207681_10016135
3220	Ga0207681_10040964
3221	Ga0207681_10075463
3222	Ga0207681_10239877
3223	Ga0207681_10259592
3224	Ga0207681_10454771
3225	Ga0207681_10458556
3226	Ga0207681_10535428
3227	Ga0207694_10002889
3228	Ga0207694_10007413
3229	Ga0207694_10048259
3230	Ga0207694_10184916
3231	Ga0207694_10232074
3232	Ga0207694_10247543
3233	Ga0207694_10261222
3234	Ga0207650_10008732
3235	Ga0207650_10037599
3236	Ga0207650_10071022
3237	Ga0207659_10000728
3238	Ga0207659_10023583
3239	Ga0207659_10025581
3240	Ga0207659_10052290
3241	Ga0207659_10059700
3242	Ga0207659_10209002
3243	Ga0207687_10066128
3244	Ga0207687_10128342
3245	Ga0207687_10290627
3246	Ga0207687_10300079
3247	Ga0207700_10023512
3248	Ga0207700_10033458
3249	Ga0207700_10063462
3250	Ga0207700_10068438
3251	Ga0207700_10101172
3252	Ga0207664_10001455
3253	Ga0207664_10054799
3254	Ga0207664_10077877
3255	Ga0207664_10145266
3256	Ga0207664_10168261
3257	Ga0207664_10174619
3258	Ga0207644_10207584
3259	Ga0207644_10630620
3260	Ga0207690_10000005
3261	Ga0207690_10002077
3262	Ga0207690_10023248
3263	Ga0207690_10111848
3264	Ga0207690_10159624
3265	Ga0207690_10202669
3266	Ga0207690_10208624
3267	Ga0207690_10261763
3268	Ga0207690_10423770
3269	Ga0207706_10002491
3270	Ga0207706_10012557
3271	Ga0207706_10028060
3272	Ga0207706_10046173
3273	Ga0207706_10054774
3274	Ga0207706_10060522
3275	Ga0207706_10066703
3276	Ga0207706_10081504
3277	Ga0207706_10124927
3278	Ga0207706_10206678
3279	Ga0207706_10237268
3280	Ga0207706_10249811
3281	Ga0207706_10432815
3282	Ga0207706_10522637
3283	Ga0207686_10003755
3284	Ga0207686_10031355
3285	Ga0207686_10521112
3286	Ga0207709_10001388
3287	Ga0207709_10003465
3288	Ga0207709_10018084
3289	Ga0207709_10109204
3290	Ga0207709_10158082
3291	Ga0207670_10186242
3292	Ga0207670_10336348
3293	Ga0207669_10007280
3294	Ga0207669_10057454
3295	Ga0207669_10137518
3296	Ga0207669_10252765
3297	Ga0207704_10012151
3298	Ga0207704_10016958
3299	Ga0207704_10265710
3300	Ga0207665_10000194
3301	Ga0207665_10028096
3302	Ga0207665_10155356
3303	Ga0207691_10004302
3304	Ga0207691_10013936
3305	Ga0207691_10047595
3306	Ga0207691_10057577
3307	Ga0207691_10059944
3308	Ga0207691_10080680
3309	Ga0207691_10223872
3310	Ga0207711_10052734
3311	Ga0207711_10062894
3312	Ga0207711_10252160
3313	Ga0207711_10544084
3314	Ga0207689_10031582
3315	Ga0207689_10050489
3316	Ga0207689_10063968
3317	Ga0207689_10205324
3318	Ga0207689_10225223
3319	Ga0207689_10359730
3320	Ga0207689_10417005
3321	Ga0207661_10026021
3322	Ga0207661_10033925
3323	Ga0207661_10047181
3324	Ga0207661_10207545
3325	Ga0207661_10470036
3326	Ga0207679_10016166
3327	Ga0207679_10071622
3328	Ga0207679_10080112
3329	Ga0207679_10100558
3330	Ga0207679_10327661
3331	Ga0207679_10462479
3332	Ga0207667_10002854
3333	Ga0207667_10004603
3334	Ga0207667_10018732
3335	Ga0207667_10024903
3336	Ga0207667_10026378
3337	Ga0207667_10064921
3338	Ga0207667_10078368
3339	Ga0207667_10085761
3340	Ga0207667_10092539
3341	Ga0207667_10122480
3342	Ga0207667_10364303
3343	Ga0207667_10433782
3344	Ga0207667_10527027
3345	Ga0207651_10060955
3346	Ga0207651_10062185
3347	Ga0207651_10275366
3348	Ga0207651_10586741
3349	Ga0207712_10002025
3350	Ga0207712_10063785
3351	Ga0207712_10153755
3352	Ga0207712_10245022
3353	Ga0207668_10000580
3354	Ga0207668_10020304
3355	Ga0207668_10077701
3356	Ga0207668_10163641
3357	Ga0207668_10184124
3358	Ga0207668_10385701
3359	Ga0207668_10392227
3360	Ga0207668_10445639
3361	Ga0207640_10000024
3362	Ga0207640_10179941
3363	Ga0207658_10137690
3364	Ga0207658_10197868
3365	Ga0207677_10000845
3366	Ga0207677_10030563
3367	Ga0207677_10030598
3368	Ga0207677_10376047
3369	Ga0207677_10388963
3370	Ga0207677_10498893
3371	Ga0207703_10006101
3372	Ga0207703_10042309
3373	Ga0207703_10045380
3374	Ga0207703_10051821
3375	Ga0207703_10073678
3376	Ga0207703_10092531
3377	Ga0207703_10170664
3378	Ga0207703_10411687
3379	Ga0207639_10039358
3380	Ga0207639_10205196
3381	Ga0207639_10209611
3382	Ga0207639_10399122
3383	Ga0207678_10033232
3384	Ga0207678_10046104
3385	Ga0207678_10054300
3386	Ga0207678_10063670
3387	Ga0207678_10073540
3388	Ga0207678_10109704
3389	Ga0207678_10117286
3390	Ga0207678_10162784
3391	Ga0207678_10244407
3392	Ga0207702_10001454
3393	Ga0207702_10008316
3394	Ga0207702_10031585
3395	Ga0207702_10082530
3396	Ga0207702_10084485
3397	Ga0207702_10139034
3398	Ga0207641_10006863
3399	Ga0207641_10020003
3400	Ga0207641_10258004
3401	Ga0207648_10000421
3402	Ga0207648_10006730
3403	Ga0207648_10030619
3404	Ga0207648_10042420
3405	Ga0207648_10059352
3406	Ga0207648_10095094
3407	Ga0207648_10109752
3408	Ga0207648_10155281
3409	Ga0207648_10163445
3410	Ga0207676_10015791
3411	Ga0207676_10071808
3412	Ga0207676_10072113
3413	Ga0207676_10166326
3414	Ga0207676_10245714
3415	Ga0207676_10282285
3416	Ga0207674_10011986
3417	Ga0207674_10018313
3418	Ga0207674_10020525
3419	Ga0207674_10063613
3420	Ga0207674_10074616
3421	Ga0207674_10081339
3422	Ga0207674_10090990
3423	Ga0207674_10234157
3424	Ga0207675_100005114
3425	Ga0207675_100099163
3426	Ga0207675_100162835
3427	Ga0207675_100273012
3428	Ga0207675_100381844
3429	Ga0207683_10000315
3430	Ga0207683_10009082
3431	Ga0207683_10015224
3432	Ga0207683_10016322
3433	Ga0207683_10021620
3434	Ga0207683_10044648
3435	Ga0207683_10083870
3436	Ga0207683_10611465
3437	Ga0207698_10029514
3438	Ga0207698_10066764
3439	Ga0207698_10160760
3440	Ga0207698_10200440
3441	Ga0207698_10218767
3442	Ga0207698_10266847
3443	Ga0207698_10684116
3444	Ga0209281_1000020
3445	Ga0209389_1000137
3446	Ga0209389_1000353
3447	Ga0209589_1003439
3448	Ga0209489_100192
3449	Ga0209489_107326
3450	Ga0209489_107331
3451	Ga0209700_100046
3452	Ga0209588_1010085
3453	Ga0209971_1013049
3454	Ga0209971_1056487
3455	Ga0209813_10002651
3456	Ga0209813_10029173
3457	Ga0209813_10097043
3458	Ga0209974_10003984
3459	Ga0209974_10066018
3460	Ga0207428_10000094
3461	Ga0207428_10006429
3462	Ga0207428_10036101
3463	Ga0207428_10134025
3464	Ga0207428_10150755
3465	Ga0207428_10288383
3466	Ga0265354_1002569
3467	Ga0265357_1002524
3468	Ga0268266_10000256
3469	Ga0268266_10005499
3470	Ga0268266_10007711
3471	Ga0268266_10009538
3472	Ga0268266_10048979
3473	Ga0268266_10049467
3474	Ga0268266_10096350
3475	Ga0268266_10126627
3476	Ga0268266_10169766
3477	Ga0268266_10347521
3478	Ga0268266_10381941
3479	Ga0268265_10018992
3480	Ga0268265_10042854
3481	Ga0268265_10050537
3482	Ga0268265_10181056
3483	Ga0268265_10395865
3484	Ga0268264_10000020
3485	Ga0268264_10001404
3486	Ga0268264_10025359
3487	Ga0268264_10070120
3488	Ga0268264_10073701
3489	Ga0268264_10254179
3490	Ga0268264_10473321
3491	Ga0268264_10498821
3492	Ga0268264_10538420
3493	Ga0265337_1001859
3494	Ga0265334_10000410
3495	Ga0265334_10045433
3496	Ga0265323_10000658
3497	Ga0265336_10000063
3498	Ga0307517_10000235
3499	Ga0307515_10037902
3500	Ga0307515_10144305
3501	Ga0307515_10170842
3502	Ga0307515_10414548
3503	Ga0265338_10000154
3504	Ga0265324_10002963
3505	Ga0307511_10033177
3506	Ga0316182_1443699
3507	Ga0265762_1010074
3508	Ga0265770_1000021
3509	Ga0265330_10147348
3510	Ga0265332_10001225
3511	Ga0265332_10059636
3512	Ga0265328_10028391
3513	Ga0265328_10106874
3514	Ga0265340_10000669
3515	Ga0265340_10024686
3516	Ga0265340_10087769
3517	Ga0265340_10159875
3518	Ga0265339_10000253
3519	Ga0265339_10024827
3520	Ga0265331_10005905
3521	Ga0265331_10024351
3522	Ga0265316_10205982
3523	Ga0307513_10089608
3524	Ga0307513_10128769
3525	Ga0307513_10182218
3526	Ga0307513_10206786
3527	Ga0307513_10360338
3528	Ga0307509_10065496
3529	Ga0307509_10196714
3530	Ga0307509_10248650
3531	Ga0307408_100042559
3532	Ga0307408_100060812
3533	Ga0307408_100065368
3534	Ga0307408_100160546
3535	Ga0307408_100269743
3536	Ga0307408_100277982
3537	Ga0265313_10021048
3538	Ga0307508_10000025
3539	Ga0307508_10077767
3540	Ga0307508_10117852
3541	Ga0265314_10005071
3542	Ga0265314_10021311
3543	Ga0265314_10029059
3544	Ga0265314_10104302
3545	Ga0265342_10000039
3546	Ga0265342_10000131
3547	Ga0265342_10003931
3548	Ga0265342_10069837
3549	Ga0265342_10130696
3550	Ga0316576_10012107
3551	Ga0307516_10015801
3552	Ga0307405_10006215
3553	Ga0307405_10007256
3554	Ga0307405_10028119
3555	Ga0307405_10030253
3556	Ga0307405_10073494
3557	Ga0307405_10094951
3558	Ga0307405_10219086
3559	Ga0307405_10315549
3560	Ga0316577_10046142
3561	Ga0307413_10004158
3562	Ga0307413_10047505
3563	Ga0307413_10054751
3564	Ga0307413_10060657
3565	Ga0307413_10070387
3566	Ga0307413_10115877
3567	Ga0307413_10274282
3568	Ga0307413_10301388
3569	Ga0307410_10000933
3570	Ga0307410_10006512
3571	Ga0307410_10024224
3572	Ga0307410_10036744
3573	Ga0307410_10046366
3574	Ga0307410_10110690
3575	Ga0307410_10129125
3576	Ga0307410_10142856
3577	Ga0307410_10143467
3578	Ga0307410_10209595
3579	Ga0307410_10309948
3580	Ga0307410_10320733
3581	Ga0307410_10337658
3582	Ga0307406_10014184
3583	Ga0307406_10049555
3584	Ga0307406_10051333
3585	Ga0307406_10058492
3586	Ga0307406_10068791
3587	Ga0307406_10120650
3588	Ga0307406_10139191
3589	Ga0307406_10207649
3590	Ga0307406_10483789
3591	Ga0307407_10001131
3592	Ga0307407_10015574
3593	Ga0307407_10023172
3594	Ga0307407_10042870
3595	Ga0307407_10149980
3596	Ga0307407_10250701
3597	Ga0307412_10002229
3598	Ga0307412_10024471
3599	Ga0307412_10034503
3600	Ga0307412_10046829
3601	Ga0307412_10066764
3602	Ga0307412_10099944
3603	Ga0307412_10206278
3604	Ga0307412_10443495
3605	Ga0307409_100005340
3606	Ga0307409_100006358
3607	Ga0307409_100025009
3608	Ga0307409_100026079
3609	Ga0307409_100046719
3610	Ga0307409_100059146
3611	Ga0307409_100073405
3612	Ga0307409_100150518
3613	Ga0307409_100361686
3614	Ga0307409_100390151
3615	Ga0307409_100441286
3616	Ga0307409_100476430
3617	Ga0307416_100003734
3618	Ga0307416_100007023
3619	Ga0307416_100011217
3620	Ga0307416_100016114
3621	Ga0307416_100027070
3622	Ga0307416_100093739
3623	Ga0307416_100133243
3624	Ga0307416_100166963
3625	Ga0307416_100194922
3626	Ga0307416_100236820
3627	Ga0307416_100284635
3628	Ga0307416_100363962
3629	Ga0307416_100471455
3630	Ga0307416_100592689
3631	Ga0307414_10000931
3632	Ga0307414_10005926
3633	Ga0307414_10020194
3634	Ga0307414_10026614
3635	Ga0307414_10046289
3636	Ga0307414_10061749
3637	Ga0307414_10076603
3638	Ga0307414_10081124
3639	Ga0307414_10089507
3640	Ga0307414_10160109
3641	Ga0307414_10211147
3642	Ga0307414_10219148
3643	Ga0307414_10244514
3644	Ga0307414_10298064
3645	Ga0307411_10007133
3646	Ga0307411_10011246
3647	Ga0307411_10018655
3648	Ga0307411_10051801
3649	Ga0307411_10107970
3650	Ga0307411_10122203
3651	Ga0307411_10141433
3652	Ga0307411_10147510
3653	Ga0307411_10236948
3654	Ga0307411_10269047
3655	Ga0307411_10341206
3656	Ga0307411_10356027
3657	Ga0307411_10368417
3658	Ga0307415_100007681
3659	Ga0307415_100029071
3660	Ga0307415_100033565
3661	Ga0307415_100043110
3662	Ga0307415_100046152
3663	Ga0307415_100055671
3664	Ga0307415_100084756
3665	Ga0307415_100140143
3666	Ga0307415_100155561
3667	Ga0307507_10130911
3668	Ga0307510_10033677
3669	Ga0307510_10050374
3670	Ga0307510_10117291
3671	Ga0307510_10148617
3672	Ga0373926_0023239
3673	Ga0373928_0016902
3674	Ga0373923_0057453
3675	Ga0373923_0100956
3676	Ga0373923_0168469
3677	Ga0373936_0007123
3678	Ga0373945_0002208
3679	Ga0373945_0010335
3680	Ga0373945_0056084
3681	Ga0373956_0013934
3682	Ga0373957_0006378
3683	Ga0373946_0013149
3684	Ga0373955_0035945
3685	Ga0373955_0168120
3686	Ga0316574_0048820
3687	Ga0373924_0020428
3688	Ga0373924_0051011
3689	Ga0373931_0005114
3690	Ga0373931_0111394
3691	Ga0373931_0180427
3692	Ga0373931_0301184
3693	Ga0373935_0003467
3694	Ga0373935_0054250
3695	Ga0373935_0098227
3696	Ga0373935_0165473
3697	Ga0373927_0010081
3698	Ga0373927_0064985
3699	Ga0373927_0067413
3700	Ga0373927_0088419
3701	Ga0373927_0108420
3702	Ga0373933_0000225
3703	Ga0373933_0076538
3704	Ga0373947_0002642
3705	Ga0373947_0008433
3706	Ga0373947_0014002
3707	Ga0373947_0091764
3708	Ga0373937_0054286
3709	Ga0373937_0059352
3710	Ga0373937_0064661
3711	Ga0373937_0310771
3712	Ga0373937_0655142
3713	Ga0372808_004872
3714	Ga0316582_0183242
3715	Ga0316584_0014162
3716	Ga0373925_0032363
3717	Ga0373925_0077195
3718	Ga0373925_0084812
3719	Ga0373925_0107674
3720	Ga0373925_0112446
3721	Ga0373925_0177630
3722	Ga0373925_0241683
3723	Ga0395899_0010129
3724	Ga0395899_0011973
3725	Ga0395899_0021576
3726	Ga0395899_0072835
3727	Ga0395899_0095033
3728	Ga0395900_0000943
3729	Ga0395900_0005612
3730	Ga0395900_0008466
3731	Ga0395900_0024575
3732	Ga0395900_0031192
3733	Ga0395900_0098011
3734	Ga0395900_0098863
3735	Ga0395900_0131609
3736	Ga0395900_0145422
3737	Ga0395900_0147368
3738	Ga0395900_0231566
3739	Ga0395900_0341476
3740	Ga0395898_0002974
3741	Ga0395898_0022005
3742	Ga0395898_0030996
3743	Ga0395898_0054338
3744	Ga0395898_0335949
3745	Ga0395898_0449775
3746	Ga0395905_0001191
3747	Ga0395905_0001314
3748	Ga0395905_0003656
3749	Ga0395905_0027387
3750	Ga0395905_0109426
3751	Ga0395905_0118840
3752	Ga0395905_0125672
3753	Ga0395905_0130273
3754	Ga0395905_0140385
3755	Ga0395905_0207970
3756	Ga0395905_0219105
3757	Ga0395905_0380779
3758	Ga0436364_0806555
3759	Ga0436364_1062405
3760	Ga0395901_0000320
3761	Ga0395901_0001973
3762	Ga0395901_0002693
3763	Ga0395901_0033917
3764	Ga0395901_0065739
3765	Ga0395901_0083304
3766	Ga0395901_0115492
3767	Ga0395901_0139345
3768	Ga0395901_0380884
3769	Ga0395901_0563583
3770	Ga0436365_0876968
3771	Ga0436365_1019011
3772	Ga0436365_1030657
3773	Ga0436365_1251026
3774	Ga0436365_1541048
3775	Ga0436360_0318167
3776	Ga0436360_0336060
3777	Ga0436361_0151792
3778	Ga0436361_0259732
3779	Ga0436361_0303744
3780	Ga0436361_0336849
3781	Ga0436361_0523670
3782	Ga0436361_0677882
3783	Ga0436361_0869861
3784	Ga0436361_0950110
3785	Ga0436361_1071877
3786	Ga0436363_0634802
3787	Ga0436363_1153269
3788	Ga0436363_1261345
3789	Ga0436363_1610649
3790	Ga0436362_0379214
3791	Ga0436362_0423859
3792	Ga0439439_0003872
3793	Ga0451837_1440309
3794	Ga0451839_1350009
3795	Ga0439445_0000421
3796	Ga0439449_0112431
3797	Ga0450920_016702
3798	Ga0450922_003443
3799	Ga0450923_002117
3800	Ga0450898_000749
3801	Ga0450905_003404
3802	Ga0439446_0039325
3803	Ga0439446_0044634
3804	Ga0439434_0008290
3805	Ga0439435_0002525
3806	Ga0439435_0017240
3807	Ga0439444_0001098
3808	Ga0439459_0024458
3809	Ga0450916_001478
3810	Ga0466969_0002344
3811	Ga0466969_0016377
3812	Ga0466972_0039915
3813	Ga0466972_0100953
3814	Ga0466965_0036286
3815	Ga0466965_0112543
3816	Ga0466965_0167058
3817	Ga0466965_0174577
3818	Ga0466966_0000229
3819	Ga0466966_0018263
3820	Ga0466966_0035952
3821	Ga0466966_0084161
3822	Ga0466966_0246989
3823	Ga0466961_0000029
3824	Ga0466963_0000376
3825	Ga0466963_0034650
3826	Ga0466963_0175690
3827	Ga0466964_0022821
3828	Ga0466964_0140606
3829	Ga0466971_0009429
3830	Ga0466971_0013597
3831	Ga0466971_0067718
3832	Ga0466968_0007268
3833	Ga0466968_0162575
3834	Ga0466970_0006059
3835	Ga0466970_0048706
3836	Ga0466957_0006077
3837	Ga0466957_0006659
3838	Ga0466957_0018120
3839	Ga0466957_0114925
3840	Ga0466957_0227562
3841	Ga0466960_0128241
3842	Ga0466959_0000533
3843	Ga0466959_0003809
3844	Ga0466959_0019883
3845	Ga0466959_0176034
3846	Ga0466958_0001039
3847	Ga0466958_0029823
3848	Ga0466967_0030661
3849	Ga0495592_0013467
3850	Ga0495592_0086216
3851	Ga0495592_0185120
3852	Ga0495603_0000237
3853	Ga0495603_0001754
3854	Ga0495603_0011365
3855	Ga0495603_0025069
3856	Ga0495603_0038759
3857	Ga0495603_0040610
3858	Ga0495603_0059521
3859	Ga0495629_0000772
3860	Ga0495629_0002337
3861	Ga0495629_0031955
3862	Ga0495629_0056707
3863	Ga0495629_0170919
3864	Ga0495629_0178254
3865	Ga0495638_0004143
3866	Ga0495638_0004606
3867	Ga0495638_0005372
3868	Ga0495638_0041430
3869	Ga0495638_0198653
3870	Ga0495641_0012966
3871	Ga0495651_0011651
3872	Ga0495651_0098891
3873	Ga0495651_0143868
3874	Ga0495653_0022036
3875	Ga0495653_0027863
3876	Ga0495653_0217635
3877	Ga0495650_0000230
3878	Ga0495650_0025394
3879	Ga0495580_0004214
3880	Ga0495580_0052612
3881	Ga0495582_0000209
3882	Ga0495582_0014036
3883	Ga0495582_0041407
3884	Ga0495605_0000071
3885	Ga0495605_0116685
3886	Ga0495605_0123331
3887	Ga0495639_0000387
3888	Ga0495662_0002150
3889	Ga0495662_0065754
3890	Ga0495664_0001615
3891	Ga0495664_0020289
3892	Ga0495664_0036970
3893	Ga0495664_0164827
3894	Ga0495664_0224499
3895	Ga0495584_0112301
3896	Ga0495585_0063354
3897	Ga0495585_0083407
3898	Ga0495594_0000342
3899	Ga0495594_0053255
3900	Ga0495594_0245976
3901	Ga0495596_0075093
3902	Ga0495596_0096815
3903	Ga0495607_0054467
3904	Ga0495606_0000077
3905	Ga0495606_0002837
3906	Ga0495606_0021044
3907	Ga0495606_0022784
3908	Ga0495606_0176234
3909	Ga0495608_0018247
3910	Ga0495608_0030836
3911	Ga0495610_0004699
3912	Ga0495610_0018192
3913	Ga0495610_0029652
3914	Ga0495610_0046624
3915	Ga0495618_0013641
3916	Ga0495618_0092392
3917	Ga0495618_0170990
3918	Ga0495628_0022291
3919	Ga0495628_0053583
3920	Ga0495630_0001378
3921	Ga0495630_0017390
3922	Ga0495630_0108191
3923	Ga0495631_0030198
3924	Ga0495632_0060728
3925	Ga0495632_0075713
3926	Ga0495643_0008539
3927	Ga0495643_0050056
3928	Ga0495644_0008390
3929	Ga0495644_0042265
3930	Ga0495648_0003600
3931	Ga0495648_0067174
3932	Ga0495648_0073583
3933	Ga0495648_0131370
3934	Ga0495648_0221562
3935	Ga0495648_0223705
3936	Ga0495663_0000244
3937	Ga0495663_0004640
3938	Ga0495663_0005899
3939	Ga0495663_0035860
3940	Ga0495642_0044451
3941	Ga0495652_0005332
3942	Ga0495652_0015193
3943	Ga0495652_0048216
3944	Ga0495652_0250060
3945	Ga0495665_0000280
3946	Ga0495640_0001578
3947	Ga0495640_0009615
3948	Ga0495640_0092149
3949	Ga0495587_0080106
3950	Ga0495587_0089701
3951	Ga0495598_0031078
3952	Ga0495621_0001420
3953	Ga0495621_0003194
3954	Ga0495621_0005820
3955	Ga0495597_0024441
3956	Ga0495597_0046672
3957	Ga0495645_0003978
3958	Ga0495645_0026670
3959	Ga0495645_0128905
3960	Ga0495622_0003837
3961	Ga0495622_0054002
3962	Ga0495633_0000682
3963	Ga0495667_0010850
3964	Ga0495667_0021239
3965	Ga0495667_0031330
3966	Ga0495667_0124426
3967	Ga0495656_0001211
3968	Ga0495656_0022169
3969	Ga0495656_0033251
3970	Ga0495668_0000064
3971	Ga0495668_0003739
3972	Ga0495668_0004733
3973	Ga0495668_0020880
3974	Ga0495668_0063027
3975	Ga0495634_0000865
3976	Ga0495634_0041615
3977	Ga0495634_0090070
3978	Ga0495634_0106789
3979	Ga0495625_0046907
3980	Ga0495625_0098424
3981	Ga0495625_0123908
3982	Ga0495625_0354240
3983	Ga0495635_0001610
3984	Ga0495635_0003974
3985	Ga0495635_0113873
3986	Ga0495659_0009267
3987	Ga0495659_0104545
3988	Ga0495661_0070986
3989	Ga0495657_0004288
3990	Ga0495657_0027394
3991	Ga0495657_0036159
3992	Ga0495657_0072961
3993	Ga0495599_0000895
3994	Ga0495599_0042087
3995	Ga0495599_0044019
3996	Ga0495599_0071169
3997	Ga0495599_0138971
3998	Ga0495623_0023407
3999	Ga0495623_0037031
4000	Ga0495623_0075975
4001	Ga0495623_0140412
4002	Ga0495646_0102307
4003	Ga0495647_0000763
4004	Ga0495658_0001222
4005	Ga0495658_0090814
4006	Ga0495669_0000425
4007	Ga0495669_0003790
4008	Ga0495669_0038102
4009	Ga0495669_0045924
4010	Ga0495669_0063315
4011	Ga0495669_0091178
4012	Ga0495613_0058134
4013	Ga0495613_0164536
4014	Ga0495624_0001082
4015	Ga0495670_0002809
4016	Ga0495670_0018241
4017	Ga0495670_0074944
4018	Ga0495670_0165554
4019	Ga0495671_0102447
4020	Ga0495671_0147660
4021	Ga0495649_0136631
4022	Ga0495589_0196479
4023	Ga0495600_0001516
4024	Ga0495600_0008985
4025	Ga0495600_0026432
4026	Ga0495600_0081749
4027	Ga0495600_0298963
4028	Ga0495581_0000969
4029	Ga0495581_0055226
4030	Ga0495581_0083192
4031	Ga0495604_0005690
4032	Ga0495604_0009731
4033	Ga0495604_0047249
4034	Ga0495604_0109157
4035	Ga0495604_0110793
4036	Ga0495604_0315607
4037	Ga0495674_0004372
4038	Ga0495674_0144466
4039	Ga0495674_0160871
4040	Ga0495674_0164583
4041	Ga0495674_0256672
4042	Ga0495674_0418134
4043	Ga0495676_0009743
4044	Ga0495676_0024919
4045	Ga0495676_0095906
4046	Ga0495680_0007239
4047	Ga0495680_0014577
4048	Ga0495680_0158436
4049	Ga0495687_004926
4050	Ga0495675_0378012
4051	Ga0495677_0012274
4052	Ga0495677_0022919
4053	Ga0495677_0049355
4054	Ga0495685_054974
4055	Ga0495673_0003053
4056	Ga0495673_0037524
4057	Ga0495684_0028329
4058	Ga0495684_0034887
4059	Ga0495684_0040228
4060	Ga0495684_0122080
4061	Ga0495686_0004694
4062	Ga0495686_0018170
4063	Ga0495686_0029770
4064	Ga0495686_0098577
4065	Ga0495686_0101275
4066	Ga0495686_0102627
4067	Ga0495593_0000238
4068	Ga0495602_0054399
4069	Ga0495602_0072832
4070	Ga0495602_0088952
4071	Ga0495602_0308361
4072	Ga0495614_0050431
4073	Ga0495615_0026386
4074	Ga0495626_0043133
4075	Ga0496100_0057279
4076	Ga0496100_0420706
4077	Ga0496101_0107022
4078	Ga0496102_0001874
4079	Ga0496102_0014235
4080	Ga0496102_0023662
4081	Ga0496102_0027582
4082	Ga0496102_0063502
4083	Ga0496102_0068985
4084	Ga0496102_0130845
4085	Ga0496102_0262361
4086	Ga0496102_0519316
4087	Ga0496103_0005154
4088	Ga0496103_0013419
4089	Ga0496103_0091118
4090	Ga0496103_0113947
4091	Ga0496104_0002350
4092	Ga0496104_0004135
4093	Ga0496104_0032406
4094	Ga0496104_0063581
4095	Ga0496104_0066816
4096	Ga0496104_0086027
4097	Ga0496104_0109245
4098	Ga0496104_0513955
4099	Ga0496105_0005457
4100	Ga0496105_0006033
4101	Ga0496105_0031458
4102	Ga0496105_0037552
4103	Ga0496105_0051057
4104	Ga0496105_0103946
4105	Ga0496105_0109410
4106	Ga0496105_0179667
4107	Ga0496106_0005572
4108	Ga0496106_0032730
4109	Ga0496106_0037383
4110	Ga0496106_0100459
4111	Ga0496106_0456658
4112	Ga0496107_0012285
4113	Ga0496107_0024590
4114	Ga0496107_0048206
4115	Ga0496107_0150166
4116	Ga0496108_0004499
4117	Ga0496108_0054660
4118	Ga0496109_0069006
4119	Ga0496109_0084752
4120	Ga0496109_0089390
4121	Ga0496109_0092516
4122	Ga0496109_0278350
4123	Ga0496109_0311404
4124	Ga0496110_0060294
4125	Ga0496110_0124160
4126	Ga0496110_0140750
4127	Ga0496110_0175342
4128	Ga0496110_0521775
4129	Ga0496111_0023618
4130	Ga0496111_0105454
4131	Ga0496111_0197704
4132	Ga0496111_0218049
4133	Ga0496111_0253803
4134	Ga0496112_0000111
4135	Ga0496112_0033792
4136	Ga0496112_0036737
4137	Ga0496112_0042124
4138	Ga0496112_0077684
4139	Ga0496112_0113093
4140	Ga0496112_0150135
4141	Ga0496112_0254947
4142	Ga0496112_0369215
4143	Ga0496113_0063987
4144	Ga0496113_0247281
4145	Ga0496113_0309761
4146	Ga0496113_0318990
4147	Ga0496113_0634733
4148	Ga0496114_0000006
4149	Ga0496114_0010915
4150	Ga0496114_0015072
4151	Ga0496114_0050568
4152	Ga0496114_0153699
4153	Ga0496114_0386513
4154	Ga0496115_0058680
4155	Ga0496115_0065612
4156	Ga0496115_0087107
4157	Ga0496115_0098033
4158	Ga0496115_0105574
4159	Ga0496115_0145985
4160	Ga0496115_0152980
4161	Ga0496115_0289354
4162	Ga0496115_0365111
4163	Ga0496115_0450644
4164	Ga0496116_0000520
4165	Ga0496116_0017386
4166	Ga0496117_0028383
4167	Ga0496117_0056829
4168	Ga0496117_0073645
4169	Ga0496117_0178549
4170	Ga0496117_0229023
4171	Ga0496118_0010974
4172	Ga0496118_0027793
4173	Ga0496118_0041819
4174	Ga0496118_0060350
4175	Ga0496118_0109313
4176	Ga0496119_0011955
4177	Ga0496119_0012495
4178	Ga0496119_0028314
4179	Ga0496119_0070076
4180	Ga0496120_0061168
4181	Ga0496121_0001361
4182	Ga0496121_0001375
4183	Ga0496121_0009848
4184	Ga0496121_0010696
4185	Ga0496121_0024520
4186	Ga0496121_0029624
4187	Ga0496121_0045348
4188	Ga0496121_0053239
4189	Ga0496121_0074732
4190	Ga0496121_0074837
4191	Ga0496121_0105948
4192	Ga0496121_0139284
4193	Ga0496121_0174499
4194	Ga0496121_0264212
4195	Ga0496122_0000317
4196	Ga0496122_0064643
4197	Ga0496122_0100311
4198	Ga0496123_0000264
4199	Ga0496123_0044466
4200	Ga0496123_0055971
4201	Ga0496123_0107425
4202	Ga0496124_0010052
4203	Ga0496124_0016823
4204	Ga0496124_0030133
4205	Ga0496124_0067619
4206	Ga0496124_0365101
4207	Ga0496125_0000202
4208	Ga0496125_0001999
4209	Ga0496125_0011066
4210	Ga0496125_0015391
4211	Ga0496125_0015510
4212	Ga0496125_0043334
4213	Ga0496125_0115642
4214	Ga0496125_0178586
4215	Ga0496125_0208981
4216	Ga0496125_0260186
4217	Ga0496126_0004835
4218	Ga0496126_0012757
4219	Ga0496126_0013430
4220	Ga0496126_0031523
4221	Ga0496126_0060578
4222	Ga0496126_0076633
4223	Ga0496126_0086531
4224	Ga0496126_0086623
4225	Ga0496126_0087691
4226	Ga0496126_0106036
4227	Ga0496126_0109568
4228	Ga0496126_0114059
4229	Ga0496126_0131831
4230	Ga0496126_0175520
4231	Ga0496126_0197717
4232	Ga0496126_0250560
4233	Ga0495682_0009656
4234	Ga0495682_0089185
4235	Ga0501031_0001272
4236	Ga0501031_0009736
4237	Ga0501032_0000257
4238	Ga0501032_0002207
4239	Ga0501032_0017662
4240	Ga0501033_0000124
4241	Ga0501033_0000244
4242	Ga0501034_0000159
4243	Ga0501034_0015413
4244	Ga0501034_0041167
4245	Ga0501034_0041285
4246	Ga0501034_0089183
4247	Ga0501034_0094099
4248	Ga0501036_0000039
4249	Ga0501036_0007815
4250	Ga0501037_0000247
4251	Ga0501037_0001386
4252	Ga0501037_0030882
4253	Ga0501038_0000041
4254	Ga0501038_0000207
4255	Ga0501038_0193738
4256	Ga0501039_0000064
4257	Ga0501039_0000148
4258	Ga0501039_0019776
4259	Ga0501040_0018578
4260	Ga0501041_0361396
4261	Ga0501042_0026466
4262	Ga0501042_0065421
4263	Ga0501043_0000202
4264	Ga0501043_0030154
4265	Ga0501043_0032864
4266	Ga0501043_0236760
4267	Ga0501046_0000185
4268	Ga0501046_0047426
4269	Ga0501046_0063676
4270	Ga0501046_0224003
4271	Ga0501047_0000154
4272	Ga0501047_0000288
4273	Ga0501047_0000392
4274	Ga0501047_0002801
4275	Ga0501048_0000536
4276	Ga0501048_0074941
4277	Ga0501067_0000896
4278	Ga0501067_0016856
4279	Ga0501067_0065527
4280	Ga0501067_0304339
4281	Ga0501068_0002219
4282	Ga0501068_0009442
4283	Ga0501069_0003631
4284	Ga0501069_0017962
4285	Ga0501070_0000175
4286	Ga0501070_0000557
4287	Ga0501070_0003774
4288	Ga0501070_0125744
4289	Ga0501070_0161410
4290	Ga0501071_0026378
4291	Ga0501071_0306570
4292	Ga0501072_0001033
4293	Ga0501072_0172336
4294	Ga0501072_0241408
4295	Ga0501073_0000034
4296	Ga0501073_0109839
4297	Ga0501074_0002163
4298	Ga0501074_0014736
4299	Ga0501074_0067981
4300	Ga0501076_0003638
4301	Ga0501076_0184579
4302	Ga0501249_004258
4303	Ga0501079_0000773
4304	Ga0501079_0165115
4305	Ga0501079_0321504
4306	Ga0501080_0000805
4307	Ga0501080_0001103
4308	Ga0501080_0190860
4309	Ga0501080_0213623
4310	Ga0501081_0028882
4311	Ga0501083_0000118
4312	Ga0501035_0000137
4313	Ga0501035_0000155
4314	Ga0501035_0013576
4315	Ga0501035_0185462
4316	Ga0501044_0000393
4317	Ga0501044_0000431
4318	Ga0501044_0043652
4319	Ga0501044_0048505
4320	Ga0501044_0184415
4321	Ga0501044_0273692
4322	Ga0501045_0005484
4323	Ga0501045_0011293
4324	Ga0501045_0370025
4325	nmdc:mga03683_18717_c1
4326	nmdc:mga03683_213821_c1
4327	nmdc:mga03683_79709_c1
4328	nmdc:mga03n38_11501_c1
4329	nmdc:mga00v17_47706_c1
4330	nmdc:mga00v17_49102_c1
4331	nmdc:mga00v17_5677_c1
4332	nmdc:mga0yw44_10115_c1
4333	nmdc:mga0yw44_244705_c1
4334	nmdc:mga0yw44_49878_c1
4335	nmdc:mga0yw44_67720_c1
4336	nmdc:mga0yw44_87100_c1
4337	nmdc:mga0k408_151890_c1
4338	nmdc:mga0k408_26106_c1
4339	nmdc:mga0k408_72426_c1
4340	nmdc:mga0k408_97542_c1
4341	nmdc:mga06z11_140673_c1
4342	nmdc:mga06z11_172160_c1
4343	nmdc:mga06z11_269336_c1
4344	nmdc:mga06z11_5709_c1
4345	nmdc:mga06z11_5831_c1
4346	nmdc:mga06z11_62884_c1
4347	nmdc:mga07m45_110346_c1
4348	nmdc:mga07m45_26891_c1
4349	nmdc:mga07m45_7680_c1
4350	nmdc:mga05p37_168433_c1
4351	nmdc:mga05p37_213047_c1
4352	nmdc:mga05p37_293_c1
4353	nmdc:mga05p37_296873_c1
4354	nmdc:mga05p37_3152_c1
4355	nmdc:mga09592_1602_c1
4356	nmdc:mga09592_306541_c1
4357	nmdc:mga09592_347162_c1
4358	nmdc:mga09592_8789_c1
4359	nmdc:mga0qj67_1524_c1
4360	nmdc:mga0qj67_17595_c2
4361	nmdc:mga0qj67_237550_c1
4362	nmdc:mga06r32_139_c1
4363	nmdc:mga06r32_392781_c1
4364	nmdc:mga06r32_70_c1
4365	nmdc:mga06r32_8345_c1
4366	nmdc:mga08y16_210988_c1
4367	nmdc:mga08y16_36453_c1
4368	nmdc:mga08y16_43379_c1
4369	nmdc:mga08y16_6788_c1
4370	nmdc:mga08y16_81_c1
4371	nmdc:mga08y16_88943_c1
4372	nmdc:mga08y16_93500_c1
4373	nmdc:mga0n895_2094_c1
4374	nmdc:mga0n895_262777_c1
4375	nmdc:mga0n895_40277_c1
4376	nmdc:mga0rr50_108497_c1
4377	nmdc:mga0rr50_15563_c1
4378	nmdc:mga0rr50_555731_c1
4379	nmdc:mga0rr50_59994_c1
4380	nmdc:mga0a205_17040_c1
4381	nmdc:mga0a205_29441_c1
4382	nmdc:mga0a205_294871_c2
4383	nmdc:mga0a205_31493_c1
4384	nmdc:mga0a205_830_c1
4385	nmdc:mga0sz30_15323_c1
4386	nmdc:mga0sz30_3996_c1
4387	Ga0495601_0296932
4388	Ga0495612_0034855
4389	Ga0495612_0079508
4390	Ga0500610_0000004
4391	Ga0495655_0054562
4392	Ga0495595_0070503
4393	Ga0495619_0015826
4394	Ga0495619_0048033
4395	Ga0495619_0127345
4396	Ga0500578_0028483
4397	Ga0500643_000037
4398	Ga0500643_027503
4399	Ga0500643_028911
4400	Ga0500646_0011894
4401	Ga0500647_0040972
4402	Ga0500651_0001199
4403	Ga0500651_0080305
4404	Ga0500566_0000166
4405	Ga0500566_0001046
4406	Ga0500566_0001772
4407	Ga0500566_0002306
4408	Ga0500566_0085084
4409	Ga0500566_0100525
4410	Ga0500640_000873
4411	Ga0500640_047604
4412	Ga0500641_0010047
4413	Ga0500641_0014080
4414	Ga0500641_0025121
4415	Ga0500641_0156289
4416	Ga0500654_077221
4417	Ga0500554_000266
4418	Ga0500555_000550
4419	Ga0500556_0000089
4420	Ga0500557_000047
4421	Ga0500562_003706
4422	Ga0500572_000474
4423	Ga0500572_000614
4424	Ga0500572_007111
4425	Ga0500595_000891
4426	Ga0500595_002669
4427	Ga0500595_004982
4428	Ga0500595_007131
4429	Ga0500607_009772
4430	Ga0500608_000206
4431	Ga0500608_030294
4432	Ga0500614_002313
4433	Ga0500626_064744
4434	Ga0500642_0000050
4435	Ga0500642_0000071
4436	Ga0500652_000004
4437	Ga0500652_009694
4438	Ga0500655_004071
4439	Ga0500658_0023361
4440	Ga0500658_0091606
4441	Ga0500658_0213137
4442	Ga0500559_0000136
4443	Ga0500559_0001651
4444	Ga0500559_0002659
4445	Ga0500559_0003297
4446	Ga0500559_0008736
4447	Ga0500568_0001309
4448	Ga0500568_0021334
4449	Ga0500568_0026208
4450	Ga0500568_0101520
4451	Ga0500573_0120136
4452	Ga0500577_0000632
4453	Ga0500577_0081718
4454	Ga0500586_002729
4455	Ga0500589_091596
4456	Ga0500603_000501
4457	Ga0500603_001014
4458	Ga0500603_008704
4459	Ga0500604_0000021
4460	Ga0500604_0017071
4461	Ga0500604_0026562
4462	Ga0500604_0113034
4463	Ga0500616_0000026
4464	Ga0500616_0009002
4465	Ga0500616_0094571
4466	Ga0500622_0001149
4467	Ga0500622_0001752
4468	Ga0500622_0134081
4469	Ga0500627_0055392
4470	Ga0500630_002780
4471	Ga0500633_0004613
4472	Ga0500638_023402
4473	Ga0500638_030195
4474	Ga0500638_051323
4475	Ga0500638_078689
4476	Ga0500639_000112
4477	Ga0500636_0000880
4478	Ga0500636_0002910
4479	Ga0500636_0023543
4480	Ga0500636_0023642
4481	Ga0500636_0051194
4482	Ga0500636_0094499
4483	Ga0500636_0167953
4484	Ga0500637_0000240
4485	Ga0500637_0000582
4486	Ga0500637_0159389
4487	Ga0500637_0197576
4488	Ga0500625_001064
4489	Ga0500645_071404
4490	Ga0500596_001425
4491	Ga0500596_016115
4492	Ga0500601_000014
4493	Ga0501084_0002041
4494	Ga0500661_003063
4495	Ga0500661_015619
4496	Ga0501082_0002604
4497	Ga0501082_0013466
4498	Ga0501082_0644965
4499	Ga0466962_0067511
4500	2507510600
4501	2508544402
4502	2508697457
4503	2508729086
4504	2509078107
4505	2509148597
4506	2511396329
4507	2513628811
4508	2513640206
4509	2513650757
4510	2513693819
4511	2513703836
4512	2513715866
4513	2513877756
4514	2513888396
4515	2514015053
4516	2515628652
4517	2517105524
4518	2524437003
4519	2528852294
4520	2548499503
4521	2599621953
4522	2599676883
4523	2599685145
4524	2599691463
4525	2603862518
4526	2617350017
4527	2617378696
4528	2643866332
4529	2643994320
4530	2644072492
4531	2644293153
4532	2644301996
4533	2644648167
4534	2722883059
4535	2723843391
4536	2739058078
4537	2745076167
4538	2774874419
4539	2776258954
4540	2793063365
4541	2793077883
4542	2805917116
4543	2818243561
4544	2819598028
4545	2821445689
4546	2824603912
4547	2824612553
4548	2824621729
4549	2824630802
4550	2824637433
4551	2824646318
4552	2824655616
4553	2824662432
4554	2824676057
4555	2824682334
4556	2824692180
4557	2824696588
4558	2824705700
4559	2824717482
4560	2824726722
4561	2824733677
4562	2824747965
4563	2824756382
4564	2824764067
4565	2824776743
4566	2831269018
4567	2835312738
4568	2838058444
4569	2838125400
4570	2841941940
4571	2841951374
4572	2841958943
4573	2841968627
4574	2841976172
4575	2841987537
4576	2842045090
4577	2842049249
4578	2842737871
4579	2842752769
4580	2844317328
4581	2844533805
4582	2847934033
4583	2847944691
4584	2849081082
4585	2857516145
4586	2857529858
4587	2874594760
4588	2874611697
4589	2874612938
4590	2874620663
4591	2874634739
4592	2874646879
4593	2876769398
4594	2876774398
4595	2876812112
4596	2876822812
4597	2879078552
4598	2879086879
4599	2879109764
4600	2879114936
4601	2879129882
4602	2879146207
4603	2881369194
4604	2881667627
4605	2881929255
4606	2882459310
4607	2884300091
4608	2885203815
4609	2885217850
4610	2885367421
4611	2885417659
4612	2885427301
4613	2888388637
4614	2888422631
4615	2889037713
4616	2893069495
4617	2894237226
4618	2896429293
4619	2899929447
4620	2903733286
4621	2904451061
4622	2904666586
4623	2904720350
4624	2906606252
4625	2906634091
4626	2906647538
4627	2908778269
4628	2919077286
4629	2922361660
4630	2922371965
4631	2922387086
4632	2922399294
4633	2928040109
4634	2928047142
4635	2928057655
4636	2928067963
4637	2928072536
4638	2929616693
4639	2929625437
4640	2932793113
4641	2932801245
4642	2932803627
4643	2932814581
4644	2932824646
4645	2932836573
4646	2933578024
4647	2935610667
4648	2935623306
4649	2935646696
4650	2935652438
4651	2935661020
4652	2935672634
4653	2935682507
4654	2935691711
4655	2935699580
4656	2935707817
4657	2935719545
4658	2935728853
4659	2935737905
4660	2935747280
4661	2935757919
4662	2935761712
4663	2935770553
4664	2935782786
4665	2935787162
4666	2935795210
4667	2935810092
4668	2935819024
4669	2935820164
4670	2935835963
4671	2935844913
4672	2935849825
4673	2935861694
4674	2935870733
4675	2935881394
4676	2935887898
4677	2935914485
4678	2935919035
4679	2935932134
4680	2935940732
4681	2935948681
4682	2935957212
4683	2935963642
4684	2935973816
4685	2935979688
4686	2935988943
4687	2936000424
4688	2936005441
4689	2936015077
4690	2936023222
4691	2936032325
4692	2936041980
4693	2936050186
4694	2936061106
4695	2940564169
4696	2941535150
4697	2941546720
4698	2990714387
4699	3005486324
4700	3005512151
4701	3005593652
4702	3005597024
4703	3005713096
4704	3005720456
4705	8006932403
4706	8006966769
4707	8006984723
4708	8006994714
4709	8016515709
4710	8016523274
4711	8016536764
4712	8016541039
4713	8016552215
4714	8016560594
4715	8016566427
4716	8016579175
4717	8016590069
4718	8016598489
4719	8016612648
4720	8016621174
4721	8016628847
4722	8016633374
4723	8017060790
4724	8019536464
4725	8019542985
4726	8019580313
4727	8019588032
4728	8019603305
4729	8019636458
4730	8019643176
4731	8019656007
4732	8019664238
4733	8019673822
4734	8019682283
4735	8019687984
4736	8055748339
4737	8056680811
4738	8056971961

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

28

126

0.96 PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

125

259

0.92 PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

23

132

0.88 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3g64-assembly1.cif.gz_A	crystal structure of putative enoyl-coa hydratase from streptomyces coelicolor a3(2)	0.9668	7	269
6sla-assembly2.cif.gz_FFF	crystal structure of isomerase paag mutant - d136n with oxepin-coa	0.9526	13	269
3hrx-assembly2.cif.gz_F	crystal structure of phenylacetic acid degradation protein paag	0.9521	13	269
5zai-assembly1.cif.gz_D	crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula	0.9514	8	268
5zai-assembly1.cif.gz_D	crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula	0.9478	8	268

ID	Description	Score	Start	End	Superfamily
3hrxA02	Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain	0.9818	212	269	1.10.12.10
3hrxE02	Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain	0.981	212	269	1.10.12.10
3gowE02	Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain	0.9808	212	269	1.10.12.10
3hrxC02	Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain	0.9799	212	269	1.10.12.10
3hrxB02	Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain	0.9799	212	269	1.10.12.10

ID	Description	Score	Start	End	GO Terms
AF-A0A7G9L0R4-F1-model_v4	Enoyl-CoA hydratase family protein	0.9979	1	269	GO:0003824
AF-A0A7H0LG70-F1-model_v4	Enoyl-CoA hydratase family protein	0.9975	3	269	GO:0003824
AF-A0A533J185-F1-model_v4	deleted	0.9966	6	158
AF-A0A0D6T924-F1-model_v4	Enoyl-CoA hydratase (EC 4.2.1.17)	0.9961	6	269	GO:0004300
AF-A0A5C6YAY1-F1-model_v4	deleted	0.9956	6	269

F496745

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

28

126

0.96

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

125

259

0.92

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

23

132

0.88

Structural Annotation

Top 5 Hits

Map