F496746

General Info

Members Datasets Scaffolds Average Seq Length
2370 489 2365 113

Family's Representative Sequence

Representative Sequence 3300006028|Ga0070717_10060444|Ga0070717_100604443
Length 115
Sequence MAMTKIEAIIQPSKLEPVKEALLEVGVEGMTVSEVRGHGRQKGHTEIYRGREYTVDLLPKVKLEVVLADDDLIERAVQTIISVTRTGRIGDGKIFLSRVDEAIRIRNDERGVAAL

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
49 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
66 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
67 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
68 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
75 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
98 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
99 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
100 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
101 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
102 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
103 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
116 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
117 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
118 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
119 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
120 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
121 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
122 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
124 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
125 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
126 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
129 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
130 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
131 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
132 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
133 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
134 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
135 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
136 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
137 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
138 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
139 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
140 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
141 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
142 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
143 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
144 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
145 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
146 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
147 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
148 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
149 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
150 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
151 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
152 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
157 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
158 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
159 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
160 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
161 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
233 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
234 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
238 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
239 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
240 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
241 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
242 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
243 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
244 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
246 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
247 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
248 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
249 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
250 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
251 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
252 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
253 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
254 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
255 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
256 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
257 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
258 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
259 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
260 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
261 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
262 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
263 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
264 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
265 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
266 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
267 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
268 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
269 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
270 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
272 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
273 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
274 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
275 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
276 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
277 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
278 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
279 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
280 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
281 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
282 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
283 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
284 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
285 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
286 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
287 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
288 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
289 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
290 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
291 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
292 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
293 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
294 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
295 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
296 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
297 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
298 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
299 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
300 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
301 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
302 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
303 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
304 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
305 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
306 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
307 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
308 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
309 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
310 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
311 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
312 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
313 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
314 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
315 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
316 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
317 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
318 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
319 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
320 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
321 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
322 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
323 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
324 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
325 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
326 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
327 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
328 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
329 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
330 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
331 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
332 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
333 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
334 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
335 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
336 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
337 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
338 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
339 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
340 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
341 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
342 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
343 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
344 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
345 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
346 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
347 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
348 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
349 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
350 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
351 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
352 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
353 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
354 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
355 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
356 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
357 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
358 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
359 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
360 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
361 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
362 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
363 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
364 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
365 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
366 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
367 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
368 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
369 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
370 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
371 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
372 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
373 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
374 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
375 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
376 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
377 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
378 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
379 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
380 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
381 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
382 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
383 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
384 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
385 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
386 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
387 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
388 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
389 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
390 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
391 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
392 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
393 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
394 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
395 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
396 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
397 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
398 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
399 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
400 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
401 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
402 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
403 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
404 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
405 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
406 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
407 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
408 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
409 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
410 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
411 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
412 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
413 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
414 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
417 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
418 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
419 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
420 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
421 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
423 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
424 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
426 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
428 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
429 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
430 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
431 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
432 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
433 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
434 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
435 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
436 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
437 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
438 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
439 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
440 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
441 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
442 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
443 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
444 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
445 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
446 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
447 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
450 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
451 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
452 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
453 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
454 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
455 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
456 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
457 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
458 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
459 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
460 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
461 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
462 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
463 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
464 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
465 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
466 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
467 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
468 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
469 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
470 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
471 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
472 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
473 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
474 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
475 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
476 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
478 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
483 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
486 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
487 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
488 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
489 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.52
Metatranscriptomes 1.43
Isolates 0.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 4.35
Rhizosphere 94.6
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_7734326 2162886011 Bacteria 953
2 LJNas_1004814 3300000546 Bacteria 1487
3 LJNas_1018771 3300000546 Bacteria 737
4 JGI24736J21556_1044934 3300001904 Bacteria 679
5 JGI24736J21556_1054256 3300001904 Unclassified 618
6 JGI24741J21665_1020503 3300001915 Bacteria 1039
7 JGI24739J22299_10156327 3300001989 Bacteria 673
8 JGI24737J22298_10016181 3300001990 Bacteria 2409
9 JGI24737J22298_10228604 3300001990 Unclassified 549
10 JGI24743J22301_10024507 3300001991 Bacteria 1165
11 JGI24735J21928_10162942 3300002067 Bacteria 644
12 JGI24750J21931_1006404 3300002070 Bacteria 1467
13 JGI24748J21848_1037345 3300002074 Bacteria 612
14 JGI24738J21930_10003066 3300002075 Bacteria 4271
15 JGI24749J21850_1028677 3300002076 Bacteria 796
16 JGI24742J22300_10101212 3300002244 Bacteria 557
17 rootH2_10081970 3300003320 Bacteria 4473
18 rootH2_10094950 3300003320 Bacteria 1408
19 rootH2_10168830 3300003320 Bacteria 1515
20 rootH2_10204522 3300003320 Bacteria 1720
21 rootH2_10213601 3300003320 Bacteria 1746
22 rootH1_10402706 3300003323 Bacteria 1165
23 Ga0058861_11643122 3300004800 Bacteria 629
24 Ga0058862_12706968 3300004803 Bacteria 620
25 Ga0065712_10094707 3300005290 Bacteria 2240
26 Ga0065712_10298466 3300005290 Bacteria 861
27 Ga0065715_10135926 3300005293 Bacteria 1931
28 Ga0065715_10201686 3300005293 Bacteria 1358
29 Ga0065707_10043322 3300005295 Bacteria 1085
30 Ga0070658_10016767 3300005327 Bacteria 5864
31 Ga0070658_10020291 3300005327 Bacteria 5325
32 Ga0070658_10030777 3300005327 Bacteria 4311
33 Ga0070658_10083097 3300005327 Bacteria 2632
34 Ga0070658_10120462 3300005327 Unclassified 2180
35 Ga0070658_10135853 3300005327 Unclassified 2052
36 Ga0070658_10393136 3300005327 Bacteria 1190
37 Ga0070658_10402796 3300005327 Bacteria 1175
38 Ga0070658_10555777 3300005327 Bacteria 993
39 Ga0070658_10561215 3300005327 Bacteria 988
40 Ga0070658_11152263 3300005327 Bacteria 674
41 Ga0070658_11290284 3300005327 Bacteria 634
42 Ga0070676_10002535 3300005328 Bacteria 9385
43 Ga0070676_10016781 3300005328 Unclassified 4047
44 Ga0070676_10022971 3300005328 Bacteria 3502
45 Ga0070683_100017801 3300005329 Bacteria 6279
46 Ga0070683_100041381 3300005329 Bacteria 4238
47 Ga0070683_100055829 3300005329 Bacteria 3666
48 Ga0070683_100194451 3300005329 Unclassified 1926
49 Ga0070683_100247617 3300005329 Unclassified 1695
50 Ga0070683_101220505 3300005329 Bacteria 723
51 Ga0070683_101667195 3300005329 Bacteria 613
52 Ga0070683_101879746 3300005329 Bacteria 575
53 Ga0070690_100001295 3300005330 Bacteria 12996
54 Ga0070690_100099601 3300005330 Bacteria 1925
55 Ga0070690_100327891 3300005330 Unclassified 1105
56 Ga0070670_100007750 3300005331 Bacteria 9133
57 Ga0070670_100045281 3300005331 Bacteria 3781
58 Ga0070670_100505805 3300005331 Bacteria 1075
59 Ga0070677_10214791 3300005333 Bacteria 936
60 Ga0070677_10419686 3300005333 Bacteria 709
61 Ga0068869_100000424 3300005334 Bacteria 23063
62 Ga0068869_100049520 3300005334 Bacteria 3042
63 Ga0068869_100595538 3300005334 Bacteria 933
64 Ga0068869_100642348 3300005334 Bacteria 900
65 Ga0070666_10005226 3300005335 Bacteria 7952
66 Ga0070666_10008629 3300005335 Bacteria 6336
67 Ga0070666_10017107 3300005335 Bacteria 4646
68 Ga0070666_10087796 3300005335 Bacteria 2132
69 Ga0070666_10348836 3300005335 Bacteria 1059
70 Ga0070680_100006210 3300005336 Bacteria 9065
71 Ga0070680_100013170 3300005336 Bacteria 6438
72 Ga0070680_100118284 3300005336 Bacteria 2210
73 Ga0070680_100511627 3300005336 Bacteria 1028
74 Ga0070680_101179946 3300005336 Bacteria 662
75 Ga0070682_100018621 3300005337 Bacteria 4064
76 Ga0070682_100021996 3300005337 Bacteria 3771
77 Ga0070682_100037300 3300005337 Bacteria 2975
78 Ga0070682_100079072 3300005337 Unclassified 2123
79 Ga0070682_100232156 3300005337 Bacteria 1319
80 Ga0068868_100006703 3300005338 Bacteria 8171
81 Ga0068868_100007870 3300005338 Bacteria 7610
82 Ga0068868_100018323 3300005338 Bacteria 5233
83 Ga0068868_100129479 3300005338 Bacteria 2064
84 Ga0068868_100156472 3300005338 Bacteria 1880
85 Ga0068868_100173680 3300005338 Bacteria 1785
86 Ga0068868_100295176 3300005338 Bacteria 1375
87 Ga0068868_100380360 3300005338 Bacteria 1215
88 Ga0068868_100936914 3300005338 Bacteria 789
89 Ga0070660_100001946 3300005339 Bacteria 14247
90 Ga0070660_100009595 3300005339 Bacteria 6816
91 Ga0070660_100016593 3300005339 Bacteria 5348
92 Ga0070660_100017843 3300005339 Bacteria 5177
93 Ga0070660_100043115 3300005339 Bacteria 3447
94 Ga0070660_100065144 3300005339 Bacteria 2836
95 Ga0070660_100126222 3300005339 Bacteria 2044
96 Ga0070660_100469235 3300005339 Bacteria 1045
97 Ga0070660_101069282 3300005339 Bacteria 683
98 Ga0070689_100002684 3300005340 Bacteria 11665
99 Ga0070689_100046830 3300005340 Bacteria 3333
100 Ga0070689_100073871 3300005340 Bacteria 2668
101 Ga0070689_100108070 3300005340 Bacteria 2210
102 Ga0070691_10082210 3300005341 Bacteria 1579
103 Ga0070691_10105021 3300005341 Bacteria 1407
104 Ga0070691_10122938 3300005341 Bacteria 1308
105 Ga0070691_10404321 3300005341 Bacteria 770
106 Ga0070691_10923141 3300005341 Bacteria 540
107 Ga0070687_100053026 3300005343 Bacteria 2107
108 Ga0070687_100329564 3300005343 Bacteria 978
109 Ga0070687_100461076 3300005343 Bacteria 847
110 Ga0070687_100882095 3300005343 Bacteria 640
111 Ga0070661_100002021 3300005344 Bacteria 14020
112 Ga0070661_100005744 3300005344 Bacteria 8540
113 Ga0070661_100008049 3300005344 Bacteria 7278
114 Ga0070661_100016097 3300005344 Bacteria 5277
115 Ga0070661_100016304 3300005344 Bacteria 5252
116 Ga0070661_100030282 3300005344 Bacteria 3909
117 Ga0070661_100033062 3300005344 Bacteria 3746
118 Ga0070661_100127916 3300005344 Bacteria 1906
119 Ga0070661_100198705 3300005344 Unclassified 1531
120 Ga0070661_100254616 3300005344 Bacteria 1356
121 Ga0070692_10379212 3300005345 Bacteria 887
122 Ga0070668_100004348 3300005347 Bacteria 10507
123 Ga0070668_100026586 3300005347 Bacteria 4393
124 Ga0070668_100447282 3300005347 Unclassified 1110
125 Ga0070668_100618673 3300005347 Bacteria 949
126 Ga0070668_101546648 3300005347 Bacteria 607
127 Ga0070668_102180198 3300005347 Bacteria 512
128 Ga0070669_100000574 3300005353 Bacteria 27273
129 Ga0070669_100106620 3300005353 Bacteria 2121
130 Ga0070669_100387276 3300005353 Bacteria 1141
131 Ga0070675_100006476 3300005354 Bacteria 8992
132 Ga0070675_100353789 3300005354 Bacteria 1303
133 Ga0070675_100777263 3300005354 Bacteria 875
134 Ga0070675_101343248 3300005354 Unclassified 659
135 Ga0070671_100000429 3300005355 Bacteria 29172
136 Ga0070671_100048543 3300005355 Unclassified 3530
137 Ga0070671_100307255 3300005355 Bacteria 1350
138 Ga0070671_101133574 3300005355 Bacteria 687
139 Ga0070671_101752565 3300005355 Bacteria 551
140 Ga0070671_101803024 3300005355 Unclassified 544
141 Ga0070674_100011573 3300005356 Bacteria 5378
142 Ga0070674_100080715 3300005356 Bacteria 2323
143 Ga0070673_100041826 3300005364 Bacteria 3528
144 Ga0070673_100339196 3300005364 Bacteria 1331
145 Ga0070673_101575568 3300005364 Bacteria 620
146 Ga0070673_101609695 3300005364 Bacteria 614
147 Ga0070688_100000238 3300005365 Bacteria 29006
148 Ga0070688_100258124 3300005365 Bacteria 1243
149 Ga0070688_101092998 3300005365 Bacteria 637
150 Ga0070659_100002752 3300005366 Bacteria 12509
151 Ga0070659_100003992 3300005366 Bacteria 10505
152 Ga0070659_100004250 3300005366 Bacteria 10224
153 Ga0070659_100033495 3300005366 Bacteria 3990
154 Ga0070659_100039295 3300005366 Bacteria 3694
155 Ga0070659_100085277 3300005366 Bacteria 2526
156 Ga0070659_100310884 3300005366 Bacteria 1316
157 Ga0070659_100363473 3300005366 Bacteria 1216
158 Ga0070659_100874522 3300005366 Bacteria 784
159 Ga0070667_100001398 3300005367 Bacteria 21590
160 Ga0070667_100007564 3300005367 Bacteria 9012
161 Ga0070667_100204011 3300005367 Unclassified 1755
162 Ga0070667_100304154 3300005367 Bacteria 1436
163 Ga0070667_100384125 3300005367 Bacteria 1276
164 Ga0070667_101240961 3300005367 Unclassified 698
165 Ga0070667_101611723 3300005367 Bacteria 610
166 Ga0070703_10064876 3300005406 Bacteria 1204
167 Ga0070709_10000553 3300005434 Bacteria 21892
168 Ga0070709_10001219 3300005434 Bacteria 14108
169 Ga0070709_10011511 3300005434 Unclassified 4935
170 Ga0070709_10014805 3300005434 Bacteria 4421
171 Ga0070709_10025197 3300005434 Bacteria 3512
172 Ga0070709_10100828 3300005434 Bacteria 1923
173 Ga0070709_10221998 3300005434 Bacteria 1348
174 Ga0070709_10291077 3300005434 Bacteria 1190
175 Ga0070709_10362201 3300005434 Unclassified 1074
176 Ga0070709_10950532 3300005434 Unclassified 682
177 Ga0070709_11149810 3300005434 Unclassified 622
178 Ga0070709_11231336 3300005434 Unclassified 602
179 Ga0070709_11261769 3300005434 Unclassified 595
180 Ga0070709_11757847 3300005434 Bacteria 507
181 Ga0070714_100007325 3300005435 Bacteria 8580
182 Ga0070714_100062908 3300005435 Bacteria 3190
183 Ga0070714_100079446 3300005435 Bacteria 2852
184 Ga0070714_100323604 3300005435 Bacteria 1442
185 Ga0070714_100325524 3300005435 Unclassified 1438
186 Ga0070714_100463877 3300005435 Bacteria 1204
187 Ga0070714_100578110 3300005435 Bacteria 1077
188 Ga0070714_100680689 3300005435 Bacteria 992
189 Ga0070714_101671555 3300005435 Bacteria 622
190 Ga0070713_100000461 3300005436 Bacteria 25984
191 Ga0070713_100002117 3300005436 Bacteria 12843
192 Ga0070713_100049968 3300005436 Bacteria 3452
193 Ga0070713_100055045 3300005436 Bacteria 3304
194 Ga0070713_100176580 3300005436 Bacteria 1917
195 Ga0070713_100180761 3300005436 Bacteria 1895
196 Ga0070713_100269421 3300005436 Unclassified 1559
197 Ga0070713_100393879 3300005436 Bacteria 1292
198 Ga0070713_100414077 3300005436 Bacteria 1261
199 Ga0070713_100434257 3300005436 Unclassified 1231
200 Ga0070713_100550154 3300005436 Unclassified 1093
201 Ga0070713_100569586 3300005436 Bacteria 1074
202 Ga0070713_100595326 3300005436 Bacteria 1050
203 Ga0070713_100624378 3300005436 Bacteria 1025
204 Ga0070713_100924805 3300005436 Bacteria 839
205 Ga0070713_100943399 3300005436 Bacteria 831
206 Ga0070713_101586723 3300005436 Bacteria 635
207 Ga0070713_101665585 3300005436 Bacteria 619
208 Ga0070710_10004047 3300005437 Bacteria 6959
209 Ga0070710_10007854 3300005437 Bacteria 5180
210 Ga0070710_10041847 3300005437 Unclassified 2531
211 Ga0070710_10085421 3300005437 Bacteria 1851
212 Ga0070710_10264828 3300005437 Unclassified 1110
213 Ga0070710_10414218 3300005437 Bacteria 906
214 Ga0070710_11031233 3300005437 Unclassified 601
215 Ga0070701_10018230 3300005438 Bacteria 3296
216 Ga0070701_10751698 3300005438 Bacteria 661
217 Ga0070711_100000213 3300005439 Bacteria 30586
218 Ga0070711_100001115 3300005439 Bacteria 14359
219 Ga0070711_100021593 3300005439 Bacteria 4165
220 Ga0070711_100052034 3300005439 Bacteria 2817
221 Ga0070711_100103057 3300005439 Bacteria 2079
222 Ga0070711_100159896 3300005439 Bacteria 1707
223 Ga0070711_100336229 3300005439 Unclassified 1210
224 Ga0070711_100425619 3300005439 Bacteria 1083
225 Ga0070711_100636327 3300005439 Unclassified 893
226 Ga0070711_101185119 3300005439 Unclassified 660
227 Ga0070705_100000937 3300005440 Bacteria 16341
228 Ga0070700_100013595 3300005441 Bacteria 4575
229 Ga0070700_100307170 3300005441 Bacteria 1160
230 Ga0070700_100492510 3300005441 Bacteria 941
231 Ga0070700_100503065 3300005441 Bacteria 932
232 Ga0070694_100182634 3300005444 Bacteria 1552
233 Ga0070708_100004203 3300005445 Bacteria 11309
234 Ga0070708_100155423 3300005445 Bacteria 2129
235 Ga0070708_100376654 3300005445 Bacteria 1338
236 Ga0070708_100783365 3300005445 Bacteria 896
237 Ga0070663_100003957 3300005455 Bacteria 8635
238 Ga0070663_100013009 3300005455 Bacteria 5286
239 Ga0070663_100019462 3300005455 Bacteria 4475
240 Ga0070663_100111413 3300005455 Unclassified 2057
241 Ga0070663_100489335 3300005455 Bacteria 1020
242 Ga0070663_100737007 3300005455 Bacteria 840
243 Ga0070663_101705203 3300005455 Bacteria 563
244 Ga0070678_100000163 3300005456 Bacteria 28192
245 Ga0070678_100045787 3300005456 Bacteria 3132
246 Ga0070678_100364765 3300005456 Bacteria 1246
247 Ga0070678_100688736 3300005456 Bacteria 920
248 Ga0070678_100900814 3300005456 Bacteria 808
249 Ga0070678_101117993 3300005456 Bacteria 728
250 Ga0070678_102318196 3300005456 Bacteria 510
251 Ga0070662_100009122 3300005457 Bacteria 6477
252 Ga0070662_100018905 3300005457 Bacteria 4668
253 Ga0070662_100412144 3300005457 Bacteria 1116
254 Ga0070662_100418315 3300005457 Bacteria 1108
255 Ga0070681_10009425 3300005458 Bacteria 9608
256 Ga0070681_10009818 3300005458 Bacteria 9426
257 Ga0070681_10023633 3300005458 Bacteria 6184
258 Ga0070681_10044143 3300005458 Bacteria 4462
259 Ga0070681_10080875 3300005458 Unclassified 3205
260 Ga0070681_10087148 3300005458 Bacteria 3075
261 Ga0070681_10229271 3300005458 Bacteria 1772
262 Ga0070681_10475498 3300005458 Bacteria 1162
263 Ga0070681_10532606 3300005458 Bacteria 1088
264 Ga0068867_100006765 3300005459 Bacteria 8102
265 Ga0068867_100036780 3300005459 Bacteria 3556
266 Ga0068867_100076061 3300005459 Bacteria 2520
267 Ga0068867_100388855 3300005459 Bacteria 1173
268 Ga0068867_100792331 3300005459 Bacteria 844
269 Ga0068867_101323988 3300005459 Bacteria 666
270 Ga0068867_102320932 3300005459 Bacteria 510
271 Ga0070685_10068149 3300005466 Bacteria 2101
272 Ga0070685_10290896 3300005466 Bacteria 1097
273 Ga0070685_10420391 3300005466 Bacteria 930
274 Ga0070706_100003196 3300005467 Bacteria 16166
275 Ga0070706_100003529 3300005467 Bacteria 15378
276 Ga0070707_100014689 3300005468 Bacteria 7338
277 Ga0070707_100666432 3300005468 Bacteria 1003
278 Ga0070707_100933262 3300005468 Bacteria 833
279 Ga0070707_102187567 3300005468 Bacteria 521
280 Ga0070698_100064875 3300005471 Bacteria 3678
281 Ga0070698_100172576 3300005471 Unclassified 2103
282 Ga0070698_100578626 3300005471 Bacteria 1063
283 Ga0070699_100058163 3300005518 Unclassified 3349
284 Ga0070699_100082090 3300005518 Bacteria 2809
285 Ga0070699_101508553 3300005518 Unclassified 616
286 Ga0070679_100006772 3300005530 Bacteria 10687
287 Ga0070679_100021139 3300005530 Bacteria 6349
288 Ga0070679_100059209 3300005530 Unclassified 3818
289 Ga0070679_100079211 3300005530 Bacteria 3275
290 Ga0070679_100087224 3300005530 Bacteria 3108
291 Ga0070679_100099343 3300005530 Bacteria 2898
292 Ga0070679_100118123 3300005530 Bacteria 2637
293 Ga0070679_100150170 3300005530 Bacteria 2307
294 Ga0070679_100179955 3300005530 Bacteria 2087
295 Ga0070679_100258476 3300005530 Bacteria 1697
296 Ga0070684_100058892 3300005535 Bacteria 3358
297 Ga0070684_100081259 3300005535 Unclassified 2868
298 Ga0070684_100085345 3300005535 Bacteria 2800
299 Ga0070684_100130395 3300005535 Unclassified 2267
300 Ga0070684_100153714 3300005535 Bacteria 2086
301 Ga0070684_100463329 3300005535 Bacteria 1172
302 Ga0070684_100746050 3300005535 Bacteria 914
303 Ga0070684_101087118 3300005535 Bacteria 751
304 Ga0070697_100001048 3300005536 Bacteria 20883
305 Ga0070697_100001102 3300005536 Bacteria 20411
306 Ga0070697_100711468 3300005536 Bacteria 886
307 Ga0070697_101123177 3300005536 Bacteria 700
308 Ga0070697_101424922 3300005536 Bacteria 619
309 Ga0070697_101852325 3300005536 Bacteria 540
310 Ga0068853_100000456 3300005539 Bacteria 27867
311 Ga0068853_100001401 3300005539 Bacteria 17397
312 Ga0068853_100018488 3300005539 Bacteria 5770
313 Ga0068853_100025543 3300005539 Bacteria 4957
314 Ga0068853_100038240 3300005539 Bacteria 4086
315 Ga0068853_100045286 3300005539 Bacteria 3767
316 Ga0068853_100072859 3300005539 Bacteria 2994
317 Ga0068853_100088326 3300005539 Bacteria 2721
318 Ga0068853_100293397 3300005539 Bacteria 1501
319 Ga0068853_100739945 3300005539 Bacteria 939
320 Ga0068853_101400393 3300005539 Bacteria 676
321 Ga0070672_100017891 3300005543 Bacteria 5110
322 Ga0070672_100236597 3300005543 Bacteria 1535
323 Ga0070672_100387007 3300005543 Bacteria 1197
324 Ga0070672_100412326 3300005543 Bacteria 1159
325 Ga0070672_100719135 3300005543 Bacteria 875
326 Ga0070672_101647140 3300005543 Bacteria 576
327 Ga0070686_100001281 3300005544 Bacteria 14220
328 Ga0070686_100091693 3300005544 Bacteria 2033
329 Ga0070686_100587130 3300005544 Unclassified 876
330 Ga0070686_101430024 3300005544 Unclassified 581
331 Ga0070695_100011479 3300005545 Bacteria 5298
332 Ga0070695_100173927 3300005545 Bacteria 1521
333 Ga0070695_100312648 3300005545 Unclassified 1165
334 Ga0070696_100000980 3300005546 Bacteria 18512
335 Ga0070696_100031772 3300005546 Bacteria 3620
336 Ga0070696_100055135 3300005546 Bacteria 2772
337 Ga0070696_100635050 3300005546 Bacteria 864
338 Ga0070696_100732215 3300005546 Bacteria 809
339 Ga0070693_100000352 3300005547 Bacteria 20882
340 Ga0070693_100008790 3300005547 Bacteria 5002
341 Ga0070693_100084355 3300005547 Unclassified 1901
342 Ga0070693_100164865 3300005547 Unclassified 1414
343 Ga0070693_101340780 3300005547 Unclassified 554
344 Ga0070665_100009297 3300005548 Bacteria 9948
345 Ga0070665_100020939 3300005548 Bacteria 6572
346 Ga0070665_100025415 3300005548 Bacteria 5968
347 Ga0070665_100064283 3300005548 Bacteria 3679
348 Ga0070665_100092697 3300005548 Bacteria 3026
349 Ga0070665_100119719 3300005548 Unclassified 2635
350 Ga0070665_100199887 3300005548 Bacteria 1999
351 Ga0070665_100213899 3300005548 Bacteria 1928
352 Ga0070665_100228279 3300005548 Bacteria 1862
353 Ga0070665_100349315 3300005548 Bacteria 1484
354 Ga0070665_100585996 3300005548 Unclassified 1128
355 Ga0070665_100627168 3300005548 Bacteria 1088
356 Ga0070665_101491930 3300005548 Bacteria 685
357 Ga0070665_101658595 3300005548 Unclassified 647
358 Ga0070704_100012293 3300005549 Bacteria 5286
359 Ga0070704_100040428 3300005549 Bacteria 3210
360 Ga0070704_100621533 3300005549 Bacteria 951
361 Ga0070704_101281064 3300005549 Bacteria 670
362 Ga0070704_101544089 3300005549 Bacteria 611
363 Ga0068855_100000779 3300005563 Bacteria 39345
364 Ga0068855_100003139 3300005563 Bacteria 20209
365 Ga0068855_100028730 3300005563 Bacteria 6654
366 Ga0068855_100031234 3300005563 Bacteria 6361
367 Ga0068855_100048321 3300005563 Bacteria 5022
368 Ga0068855_100084815 3300005563 Unclassified 3666
369 Ga0068855_100123972 3300005563 Bacteria 2955
370 Ga0068855_100134639 3300005563 Bacteria 2819
371 Ga0068855_100190117 3300005563 Bacteria 2316
372 Ga0068855_100217209 3300005563 Bacteria 2146
373 Ga0068855_100222583 3300005563 Bacteria 2115
374 Ga0068855_100235006 3300005563 Bacteria 2050
375 Ga0068855_100289512 3300005563 Unclassified 1816
376 Ga0068855_100635930 3300005563 Bacteria 1147
377 Ga0068855_100776291 3300005563 Bacteria 1020
378 Ga0068855_100846328 3300005563 Bacteria 970
379 Ga0068855_102205287 3300005563 Bacteria 553
380 Ga0068855_102289816 3300005563 Bacteria 541
381 Ga0070664_100004148 3300005564 Bacteria 11644
382 Ga0070664_100013503 3300005564 Bacteria 6654
383 Ga0070664_100090497 3300005564 Bacteria 2648
384 Ga0070664_100429193 3300005564 Bacteria 1211
385 Ga0070664_101813166 3300005564 Bacteria 579
386 Ga0068857_100025768 3300005577 Bacteria 5178
387 Ga0068857_100037905 3300005577 Bacteria 4271
388 Ga0068857_100130539 3300005577 Bacteria 2266
389 Ga0068857_100696985 3300005577 Bacteria 965
390 Ga0068857_100738750 3300005577 Bacteria 937
391 Ga0068857_101574558 3300005577 Bacteria 641
392 Ga0068854_100001211 3300005578 Bacteria 15465
393 Ga0068854_100001753 3300005578 Bacteria 13213
394 Ga0068854_100002891 3300005578 Bacteria 10676
395 Ga0068854_100012470 3300005578 Bacteria 5568
396 Ga0068854_100013626 3300005578 Bacteria 5343
397 Ga0068854_100082122 3300005578 Bacteria 2382
398 Ga0068854_100105316 3300005578 Unclassified 2120
399 Ga0068854_100173768 3300005578 Unclassified 1678
400 Ga0068854_100505692 3300005578 Bacteria 1018
401 Ga0068854_101114583 3300005578 Bacteria 704
402 Ga0068854_102137406 3300005578 Bacteria 517
403 Ga0068856_100011466 3300005614 Bacteria 8603
404 Ga0068856_100017168 3300005614 Bacteria 7014
405 Ga0068856_100017545 3300005614 Bacteria 6936
406 Ga0068856_100032999 3300005614 Bacteria 5070
407 Ga0068856_100042762 3300005614 Bacteria 4458
408 Ga0068856_100060237 3300005614 Bacteria 3750
409 Ga0068856_100121386 3300005614 Bacteria 2615
410 Ga0068856_100170445 3300005614 Bacteria 2189
411 Ga0068856_100218501 3300005614 Bacteria 1921
412 Ga0068856_100402159 3300005614 Unclassified 1389
413 Ga0068856_100413391 3300005614 Bacteria 1369
414 Ga0068856_100493770 3300005614 Bacteria 1245
415 Ga0068856_100502865 3300005614 Bacteria 1233
416 Ga0068856_100562611 3300005614 Bacteria 1161
417 Ga0068856_100665404 3300005614 Bacteria 1062
418 Ga0068856_100793540 3300005614 Bacteria 967
419 Ga0068856_100847071 3300005614 Bacteria 933
420 Ga0068856_102538459 3300005614 Bacteria 519
421 Ga0070702_100000144 3300005615 Bacteria 22195
422 Ga0070702_100838082 3300005615 Bacteria 714
423 Ga0070702_101773518 3300005615 Bacteria 515
424 Ga0068852_100000020 3300005616 Bacteria 126369
425 Ga0068852_100038794 3300005616 Bacteria 4006
426 Ga0068852_100065401 3300005616 Bacteria 3172
427 Ga0068852_100070040 3300005616 Bacteria 3076
428 Ga0068852_100071856 3300005616 Bacteria 3040
429 Ga0068852_100095130 3300005616 Bacteria 2674
430 Ga0068852_100126170 3300005616 Bacteria 2351
431 Ga0068852_100261595 3300005616 Bacteria 1661
432 Ga0068852_100385689 3300005616 Bacteria 1375
433 Ga0068852_100528043 3300005616 Bacteria 1178
434 Ga0068852_100569131 3300005616 Bacteria 1135
435 Ga0068852_100638037 3300005616 Bacteria 1072
436 Ga0068852_100752670 3300005616 Bacteria 987
437 Ga0068852_100934980 3300005616 Bacteria 885
438 Ga0068852_100995554 3300005616 Bacteria 857
439 Ga0068852_101920714 3300005616 Bacteria 614
440 Ga0068859_100011985 3300005617 Bacteria 8709
441 Ga0068859_100023070 3300005617 Bacteria 6240
442 Ga0068859_100029008 3300005617 Bacteria 5551
443 Ga0068859_100288899 3300005617 Bacteria 1733
444 Ga0068859_100290320 3300005617 Bacteria 1729
445 Ga0068859_101400181 3300005617 Bacteria 771
446 Ga0068859_103082043 3300005617 Bacteria 508
447 Ga0068864_100019140 3300005618 Bacteria 5724
448 Ga0068864_100026682 3300005618 Bacteria 4871
449 Ga0068864_100628737 3300005618 Bacteria 1044
450 Ga0068864_101108648 3300005618 Bacteria 788
451 Ga0068866_10001363 3300005718 Bacteria 10576
452 Ga0068866_10212247 3300005718 Bacteria 1163
453 Ga0068866_10541625 3300005718 Unclassified 777
454 Ga0068866_11058789 3300005718 Unclassified 579
455 Ga0068866_11080153 3300005718 Bacteria 574
456 Ga0068861_100006708 3300005719 Bacteria 7866
457 Ga0068861_100076137 3300005719 Bacteria 2614
458 Ga0068861_101272965 3300005719 Bacteria 714
459 Ga0068861_101845553 3300005719 Unclassified 600
460 Ga0068851_10003533 3300005834 Bacteria 6955
461 Ga0068851_10037043 3300005834 Bacteria 2445
462 Ga0068851_10059125 3300005834 Bacteria 1960
463 Ga0068851_10251801 3300005834 Bacteria 1002
464 Ga0068851_10264680 3300005834 Bacteria 979
465 Ga0068851_10457287 3300005834 Bacteria 759
466 Ga0068851_10615724 3300005834 Bacteria 662
467 Ga0068851_10844480 3300005834 Unclassified 571
468 Ga0068870_10091284 3300005840 Bacteria 1703
469 Ga0068870_10408623 3300005840 Bacteria 885
470 Ga0068870_10871617 3300005840 Bacteria 634
471 Ga0068863_100001553 3300005841 Bacteria 22691
472 Ga0068863_100006574 3300005841 Bacteria 11408
473 Ga0068863_100028069 3300005841 Bacteria 5372
474 Ga0068863_100045655 3300005841 Bacteria 4158
475 Ga0068863_100048529 3300005841 Bacteria 4026
476 Ga0068863_100328696 3300005841 Bacteria 1486
477 Ga0068863_100527425 3300005841 Bacteria 1165
478 Ga0068863_100710913 3300005841 Bacteria 999
479 Ga0068863_101082177 3300005841 Unclassified 806
480 Ga0068863_101085088 3300005841 Bacteria 805
481 Ga0068858_100002502 3300005842 Bacteria 18541
482 Ga0068858_100003338 3300005842 Bacteria 15989
483 Ga0068858_100019098 3300005842 Bacteria 6411
484 Ga0068858_100025835 3300005842 Bacteria 5462
485 Ga0068858_100122384 3300005842 Bacteria 2434
486 Ga0068858_100243981 3300005842 Bacteria 1705
487 Ga0068858_100274960 3300005842 Bacteria 1603
488 Ga0068858_100373881 3300005842 Bacteria 1367
489 Ga0068858_100469109 3300005842 Bacteria 1214
490 Ga0068858_100516026 3300005842 Unclassified 1155
491 Ga0068858_100566557 3300005842 Bacteria 1100
492 Ga0068858_100788693 3300005842 Unclassified 927
493 Ga0068858_101025104 3300005842 Unclassified 809
494 Ga0068858_101228545 3300005842 Bacteria 737
495 Ga0068860_100042051 3300005843 Bacteria 4367
496 Ga0068860_100056723 3300005843 Unclassified 3722
497 Ga0068860_100068229 3300005843 Bacteria 3379
498 Ga0068860_100119123 3300005843 Bacteria 2527
499 Ga0068860_100130727 3300005843 Bacteria 2409
500 Ga0068860_100160165 3300005843 Bacteria 2170
501 Ga0068860_100183930 3300005843 Bacteria 2020
502 Ga0068860_100204686 3300005843 Bacteria 1913
503 Ga0068860_100589934 3300005843 Unclassified 1116
504 Ga0068860_101215263 3300005843 Bacteria 774
505 Ga0068862_100001405 3300005844 Bacteria 22295
506 Ga0068862_100233050 3300005844 Unclassified 1671
507 Ga0068862_100681386 3300005844 Bacteria 994
508 Ga0068862_100852334 3300005844 Bacteria 893
509 Ga0068862_101453547 3300005844 Bacteria 690
510 Ga0081455_10367389 3300005937 Unclassified 1009
511 Ga0081540_1146292 3300005983 Unclassified 940
512 Ga0070717_10007095 3300006028 Bacteria 8300
513 Ga0070717_10007853 3300006028 Bacteria 7942
514 Ga0070717_10015061 3300006028 Bacteria 5962
515 Ga0070717_10043871 3300006028 Bacteria 3651
516 Ga0070717_10060444 3300006028 Unclassified 3138
517 Ga0070717_10087796 3300006028 Unclassified 2620
518 Ga0070717_10136753 3300006028 Bacteria 2111
519 Ga0070717_10380014 3300006028 Unclassified 1266
520 Ga0070717_10454186 3300006028 Bacteria 1155
521 Ga0070717_10512982 3300006028 Bacteria 1084
522 Ga0070717_10599603 3300006028 Unclassified 999
523 Ga0070717_10849662 3300006028 Bacteria 831
524 Ga0070717_10931013 3300006028 Unclassified 791
525 Ga0075432_10076351 3300006058 Bacteria 1209
526 Ga0070715_10000351 3300006163 Bacteria 11514
527 Ga0070715_10002454 3300006163 Bacteria 5692
528 Ga0070715_10110153 3300006163 Bacteria 1298
529 Ga0070715_10180473 3300006163 Bacteria 1058
530 Ga0070715_10449323 3300006163 Bacteria 727
531 Ga0070715_10555407 3300006163 Bacteria 666
532 Ga0070715_10782831 3300006163 Unclassified 577
533 Ga0070716_100002822 3300006173 Bacteria 8087
534 Ga0070716_100013970 3300006173 Bacteria 4106
535 Ga0070716_100083426 3300006173 Bacteria 1914
536 Ga0070716_100101305 3300006173 Unclassified 1766
537 Ga0070716_100188941 3300006173 Bacteria 1359
538 Ga0070716_100208493 3300006173 Bacteria 1304
539 Ga0070716_100395828 3300006173 Bacteria 992
540 Ga0070716_100755034 3300006173 Unclassified 749
541 Ga0070716_100780910 3300006173 Bacteria 738
542 Ga0070712_100000506 3300006175 Bacteria 22281
543 Ga0070712_100000650 3300006175 Bacteria 20430
544 Ga0070712_100002973 3300006175 Bacteria 10491
545 Ga0070712_100015896 3300006175 Bacteria 4852
546 Ga0070712_100048356 3300006175 Bacteria 2948
547 Ga0070712_100053417 3300006175 Unclassified 2821
548 Ga0070712_100539294 3300006175 Unclassified 982
549 Ga0070712_100763008 3300006175 Unclassified 828
550 Ga0070712_100849643 3300006175 Bacteria 785
551 Ga0070712_101015497 3300006175 Bacteria 718
552 Ga0070712_101570537 3300006175 Bacteria 575
553 Ga0097621_100023960 3300006237 Bacteria 4759
554 Ga0097621_100025307 3300006237 Bacteria 4641
555 Ga0097621_100033405 3300006237 Bacteria 4097
556 Ga0097621_100038601 3300006237 Bacteria 3832
557 Ga0097621_100069200 3300006237 Bacteria 2914
558 Ga0097621_100100126 3300006237 Bacteria 2438
559 Ga0097621_100174824 3300006237 Unclassified 1853
560 Ga0097621_100203371 3300006237 Bacteria 1720
561 Ga0097621_100210345 3300006237 Bacteria 1692
562 Ga0097621_100342592 3300006237 Bacteria 1328
563 Ga0097621_100469333 3300006237 Bacteria 1136
564 Ga0097621_100935177 3300006237 Bacteria 809
565 Ga0097621_101354585 3300006237 Bacteria 673
566 Ga0097621_101518992 3300006237 Bacteria 636
567 Ga0097621_102238318 3300006237 Unclassified 523
568 Ga0068871_100000129 3300006358 Bacteria 47939
569 Ga0068871_100013553 3300006358 Bacteria 6052
570 Ga0068871_100019520 3300006358 Bacteria 5176
571 Ga0068871_100054407 3300006358 Bacteria 3247
572 Ga0068871_100091734 3300006358 Bacteria 2532
573 Ga0068871_100119920 3300006358 Bacteria 2221
574 Ga0068871_100333458 3300006358 Bacteria 1338
575 Ga0068871_100645050 3300006358 Bacteria 966
576 Ga0068871_100757066 3300006358 Bacteria 893
577 Ga0068871_100884527 3300006358 Bacteria 827
578 Ga0068871_100946388 3300006358 Bacteria 800
579 Ga0068871_101543668 3300006358 Bacteria 628
580 Ga0068871_101559570 3300006358 Unclassified 625
581 Ga0075428_100320558 3300006844 Bacteria 1665
582 Ga0075428_100398753 3300006844 Bacteria 1475
583 Ga0075430_100532473 3300006846 Unclassified 969
584 Ga0075431_100095359 3300006847 Bacteria 3071
585 Ga0075431_100118946 3300006847 Bacteria 2726
586 Ga0075431_100561223 3300006847 Bacteria 1128
587 Ga0075433_10001462 3300006852 Bacteria 17474
588 Ga0075433_10009947 3300006852 Bacteria 7621
589 Ga0075433_10553220 3300006852 Bacteria 1011
590 Ga0075433_11143319 3300006852 Bacteria 676
591 Ga0075434_100000295 3300006871 Bacteria 35374
592 Ga0075434_100001801 3300006871 Bacteria 18524
593 Ga0075434_100034621 3300006871 Bacteria 4989
594 Ga0075429_100076875 3300006880 Bacteria 2908
595 Ga0075429_100105501 3300006880 Bacteria 2461
596 Ga0075429_100202909 3300006880 Bacteria 1737
597 Ga0068865_100000403 3300006881 Bacteria 24052
598 Ga0068865_100037352 3300006881 Bacteria 3279
599 Ga0068865_100038581 3300006881 Unclassified 3234
600 Ga0068865_100109262 3300006881 Unclassified 2037
601 Ga0068865_100198106 3300006881 Bacteria 1558
602 Ga0068865_100369886 3300006881 Bacteria 1166
603 Ga0075436_100007723 3300006914 Bacteria 7350
604 Ga0075436_100014105 3300006914 Bacteria 5471
605 Ga0075436_100073100 3300006914 Bacteria 2373
606 Ga0075436_100113107 3300006914 Bacteria 1896
607 Ga0075436_100200804 3300006914 Unclassified 1412
608 Ga0097620_100011985 3300006931 Bacteria 8709
609 Ga0097620_100023070 3300006931 Bacteria 6240
610 Ga0097620_100029010 3300006931 Bacteria 5551
611 Ga0097620_100288892 3300006931 Bacteria 1733
612 Ga0097620_100290311 3300006931 Bacteria 1729
613 Ga0097620_101400606 3300006931 Bacteria 771
614 Ga0097620_103081995 3300006931 Bacteria 508
615 Ga0075435_100000025 3300007076 Bacteria 87314
616 Ga0075435_100154072 3300007076 Bacteria 1933
617 Ga0075435_100275390 3300007076 Unclassified 1436
618 Ga0075435_100388084 3300007076 Unclassified 1200
619 Ga0075435_101060253 3300007076 Bacteria 708
620 Ga0075435_101643958 3300007076 Bacteria 563
621 Ga0099794_10129063 3300007265 Unclassified 1276
622 Ga0099794_10473525 3300007265 Unclassified 658
623 Ga0099794_10702230 3300007265 Bacteria 539
624 Ga0099795_10107665 3300007788 Unclassified 1101
625 Ga0099795_10345922 3300007788 Unclassified 664
626 Ga0099795_10401821 3300007788 Bacteria 623
627 Ga0099795_10524627 3300007788 Bacteria 555
628 Ga0099795_10615150 3300007788 Unclassified 518
629 Ga0105251_10220384 3300009011 Bacteria 854
630 Ga0105244_10162087 3300009036 Bacteria 1067
631 Ga0105250_10079778 3300009092 Bacteria 1326
632 Ga0105250_10126291 3300009092 Bacteria 1054
633 Ga0105240_10000145 3300009093 Bacteria 143918
634 Ga0105240_10004691 3300009093 Bacteria 20668
635 Ga0105240_10021776 3300009093 Bacteria 8517
636 Ga0105240_10025618 3300009093 Bacteria 7745
637 Ga0105240_10026057 3300009093 Bacteria 7677
638 Ga0105240_10038510 3300009093 Bacteria 6132
639 Ga0105240_10071330 3300009093 Bacteria 4297
640 Ga0105240_10072810 3300009093 Bacteria 4245
641 Ga0105240_10080608 3300009093 Bacteria 4002
642 Ga0105240_10081899 3300009093 Bacteria 3964
643 Ga0105240_10115966 3300009093 Unclassified 3232
644 Ga0105240_10134435 3300009093 Bacteria 2963
645 Ga0105240_10135880 3300009093 Unclassified 2945
646 Ga0105240_10199401 3300009093 Bacteria 2347
647 Ga0105240_10205119 3300009093 Unclassified 2308
648 Ga0105240_10229055 3300009093 Bacteria 2161
649 Ga0105240_10258036 3300009093 Bacteria 2012
650 Ga0105240_10316502 3300009093 Bacteria 1780
651 Ga0105240_10685281 3300009093 Unclassified 1120
652 Ga0105240_10686199 3300009093 Bacteria 1119
653 Ga0105240_10718718 3300009093 Bacteria 1089
654 Ga0105240_10797263 3300009093 Bacteria 1023
655 Ga0105240_10805833 3300009093 Bacteria 1017
656 Ga0105240_10966022 3300009093 Bacteria 913
657 Ga0105240_12192974 3300009093 Bacteria 573
658 Ga0111539_10365779 3300009094 Bacteria 1679
659 Ga0111539_10903661 3300009094 Bacteria 1027
660 Ga0111539_11475617 3300009094 Unclassified 789
661 Ga0105245_10001024 3300009098 Bacteria 25390
662 Ga0105245_10001576 3300009098 Bacteria 20702
663 Ga0105245_10001781 3300009098 Bacteria 19603
664 Ga0105245_10020798 3300009098 Bacteria 5752
665 Ga0105245_10023214 3300009098 Bacteria 5445
666 Ga0105245_10030955 3300009098 Bacteria 4733
667 Ga0105245_10030993 3300009098 Unclassified 4730
668 Ga0105245_10048228 3300009098 Bacteria 3810
669 Ga0105245_10063234 3300009098 Bacteria 3341
670 Ga0105245_10139809 3300009098 Bacteria 2279
671 Ga0105245_10382022 3300009098 Bacteria 1403
672 Ga0105245_10420475 3300009098 Bacteria 1339
673 Ga0105245_11048007 3300009098 Bacteria 861
674 Ga0105245_11579023 3300009098 Bacteria 708
675 Ga0105247_10001124 3300009101 Bacteria 19897
676 Ga0105247_10076275 3300009101 Bacteria 2105
677 Ga0105247_10297823 3300009101 Unclassified 1118
678 Ga0105247_10413301 3300009101 Bacteria 964
679 Ga0105247_10605147 3300009101 Bacteria 813
680 Ga0105247_10627191 3300009101 Bacteria 800
681 Ga0105247_10644008 3300009101 Bacteria 791
682 Ga0105247_10938874 3300009101 Bacteria 671
683 Ga0114129_10149799 3300009147 Bacteria 3193
684 Ga0114129_10463442 3300009147 Bacteria 1660
685 Ga0114129_10845814 3300009147 Bacteria 1164
686 Ga0114129_11335929 3300009147 Bacteria 887
687 Ga0114129_11426095 3300009147 Bacteria 854
688 Ga0114129_11428304 3300009147 Bacteria 853
689 Ga0105243_10002082 3300009148 Bacteria 16941
690 Ga0105243_11654019 3300009148 Unclassified 668
691 Ga0105241_10004540 3300009174 Bacteria 10273
692 Ga0105241_10012338 3300009174 Bacteria 6267
693 Ga0105241_10014235 3300009174 Bacteria 5827
694 Ga0105241_10018963 3300009174 Bacteria 5070
695 Ga0105241_10022303 3300009174 Bacteria 4689
696 Ga0105241_10038529 3300009174 Bacteria 3603
697 Ga0105241_10135528 3300009174 Bacteria 1999
698 Ga0105241_10178395 3300009174 Bacteria 1760
699 Ga0105241_10387989 3300009174 Unclassified 1222
700 Ga0105241_10737395 3300009174 Bacteria 902
701 Ga0105241_11596411 3300009174 Bacteria 631
702 Ga0105241_11619404 3300009174 Bacteria 627
703 Ga0105241_12158699 3300009174 Bacteria 551
704 Ga0105241_12360473 3300009174 Bacteria 530
705 Ga0105242_10001679 3300009176 Bacteria 17528
706 Ga0105242_10024870 3300009176 Bacteria 4733
707 Ga0105242_10026868 3300009176 Bacteria 4565
708 Ga0105242_10031137 3300009176 Bacteria 4259
709 Ga0105242_10233425 3300009176 Bacteria 1650
710 Ga0105248_10002287 3300009177 Bacteria 21211
711 Ga0105248_10012972 3300009177 Bacteria 9186
712 Ga0105248_10018604 3300009177 Bacteria 7680
713 Ga0105248_10030100 3300009177 Bacteria 6059
714 Ga0105248_10034546 3300009177 Bacteria 5655
715 Ga0105248_10048853 3300009177 Bacteria 4746
716 Ga0105248_10060707 3300009177 Bacteria 4245
717 Ga0105248_10170391 3300009177 Bacteria 2454
718 Ga0105248_10272894 3300009177 Bacteria 1904
719 Ga0105248_10275431 3300009177 Unclassified 1895
720 Ga0105248_10410954 3300009177 Bacteria 1524
721 Ga0105248_11130205 3300009177 Bacteria 885
722 Ga0105248_11441483 3300009177 Bacteria 779
723 Ga0105248_12749082 3300009177 Unclassified 561
724 Ga0105248_12955880 3300009177 Bacteria 542
725 Ga0105237_10010596 3300009545 Bacteria 9792
726 Ga0105237_10030560 3300009545 Bacteria 5470
727 Ga0105237_10041331 3300009545 Unclassified 4650
728 Ga0105237_10053532 3300009545 Bacteria 4047
729 Ga0105237_10077921 3300009545 Bacteria 3304
730 Ga0105237_10081939 3300009545 Bacteria 3217
731 Ga0105237_10122216 3300009545 Bacteria 2598
732 Ga0105237_10208188 3300009545 Bacteria 1956
733 Ga0105237_10214350 3300009545 Bacteria 1925
734 Ga0105237_10265708 3300009545 Unclassified 1719
735 Ga0105237_10289797 3300009545 Bacteria 1640
736 Ga0105237_10448398 3300009545 Bacteria 1296
737 Ga0105237_10481667 3300009545 Bacteria 1247
738 Ga0105237_10825974 3300009545 Bacteria 933
739 Ga0105237_11133179 3300009545 Bacteria 789
740 Ga0105237_11706477 3300009545 Bacteria 637
741 Ga0105238_10001529 3300009551 Bacteria 23182
742 Ga0105238_10006161 3300009551 Bacteria 11903
743 Ga0105238_10006777 3300009551 Bacteria 11444
744 Ga0105238_10011778 3300009551 Bacteria 8815
745 Ga0105238_10020785 3300009551 Bacteria 6686
746 Ga0105238_10024772 3300009551 Bacteria 6115
747 Ga0105238_10037550 3300009551 Bacteria 4924
748 Ga0105238_10046742 3300009551 Bacteria 4366
749 Ga0105238_10049427 3300009551 Bacteria 4235
750 Ga0105238_10131897 3300009551 Bacteria 2477
751 Ga0105238_10226027 3300009551 Bacteria 1848
752 Ga0105238_10645153 3300009551 Bacteria 1068
753 Ga0105238_10739601 3300009551 Bacteria 997
754 Ga0105238_10836512 3300009551 Bacteria 937
755 Ga0105238_10843907 3300009551 Bacteria 933
756 Ga0105238_10875751 3300009551 Bacteria 916
757 Ga0105238_11014402 3300009551 Bacteria 851
758 Ga0105238_11017981 3300009551 Bacteria 849
759 Ga0105238_11189787 3300009551 Bacteria 786
760 Ga0105238_11215441 3300009551 Bacteria 778
761 Ga0105238_11248380 3300009551 Bacteria 768
762 Ga0105249_10008998 3300009553 Bacteria 8724
763 Ga0105249_10031865 3300009553 Bacteria 4769
764 Ga0105249_10039508 3300009553 Bacteria 4285
765 Ga0105249_10165531 3300009553 Bacteria 2140
766 Ga0105249_10318461 3300009553 Bacteria 1566
767 Ga0105249_10432111 3300009553 Bacteria 1353
768 Ga0105249_11293133 3300009553 Bacteria 801
769 Ga0105249_11593097 3300009553 Bacteria 725
770 Ga0099796_10294450 3300010159 Unclassified 686
771 Ga0099796_10574503 3300010159 Unclassified 507
772 Ga0105239_10003151 3300010375 Bacteria 20450
773 Ga0105239_10017516 3300010375 Bacteria 7923
774 Ga0105239_10043675 3300010375 Bacteria 4914
775 Ga0105239_10044763 3300010375 Bacteria 4850
776 Ga0105239_10113346 3300010375 Bacteria 3007
777 Ga0105239_10148021 3300010375 Bacteria 2620
778 Ga0105239_10224353 3300010375 Unclassified 2107
779 Ga0105239_10310762 3300010375 Bacteria 1776
780 Ga0105239_10380555 3300010375 Bacteria 1595
781 Ga0105239_10555620 3300010375 Bacteria 1308
782 Ga0105239_10667290 3300010375 Bacteria 1188
783 Ga0105239_10908126 3300010375 Unclassified 1011
784 Ga0105239_11059803 3300010375 Bacteria 933
785 Ga0105239_11340470 3300010375 Bacteria 826
786 Ga0105239_11526473 3300010375 Bacteria 772
787 Ga0105239_11995666 3300010375 Unclassified 673
788 Ga0105239_12388581 3300010375 Bacteria 616
789 Ga0105239_12965415 3300010375 Unclassified 553
790 Ga0105239_13498654 3300010375 Unclassified 510
791 Ga0105246_10000623 3300011119 Bacteria 19751
792 Ga0105246_10030324 3300011119 Bacteria 3570
793 Ga0105246_10032578 3300011119 Bacteria 3457
794 Ga0105246_10674149 3300011119 Bacteria 903
795 Ga0157316_1024382 3300012510 Bacteria 687
796 Ga0157373_10088591 3300013100 Bacteria 2180
797 Ga0157373_10110215 3300013100 Bacteria 1935
798 Ga0157373_10115492 3300013100 Unclassified 1887
799 Ga0157373_10340115 3300013100 Bacteria 1069
800 Ga0157373_10392901 3300013100 Unclassified 993
801 Ga0157371_10013549 3300013102 Bacteria 6190
802 Ga0157371_10024040 3300013102 Bacteria 4451
803 Ga0157371_10223625 3300013102 Bacteria 1352
804 Ga0157371_10486855 3300013102 Bacteria 910
805 Ga0157370_10000110 3300013104 Bacteria 95051
806 Ga0157370_10010542 3300013104 Bacteria 9733
807 Ga0157370_10033050 3300013104 Bacteria 5045
808 Ga0157370_10033931 3300013104 Bacteria 4972
809 Ga0157370_10037468 3300013104 Bacteria 4701
810 Ga0157370_10054800 3300013104 Bacteria 3801
811 Ga0157370_10146565 3300013104 Bacteria 2198
812 Ga0157370_10181468 3300013104 Bacteria 1956
813 Ga0157370_10234869 3300013104 Bacteria 1696
814 Ga0157370_10351916 3300013104 Bacteria 1358
815 Ga0157370_10411456 3300013104 Bacteria 1244
816 Ga0157370_10494156 3300013104 Unclassified 1124
817 Ga0157370_10502531 3300013104 Bacteria 1113
818 Ga0157370_10587295 3300013104 Bacteria 1020
819 Ga0157370_10626201 3300013104 Bacteria 984
820 Ga0157370_10772725 3300013104 Bacteria 875
821 Ga0157369_10000162 3300013105 Bacteria 94983
822 Ga0157369_10002576 3300013105 Bacteria 21701
823 Ga0157369_10002760 3300013105 Bacteria 20967
824 Ga0157369_10012232 3300013105 Bacteria 9746
825 Ga0157369_10016602 3300013105 Bacteria 8277
826 Ga0157369_10016811 3300013105 Bacteria 8223
827 Ga0157369_10017943 3300013105 Bacteria 7945
828 Ga0157369_10040564 3300013105 Bacteria 5081
829 Ga0157369_10043129 3300013105 Bacteria 4918
830 Ga0157369_10055977 3300013105 Bacteria 4256
831 Ga0157369_10140129 3300013105 Bacteria 2559
832 Ga0157369_10195508 3300013105 Bacteria 2124
833 Ga0157369_10206263 3300013105 Bacteria 2061
834 Ga0157369_10267274 3300013105 Bacteria 1783
835 Ga0157369_10307921 3300013105 Bacteria 1647
836 Ga0157369_10656965 3300013105 Bacteria 1081
837 Ga0157369_10739846 3300013105 Bacteria 1012
838 Ga0157369_10747971 3300013105 Bacteria 1006
839 Ga0157369_11177490 3300013105 Bacteria 783
840 Ga0157369_12012586 3300013105 Unclassified 586
841 Ga0157374_10001094 3300013296 Bacteria 23330
842 Ga0157374_10001844 3300013296 Bacteria 17834
843 Ga0157374_10002773 3300013296 Bacteria 14710
844 Ga0157374_10015115 3300013296 Bacteria 6767
845 Ga0157374_10015176 3300013296 Bacteria 6756
846 Ga0157374_10022411 3300013296 Bacteria 5635
847 Ga0157374_10027298 3300013296 Bacteria 5147
848 Ga0157374_10042374 3300013296 Bacteria 4199
849 Ga0157374_10062887 3300013296 Bacteria 3480
850 Ga0157374_10074128 3300013296 Unclassified 3213
851 Ga0157374_10089896 3300013296 Bacteria 2927
852 Ga0157374_10093275 3300013296 Unclassified 2874
853 Ga0157374_10098456 3300013296 Unclassified 2800
854 Ga0157374_10111719 3300013296 Bacteria 2629
855 Ga0157374_10289734 3300013296 Bacteria 1618
856 Ga0157374_10290850 3300013296 Bacteria 1615
857 Ga0157374_10497609 3300013296 Bacteria 1223
858 Ga0157374_10696099 3300013296 Bacteria 1029
859 Ga0157374_10789246 3300013296 Bacteria 965
860 Ga0157374_11077274 3300013296 Bacteria 824
861 Ga0157374_11129271 3300013296 Bacteria 804
862 Ga0157374_11483277 3300013296 Unclassified 701
863 Ga0157374_12073853 3300013296 Bacteria 595
864 Ga0157374_12150581 3300013296 Bacteria 585
865 Ga0157374_12254118 3300013296 Bacteria 572
866 Ga0157378_10000852 3300013297 Bacteria 28277
867 Ga0157378_10001216 3300013297 Bacteria 23323
868 Ga0157378_10001914 3300013297 Bacteria 18690
869 Ga0157378_10006171 3300013297 Bacteria 10492
870 Ga0157378_10017818 3300013297 Bacteria 6235
871 Ga0157378_10017845 3300013297 Bacteria 6229
872 Ga0157378_10034547 3300013297 Bacteria 4471
873 Ga0157378_10043257 3300013297 Bacteria 3999
874 Ga0157378_10044149 3300013297 Bacteria 3957
875 Ga0157378_10098881 3300013297 Unclassified 2661
876 Ga0157378_10236094 3300013297 Bacteria 1745
877 Ga0157378_10462435 3300013297 Bacteria 1261
878 Ga0157378_10564275 3300013297 Bacteria 1145
879 Ga0157378_10863441 3300013297 Bacteria 934
880 Ga0157378_11032205 3300013297 Bacteria 857
881 Ga0157378_12442240 3300013297 Unclassified 575
882 Ga0163162_10003253 3300013306 Bacteria 15534
883 Ga0163162_10006554 3300013306 Bacteria 11278
884 Ga0163162_10007686 3300013306 Bacteria 10498
885 Ga0163162_10029772 3300013306 Bacteria 5404
886 Ga0163162_10029947 3300013306 Bacteria 5390
887 Ga0163162_10110901 3300013306 Bacteria 2841
888 Ga0163162_10124181 3300013306 Bacteria 2687
889 Ga0163162_10127674 3300013306 Bacteria 2650
890 Ga0163162_10173385 3300013306 Bacteria 2281
891 Ga0163162_10312934 3300013306 Unclassified 1703
892 Ga0163162_10482861 3300013306 Bacteria 1370
893 Ga0163162_10673765 3300013306 Bacteria 1157
894 Ga0163162_10682503 3300013306 Bacteria 1150
895 Ga0163162_11023364 3300013306 Bacteria 934
896 Ga0163162_11043271 3300013306 Bacteria 925
897 Ga0163162_11330793 3300013306 Bacteria 816
898 Ga0163162_11516863 3300013306 Unclassified 764
899 Ga0163162_11787388 3300013306 Bacteria 703
900 Ga0157372_10000276 3300013307 Bacteria 56940
901 Ga0157372_10002164 3300013307 Bacteria 21380
902 Ga0157372_10004425 3300013307 Bacteria 14985
903 Ga0157372_10017408 3300013307 Bacteria 7713
904 Ga0157372_10021851 3300013307 Bacteria 6917
905 Ga0157372_10025779 3300013307 Bacteria 6395
906 Ga0157372_10043485 3300013307 Bacteria 4973
907 Ga0157372_10074180 3300013307 Bacteria 3836
908 Ga0157372_10088297 3300013307 Bacteria 3520
909 Ga0157372_10094515 3300013307 Bacteria 3404
910 Ga0157372_10094815 3300013307 Bacteria 3399
911 Ga0157372_10146864 3300013307 Bacteria 2719
912 Ga0157372_10165997 3300013307 Bacteria 2553
913 Ga0157372_10202511 3300013307 Bacteria 2299
914 Ga0157372_10278337 3300013307 Bacteria 1945
915 Ga0157372_10487286 3300013307 Bacteria 1437
916 Ga0157372_10661068 3300013307 Bacteria 1217
917 Ga0157372_10890178 3300013307 Bacteria 1033
918 Ga0157372_10902693 3300013307 Bacteria 1025
919 Ga0157372_11050876 3300013307 Bacteria 943
920 Ga0157372_11146848 3300013307 Bacteria 899
921 Ga0157372_11228828 3300013307 Bacteria 865
922 Ga0157372_11357558 3300013307 Bacteria 820
923 Ga0157372_11681584 3300013307 Bacteria 730
924 Ga0157372_12255037 3300013307 Bacteria 625
925 Ga0157372_13147991 3300013307 Bacteria 526
926 Ga0157375_10001815 3300013308 Bacteria 18305
927 Ga0157375_10006530 3300013308 Bacteria 10152
928 Ga0157375_10017741 3300013308 Bacteria 6434
929 Ga0157375_10018214 3300013308 Bacteria 6364
930 Ga0157375_10026750 3300013308 Bacteria 5382
931 Ga0157375_10067984 3300013308 Bacteria 3562
932 Ga0157375_10163131 3300013308 Bacteria 2372
933 Ga0157375_11188114 3300013308 Unclassified 894
934 Ga0157375_11636243 3300013308 Bacteria 762
935 Ga0157375_11693093 3300013308 Bacteria 749
936 Ga0157375_11810415 3300013308 Bacteria 724
937 Ga0157375_12087231 3300013308 Unclassified 674
938 Ga0157375_12890382 3300013308 Unclassified 574
939 Ga0157375_13010708 3300013308 Bacteria 563
940 Ga0163163_10008343 3300014325 Bacteria 9201
941 Ga0163163_10056817 3300014325 Unclassified 3868
942 Ga0163163_10060127 3300014325 Bacteria 3761
943 Ga0163163_10377690 3300014325 Bacteria 1475
944 Ga0163163_10440100 3300014325 Bacteria 1363
945 Ga0163163_10497229 3300014325 Bacteria 1281
946 Ga0163163_10999668 3300014325 Bacteria 900
947 Ga0163163_11026700 3300014325 Unclassified 888
948 Ga0163163_11086664 3300014325 Unclassified 863
949 Ga0163163_11174127 3300014325 Bacteria 830
950 Ga0157380_10003685 3300014326 Bacteria 10540
951 Ga0157380_10172710 3300014326 Bacteria 1890
952 Ga0157380_10201916 3300014326 Unclassified 1764
953 Ga0157380_11836563 3300014326 Unclassified 666
954 Ga0182008_10140659 3300014497 Bacteria 1207
955 Ga0157377_10296143 3300014745 Bacteria 1066
956 Ga0157377_10371669 3300014745 Bacteria 965
957 Ga0157377_10445271 3300014745 Bacteria 893
958 Ga0157377_10460179 3300014745 Unclassified 880
959 Ga0157377_11416708 3300014745 Bacteria 549
960 Ga0157379_10000825 3300014968 Bacteria 25116
961 Ga0157379_10003521 3300014968 Bacteria 13257
962 Ga0157379_10046251 3300014968 Bacteria 3883
963 Ga0157379_10091153 3300014968 Bacteria 2734
964 Ga0157379_10091955 3300014968 Bacteria 2721
965 Ga0157379_10121200 3300014968 Unclassified 2352
966 Ga0157379_10151137 3300014968 Bacteria 2094
967 Ga0157379_10166226 3300014968 Unclassified 1991
968 Ga0157379_10190457 3300014968 Bacteria 1853
969 Ga0157379_10296941 3300014968 Bacteria 1472
970 Ga0157379_10306518 3300014968 Unclassified 1448
971 Ga0157379_10332935 3300014968 Bacteria 1387
972 Ga0157379_10425702 3300014968 Unclassified 1223
973 Ga0157379_10452641 3300014968 Bacteria 1185
974 Ga0157376_10004936 3300014969 Bacteria 9303
975 Ga0157376_10028242 3300014969 Bacteria 4457
976 Ga0157376_10033123 3300014969 Bacteria 4156
977 Ga0157376_10034621 3300014969 Bacteria 4080
978 Ga0157376_10056935 3300014969 Bacteria 3268
979 Ga0157376_10065433 3300014969 Bacteria 3070
980 Ga0157376_10104339 3300014969 Bacteria 2484
981 Ga0157376_10156906 3300014969 Bacteria 2059
982 Ga0157376_10195561 3300014969 Bacteria 1857
983 Ga0157376_10295097 3300014969 Bacteria 1532
984 Ga0157376_10297136 3300014969 Bacteria 1527
985 Ga0157376_10315296 3300014969 Bacteria 1485
986 Ga0157376_10329098 3300014969 Bacteria 1455
987 Ga0157376_11403233 3300014969 Unclassified 730
988 Ga0157376_11783198 3300014969 Unclassified 651
989 Ga0182006_1025974 3300015261 Bacteria 2402
990 Ga0163161_10010112 3300017792 Bacteria 6528
991 Ga0163161_10193284 3300017792 Bacteria 1565
992 Ga0163161_10512528 3300017792 Bacteria 978
993 Ga0163161_11364725 3300017792 Bacteria 618
994 Ga0206350_11639771 3300020080 Bacteria 657
995 Ga0206354_11705963 3300020081 Bacteria 591
996 Ga0213872_10002030 3300021361 Bacteria 12297
997 Ga0213872_10012963 3300021361 Bacteria 3910
998 Ga0213872_10106788 3300021361 Bacteria 1245
999 Ga0213872_10114652 3300021361 Bacteria 1194
1000 Ga0213872_10300041 3300021361 Unclassified 667
1001 Ga0213874_10060779 3300021377 Unclassified 1183
1002 Ga0213871_10055645 3300021441 Bacteria 1093
1003 Ga0213871_10080713 3300021441 Bacteria 931
1004 Ga0228598_1007218 3300024227 Bacteria 2270
1005 Ga0209233_1021489 3300025261 Bacteria 1669
1006 Ga0207697_10279538 3300025315 Bacteria 740
1007 Ga0207656_10018418 3300025321 Bacteria 2750
1008 Ga0207656_10122187 3300025321 Bacteria 1213
1009 Ga0207656_10140433 3300025321 Bacteria 1138
1010 Ga0207656_10241699 3300025321 Bacteria 882
1011 Ga0207656_10580996 3300025321 Bacteria 572
1012 Ga0207696_1191954 3300025711 Bacteria 538
1013 Ga0207653_10101732 3300025885 Bacteria 1017
1014 Ga0207692_10006591 3300025898 Unclassified 4717
1015 Ga0207692_10007842 3300025898 Bacteria 4395
1016 Ga0207692_10014058 3300025898 Bacteria 3489
1017 Ga0207692_10786691 3300025898 Unclassified 621
1018 Ga0207692_10845036 3300025898 Bacteria 600
1019 Ga0207692_11125645 3300025898 Unclassified 520
1020 Ga0207642_10052886 3300025899 Bacteria 1845
1021 Ga0207642_10062041 3300025899 Bacteria 1741
1022 Ga0207642_10106637 3300025899 Bacteria 1418
1023 Ga0207642_10294244 3300025899 Bacteria 939
1024 Ga0207710_10010209 3300025900 Bacteria 3950
1025 Ga0207710_10117631 3300025900 Unclassified 1267
1026 Ga0207710_10247018 3300025900 Unclassified 891
1027 Ga0207710_10336491 3300025900 Bacteria 767
1028 Ga0207710_10553897 3300025900 Unclassified 599
1029 Ga0207688_10004014 3300025901 Bacteria 8014
1030 Ga0207688_10641226 3300025901 Unclassified 670
1031 Ga0207680_10011264 3300025903 Bacteria 4512
1032 Ga0207680_10020889 3300025903 Bacteria 3535
1033 Ga0207680_10082401 3300025903 Bacteria 2024
1034 Ga0207680_10106888 3300025903 Unclassified 1808
1035 Ga0207680_10763409 3300025903 Bacteria 693
1036 Ga0207647_10001229 3300025904 Bacteria 19727
1037 Ga0207647_10001523 3300025904 Bacteria 17820
1038 Ga0207647_10002120 3300025904 Bacteria 15170
1039 Ga0207647_10004333 3300025904 Bacteria 10522
1040 Ga0207647_10071098 3300025904 Bacteria 2099
1041 Ga0207647_10207969 3300025904 Bacteria 1131
1042 Ga0207685_10005408 3300025905 Unclassified 3369
1043 Ga0207685_10019658 3300025905 Bacteria 2230
1044 Ga0207685_10117496 3300025905 Bacteria 1162
1045 Ga0207685_10140359 3300025905 Bacteria 1083
1046 Ga0207685_10689018 3300025905 Unclassified 555
1047 Ga0207699_10005332 3300025906 Bacteria 6160
1048 Ga0207699_10034321 3300025906 Bacteria 2876
1049 Ga0207699_10037468 3300025906 Bacteria 2772
1050 Ga0207699_10095006 3300025906 Bacteria 1879
1051 Ga0207699_10366141 3300025906 Unclassified 1020
1052 Ga0207699_10555028 3300025906 Unclassified 833
1053 Ga0207699_10688688 3300025906 Unclassified 748
1054 Ga0207699_10744993 3300025906 Unclassified 719
1055 Ga0207699_10947309 3300025906 Unclassified 636
1056 Ga0207699_11016187 3300025906 Bacteria 613
1057 Ga0207645_10001940 3300025907 Bacteria 16694
1058 Ga0207645_10006711 3300025907 Bacteria 8226
1059 Ga0207645_10027694 3300025907 Bacteria 3659
1060 Ga0207643_10280250 3300025908 Bacteria 1034
1061 Ga0207643_10768457 3300025908 Bacteria 624
1062 Ga0207705_10000013 3300025909 Bacteria 451680
1063 Ga0207705_10000585 3300025909 Bacteria 30596
1064 Ga0207705_10004143 3300025909 Bacteria 10997
1065 Ga0207705_10018627 3300025909 Bacteria 4964
1066 Ga0207705_10027208 3300025909 Bacteria 4076
1067 Ga0207705_10055786 3300025909 Bacteria 2849
1068 Ga0207705_10058290 3300025909 Bacteria 2786
1069 Ga0207705_10099463 3300025909 Bacteria 2138
1070 Ga0207705_10183271 3300025909 Bacteria 1581
1071 Ga0207705_10751584 3300025909 Unclassified 757
1072 Ga0207684_10001356 3300025910 Bacteria 26825
1073 Ga0207684_10084336 3300025910 Unclassified 2706
1074 Ga0207684_10119358 3300025910 Bacteria 2260
1075 Ga0207684_10279636 3300025910 Bacteria 1439
1076 Ga0207684_11744907 3300025910 Bacteria 501
1077 Ga0207654_10002789 3300025911 Bacteria 8879
1078 Ga0207654_10005967 3300025911 Bacteria 6129
1079 Ga0207654_10014520 3300025911 Bacteria 4070
1080 Ga0207654_10131988 3300025911 Bacteria 1582
1081 Ga0207654_10158205 3300025911 Bacteria 1461
1082 Ga0207654_10190778 3300025911 Bacteria 1343
1083 Ga0207654_10249014 3300025911 Unclassified 1190
1084 Ga0207654_10292305 3300025911 Bacteria 1105
1085 Ga0207654_10429045 3300025911 Unclassified 924
1086 Ga0207654_10731292 3300025911 Bacteria 712
1087 Ga0207654_11432280 3300025911 Bacteria 504
1088 Ga0207707_10030731 3300025912 Bacteria 4698
1089 Ga0207707_10041436 3300025912 Bacteria 4022
1090 Ga0207707_10068635 3300025912 Unclassified 3089
1091 Ga0207707_10118635 3300025912 Bacteria 2312
1092 Ga0207707_10251752 3300025912 Bacteria 1534
1093 Ga0207707_10401830 3300025912 Bacteria 1176
1094 Ga0207707_10478918 3300025912 Bacteria 1063
1095 Ga0207707_10502282 3300025912 Bacteria 1034
1096 Ga0207707_11181711 3300025912 Unclassified 620
1097 Ga0207707_11474727 3300025912 Bacteria 540
1098 Ga0207695_10000035 3300025913 Bacteria 486590
1099 Ga0207695_10000047 3300025913 Bacteria 422459
1100 Ga0207695_10010561 3300025913 Bacteria 11290
1101 Ga0207695_10020137 3300025913 Bacteria 7652
1102 Ga0207695_10072734 3300025913 Bacteria 3506
1103 Ga0207695_10089813 3300025913 Bacteria 3089
1104 Ga0207695_10166666 3300025913 Bacteria 2131
1105 Ga0207695_10183809 3300025913 Bacteria 2010
1106 Ga0207695_10188887 3300025913 Bacteria 1978
1107 Ga0207695_10246144 3300025913 Bacteria 1688
1108 Ga0207695_10273370 3300025913 Bacteria 1585
1109 Ga0207695_10389116 3300025913 Unclassified 1279
1110 Ga0207695_10416068 3300025913 Bacteria 1228
1111 Ga0207695_10899738 3300025913 Unclassified 765
1112 Ga0207695_11153016 3300025913 Unclassified 655
1113 Ga0207671_10069308 3300025914 Bacteria 2629
1114 Ga0207671_10090324 3300025914 Bacteria 2307
1115 Ga0207671_10094962 3300025914 Bacteria 2251
1116 Ga0207671_10105929 3300025914 Bacteria 2134
1117 Ga0207671_10125219 3300025914 Bacteria 1968
1118 Ga0207671_10135588 3300025914 Bacteria 1892
1119 Ga0207671_10183605 3300025914 Bacteria 1629
1120 Ga0207671_10242995 3300025914 Bacteria 1414
1121 Ga0207671_10298715 3300025914 Bacteria 1272
1122 Ga0207671_10855865 3300025914 Bacteria 720
1123 Ga0207693_10000065 3300025915 Bacteria 91476
1124 Ga0207693_10000328 3300025915 Bacteria 43917
1125 Ga0207693_10001244 3300025915 Bacteria 22675
1126 Ga0207693_10014186 3300025915 Bacteria 6414
1127 Ga0207693_10028178 3300025915 Bacteria 4438
1128 Ga0207693_10064050 3300025915 Bacteria 2880
1129 Ga0207693_10657471 3300025915 Unclassified 814
1130 Ga0207693_11188679 3300025915 Bacteria 575
1131 Ga0207663_10008681 3300025916 Bacteria 5332
1132 Ga0207663_10016485 3300025916 Bacteria 4099
1133 Ga0207663_10035597 3300025916 Bacteria 2988
1134 Ga0207663_10093605 3300025916 Bacteria 2000
1135 Ga0207663_10124953 3300025916 Bacteria 1768
1136 Ga0207663_10149712 3300025916 Bacteria 1636
1137 Ga0207663_10224814 3300025916 Bacteria 1368
1138 Ga0207663_10399399 3300025916 Unclassified 1051
1139 Ga0207663_10561288 3300025916 Unclassified 893
1140 Ga0207663_10657392 3300025916 Unclassified 828
1141 Ga0207663_10981830 3300025916 Unclassified 677
1142 Ga0207663_10983675 3300025916 Bacteria 676
1143 Ga0207663_10990870 3300025916 Bacteria 674
1144 Ga0207663_11321583 3300025916 Bacteria 581
1145 Ga0207663_11372126 3300025916 Bacteria 569
1146 Ga0207660_10033768 3300025917 Bacteria 3542
1147 Ga0207660_10052348 3300025917 Bacteria 2906
1148 Ga0207660_11076671 3300025917 Bacteria 655
1149 Ga0207660_11361921 3300025917 Bacteria 575
1150 Ga0207662_10180736 3300025918 Bacteria 1357
1151 Ga0207662_10393861 3300025918 Bacteria 938
1152 Ga0207657_10000099 3300025919 Bacteria 83148
1153 Ga0207657_10000664 3300025919 Bacteria 36576
1154 Ga0207657_10002042 3300025919 Bacteria 21838
1155 Ga0207657_10009952 3300025919 Bacteria 9516
1156 Ga0207657_10009959 3300025919 Bacteria 9514
1157 Ga0207657_10060185 3300025919 Bacteria 3260
1158 Ga0207657_10082714 3300025919 Bacteria 2694
1159 Ga0207657_10395626 3300025919 Bacteria 1087
1160 Ga0207649_10003008 3300025920 Bacteria 9275
1161 Ga0207649_10004398 3300025920 Bacteria 7646
1162 Ga0207649_10005481 3300025920 Bacteria 6866
1163 Ga0207649_10033259 3300025920 Bacteria 3079
1164 Ga0207649_10067829 3300025920 Bacteria 2266
1165 Ga0207649_10178279 3300025920 Bacteria 1485
1166 Ga0207649_10622203 3300025920 Bacteria 832
1167 Ga0207649_11102760 3300025920 Bacteria 626
1168 Ga0207652_10007556 3300025921 Bacteria 8750
1169 Ga0207652_10021099 3300025921 Bacteria 5373
1170 Ga0207652_10025973 3300025921 Unclassified 4874
1171 Ga0207652_10059268 3300025921 Bacteria 3299
1172 Ga0207652_10115865 3300025921 Bacteria 2380
1173 Ga0207652_10137314 3300025921 Bacteria 2184
1174 Ga0207652_10201782 3300025921 Bacteria 1790
1175 Ga0207652_10208608 3300025921 Bacteria 1759
1176 Ga0207652_10219023 3300025921 Bacteria 1715
1177 Ga0207652_10283282 3300025921 Bacteria 1495
1178 Ga0207646_10000020 3300025922 Bacteria 272909
1179 Ga0207646_10400938 3300025922 Bacteria 1239
1180 Ga0207646_10504138 3300025922 Bacteria 1090
1181 Ga0207646_11342293 3300025922 Bacteria 623
1182 Ga0207681_10167233 3300025923 Bacteria 1663
1183 Ga0207681_10386613 3300025923 Bacteria 1127
1184 Ga0207681_10406145 3300025923 Bacteria 1101
1185 Ga0207681_10748137 3300025923 Bacteria 815
1186 Ga0207694_10001171 3300025924 Bacteria 22719
1187 Ga0207694_10001342 3300025924 Bacteria 21187
1188 Ga0207694_10009268 3300025924 Bacteria 7427
1189 Ga0207694_10026083 3300025924 Bacteria 4443
1190 Ga0207694_10028788 3300025924 Bacteria 4237
1191 Ga0207694_10039165 3300025924 Bacteria 3647
1192 Ga0207694_10060752 3300025924 Bacteria 2942
1193 Ga0207694_10062118 3300025924 Bacteria 2908
1194 Ga0207694_10086457 3300025924 Bacteria 2469
1195 Ga0207694_10099657 3300025924 Bacteria 2301
1196 Ga0207694_10111398 3300025924 Unclassified 2177
1197 Ga0207694_10113635 3300025924 Bacteria 2156
1198 Ga0207694_10138356 3300025924 Bacteria 1957
1199 Ga0207694_10204190 3300025924 Bacteria 1608
1200 Ga0207694_10364031 3300025924 Bacteria 1199
1201 Ga0207694_10701846 3300025924 Bacteria 853
1202 Ga0207694_10812496 3300025924 Unclassified 790
1203 Ga0207694_10968273 3300025924 Bacteria 720
1204 Ga0207650_11916914 3300025925 Bacteria 500
1205 Ga0207659_10831255 3300025926 Bacteria 794
1206 Ga0207659_11360314 3300025926 Bacteria 609
1207 Ga0207687_10013538 3300025927 Bacteria 5327
1208 Ga0207687_10021376 3300025927 Bacteria 4298
1209 Ga0207687_10068353 3300025927 Bacteria 2531
1210 Ga0207687_10114084 3300025927 Bacteria 2011
1211 Ga0207687_10128331 3300025927 Bacteria 1907
1212 Ga0207687_10163849 3300025927 Bacteria 1709
1213 Ga0207687_10277034 3300025927 Bacteria 1343
1214 Ga0207687_10286663 3300025927 Bacteria 1322
1215 Ga0207687_10893853 3300025927 Unclassified 760
1216 Ga0207700_10000988 3300025928 Bacteria 16396
1217 Ga0207700_10055797 3300025928 Bacteria 2970
1218 Ga0207700_10136488 3300025928 Bacteria 2010
1219 Ga0207700_10206905 3300025928 Unclassified 1657
1220 Ga0207700_10213247 3300025928 Bacteria 1634
1221 Ga0207700_10219478 3300025928 Bacteria 1611
1222 Ga0207700_10435470 3300025928 Unclassified 1153
1223 Ga0207700_10558029 3300025928 Bacteria 1017
1224 Ga0207700_10584569 3300025928 Bacteria 993
1225 Ga0207700_10605466 3300025928 Bacteria 975
1226 Ga0207700_10669129 3300025928 Bacteria 926
1227 Ga0207700_10841443 3300025928 Unclassified 821
1228 Ga0207700_10878310 3300025928 Unclassified 802
1229 Ga0207700_11407557 3300025928 Bacteria 620
1230 Ga0207700_11728478 3300025928 Bacteria 551
1231 Ga0207664_10049185 3300025929 Bacteria 3318
1232 Ga0207664_10062192 3300025929 Unclassified 2981
1233 Ga0207664_10317487 3300025929 Bacteria 1374
1234 Ga0207664_10399607 3300025929 Bacteria 1222
1235 Ga0207664_10726452 3300025929 Bacteria 893
1236 Ga0207664_10822830 3300025929 Bacteria 835
1237 Ga0207664_10897158 3300025929 Bacteria 796
1238 Ga0207664_11086845 3300025929 Bacteria 715
1239 Ga0207644_10006838 3300025931 Bacteria 7433
1240 Ga0207644_10065803 3300025931 Bacteria 2636
1241 Ga0207644_10094028 3300025931 Bacteria 2239
1242 Ga0207644_10489242 3300025931 Bacteria 1014
1243 Ga0207690_10000932 3300025932 Bacteria 18697
1244 Ga0207690_10004700 3300025932 Bacteria 8062
1245 Ga0207690_10012962 3300025932 Bacteria 4997
1246 Ga0207690_10024883 3300025932 Bacteria 3753
1247 Ga0207690_10037151 3300025932 Bacteria 3160
1248 Ga0207690_10113764 3300025932 Bacteria 1953
1249 Ga0207690_10121718 3300025932 Bacteria 1897
1250 Ga0207690_11019489 3300025932 Bacteria 689
1251 Ga0207706_10000247 3300025933 Bacteria 59079
1252 Ga0207706_10002670 3300025933 Bacteria 17375
1253 Ga0207706_10007404 3300025933 Bacteria 10149
1254 Ga0207706_10045081 3300025933 Bacteria 3908
1255 Ga0207706_10163663 3300025933 Unclassified 1955
1256 Ga0207706_10817884 3300025933 Bacteria 791
1257 Ga0207686_10032419 3300025934 Bacteria 3109
1258 Ga0207686_10076618 3300025934 Bacteria 2169
1259 Ga0207686_10310555 3300025934 Bacteria 1174
1260 Ga0207686_10935815 3300025934 Unclassified 701
1261 Ga0207686_10944810 3300025934 Bacteria 697
1262 Ga0207709_10149123 3300025935 Bacteria 1618
1263 Ga0207709_10759776 3300025935 Bacteria 780
1264 Ga0207670_10079658 3300025936 Bacteria 2287
1265 Ga0207670_10199360 3300025936 Bacteria 1520
1266 Ga0207670_10483541 3300025936 Bacteria 1003
1267 Ga0207670_11356782 3300025936 Bacteria 603
1268 Ga0207669_10001810 3300025937 Bacteria 9051
1269 Ga0207669_11001969 3300025937 Bacteria 702
1270 Ga0207704_10002045 3300025938 Bacteria 9023
1271 Ga0207704_10031994 3300025938 Bacteria 2971
1272 Ga0207704_10143939 3300025938 Unclassified 1672
1273 Ga0207704_10375440 3300025938 Bacteria 1114
1274 Ga0207704_10454514 3300025938 Bacteria 1023
1275 Ga0207704_10873823 3300025938 Unclassified 755
1276 Ga0207704_11121172 3300025938 Unclassified 669
1277 Ga0207665_10000262 3300025939 Bacteria 36575
1278 Ga0207665_10001298 3300025939 Bacteria 16869
1279 Ga0207665_10019608 3300025939 Unclassified 4447
1280 Ga0207665_10021989 3300025939 Bacteria 4193
1281 Ga0207665_10209549 3300025939 Bacteria 1423
1282 Ga0207665_10233336 3300025939 Unclassified 1353
1283 Ga0207665_10300828 3300025939 Bacteria 1199
1284 Ga0207665_10550791 3300025939 Bacteria 896
1285 Ga0207665_11089414 3300025939 Bacteria 637
1286 Ga0207665_11113867 3300025939 Unclassified 629
1287 Ga0207691_10015768 3300025940 Bacteria 7183
1288 Ga0207691_10246731 3300025940 Bacteria 1542
1289 Ga0207691_10247576 3300025940 Unclassified 1539
1290 Ga0207691_10733881 3300025940 Bacteria 832
1291 Ga0207691_10889684 3300025940 Bacteria 746
1292 Ga0207691_11390159 3300025940 Bacteria 577
1293 Ga0207691_11447591 3300025940 Bacteria 563
1294 Ga0207711_10008693 3300025941 Bacteria 8496
1295 Ga0207711_10010686 3300025941 Bacteria 7633
1296 Ga0207711_10025132 3300025941 Bacteria 4997
1297 Ga0207711_10097773 3300025941 Bacteria 2592
1298 Ga0207711_10210552 3300025941 Unclassified 1776
1299 Ga0207711_10403786 3300025941 Unclassified 1270
1300 Ga0207711_10822098 3300025941 Bacteria 865
1301 Ga0207689_10001371 3300025942 Bacteria 23349
1302 Ga0207689_10018344 3300025942 Bacteria 5904
1303 Ga0207689_10093620 3300025942 Unclassified 2468
1304 Ga0207689_10330520 3300025942 Bacteria 1266
1305 Ga0207661_10024681 3300025944 Bacteria 4559
1306 Ga0207661_10076799 3300025944 Bacteria 2744
1307 Ga0207661_10103949 3300025944 Bacteria 2391
1308 Ga0207661_10162999 3300025944 Bacteria 1935
1309 Ga0207661_10734076 3300025944 Bacteria 909
1310 Ga0207661_11130012 3300025944 Bacteria 721
1311 Ga0207679_10277363 3300025945 Bacteria 1436
1312 Ga0207679_10399509 3300025945 Bacteria 1209
1313 Ga0207679_11029435 3300025945 Bacteria 755
1314 Ga0207679_11266115 3300025945 Bacteria 677
1315 Ga0207667_10001640 3300025949 Bacteria 28185
1316 Ga0207667_10004151 3300025949 Bacteria 17799
1317 Ga0207667_10005659 3300025949 Bacteria 15238
1318 Ga0207667_10011338 3300025949 Bacteria 10365
1319 Ga0207667_10017720 3300025949 Bacteria 8011
1320 Ga0207667_10029273 3300025949 Bacteria 5973
1321 Ga0207667_10058296 3300025949 Bacteria 4051
1322 Ga0207667_10075770 3300025949 Bacteria 3492
1323 Ga0207667_10113060 3300025949 Bacteria 2800
1324 Ga0207667_10114527 3300025949 Bacteria 2779
1325 Ga0207667_10189703 3300025949 Bacteria 2109
1326 Ga0207667_10199773 3300025949 Bacteria 2051
1327 Ga0207667_10580612 3300025949 Unclassified 1132
1328 Ga0207667_10625322 3300025949 Bacteria 1084
1329 Ga0207667_11990843 3300025949 Bacteria 541
1330 Ga0207651_10001394 3300025960 Bacteria 10954
1331 Ga0207651_10360944 3300025960 Bacteria 1226
1332 Ga0207651_10722276 3300025960 Bacteria 879
1333 Ga0207651_11048146 3300025960 Bacteria 730
1334 Ga0207651_11081129 3300025960 Unclassified 718
1335 Ga0207651_11834526 3300025960 Bacteria 546
1336 Ga0207712_10014792 3300025961 Bacteria 5024
1337 Ga0207712_10026458 3300025961 Bacteria 3865
1338 Ga0207712_10241024 3300025961 Unclassified 1456
1339 Ga0207712_10321110 3300025961 Bacteria 1277
1340 Ga0207712_10358895 3300025961 Bacteria 1214
1341 Ga0207712_11492706 3300025961 Bacteria 605
1342 Ga0207712_11497598 3300025961 Bacteria 604
1343 Ga0207712_11786121 3300025961 Unclassified 551
1344 Ga0207668_10000960 3300025972 Bacteria 17364
1345 Ga0207668_10025595 3300025972 Bacteria 3821
1346 Ga0207668_10641733 3300025972 Bacteria 929
1347 Ga0207668_11120599 3300025972 Bacteria 706
1348 Ga0207640_10001234 3300025981 Bacteria 13933
1349 Ga0207640_10010087 3300025981 Bacteria 5309
1350 Ga0207640_10020019 3300025981 Bacteria 3965
1351 Ga0207640_10022284 3300025981 Bacteria 3788
1352 Ga0207640_10049273 3300025981 Bacteria 2726
1353 Ga0207640_10091246 3300025981 Unclassified 2110
1354 Ga0207640_10758438 3300025981 Bacteria 837
1355 Ga0207658_10058854 3300025986 Bacteria 2861
1356 Ga0207658_10343165 3300025986 Bacteria 1298
1357 Ga0207677_10008264 3300026023 Bacteria 5801
1358 Ga0207677_10020444 3300026023 Unclassified 4020
1359 Ga0207677_10036199 3300026023 Bacteria 3214
1360 Ga0207677_10093476 3300026023 Bacteria 2193
1361 Ga0207677_10174502 3300026023 Bacteria 1685
1362 Ga0207677_10194111 3300026023 Bacteria 1608
1363 Ga0207677_10588036 3300026023 Bacteria 975
1364 Ga0207677_11010080 3300026023 Bacteria 755
1365 Ga0207677_11472871 3300026023 Unclassified 628
1366 Ga0207703_10002024 3300026035 Bacteria 17901
1367 Ga0207703_10060004 3300026035 Bacteria 3108
1368 Ga0207703_10085878 3300026035 Bacteria 2634
1369 Ga0207703_10107189 3300026035 Bacteria 2378
1370 Ga0207703_10193265 3300026035 Bacteria 1804
1371 Ga0207703_10204541 3300026035 Bacteria 1756
1372 Ga0207703_10478168 3300026035 Unclassified 1167
1373 Ga0207703_10491038 3300026035 Bacteria 1151
1374 Ga0207703_10653083 3300026035 Bacteria 998
1375 Ga0207703_10653335 3300026035 Unclassified 998
1376 Ga0207703_10669541 3300026035 Bacteria 985
1377 Ga0207703_10713393 3300026035 Bacteria 954
1378 Ga0207703_10812299 3300026035 Bacteria 893
1379 Ga0207639_10000293 3300026041 Bacteria 35588
1380 Ga0207639_10001054 3300026041 Bacteria 18730
1381 Ga0207639_10004120 3300026041 Bacteria 9801
1382 Ga0207639_10007772 3300026041 Bacteria 7326
1383 Ga0207639_10041868 3300026041 Bacteria 3430
1384 Ga0207639_10059166 3300026041 Bacteria 2951
1385 Ga0207639_10102725 3300026041 Unclassified 2314
1386 Ga0207639_10105193 3300026041 Bacteria 2289
1387 Ga0207639_10654656 3300026041 Bacteria 972
1388 Ga0207639_10723150 3300026041 Bacteria 924
1389 Ga0207639_11226240 3300026041 Bacteria 704
1390 Ga0207639_11957287 3300026041 Bacteria 547
1391 Ga0207678_10000247 3300026067 Bacteria 48621
1392 Ga0207678_10009516 3300026067 Bacteria 8551
1393 Ga0207678_10010640 3300026067 Bacteria 8082
1394 Ga0207678_10017164 3300026067 Bacteria 6354
1395 Ga0207678_10058881 3300026067 Bacteria 3305
1396 Ga0207678_10200784 3300026067 Unclassified 1705
1397 Ga0207678_10241428 3300026067 Bacteria 1547
1398 Ga0207678_10385675 3300026067 Bacteria 1212
1399 Ga0207678_10735763 3300026067 Bacteria 869
1400 Ga0207678_10777240 3300026067 Bacteria 845
1401 Ga0207708_10001039 3300026075 Bacteria 20776
1402 Ga0207708_10100063 3300026075 Bacteria 2243
1403 Ga0207708_10558969 3300026075 Bacteria 966
1404 Ga0207708_10569135 3300026075 Bacteria 957
1405 Ga0207702_10019919 3300026078 Bacteria 5558
1406 Ga0207702_10021465 3300026078 Bacteria 5346
1407 Ga0207702_10066455 3300026078 Bacteria 3091
1408 Ga0207702_10120209 3300026078 Bacteria 2350
1409 Ga0207702_10121692 3300026078 Unclassified 2337
1410 Ga0207702_10144911 3300026078 Bacteria 2154
1411 Ga0207702_10153014 3300026078 Bacteria 2100
1412 Ga0207702_10182041 3300026078 Bacteria 1936
1413 Ga0207702_10206468 3300026078 Bacteria 1824
1414 Ga0207702_10276688 3300026078 Unclassified 1585
1415 Ga0207702_10333440 3300026078 Unclassified 1448
1416 Ga0207702_10396667 3300026078 Unclassified 1330
1417 Ga0207702_10404701 3300026078 Bacteria 1317
1418 Ga0207702_10704632 3300026078 Bacteria 995
1419 Ga0207702_10783728 3300026078 Bacteria 942
1420 Ga0207702_11001212 3300026078 Bacteria 829
1421 Ga0207702_11222987 3300026078 Bacteria 745
1422 Ga0207641_10008364 3300026088 Bacteria 8551
1423 Ga0207641_10035600 3300026088 Unclassified 4149
1424 Ga0207641_10038875 3300026088 Bacteria 3979
1425 Ga0207641_10063858 3300026088 Bacteria 3146
1426 Ga0207641_10077861 3300026088 Bacteria 2870
1427 Ga0207641_10158928 3300026088 Bacteria 2053
1428 Ga0207641_10285525 3300026088 Bacteria 1554
1429 Ga0207641_10528916 3300026088 Bacteria 1148
1430 Ga0207648_10023117 3300026089 Bacteria 5575
1431 Ga0207648_10052048 3300026089 Bacteria 3580
1432 Ga0207648_10087936 3300026089 Bacteria 2712
1433 Ga0207648_10246862 3300026089 Bacteria 1591
1434 Ga0207648_10411447 3300026089 Bacteria 1227
1435 Ga0207648_10554492 3300026089 Bacteria 1056
1436 Ga0207676_10050011 3300026095 Bacteria 3256
1437 Ga0207676_10115545 3300026095 Bacteria 2254
1438 Ga0207676_10256790 3300026095 Bacteria 1576
1439 Ga0207676_10287893 3300026095 Bacteria 1494
1440 Ga0207676_11385700 3300026095 Bacteria 699
1441 Ga0207674_10005608 3300026116 Bacteria 14880
1442 Ga0207674_10114569 3300026116 Bacteria 2668
1443 Ga0207674_10155960 3300026116 Bacteria 2238
1444 Ga0207674_10329564 3300026116 Bacteria 1476
1445 Ga0207674_10452405 3300026116 Bacteria 1241
1446 Ga0207674_10946456 3300026116 Bacteria 830
1447 Ga0207674_10982683 3300026116 Bacteria 813
1448 Ga0207674_11677450 3300026116 Bacteria 604
1449 Ga0207674_12070088 3300026116 Bacteria 533
1450 Ga0207675_100000047 3300026118 Bacteria 85113
1451 Ga0207675_100041148 3300026118 Bacteria 4315
1452 Ga0207675_100657529 3300026118 Bacteria 1054
1453 Ga0207675_101162152 3300026118 Bacteria 792
1454 Ga0207675_101645824 3300026118 Bacteria 662
1455 Ga0207683_10000542 3300026121 Bacteria 34972
1456 Ga0207683_10240800 3300026121 Bacteria 1650
1457 Ga0207683_10256449 3300026121 Bacteria 1596
1458 Ga0207683_10260685 3300026121 Bacteria 1583
1459 Ga0207683_10336546 3300026121 Bacteria 1384
1460 Ga0207683_10488646 3300026121 Bacteria 1136
1461 Ga0207683_10529931 3300026121 Bacteria 1089
1462 Ga0207683_11167727 3300026121 Bacteria 714
1463 Ga0207698_10000025 3300026142 Bacteria 122764
1464 Ga0207698_10006816 3300026142 Bacteria 7144
1465 Ga0207698_10027915 3300026142 Bacteria 4015
1466 Ga0207698_10036137 3300026142 Bacteria 3623
1467 Ga0207698_10052969 3300026142 Bacteria 3112
1468 Ga0207698_10055169 3300026142 Bacteria 3060
1469 Ga0207698_10055630 3300026142 Bacteria 3051
1470 Ga0207698_10271514 3300026142 Unclassified 1563
1471 Ga0207698_10326295 3300026142 Bacteria 1440
1472 Ga0207698_10363007 3300026142 Bacteria 1372
1473 Ga0207698_10575743 3300026142 Bacteria 1107
1474 Ga0207698_10618633 3300026142 Bacteria 1069
1475 Ga0207698_10694450 3300026142 Bacteria 1012
1476 Ga0207698_10950519 3300026142 Bacteria 868
1477 Ga0207698_11783981 3300026142 Bacteria 630
1478 Ga0207698_12312536 3300026142 Unclassified 549
1479 Ga0209179_1018751 3300027512 Bacteria 1324
1480 Ga0209588_1004779 3300027671 Bacteria 3843
1481 Ga0209588_1037126 3300027671 Bacteria 1568
1482 Ga0209588_1091054 3300027671 Bacteria 983
1483 Ga0209588_1115147 3300027671 Unclassified 863
1484 Ga0209998_10005918 3300027717 Bacteria 2544
1485 Ga0207428_10022192 3300027907 Bacteria 5359
1486 Ga0207428_10078778 3300027907 Bacteria 2578
1487 Ga0265356_1037157 3300028017 Bacteria 534
1488 Ga0268266_10002668 3300028379 Bacteria 18781
1489 Ga0268266_10008204 3300028379 Bacteria 9310
1490 Ga0268266_10010857 3300028379 Bacteria 7933
1491 Ga0268266_10024026 3300028379 Bacteria 5186
1492 Ga0268266_10045033 3300028379 Bacteria 3773
1493 Ga0268266_10064377 3300028379 Bacteria 3167
1494 Ga0268266_10072580 3300028379 Bacteria 2985
1495 Ga0268266_10079901 3300028379 Bacteria 2849
1496 Ga0268266_10273915 3300028379 Bacteria 1568
1497 Ga0268266_10346165 3300028379 Bacteria 1396
1498 Ga0268266_10508283 3300028379 Bacteria 1151
1499 Ga0268266_10554558 3300028379 Unclassified 1101
1500 Ga0268266_10581847 3300028379 Bacteria 1074
1501 Ga0268266_10835704 3300028379 Bacteria 890
1502 Ga0268266_11259377 3300028379 Bacteria 715
1503 Ga0268266_11964639 3300028379 Bacteria 559
1504 Ga0268265_10005462 3300028380 Bacteria 8686
1505 Ga0268265_10038432 3300028380 Bacteria 3521
1506 Ga0268265_10107741 3300028380 Bacteria 2267
1507 Ga0268265_10821694 3300028380 Bacteria 907
1508 Ga0268264_10028119 3300028381 Bacteria 4598
1509 Ga0268264_10069509 3300028381 Bacteria 2978
1510 Ga0268264_10138584 3300028381 Bacteria 2166
1511 Ga0268264_10307894 3300028381 Unclassified 1493
1512 Ga0268264_10658833 3300028381 Unclassified 1037
1513 Ga0268264_10676965 3300028381 Unclassified 1023
1514 Ga0268264_10716993 3300028381 Bacteria 994
1515 Ga0268264_11284742 3300028381 Bacteria 742
1516 Ga0268264_11982388 3300028381 Unclassified 591
1517 Ga0268264_12255397 3300028381 Bacteria 552
1518 Ga0265319_1001189 3300028563 Bacteria 16105
1519 Ga0265334_10122514 3300028573 Unclassified 929
1520 Ga0265318_10000394 3300028577 Bacteria 34111
1521 Ga0265318_10005472 3300028577 Bacteria 5963
1522 Ga0265318_10021336 3300028577 Bacteria 2601
1523 Ga0265318_10064003 3300028577 Bacteria 1368
1524 Ga0265323_10018816 3300028653 Bacteria 2669
1525 Ga0265322_10244707 3300028654 Unclassified 515
1526 Ga0265336_10055991 3300028666 Bacteria 1185
1527 Ga0265338_10008713 3300028800 Bacteria 12261
1528 Ga0265338_10011499 3300028800 Bacteria 10216
1529 Ga0265338_10014549 3300028800 Bacteria 8742
1530 Ga0265338_10060534 3300028800 Bacteria 3326
1531 Ga0265338_10109006 3300028800 Bacteria 2235
1532 Ga0265338_10116207 3300028800 Unclassified 2144
1533 Ga0265338_10136962 3300028800 Bacteria 1923
1534 Ga0265338_10145640 3300028800 Bacteria 1848
1535 Ga0265338_10225920 3300028800 Bacteria 1395
1536 Ga0265338_10253230 3300028800 Bacteria 1298
1537 Ga0265338_10356232 3300028800 Bacteria 1051
1538 Ga0265338_10422171 3300028800 Unclassified 948
1539 Ga0265338_11035448 3300028800 Bacteria 555
1540 Ga0265760_10010384 3300031090 Bacteria 2659
1541 Ga0265760_10040675 3300031090 Unclassified 1385
1542 Ga0265760_10119507 3300031090 Bacteria 845
1543 Ga0265760_10171008 3300031090 Unclassified 721
1544 Ga0265330_10000982 3300031235 Bacteria 17423
1545 Ga0265330_10001198 3300031235 Bacteria 15376
1546 Ga0265330_10087886 3300031235 Bacteria 1335
1547 Ga0265330_10159892 3300031235 Bacteria 957
1548 Ga0265330_10168233 3300031235 Unclassified 930
1549 Ga0265332_10008188 3300031238 Unclassified 4702
1550 Ga0265332_10018958 3300031238 Bacteria 3038
1551 Ga0265332_10033970 3300031238 Bacteria 2219
1552 Ga0265328_10021411 3300031239 Unclassified 2467
1553 Ga0265328_10085468 3300031239 Bacteria 1164
1554 Ga0265320_10000019 3300031240 Bacteria 183346
1555 Ga0265320_10086969 3300031240 Bacteria 1452
1556 Ga0265325_10000197 3300031241 Bacteria 43020
1557 Ga0265325_10000338 3300031241 Bacteria 33218
1558 Ga0265325_10003237 3300031241 Bacteria 10718
1559 Ga0265325_10006727 3300031241 Archaea 6955
1560 Ga0265325_10019057 3300031241 Bacteria 3799
1561 Ga0265325_10023575 3300031241 Bacteria 3357
1562 Ga0265325_10039083 3300031241 Bacteria 2500
1563 Ga0265325_10119370 3300031241 Bacteria 1273
1564 Ga0265325_10126169 3300031241 Bacteria 1230
1565 Ga0265325_10209458 3300031241 Unclassified 896
1566 Ga0265329_10000010 3300031242 Bacteria 73819
1567 Ga0265329_10075969 3300031242 Unclassified 1063
1568 Ga0265329_10121085 3300031242 Unclassified 839
1569 Ga0265340_10090178 3300031247 Bacteria 1434
1570 Ga0265340_10165139 3300031247 Bacteria 1004
1571 Ga0265340_10209379 3300031247 Unclassified 875
1572 Ga0265339_10000025 3300031249 Bacteria 169559
1573 Ga0265339_10001701 3300031249 Bacteria 16207
1574 Ga0265339_10018805 3300031249 Bacteria 4067
1575 Ga0265339_10021372 3300031249 Bacteria 3766
1576 Ga0265339_10033613 3300031249 Bacteria 2886
1577 Ga0265339_10042409 3300031249 Bacteria 2519
1578 Ga0265339_10055961 3300031249 Bacteria 2138
1579 Ga0265339_10086378 3300031249 Bacteria 1650
1580 Ga0265339_10106250 3300031249 Bacteria 1457
1581 Ga0265339_10219271 3300031249 Unclassified 931
1582 Ga0265339_10383116 3300031249 Unclassified 659
1583 Ga0265339_10438392 3300031249 Bacteria 607
1584 Ga0265331_10000028 3300031250 Bacteria 216539
1585 Ga0265331_10003298 3300031250 Bacteria 10494
1586 Ga0265331_10016230 3300031250 Bacteria 3914
1587 Ga0265316_10000092 3300031344 Bacteria 96395
1588 Ga0265316_10001094 3300031344 Bacteria 29360
1589 Ga0265316_10005678 3300031344 Bacteria 12069
1590 Ga0265316_10011953 3300031344 Bacteria 7802
1591 Ga0265316_10016793 3300031344 Bacteria 6337
1592 Ga0265316_10017213 3300031344 Bacteria 6253
1593 Ga0265316_10021441 3300031344 Bacteria 5471
1594 Ga0265316_10188077 3300031344 Bacteria 1535
1595 Ga0265316_10255681 3300031344 Bacteria 1285
1596 Ga0265316_10390648 3300031344 Bacteria 1003
1597 Ga0265316_11006997 3300031344 Unclassified 580
1598 Ga0265316_11230697 3300031344 Bacteria 518
1599 Ga0265316_11235776 3300031344 Unclassified 516
1600 Ga0265313_10000208 3300031595 Bacteria 63117
1601 Ga0265313_10000434 3300031595 Bacteria 44323
1602 Ga0265313_10003074 3300031595 Bacteria 13843
1603 Ga0265313_10010684 3300031595 Bacteria 5779
1604 Ga0265313_10033940 3300031595 Bacteria 2586
1605 Ga0265313_10122818 3300031595 Bacteria 1131
1606 Ga0265313_10124931 3300031595 Bacteria 1119
1607 Ga0265313_10138472 3300031595 Bacteria 1048
1608 Ga0265313_10187250 3300031595 Unclassified 867
1609 Ga0265313_10227235 3300031595 Unclassified 768
1610 Ga0265313_10368243 3300031595 Unclassified 567
1611 Ga0265314_10001131 3300031711 Bacteria 30899
1612 Ga0265314_10059832 3300031711 Bacteria 2603
1613 Ga0265314_10183231 3300031711 Bacteria 1252
1614 Ga0265314_10577818 3300031711 Bacteria 581
1615 Ga0265342_10000074 3300031712 Bacteria 106584
1616 Ga0265342_10000236 3300031712 Bacteria 61931
1617 Ga0265342_10000757 3300031712 Bacteria 33032
1618 Ga0265342_10000883 3300031712 Bacteria 29891
1619 Ga0265342_10028498 3300031712 Bacteria 3477
1620 Ga0265342_10029681 3300031712 Unclassified 3393
1621 Ga0265342_10030451 3300031712 Bacteria 3344
1622 Ga0265342_10044897 3300031712 Bacteria 2662
1623 Ga0265342_10076489 3300031712 Bacteria 1940
1624 Ga0265342_10209163 3300031712 Bacteria 1056
1625 Ga0316578_10602776 3300031728 Bacteria 643
1626 Ga0307405_10045681 3300031731 Bacteria 2686
1627 Ga0307413_10109210 3300031824 Bacteria 1848
1628 Ga0307410_11790927 3300031852 Bacteria 545
1629 Ga0307406_11106382 3300031901 Bacteria 684
1630 Ga0307407_10446110 3300031903 Bacteria 938
1631 Ga0307412_10522458 3300031911 Bacteria 992
1632 Ga0307409_100018671 3300031995 Bacteria 4671
1633 Ga0307409_100100117 3300031995 Bacteria 2402
1634 Ga0307414_10085137 3300032004 Bacteria 2328
1635 Ga0307411_10052293 3300032005 Bacteria 2670
1636 Ga0307415_100033729 3300032126 Bacteria 3325
1637 Ga0307415_100679672 3300032126 Bacteria 926
1638 Ga0307510_10085679 3300033180 Bacteria 3026
1639 Ga0316596_1079859 3300033541 Bacteria 879
1640 Ga0373948_0211148 3300034817 Bacteria 510
1641 Ga0373959_0035525 3300034820 Bacteria 1025
1642 Ga0373938_0234681 3300034957 Bacteria 519
1643 Ga0373926_0000590 3300035083 Bacteria 9804
1644 Ga0373926_0008226 3300035083 Unclassified 3472
1645 Ga0373928_0167799 3300035084 Bacteria 617
1646 Ga0373928_0168117 3300035084 Bacteria 617
1647 Ga0373929_0028648 3300035085 Bacteria 1177
1648 Ga0373934_0083563 3300035086 Unclassified 1284
1649 Ga0373940_0033797 3300035088 Unclassified 1377
1650 Ga0373944_0255152 3300035089 Bacteria 648
1651 Ga0373923_0001644 3300035111 Bacteria 6520
1652 Ga0373923_0013016 3300035111 Bacteria 3090
1653 Ga0373923_0351645 3300035111 Bacteria 704
1654 Ga0373932_0013065 3300035112 Bacteria 2058
1655 Ga0373932_0115040 3300035112 Bacteria 891
1656 Ga0373939_0036969 3300035114 Bacteria 1448
1657 Ga0373939_0042245 3300035114 Bacteria 1378
1658 Ga0373939_0313388 3300035114 Bacteria 629
1659 Ga0373941_0007336 3300035115 Bacteria 2695
1660 Ga0373941_0073860 3300035115 Bacteria 1138
1661 Ga0373945_0443407 3300035116 Bacteria 573
1662 Ga0373945_0520774 3300035116 Unclassified 531
1663 Ga0373954_0654138 3300035118 Bacteria 521
1664 Ga0373957_0347973 3300035120 Unclassified 633
1665 Ga0373960_0346973 3300035121 Bacteria 562
1666 Ga0373946_0365902 3300035171 Unclassified 723
1667 Ga0373955_0112482 3300035172 Unclassified 1575
1668 Ga0373955_0337423 3300035172 Bacteria 912
1669 Ga0373955_0805167 3300035172 Bacteria 578
1670 Ga0373955_1024685 3300035172 Unclassified 508
1671 Ga0373942_0025727 3300035207 Bacteria 1519
1672 Ga0373961_0290729 3300035241 Bacteria 602
1673 Ga0373962_0342870 3300035242 Bacteria 538
1674 Ga0373924_0060463 3300035410 Unclassified 1584
1675 Ga0373924_0113851 3300035410 Bacteria 1171
1676 Ga0373924_0252217 3300035410 Unclassified 781
1677 Ga0373931_0006143 3300035691 Bacteria 5598
1678 Ga0373931_0030272 3300035691 Bacteria 2785
1679 Ga0373931_0054992 3300035691 Bacteria 2129
1680 Ga0373931_0070227 3300035691 Bacteria 1910
1681 Ga0373931_0116012 3300035691 Bacteria 1525
1682 Ga0373931_0494378 3300035691 Bacteria 788
1683 Ga0373935_0001751 3300035692 Bacteria 12175
1684 Ga0373935_0006950 3300035692 Bacteria 6755
1685 Ga0373935_0584958 3300035692 Bacteria 816
1686 Ga0373935_0587658 3300035692 Bacteria 814
1687 Ga0373935_0730413 3300035692 Bacteria 729
1688 Ga0373927_0003077 3300035695 Bacteria 12095
1689 Ga0373927_0011498 3300035695 Bacteria 5897
1690 Ga0373933_0110681 3300035724 Bacteria 1713
1691 Ga0373933_0181696 3300035724 Unclassified 1342
1692 Ga0373933_0199882 3300035724 Unclassified 1279
1693 Ga0373933_0442054 3300035724 Unclassified 850
1694 Ga0373947_0019403 3300035725 Unclassified 3920
1695 Ga0373947_0054534 3300035725 Unclassified 2412
1696 Ga0373947_0217946 3300035725 Bacteria 1254
1697 Ga0373937_0020897 3300036401 Bacteria 5871
1698 Ga0373937_0056082 3300036401 Unclassified 3618
1699 Ga0373937_0237661 3300036401 Bacteria 1716
1700 Ga0373937_0458455 3300036401 Unclassified 1211
1701 Ga0373937_0996434 3300036401 Bacteria 787
1702 Ga0373937_1562192 3300036401 Bacteria 607
1703 Ga0373937_1614261 3300036401 Bacteria 596
1704 Ga0373925_0044083 3300037068 Bacteria 3312
1705 Ga0373925_0126209 3300037068 Unclassified 1991
1706 Ga0373925_0883010 3300037068 Bacteria 737
1707 Ga0395899_0622241 3300037312 Bacteria 685
1708 Ga0395900_0210569 3300037418 Bacteria 1963
1709 Ga0395900_1215979 3300037418 Unclassified 669
1710 Ga0395898_0011521 3300037466 Bacteria 9182
1711 Ga0395905_0004814 3300037471 Bacteria 13929
1712 Ga0395905_0536100 3300037471 Bacteria 1071
1713 Ga0436364_1498740 3300037853 Bacteria 1067
1714 Ga0395901_0013981 3300038443 Bacteria 8168
1715 Ga0242420_027410 3300038996 Bacteria 1044
1716 Ga0436365_0620187 3300039437 Unclassified 647
1717 Ga0436365_0987606 3300039437 Bacteria 5512
1718 Ga0436360_0084770 3300039438 Bacteria 911
1719 Ga0436360_0127249 3300039438 Bacteria 511
1720 Ga0436360_0161883 3300039438 Bacteria 14356
1721 Ga0436360_0294598 3300039438 Bacteria 743
1722 Ga0436360_0417422 3300039438 Bacteria 1598
1723 Ga0436360_1036151 3300039438 Bacteria 10193
1724 Ga0436361_0092825 3300039447 Bacteria 524
1725 Ga0436361_0190313 3300039447 Bacteria 2102
1726 Ga0436361_0297841 3300039447 Unclassified 546
1727 Ga0436361_0307406 3300039447 Bacteria 13409
1728 Ga0436361_0340747 3300039447 Bacteria 1861
1729 Ga0436361_0696344 3300039447 Bacteria 16797
1730 Ga0436361_0753515 3300039447 Bacteria 725
1731 Ga0436361_0964497 3300039447 Unclassified 621
1732 Ga0436363_1022683 3300039450 Bacteria 1319
1733 Ga0436363_1330865 3300039450 Bacteria 2022
1734 Ga0436363_1370807 3300039450 Unclassified 861
1735 Ga0436363_1371418 3300039450 Bacteria 2109
1736 Ga0436363_1670999 3300039450 Bacteria 821
1737 Ga0451839_0917702 3300041496 Unclassified 1185
1738 Ga0439448_0005158 3300042005 Bacteria 3718
1739 Ga0439448_0109968 3300042005 Bacteria 941
1740 Ga0439463_106542 3300042016 Bacteria 723
1741 Ga0451577_0087527 3300042876 Bacteria 2779
1742 Ga0453683_0144199 3300044673 Bacteria 1503
1743 Ga0453683_0447391 3300044673 Bacteria 835
1744 Ga0466966_0017437 3300044684 Bacteria 4745
1745 Ga0466961_0145000 3300044693 Bacteria 1485
1746 Ga0466963_0270734 3300044694 Bacteria 1193
1747 Ga0466963_0316956 3300044694 Bacteria 1097
1748 Ga0466963_0663895 3300044694 Bacteria 736
1749 Ga0466964_0585746 3300044706 Bacteria 610
1750 Ga0453684_0074070 3300044712 Bacteria 4289
1751 Ga0453684_2062107 3300044712 Unclassified 573
1752 Ga0466959_0103956 3300045049 Bacteria 2032
1753 Ga0466959_1023293 3300045049 Bacteria 550
1754 Ga0451576_0073884 3300045051 Bacteria 3548
1755 Ga0451576_0312156 3300045051 Bacteria 1645
1756 Ga0451576_0769788 3300045051 Unclassified 1011
1757 Ga0451576_1508552 3300045051 Bacteria 698
1758 Ga0451576_1732008 3300045051 Bacteria 647
1759 Ga0466958_0079703 3300045836 Unclassified 2014
1760 Ga0466967_0144534 3300045976 Bacteria 2218
1761 Ga0466967_0223948 3300045976 Bacteria 1789
1762 Ga0466967_0425611 3300045976 Bacteria 1295
1763 Ga0466967_1043058 3300045976 Bacteria 814
1764 Ga0466967_1165739 3300045976 Bacteria 768
1765 Ga0466967_1474979 3300045976 Unclassified 678
1766 Ga0466967_1909412 3300045976 Bacteria 591
1767 Ga0495592_0011212 3300046454 Bacteria 6775
1768 Ga0495592_0036721 3300046454 Unclassified 3689
1769 Ga0495592_0284476 3300046454 Unclassified 1080
1770 Ga0495603_0122093 3300046455 Bacteria 1518
1771 Ga0495629_0006654 3300046459 Bacteria 8553
1772 Ga0495629_0116230 3300046459 Bacteria 1864
1773 Ga0495629_0347915 3300046459 Bacteria 1011
1774 Ga0495638_0182404 3300046460 Bacteria 1197
1775 Ga0495638_0406266 3300046460 Bacteria 705
1776 Ga0495651_0000126 3300046462 Bacteria 56547
1777 Ga0495651_0000811 3300046462 Bacteria 24184
1778 Ga0495651_0001612 3300046462 Bacteria 17476
1779 Ga0495651_0007961 3300046462 Bacteria 8126
1780 Ga0495651_0009443 3300046462 Bacteria 7490
1781 Ga0495651_0038281 3300046462 Bacteria 3734
1782 Ga0495651_0148056 3300046462 Bacteria 1695
1783 Ga0495653_0019028 3300046463 Bacteria 5572
1784 Ga0495653_0032798 3300046463 Unclassified 4120
1785 Ga0495653_0038863 3300046463 Bacteria 3733
1786 Ga0495653_0101086 3300046463 Bacteria 2089
1787 Ga0495653_0110481 3300046463 Bacteria 1976
1788 Ga0495653_0531180 3300046463 Unclassified 730
1789 Ga0495650_0000038 3300046471 Bacteria 377530
1790 Ga0495650_0006759 3300046471 Bacteria 7093
1791 Ga0495580_0008492 3300046472 Bacteria 8167
1792 Ga0495580_0022118 3300046472 Unclassified 4684
1793 Ga0495580_0034827 3300046472 Bacteria 3623
1794 Ga0495580_0038206 3300046472 Bacteria 3440
1795 Ga0495580_0039802 3300046472 Bacteria 3363
1796 Ga0495580_0083582 3300046472 Bacteria 2224
1797 Ga0495580_0119089 3300046472 Unclassified 1833
1798 Ga0495580_0335591 3300046472 Bacteria 1026
1799 Ga0495580_0412200 3300046472 Bacteria 910
1800 Ga0495580_0805659 3300046472 Bacteria 609
1801 Ga0495582_0003388 3300046473 Bacteria 8971
1802 Ga0495582_0032500 3300046473 Bacteria 2869
1803 Ga0495582_0141284 3300046473 Bacteria 1365
1804 Ga0495582_0270656 3300046473 Bacteria 975
1805 Ga0495582_0288461 3300046473 Unclassified 943
1806 Ga0495582_0333190 3300046473 Bacteria 874
1807 Ga0495582_0372810 3300046473 Unclassified 822
1808 Ga0495582_0381966 3300046473 Bacteria 812
1809 Ga0495605_0480013 3300046474 Bacteria 510
1810 Ga0495639_0001954 3300046475 Bacteria 9140
1811 Ga0495639_0538793 3300046475 Unclassified 598
1812 Ga0495662_0001280 3300046476 Bacteria 12438
1813 Ga0495662_0125524 3300046476 Bacteria 1261
1814 Ga0495664_0009472 3300046477 Bacteria 5451
1815 Ga0495664_0035747 3300046477 Unclassified 2927
1816 Ga0495664_0058773 3300046477 Bacteria 2288
1817 Ga0495664_0092440 3300046477 Bacteria 1820
1818 Ga0495664_0103053 3300046477 Bacteria 1720
1819 Ga0495664_0108090 3300046477 Bacteria 1678
1820 Ga0495664_0300578 3300046477 Unclassified 969
1821 Ga0495664_0569227 3300046477 Unclassified 674
1822 Ga0495584_0043018 3300046491 Bacteria 2280
1823 Ga0495584_0086954 3300046491 Bacteria 1575
1824 Ga0495585_0100664 3300046492 Bacteria 1546
1825 Ga0495585_0192349 3300046492 Bacteria 1043
1826 Ga0495585_0336109 3300046492 Bacteria 736
1827 Ga0495594_0000395 3300046499 Bacteria 21937
1828 Ga0495594_0000883 3300046499 Bacteria 15463
1829 Ga0495594_0245182 3300046499 Bacteria 1021
1830 Ga0495594_0689832 3300046499 Bacteria 577
1831 Ga0495583_0016461 3300046506 Bacteria 3972
1832 Ga0495583_0070964 3300046506 Bacteria 1531
1833 Ga0495583_0081339 3300046506 Bacteria 1407
1834 Ga0495606_0060363 3300046507 Bacteria 2429
1835 Ga0495606_0316719 3300046507 Bacteria 839
1836 Ga0495608_0002780 3300046511 Bacteria 12557
1837 Ga0495608_0014164 3300046511 Bacteria 5533
1838 Ga0495608_0068360 3300046511 Unclassified 2323
1839 Ga0495608_0166204 3300046511 Bacteria 1401
1840 Ga0495610_0221920 3300046512 Bacteria 763
1841 Ga0495616_0053817 3300046513 Bacteria 1999
1842 Ga0495618_0131744 3300046514 Bacteria 1599
1843 Ga0495618_0190200 3300046514 Unclassified 1302
1844 Ga0495628_0002365 3300046516 Bacteria 17026
1845 Ga0495628_0002992 3300046516 Bacteria 15147
1846 Ga0495628_0006375 3300046516 Bacteria 10310
1847 Ga0495628_0015511 3300046516 Bacteria 6363
1848 Ga0495628_0018771 3300046516 Bacteria 5725
1849 Ga0495628_0028060 3300046516 Bacteria 4577
1850 Ga0495628_0038578 3300046516 Unclassified 3823
1851 Ga0495628_0185669 3300046516 Bacteria 1571
1852 Ga0495628_0389584 3300046516 Unclassified 1019
1853 Ga0495628_0883172 3300046516 Bacteria 621
1854 Ga0495630_0026462 3300046517 Unclassified 4295
1855 Ga0495630_0069009 3300046517 Unclassified 2659
1856 Ga0495630_0165903 3300046517 Bacteria 1681
1857 Ga0495630_0354317 3300046517 Bacteria 1123
1858 Ga0495630_0394134 3300046517 Unclassified 1061
1859 Ga0495630_0398065 3300046517 Unclassified 1055
1860 Ga0495630_0524694 3300046517 Bacteria 908
1861 Ga0495630_0604466 3300046517 Unclassified 840
1862 Ga0495630_0972771 3300046517 Unclassified 645
1863 Ga0495632_0109131 3300046519 Bacteria 1300
1864 Ga0495663_0184935 3300046525 Bacteria 723
1865 Ga0495666_0000810 3300046526 Bacteria 14490
1866 Ga0495666_0037434 3300046526 Unclassified 2360
1867 Ga0495642_0179715 3300046528 Bacteria 921
1868 Ga0495652_0001558 3300046529 Bacteria 25097
1869 Ga0495652_0004388 3300046529 Bacteria 13489
1870 Ga0495652_0005489 3300046529 Bacteria 11944
1871 Ga0495652_0007766 3300046529 Bacteria 9859
1872 Ga0495652_0008023 3300046529 Bacteria 9680
1873 Ga0495652_0061067 3300046529 Bacteria 3183
1874 Ga0495652_0104318 3300046529 Bacteria 2293
1875 Ga0495652_0641662 3300046529 Bacteria 720
1876 Ga0495652_0996912 3300046529 Bacteria 548
1877 Ga0495665_0000528 3300046531 Bacteria 19349
1878 Ga0495665_0002595 3300046531 Bacteria 9747
1879 Ga0495665_0035102 3300046531 Unclassified 2680
1880 Ga0495665_0332577 3300046531 Bacteria 775
1881 Ga0495665_0494353 3300046531 Unclassified 616
1882 Ga0495665_0617814 3300046531 Bacteria 541
1883 Ga0495640_0007633 3300046533 Bacteria 8502
1884 Ga0495640_0020406 3300046533 Bacteria 4876
1885 Ga0495640_0051762 3300046533 Unclassified 2822
1886 Ga0495640_0188749 3300046533 Bacteria 1311
1887 Ga0495640_0330388 3300046533 Bacteria 943
1888 Ga0495586_0001563 3300046535 Bacteria 12634
1889 Ga0495586_0002392 3300046535 Bacteria 10193
1890 Ga0495586_0003622 3300046535 Bacteria 8276
1891 Ga0495586_0035722 3300046535 Bacteria 2670
1892 Ga0495586_0260286 3300046535 Unclassified 991
1893 Ga0495586_0318852 3300046535 Bacteria 891
1894 Ga0495587_0003845 3300046536 Bacteria 9963
1895 Ga0495587_0008849 3300046536 Bacteria 6461
1896 Ga0495587_0050541 3300046536 Bacteria 2460
1897 Ga0495587_0062291 3300046536 Unclassified 2185
1898 Ga0495587_0188617 3300046536 Bacteria 1168
1899 Ga0495597_0113612 3300046542 Bacteria 1134
1900 Ga0495645_0002780 3300046543 Bacteria 11868
1901 Ga0495645_0014391 3300046543 Bacteria 5613
1902 Ga0495645_0014486 3300046543 Bacteria 5596
1903 Ga0495645_0073648 3300046543 Bacteria 2460
1904 Ga0495645_0086349 3300046543 Unclassified 2245
1905 Ga0495645_0116157 3300046543 Unclassified 1889
1906 Ga0495645_0124885 3300046543 Bacteria 1809
1907 Ga0495645_0187975 3300046543 Bacteria 1410
1908 Ga0495645_0398573 3300046543 Bacteria 877
1909 Ga0495645_0539698 3300046543 Bacteria 724
1910 Ga0495622_0406112 3300046557 Bacteria 586
1911 Ga0495667_0000405 3300046559 Bacteria 27690
1912 Ga0495667_0000531 3300046559 Bacteria 24376
1913 Ga0495667_0014467 3300046559 Bacteria 5331
1914 Ga0495667_0028890 3300046559 Bacteria 3733
1915 Ga0495667_0052279 3300046559 Unclassified 2692
1916 Ga0495667_0132603 3300046559 Unclassified 1607
1917 Ga0495667_0140847 3300046559 Unclassified 1554
1918 Ga0495667_0276525 3300046559 Bacteria 1066
1919 Ga0495667_0307440 3300046559 Bacteria 1004
1920 Ga0495667_0450525 3300046559 Unclassified 809
1921 Ga0495667_0765047 3300046559 Bacteria 597
1922 Ga0495656_0421037 3300046615 Bacteria 701
1923 Ga0495668_0052867 3300046616 Bacteria 2247
1924 Ga0495634_0008727 3300046642 Bacteria 7516
1925 Ga0495634_0134684 3300046642 Bacteria 1572
1926 Ga0495634_0189402 3300046642 Unclassified 1284
1927 Ga0495634_0362461 3300046642 Bacteria 866
1928 Ga0495634_0663052 3300046642 Bacteria 602
1929 Ga0495625_0002916 3300046660 Bacteria 17877
1930 Ga0495625_0039604 3300046660 Bacteria 3440
1931 Ga0495625_0114010 3300046660 Bacteria 1845
1932 Ga0495625_0304577 3300046660 Bacteria 1018
1933 Ga0495635_0008384 3300046663 Bacteria 7214
1934 Ga0495635_0011585 3300046663 Bacteria 6181
1935 Ga0495635_0067774 3300046663 Unclassified 2447
1936 Ga0495635_0235504 3300046663 Bacteria 1236
1937 Ga0495635_0275036 3300046663 Bacteria 1132
1938 Ga0495635_0276602 3300046663 Bacteria 1128
1939 Ga0495588_0174182 3300046674 Bacteria 1138
1940 Ga0495588_0232053 3300046674 Bacteria 974
1941 Ga0495657_0002645 3300046675 Bacteria 14975
1942 Ga0495657_0020289 3300046675 Bacteria 4780
1943 Ga0495657_0028816 3300046675 Archaea 3900
1944 Ga0495657_0040181 3300046675 Unclassified 3210
1945 Ga0495657_0282249 3300046675 Unclassified 993
1946 Ga0495599_0004912 3300046678 Bacteria 7944
1947 Ga0495599_0046201 3300046678 Unclassified 2730
1948 Ga0495599_0169005 3300046678 Bacteria 1350
1949 Ga0495599_0224172 3300046678 Bacteria 1149
1950 Ga0495599_0303923 3300046678 Unclassified 963
1951 Ga0495599_0421251 3300046678 Bacteria 793
1952 Ga0495599_0601234 3300046678 Unclassified 640
1953 Ga0495623_0002161 3300046679 Bacteria 13126
1954 Ga0495623_0003440 3300046679 Bacteria 10472
1955 Ga0495623_0016316 3300046679 Bacteria 4798
1956 Ga0495646_0004076 3300046680 Bacteria 9168
1957 Ga0495646_0046178 3300046680 Unclassified 2656
1958 Ga0495646_0046723 3300046680 Bacteria 2638
1959 Ga0495646_0124688 3300046680 Bacteria 1454
1960 Ga0495647_0047650 3300046681 Bacteria 1655
1961 Ga0495669_0421991 3300046684 Bacteria 647
1962 Ga0495613_0004130 3300046689 Bacteria 10864
1963 Ga0495613_0038032 3300046689 Bacteria 3567
1964 Ga0495613_0060170 3300046689 Unclassified 2782
1965 Ga0495613_0071418 3300046689 Bacteria 2531
1966 Ga0495613_0090638 3300046689 Bacteria 2214
1967 Ga0495613_0135104 3300046689 Bacteria 1765
1968 Ga0495613_0319476 3300046689 Bacteria 1072
1969 Ga0495613_0345747 3300046689 Unclassified 1022
1970 Ga0495613_0392001 3300046689 Unclassified 948
1971 Ga0495624_0003027 3300046690 Bacteria 12587
1972 Ga0495624_0004591 3300046690 Bacteria 10078
1973 Ga0495624_0734767 3300046690 Bacteria 585
1974 Ga0495624_0776566 3300046690 Bacteria 567
1975 Ga0495670_0392847 3300046691 Unclassified 749
1976 Ga0495649_0007234 3300046694 Bacteria 6800
1977 Ga0495649_0191087 3300046694 Bacteria 1066
1978 Ga0495649_0273977 3300046694 Bacteria 863
1979 Ga0495649_0274626 3300046694 Bacteria 862
1980 Ga0495589_0069623 3300046794 Bacteria 1721
1981 Ga0495589_0370357 3300046794 Bacteria 659
1982 Ga0495600_0000532 3300046809 Bacteria 19789
1983 Ga0495600_0050474 3300046809 Bacteria 2715
1984 Ga0495600_0080903 3300046809 Bacteria 2120
1985 Ga0495600_0452199 3300046809 Bacteria 794
1986 Ga0495581_0012382 3300047315 Bacteria 4941
1987 Ga0495581_0480264 3300047315 Unclassified 723
1988 Ga0495581_0682842 3300047315 Unclassified 593
1989 Ga0495581_0856895 3300047315 Unclassified 520
1990 Ga0495604_0000485 3300047317 Bacteria 34892
1991 Ga0495604_0003584 3300047317 Bacteria 12371
1992 Ga0495604_0015963 3300047317 Bacteria 5995
1993 Ga0495604_0020087 3300047317 Bacteria 5339
1994 Ga0495604_0021328 3300047317 Bacteria 5171
1995 Ga0495604_0033224 3300047317 Bacteria 4084
1996 Ga0495604_0187869 3300047317 Bacteria 1442
1997 Ga0495604_0245130 3300047317 Unclassified 1223
1998 Ga0495604_0250773 3300047317 Bacteria 1207
1999 Ga0495604_0766648 3300047317 Unclassified 609
2000 Ga0495604_0779029 3300047317 Unclassified 603
2001 Ga0495674_0005644 3300047319 Bacteria 11981
2002 Ga0495674_0006959 3300047319 Bacteria 10820
2003 Ga0495674_0016535 3300047319 Bacteria 6884
2004 Ga0495674_0017768 3300047319 Bacteria 6622
2005 Ga0495674_0019627 3300047319 Bacteria 6272
2006 Ga0495674_0038007 3300047319 Bacteria 4324
2007 Ga0495674_0052634 3300047319 Bacteria 3581
2008 Ga0495674_0108464 3300047319 Bacteria 2355
2009 Ga0495674_0111492 3300047319 Unclassified 2318
2010 Ga0495674_0126982 3300047319 Unclassified 2151
2011 Ga0495674_0141476 3300047319 Bacteria 2022
2012 Ga0495674_0227305 3300047319 Bacteria 1541
2013 Ga0495674_0277138 3300047319 Bacteria 1375
2014 Ga0495674_0363225 3300047319 Bacteria 1173
2015 Ga0495674_1039512 3300047319 Bacteria 626
2016 Ga0495676_0005277 3300047321 Bacteria 11829
2017 Ga0495676_0269100 3300047321 Unclassified 1157
2018 Ga0495676_0289859 3300047321 Unclassified 1106
2019 Ga0495680_0002495 3300047322 Bacteria 18808
2020 Ga0495680_0002614 3300047322 Bacteria 18322
2021 Ga0495680_0007678 3300047322 Bacteria 9850
2022 Ga0495680_0024503 3300047322 Bacteria 5005
2023 Ga0495680_0044450 3300047322 Unclassified 3512
2024 Ga0495680_0619488 3300047322 Unclassified 722
2025 Ga0495680_0637149 3300047322 Unclassified 710
2026 Ga0495683_0070080 3300047323 Bacteria 1722
2027 Ga0495683_0106793 3300047323 Bacteria 1340
2028 Ga0495675_0000052 3300047444 Bacteria 79959
2029 Ga0495675_0003417 3300047444 Bacteria 9564
2030 Ga0495675_0008394 3300047444 Bacteria 6396
2031 Ga0495675_0012542 3300047444 Bacteria 5333
2032 Ga0495675_0014507 3300047444 Bacteria 4980
2033 Ga0495675_0198921 3300047444 Unclassified 1220
2034 Ga0495675_0252268 3300047444 Unclassified 1059
2035 Ga0495675_0482552 3300047444 Bacteria 714
2036 Ga0495673_0088976 3300047469 Bacteria 1265
2037 Ga0495684_0001568 3300047471 Bacteria 18313
2038 Ga0495684_0004732 3300047471 Bacteria 10630
2039 Ga0495684_0008544 3300047471 Bacteria 7930
2040 Ga0495684_0011987 3300047471 Bacteria 6684
2041 Ga0495684_0022420 3300047471 Bacteria 4859
2042 Ga0495684_0059419 3300047471 Unclassified 2911
2043 Ga0495684_0068917 3300047471 Unclassified 2689
2044 Ga0495684_0324696 3300047471 Bacteria 1099
2045 Ga0495684_0397246 3300047471 Unclassified 969
2046 Ga0495684_0629986 3300047471 Unclassified 720
2047 Ga0495686_0007930 3300047472 Bacteria 7882
2048 Ga0495686_0080325 3300047472 Bacteria 1993
2049 Ga0495686_0672154 3300047472 Bacteria 530
2050 Ga0495593_0002284 3300047673 Bacteria 11483
2051 Ga0495593_0016562 3300047673 Unclassified 4156
2052 Ga0495593_0322545 3300047673 Unclassified 772
2053 Ga0495602_0036602 3300048088 Unclassified 4565
2054 Ga0495602_0050354 3300048088 Unclassified 3722
2055 Ga0495602_0069298 3300048088 Bacteria 3024
2056 Ga0495602_0148069 3300048088 Unclassified 1849
2057 Ga0495602_0280879 3300048088 Bacteria 1227
2058 Ga0495602_0568883 3300048088 Unclassified 783
2059 Ga0495614_0001902 3300048089 Bacteria 9161
2060 Ga0495614_0011116 3300048089 Unclassified 3961
2061 Ga0495614_0036592 3300048089 Bacteria 2107
2062 Ga0495614_0181402 3300048089 Unclassified 947
2063 Ga0496100_0007601 3300048903 Bacteria 5992
2064 Ga0496100_0029040 3300048903 Bacteria 3416
2065 Ga0496100_0061559 3300048903 Bacteria 2473
2066 Ga0496100_0154076 3300048903 Bacteria 1642
2067 Ga0496100_0324730 3300048903 Bacteria 1157
2068 Ga0496100_0931766 3300048903 Bacteria 683
2069 Ga0496100_1131048 3300048903 Unclassified 617
2070 Ga0496101_0002089 3300048904 Bacteria 12162
2071 Ga0496101_0052756 3300048904 Bacteria 2932
2072 Ga0496101_0104226 3300048904 Bacteria 2127
2073 Ga0496101_0250462 3300048904 Unclassified 1380
2074 Ga0496101_0627423 3300048904 Bacteria 849
2075 Ga0496101_0724387 3300048904 Unclassified 785
2076 Ga0496101_0785465 3300048904 Bacteria 751
2077 Ga0496101_1014760 3300048904 Bacteria 652
2078 Ga0496101_1029425 3300048904 Unclassified 647
2079 Ga0496102_0016235 3300048905 Bacteria 6506
2080 Ga0496102_0020787 3300048905 Bacteria 5801
2081 Ga0496102_0038436 3300048905 Unclassified 4319
2082 Ga0496102_0098401 3300048905 Bacteria 2714
2083 Ga0496102_0529950 3300048905 Bacteria 1100
2084 Ga0496102_0555868 3300048905 Bacteria 1070
2085 Ga0496102_1009786 3300048905 Bacteria 752
2086 Ga0496103_0008849 3300048906 Bacteria 5971
2087 Ga0496103_0008856 3300048906 Bacteria 5968
2088 Ga0496103_0026334 3300048906 Bacteria 3521
2089 Ga0496103_0159917 3300048906 Bacteria 1444
2090 Ga0496103_0263269 3300048906 Bacteria 1109
2091 Ga0496103_0403411 3300048906 Bacteria 878
2092 Ga0496104_0010970 3300048907 Bacteria 8107
2093 Ga0496104_0018250 3300048907 Bacteria 6399
2094 Ga0496104_0043933 3300048907 Bacteria 4198
2095 Ga0496104_0071634 3300048907 Bacteria 3295
2096 Ga0496104_0094575 3300048907 Bacteria 2859
2097 Ga0496104_0127483 3300048907 Bacteria 2444
2098 Ga0496104_0151160 3300048907 Bacteria 2228
2099 Ga0496104_0393359 3300048907 Bacteria 1298
2100 Ga0496104_0534404 3300048907 Bacteria 1083
2101 Ga0496104_0625202 3300048907 Bacteria 986
2102 Ga0496104_0854807 3300048907 Bacteria 815
2103 Ga0496104_1823923 3300048907 Unclassified 510
2104 Ga0496105_0014746 3300048908 Bacteria 6221
2105 Ga0496105_0047425 3300048908 Bacteria 3545
2106 Ga0496105_0081353 3300048908 Bacteria 2675
2107 Ga0496105_0085574 3300048908 Bacteria 2605
2108 Ga0496105_0192182 3300048908 Bacteria 1668
2109 Ga0496105_0397245 3300048908 Bacteria 1095
2110 Ga0496106_0000863 3300048909 Bacteria 22031
2111 Ga0496106_0017625 3300048909 Bacteria 5283
2112 Ga0496106_0059652 3300048909 Bacteria 2890
2113 Ga0496106_0067384 3300048909 Bacteria 2729
2114 Ga0496106_0067877 3300048909 Bacteria 2719
2115 Ga0496106_0170426 3300048909 Bacteria 1725
2116 Ga0496106_0444250 3300048909 Bacteria 1042
2117 Ga0496106_1049573 3300048909 Bacteria 640
2118 Ga0496107_0000335 3300048910 Bacteria 25483
2119 Ga0496107_0128643 3300048910 Unclassified 1869
2120 Ga0496107_0152542 3300048910 Bacteria 1709
2121 Ga0496107_0161917 3300048910 Bacteria 1658
2122 Ga0496107_0353762 3300048910 Bacteria 1093
2123 Ga0496107_0382180 3300048910 Bacteria 1047
2124 Ga0496107_0887245 3300048910 Bacteria 650
2125 Ga0496108_0028874 3300048911 Bacteria 4590
2126 Ga0496108_0430852 3300048911 Bacteria 1152
2127 Ga0496109_0021621 3300048912 Bacteria 5691
2128 Ga0496109_0054159 3300048912 Bacteria 3659
2129 Ga0496109_0120590 3300048912 Bacteria 2443
2130 Ga0496109_0464332 3300048912 Unclassified 1195
2131 Ga0496109_1232237 3300048912 Bacteria 685
2132 Ga0496109_1587858 3300048912 Bacteria 589
2133 Ga0496110_0111670 3300048913 Unclassified 2457
2134 Ga0496110_0373870 3300048913 Bacteria 1298
2135 Ga0496110_0453810 3300048913 Unclassified 1168
2136 Ga0496110_0497867 3300048913 Bacteria 1110
2137 Ga0496110_0619269 3300048913 Bacteria 981
2138 Ga0496110_0781326 3300048913 Bacteria 859
2139 Ga0496111_0022443 3300048914 Bacteria 4419
2140 Ga0496111_0194491 3300048914 Bacteria 1508
2141 Ga0496111_0235601 3300048914 Unclassified 1359
2142 Ga0496112_0020896 3300048915 Bacteria 6214
2143 Ga0496112_0068925 3300048915 Unclassified 3494
2144 Ga0496112_0226683 3300048915 Bacteria 1824
2145 Ga0496112_0281806 3300048915 Unclassified 1609
2146 Ga0496112_0608526 3300048915 Bacteria 1024
2147 Ga0496112_0718331 3300048915 Bacteria 926
2148 Ga0496112_0752524 3300048915 Bacteria 900
2149 Ga0496112_0872792 3300048915 Unclassified 822
2150 Ga0496112_0942296 3300048915 Bacteria 784
2151 Ga0496112_1208920 3300048915 Bacteria 672
2152 Ga0496112_1478034 3300048915 Bacteria 593
2153 Ga0496113_0054462 3300048916 Bacteria 2995
2154 Ga0496113_0193852 3300048916 Bacteria 1613
2155 Ga0496113_0194230 3300048916 Bacteria 1612
2156 Ga0496113_0685314 3300048916 Bacteria 818
2157 Ga0496114_0001714 3300048917 Bacteria 16643
2158 Ga0496114_0047247 3300048917 Bacteria 3580
2159 Ga0496114_0051397 3300048917 Bacteria 3431
2160 Ga0496114_0327732 3300048917 Bacteria 1353
2161 Ga0496114_1513758 3300048917 Bacteria 559
2162 Ga0496115_0019333 3300048918 Bacteria 5240
2163 Ga0496115_0041560 3300048918 Bacteria 3659
2164 Ga0496115_0106514 3300048918 Bacteria 2301
2165 Ga0496115_1162299 3300048918 Unclassified 582
2166 Ga0496120_0254803 3300048923 Bacteria 822
2167 Ga0496126_0000004 3300048929 Bacteria 925026
2168 Ga0496126_0000770 3300048929 Bacteria 57986
2169 Ga0496126_0010867 3300048929 Bacteria 9487
2170 Ga0495682_0026280 3300049460 Bacteria 2162
2171 Ga0495682_0071017 3300049460 Bacteria 1253
2172 Ga0501295_017782 3300049518 Bacteria 1254
2173 Ga0501311_060812 3300049527 Bacteria 610
2174 Ga0501312_032476 3300049528 Bacteria 824
2175 Ga0501031_0098143 3300049568 Bacteria 1912
2176 Ga0501031_0115471 3300049568 Bacteria 1754
2177 Ga0501031_0240935 3300049568 Bacteria 1176
2178 Ga0501031_0276266 3300049568 Bacteria 1090
2179 Ga0501031_0556249 3300049568 Bacteria 739
2180 Ga0501031_0821416 3300049568 Bacteria 596
2181 Ga0501032_0123645 3300049569 Bacteria 1710
2182 Ga0501032_0166955 3300049569 Bacteria 1444
2183 Ga0501033_0167382 3300049570 Bacteria 1580
2184 Ga0501036_0137059 3300049572 Bacteria 2066
2185 Ga0501036_0196013 3300049572 Bacteria 1699
2186 Ga0501036_0758565 3300049572 Bacteria 800
2187 Ga0501036_1185812 3300049572 Bacteria 622
2188 Ga0501036_1312112 3300049572 Bacteria 588
2189 Ga0501036_1378618 3300049572 Bacteria 572
2190 Ga0501037_0188200 3300049573 Bacteria 1462
2191 Ga0501038_0165646 3300049574 Bacteria 1793
2192 Ga0501038_0224378 3300049574 Bacteria 1498
2193 Ga0501038_0292395 3300049574 Bacteria 1280
2194 Ga0501038_0294434 3300049574 Bacteria 1275
2195 Ga0501038_0801696 3300049574 Bacteria 700
2196 Ga0501039_0229855 3300049575 Bacteria 1458
2197 Ga0501039_0685983 3300049575 Bacteria 801
2198 Ga0501039_0755135 3300049575 Bacteria 759
2199 Ga0501039_0970668 3300049575 Bacteria 661
2200 Ga0501040_0051676 3300049576 Bacteria 2812
2201 Ga0501040_0472963 3300049576 Bacteria 903
2202 Ga0501040_0670789 3300049576 Bacteria 749
2203 Ga0501040_1234028 3300049576 Bacteria 542
2204 Ga0501041_0015485 3300049577 Bacteria 4529
2205 Ga0501041_0040540 3300049577 Bacteria 2827
2206 Ga0501041_0253893 3300049577 Bacteria 1105
2207 Ga0501041_0391432 3300049577 Bacteria 880
2208 Ga0501041_0682442 3300049577 Bacteria 657
2209 Ga0501042_0057102 3300049578 Bacteria 2786
2210 Ga0501042_0062154 3300049578 Bacteria 2668
2211 Ga0501042_0104537 3300049578 Bacteria 2038
2212 Ga0501042_0550399 3300049578 Bacteria 839
2213 Ga0501043_0239742 3300049579 Bacteria 1399
2214 Ga0501043_0286126 3300049579 Bacteria 1263
2215 Ga0501043_0906633 3300049579 Bacteria 632
2216 Ga0501043_1054921 3300049579 Bacteria 576
2217 Ga0501046_0204496 3300049580 Bacteria 1468
2218 Ga0501046_0388470 3300049580 Bacteria 1009
2219 Ga0501046_0621448 3300049580 Bacteria 765
2220 Ga0501046_0836527 3300049580 Bacteria 644
2221 Ga0501047_0147313 3300049581 Bacteria 2230
2222 Ga0501048_0087289 3300049582 Bacteria 2201
2223 Ga0501048_0557053 3300049582 Bacteria 823
2224 Ga0501048_0726503 3300049582 Bacteria 713
2225 Ga0501067_0205867 3300049583 Bacteria 1096
2226 Ga0501070_0078965 3300049586 Bacteria 2723
2227 Ga0501070_0602490 3300049586 Bacteria 876
2228 Ga0501071_0052272 3300049587 Bacteria 2946
2229 Ga0501071_0517177 3300049587 Bacteria 916
2230 Ga0501071_1360203 3300049587 Bacteria 548
2231 Ga0501072_0196262 3300049588 Bacteria 1610
2232 Ga0501072_0336896 3300049588 Bacteria 1198
2233 Ga0501072_1093998 3300049588 Bacteria 620
2234 Ga0501073_0034581 3300049589 Bacteria 3596
2235 Ga0501073_0076495 3300049589 Bacteria 2329
2236 Ga0501073_0387833 3300049589 Bacteria 965
2237 Ga0501074_0104380 3300049590 Bacteria 2029
2238 Ga0501074_0173668 3300049590 Bacteria 1538
2239 Ga0501074_1039204 3300049590 Bacteria 576
2240 Ga0501074_1305152 3300049590 Bacteria 509
2241 Ga0501075_0379676 3300049591 Bacteria 1077
2242 Ga0501075_0397727 3300049591 Bacteria 1050
2243 Ga0501075_1485494 3300049591 Bacteria 513
2244 Ga0501076_0068609 3300049592 Bacteria 2832
2245 Ga0501076_0198781 3300049592 Bacteria 1637
2246 Ga0501076_0241742 3300049592 Bacteria 1477
2247 Ga0501076_0268516 3300049592 Bacteria 1397
2248 Ga0501076_0761333 3300049592 Bacteria 799
2249 Ga0501077_0074786 3300049593 Bacteria 2145
2250 Ga0501077_0523648 3300049593 Bacteria 760
2251 Ga0501077_0759049 3300049593 Bacteria 624
2252 Ga0501077_0879319 3300049593 Bacteria 576
2253 Ga0501216_087684 3300049660 Bacteria 668
2254 Ga0501249_016405 3300049679 Bacteria 1591
2255 Ga0501079_0373748 3300049741 Bacteria 1117
2256 Ga0501080_0210324 3300049742 Bacteria 1783
2257 Ga0501080_0308003 3300049742 Bacteria 1436
2258 Ga0501080_0698019 3300049742 Bacteria 895
2259 Ga0501080_0705672 3300049742 Bacteria 890
2260 Ga0501081_0051625 3300049743 Bacteria 2835
2261 Ga0501081_0239298 3300049743 Bacteria 1323
2262 Ga0501081_0345231 3300049743 Bacteria 1096
2263 Ga0501083_0119421 3300049744 Bacteria 1730
2264 Ga0501083_0307903 3300049744 Bacteria 1030
2265 Ga0501266_059993 3300049763 Bacteria 606
2266 Ga0501272_041591 3300049769 Bacteria 615
2267 Ga0501035_0102424 3300049822 Bacteria 2511
2268 Ga0501035_0502323 3300049822 Bacteria 998
2269 Ga0501035_0683690 3300049822 Bacteria 829
2270 Ga0501035_0842940 3300049822 Bacteria 730
2271 Ga0501044_0176181 3300049823 Bacteria 2107
2272 Ga0501044_0715575 3300049823 Bacteria 886
2273 Ga0501045_0057169 3300049824 Bacteria 2854
2274 Ga0501045_0213780 3300049824 Bacteria 1436
2275 Ga0501045_0611379 3300049824 Bacteria 807
2276 nmdc:mga05p37_1023337_c1 3300050507 Bacteria 875
2277 nmdc:mga05p37_137341_c1 3300050507 Bacteria 2997
2278 nmdc:mga05p37_408816_c1 3300050507 Bacteria 1583
2279 nmdc:mga05p37_794116_c1 3300050507 Bacteria 1037
2280 nmdc:mga05p37_84017_c1 3300050507 Bacteria 3923
2281 nmdc:mga09592_256597_c1 3300050508 Bacteria 1516
2282 nmdc:mga09592_53592_c1 3300050508 Bacteria 3406
2283 nmdc:mga09592_639785_c1 3300050508 Bacteria 909
2284 nmdc:mga0qj67_581855_c1 3300050509 Bacteria 896
2285 nmdc:mga0qj67_81500_c1 3300050509 Bacteria 2594
2286 nmdc:mga06r32_114685_c1 3300050510 Bacteria 2653
2287 nmdc:mga06r32_464495_c1 3300050510 Bacteria 1245
2288 nmdc:mga08y16_419572_c1 3300050511 Bacteria 1368
2289 nmdc:mga08y16_759004_c1 3300050511 Bacteria 966
2290 nmdc:mga0n895_1018405_c1 3300050512 Bacteria 809
2291 nmdc:mga0n895_103_c1 3300050512 Bacteria 49967
2292 nmdc:mga0n895_233_c1 3300050512 Bacteria 35314
2293 nmdc:mga0n895_43795_c1 3300050512 Bacteria 4363
2294 nmdc:mga0n895_63955_c1 3300050512 Bacteria 3639
2295 nmdc:mga0rr50_101056_c1 3300050513 Bacteria 2266
2296 nmdc:mga0rr50_1224010_c1 3300050513 Bacteria 638
2297 nmdc:mga0rr50_337766_c1 3300050513 Unclassified 1265
2298 nmdc:mga0rr50_350402_c1 3300050513 Bacteria 1242
2299 nmdc:mga0rr50_436909_c1 3300050513 Unclassified 1108
2300 nmdc:mga0rr50_493_c1 3300050513 Bacteria 21017
2301 nmdc:mga08x19_12489_c1 3300050514 Bacteria 5119
2302 nmdc:mga08x19_23477_c1 3300050514 Bacteria 3826
2303 nmdc:mga08x19_259901_c1 3300050514 Unclassified 1200
2304 nmdc:mga08x19_64753_c1 3300050514 Bacteria 2373
2305 nmdc:mga0a205_171_c1 3300050515 Bacteria 43456
2306 nmdc:mga0a205_21442_c1 3300050515 Bacteria 6111
2307 nmdc:mga0a205_270691_c1 3300050515 Bacteria 1575
2308 nmdc:mga0a205_349732_c1 3300050515 Bacteria 1346
2309 nmdc:mga0a205_57633_c1 3300050515 Bacteria 3227
2310 nmdc:mga0a205_697251_c1 3300050515 Bacteria 865
2311 nmdc:mga0a205_949559_c1 3300050515 Bacteria 707
2312 Ga0495601_0004254 3300053077 Bacteria 8269
2313 Ga0495601_0225537 3300053077 Bacteria 1224
2314 Ga0495601_0531209 3300053077 Unclassified 758
2315 Ga0495612_0001587 3300053078 Bacteria 9376
2316 Ga0495612_0011361 3300053078 Unclassified 3589
2317 Ga0495612_0357546 3300053078 Bacteria 660
2318 Ga0495612_0423433 3300053078 Bacteria 607
2319 Ga0495655_0000429 3300053083 Bacteria 7104
2320 Ga0495619_0039417 3300053085 Bacteria 3084
2321 Ga0495619_0297264 3300053085 Bacteria 1119
2322 Ga0500643_042192 3300053087 Bacteria 1336
2323 Ga0500651_0000005 3300053093 Bacteria 384761
2324 Ga0500595_000011 3300053119 Bacteria 268589
2325 Ga0501084_0039274 3300054114 Bacteria 3959
2326 Ga0501084_0645739 3300054114 Bacteria 893
2327 Ga0501084_0665742 3300054114 Bacteria 879
2328 Ga0501084_0789770 3300054114 Bacteria 800
2329 Ga0501084_1243521 3300054114 Bacteria 624
2330 Ga0501084_1878385 3300054114 Bacteria 500
2331 Ga0587080_049109 3300059503 Unclassified 792
2332 Ga0587082_072414 3300059504 Bacteria 703
2333 Ga0587083_0017438 3300059505 Bacteria 1284
2334 Ga0587083_0035865 3300059505 Bacteria 1013
2335 Ga0587085_035212 3300059506 Bacteria 845
2336 Ga0587086_007380 3300059507 Bacteria 1258
2337 Ga0587088_047426 3300059508 Bacteria 830
2338 Ga0587089_034761 3300059509 Unclassified 758
2339 Ga0587092_061532 3300059512 Bacteria 703
2340 Ga0587094_017661 3300059513 Bacteria 1006
2341 Ga0587101_029992 3300059623 Unclassified 843
2342 Ga0587117_026016 3300059627 Bacteria 851
2343 Ga0587117_032244 3300059627 Bacteria 796
2344 Ga0587128_002947 3300059630 Bacteria 1834
2345 Ga0587128_003083 3300059630 Bacteria 1812
2346 Ga0587067_043751 3300059640 Unclassified 880
2347 Ga0587068_040459 3300059641 Bacteria 841
2348 Ga0587069_033667 3300059642 Unclassified 842
2349 Ga0587072_108340 3300059643 Bacteria 631
2350 Ga0587075_006474 3300059644 Bacteria 1440
2351 Ga0587076_048897 3300059645 Unclassified 818
2352 Ga0587071_048605 3300060344 Bacteria 871
2353 Ga0587111_0112439 3300060346 Unclassified 692
2354 Ga0501082_0202875 3300060353 Bacteria 1725
2355 Ga0501082_0247351 3300060353 Bacteria 1552
2356 Ga0501082_0320357 3300060353 Bacteria 1351
2357 Ga0501082_0406378 3300060353 Bacteria 1188
2358 Ga0501082_1605652 3300060353 Bacteria 568
2359 Ga0466962_0163346 3300061719 Bacteria 1083
2360 Ga0530510_0021810 3300061734 Bacteria 4558
2361 Ga0530510_0084725 3300061734 Bacteria 2309
2362 Ga0530510_0144521 3300061734 Bacteria 1754
2363 Ga0530510_0504054 3300061734 Bacteria 918
2364 Ga0530510_0563530 3300061734 Bacteria 866
2365 Ga0530510_1058934 3300061734 Bacteria 621

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_11032205 Ga0157378_110322052 93
2 3300039438 Ga0436360_0417422 Ga0436360_0417422_12_314 100
3 3300039450 Ga0436363_1370807 Ga0436363_1370807_516_818 100
4 iso_pu_bacteria 2884215851 2884217426 108
5 2162886011 MRS1b_contig_7734326 MRS1b_0630.00001320 112
6 3300000546 LJNas_1004814 LJNas_10048142 112
7 3300000546 LJNas_1018771 LJNas_10187712 112
8 3300001904 JGI24736J21556_1044934 JGI24736J21556_10449341 112
9 3300001904 JGI24736J21556_1054256 JGI24736J21556_10542562 112
10 3300001915 JGI24741J21665_1020503 JGI24741J21665_10205032 112
11 3300001989 JGI24739J22299_10156327 JGI24739J22299_101563272 112
12 3300001990 JGI24737J22298_10016181 JGI24737J22298_100161811 112
13 3300001990 JGI24737J22298_10228604 JGI24737J22298_102286042 112
14 3300001991 JGI24743J22301_10024507 JGI24743J22301_100245072 112
15 3300002067 JGI24735J21928_10162942 JGI24735J21928_101629422 112
16 3300002070 JGI24750J21931_1006404 JGI24750J21931_10064042 112
17 3300002074 JGI24748J21848_1037345 JGI24748J21848_10373451 112
18 3300002075 JGI24738J21930_10003066 JGI24738J21930_100030667 112
19 3300002076 JGI24749J21850_1028677 JGI24749J21850_10286772 112
20 3300002244 JGI24742J22300_10101212 JGI24742J22300_101012122 112
21 3300003320 rootH2_10081970 rootH2_100819702 112
22 3300003320 rootH2_10094950 rootH2_100949501 112
23 3300003320 rootH2_10168830 rootH2_101688303 112
24 3300003320 rootH2_10204522 rootH2_102045222 112
25 3300003320 rootH2_10213601 rootH2_102136012 112
26 3300003323 rootH1_10402706 rootH1_104027061 112
27 3300004800 Ga0058861_11643122 Ga0058861_116431221 112
28 3300004803 Ga0058862_12706968 Ga0058862_127069681 112
29 3300005290 Ga0065712_10094707 Ga0065712_100947072 112
30 3300005290 Ga0065712_10298466 Ga0065712_102984661 112
31 3300005293 Ga0065715_10135926 Ga0065715_101359262 112
32 3300005293 Ga0065715_10201686 Ga0065715_102016862 112
33 3300005295 Ga0065707_10043322 Ga0065707_100433222 112
34 3300005327 Ga0070658_10016767 Ga0070658_100167673 112
35 3300005327 Ga0070658_10020291 Ga0070658_100202918 112
36 3300005327 Ga0070658_10030777 Ga0070658_100307772 112
37 3300005327 Ga0070658_10083097 Ga0070658_100830972 112
38 3300005327 Ga0070658_10120462 Ga0070658_101204622 112
39 3300005327 Ga0070658_10135853 Ga0070658_101358533 112
40 3300005327 Ga0070658_10393136 Ga0070658_103931362 112
41 3300005327 Ga0070658_10402796 Ga0070658_104027963 112
42 3300005327 Ga0070658_10555777 Ga0070658_105557772 112
43 3300005327 Ga0070658_10561215 Ga0070658_105612152 112
44 3300005327 Ga0070658_11152263 Ga0070658_111522631 112
45 3300005327 Ga0070658_11290284 Ga0070658_112902841 112
46 3300005328 Ga0070676_10002535 Ga0070676_1000253510 112
47 3300005328 Ga0070676_10016781 Ga0070676_100167812 112
48 3300005328 Ga0070676_10022971 Ga0070676_100229712 112
49 3300005329 Ga0070683_100017801 Ga0070683_1000178014 112
50 3300005329 Ga0070683_100041381 Ga0070683_1000413813 112
51 3300005329 Ga0070683_100055829 Ga0070683_1000558295 112
52 3300005329 Ga0070683_100194451 Ga0070683_1001944512 112
53 3300005329 Ga0070683_100247617 Ga0070683_1002476173 112
54 3300005329 Ga0070683_101220505 Ga0070683_1012205051 112
55 3300005329 Ga0070683_101667195 Ga0070683_1016671952 112
56 3300005329 Ga0070683_101879746 Ga0070683_1018797462 112
57 3300005330 Ga0070690_100001295 Ga0070690_10000129511 112
58 3300005330 Ga0070690_100099601 Ga0070690_1000996013 112
59 3300005330 Ga0070690_100327891 Ga0070690_1003278911 112
60 3300005331 Ga0070670_100007750 Ga0070670_1000077508 112
61 3300005331 Ga0070670_100045281 Ga0070670_1000452813 112
62 3300005331 Ga0070670_100505805 Ga0070670_1005058051 112
63 3300005333 Ga0070677_10214791 Ga0070677_102147912 112
64 3300005333 Ga0070677_10419686 Ga0070677_104196861 112
65 3300005334 Ga0068869_100000424 Ga0068869_10000042411 112
66 3300005334 Ga0068869_100000424 Ga0068869_10000042418 112
67 3300005334 Ga0068869_100049520 Ga0068869_1000495204 112
68 3300005334 Ga0068869_100595538 Ga0068869_1005955382 112
69 3300005334 Ga0068869_100642348 Ga0068869_1006423481 112
70 3300005335 Ga0070666_10005226 Ga0070666_100052267 112
71 3300005335 Ga0070666_10008629 Ga0070666_100086294 112
72 3300005335 Ga0070666_10017107 Ga0070666_100171072 112
73 3300005335 Ga0070666_10087796 Ga0070666_100877962 112
74 3300005335 Ga0070666_10348836 Ga0070666_103488362 112
75 3300005336 Ga0070680_100006210 Ga0070680_1000062102 112
76 3300005336 Ga0070680_100013170 Ga0070680_1000131703 112
77 3300005336 Ga0070680_100118284 Ga0070680_1001182842 112
78 3300005336 Ga0070680_100511627 Ga0070680_1005116272 112
79 3300005336 Ga0070680_101179946 Ga0070680_1011799462 112
80 3300005337 Ga0070682_100018621 Ga0070682_1000186215 112
81 3300005337 Ga0070682_100021996 Ga0070682_1000219963 112
82 3300005337 Ga0070682_100037300 Ga0070682_1000373002 112
83 3300005337 Ga0070682_100079072 Ga0070682_1000790722 112
84 3300005337 Ga0070682_100232156 Ga0070682_1002321561 112
85 3300005338 Ga0068868_100006703 Ga0068868_1000067033 112
86 3300005338 Ga0068868_100007870 Ga0068868_1000078701 112
87 3300005338 Ga0068868_100018323 Ga0068868_1000183236 112
88 3300005338 Ga0068868_100129479 Ga0068868_1001294792 112
89 3300005338 Ga0068868_100156472 Ga0068868_1001564722 112
90 3300005338 Ga0068868_100173680 Ga0068868_1001736802 112
91 3300005338 Ga0068868_100295176 Ga0068868_1002951763 112
92 3300005338 Ga0068868_100380360 Ga0068868_1003803602 112
93 3300005338 Ga0068868_100936914 Ga0068868_1009369141 112
94 3300005339 Ga0070660_100001946 Ga0070660_10000194616 112
95 3300005339 Ga0070660_100009595 Ga0070660_1000095952 112
96 3300005339 Ga0070660_100016593 Ga0070660_1000165932 112
97 3300005339 Ga0070660_100017843 Ga0070660_1000178436 112
98 3300005339 Ga0070660_100043115 Ga0070660_1000431154 112
99 3300005339 Ga0070660_100065144 Ga0070660_1000651442 112
100 3300005339 Ga0070660_100126222 Ga0070660_1001262222 112
101 3300005339 Ga0070660_100469235 Ga0070660_1004692352 112
102 3300005339 Ga0070660_101069282 Ga0070660_1010692821 112
103 3300005340 Ga0070689_100002684 Ga0070689_1000026845 112
104 3300005340 Ga0070689_100046830 Ga0070689_1000468303 112
105 3300005340 Ga0070689_100073871 Ga0070689_1000738712 112
106 3300005340 Ga0070689_100108070 Ga0070689_1001080702 112
107 3300005341 Ga0070691_10082210 Ga0070691_100822102 112
108 3300005341 Ga0070691_10105021 Ga0070691_101050213 112
109 3300005341 Ga0070691_10122938 Ga0070691_101229381 112
110 3300005341 Ga0070691_10404321 Ga0070691_104043212 112
111 3300005341 Ga0070691_10923141 Ga0070691_109231411 112
112 3300005343 Ga0070687_100053026 Ga0070687_1000530263 112
113 3300005343 Ga0070687_100329564 Ga0070687_1003295642 112
114 3300005343 Ga0070687_100461076 Ga0070687_1004610761 112
115 3300005343 Ga0070687_100882095 Ga0070687_1008820952 112
116 3300005344 Ga0070661_100002021 Ga0070661_1000020212 112
117 3300005344 Ga0070661_100005744 Ga0070661_1000057442 112
118 3300005344 Ga0070661_100008049 Ga0070661_1000080497 112
119 3300005344 Ga0070661_100016097 Ga0070661_1000160974 112
120 3300005344 Ga0070661_100016304 Ga0070661_1000163042 112
121 3300005344 Ga0070661_100030282 Ga0070661_1000302822 112
122 3300005344 Ga0070661_100033062 Ga0070661_1000330622 112
123 3300005344 Ga0070661_100127916 Ga0070661_1001279162 112
124 3300005344 Ga0070661_100198705 Ga0070661_1001987052 112
125 3300005344 Ga0070661_100254616 Ga0070661_1002546162 112
126 3300005345 Ga0070692_10379212 Ga0070692_103792122 112
127 3300005347 Ga0070668_100004348 Ga0070668_10000434811 112
128 3300005347 Ga0070668_100026586 Ga0070668_1000265862 112
129 3300005347 Ga0070668_100447282 Ga0070668_1004472822 112
130 3300005347 Ga0070668_100618673 Ga0070668_1006186732 112
131 3300005347 Ga0070668_101546648 Ga0070668_1015466482 112
132 3300005347 Ga0070668_102180198 Ga0070668_1021801981 112
133 3300005353 Ga0070669_100000574 Ga0070669_10000057413 112
134 3300005353 Ga0070669_100106620 Ga0070669_1001066201 112
135 3300005353 Ga0070669_100387276 Ga0070669_1003872762 112
136 3300005354 Ga0070675_100006476 Ga0070675_10000647611 112
137 3300005354 Ga0070675_100353789 Ga0070675_1003537892 112
138 3300005354 Ga0070675_100777263 Ga0070675_1007772632 112
139 3300005354 Ga0070675_101343248 Ga0070675_1013432481 112
140 3300005355 Ga0070671_100000429 Ga0070671_1000004297 112
141 3300005355 Ga0070671_100048543 Ga0070671_1000485432 112
142 3300005355 Ga0070671_100307255 Ga0070671_1003072553 112
143 3300005355 Ga0070671_101133574 Ga0070671_1011335742 112
144 3300005355 Ga0070671_101752565 Ga0070671_1017525651 112
145 3300005355 Ga0070671_101803024 Ga0070671_1018030241 112
146 3300005356 Ga0070674_100011573 Ga0070674_1000115734 112
147 3300005356 Ga0070674_100080715 Ga0070674_1000807153 112
148 3300005364 Ga0070673_100041826 Ga0070673_1000418264 112
149 3300005364 Ga0070673_100339196 Ga0070673_1003391962 112
150 3300005364 Ga0070673_101575568 Ga0070673_1015755681 112
151 3300005364 Ga0070673_101609695 Ga0070673_1016096952 112
152 3300005365 Ga0070688_100000238 Ga0070688_10000023816 112
153 3300005365 Ga0070688_100258124 Ga0070688_1002581241 112
154 3300005365 Ga0070688_101092998 Ga0070688_1010929982 112
155 3300005366 Ga0070659_100002752 Ga0070659_1000027525 112
156 3300005366 Ga0070659_100003992 Ga0070659_1000039926 112
157 3300005366 Ga0070659_100004250 Ga0070659_10000425012 112
158 3300005366 Ga0070659_100033495 Ga0070659_1000334954 112
159 3300005366 Ga0070659_100039295 Ga0070659_1000392954 112
160 3300005366 Ga0070659_100085277 Ga0070659_1000852772 112
161 3300005366 Ga0070659_100310884 Ga0070659_1003108842 112
162 3300005366 Ga0070659_100363473 Ga0070659_1003634731 112
163 3300005366 Ga0070659_100874522 Ga0070659_1008745222 112
164 3300005367 Ga0070667_100001398 Ga0070667_10000139821 112
165 3300005367 Ga0070667_100007564 Ga0070667_1000075646 112
166 3300005367 Ga0070667_100204011 Ga0070667_1002040112 112
167 3300005367 Ga0070667_100304154 Ga0070667_1003041543 112
168 3300005367 Ga0070667_100384125 Ga0070667_1003841252 112
169 3300005367 Ga0070667_101240961 Ga0070667_1012409612 112
170 3300005367 Ga0070667_101611723 Ga0070667_1016117231 112
171 3300005406 Ga0070703_10064876 Ga0070703_100648762 112
172 3300005434 Ga0070709_10000553 Ga0070709_1000055317 112
173 3300005434 Ga0070709_10001219 Ga0070709_100012195 112
174 3300005434 Ga0070709_10011511 Ga0070709_100115114 112
175 3300005434 Ga0070709_10014805 Ga0070709_100148051 112
176 3300005434 Ga0070709_10025197 Ga0070709_100251974 112
177 3300005434 Ga0070709_10100828 Ga0070709_101008282 112
178 3300005434 Ga0070709_10221998 Ga0070709_102219982 112
179 3300005434 Ga0070709_10291077 Ga0070709_102910772 112
180 3300005434 Ga0070709_10362201 Ga0070709_103622012 112
181 3300005434 Ga0070709_10950532 Ga0070709_109505321 112
182 3300005434 Ga0070709_11149810 Ga0070709_111498101 112
183 3300005434 Ga0070709_11231336 Ga0070709_112313361 112
184 3300005434 Ga0070709_11261769 Ga0070709_112617691 112
185 3300005434 Ga0070709_11757847 Ga0070709_117578471 112
186 3300005435 Ga0070714_100007325 Ga0070714_1000073258 112
187 3300005435 Ga0070714_100062908 Ga0070714_1000629084 112
188 3300005435 Ga0070714_100079446 Ga0070714_1000794463 112
189 3300005435 Ga0070714_100323604 Ga0070714_1003236042 112
190 3300005435 Ga0070714_100325524 Ga0070714_1003255242 112
191 3300005435 Ga0070714_100463877 Ga0070714_1004638771 112
192 3300005435 Ga0070714_100578110 Ga0070714_1005781101 112
193 3300005435 Ga0070714_100680689 Ga0070714_1006806892 112
194 3300005435 Ga0070714_101671555 Ga0070714_1016715552 112
195 3300005436 Ga0070713_100000461 Ga0070713_10000046119 112
196 3300005436 Ga0070713_100002117 Ga0070713_1000021175 112
197 3300005436 Ga0070713_100049968 Ga0070713_1000499683 112
198 3300005436 Ga0070713_100055045 Ga0070713_1000550452 112
199 3300005436 Ga0070713_100176580 Ga0070713_1001765803 112
200 3300005436 Ga0070713_100180761 Ga0070713_1001807611 112
201 3300005436 Ga0070713_100269421 Ga0070713_1002694212 112
202 3300005436 Ga0070713_100393879 Ga0070713_1003938791 112
203 3300005436 Ga0070713_100414077 Ga0070713_1004140772 112
204 3300005436 Ga0070713_100434257 Ga0070713_1004342572 112
205 3300005436 Ga0070713_100550154 Ga0070713_1005501541 112
206 3300005436 Ga0070713_100569586 Ga0070713_1005695862 112
207 3300005436 Ga0070713_100595326 Ga0070713_1005953261 112
208 3300005436 Ga0070713_100624378 Ga0070713_1006243782 112
209 3300005436 Ga0070713_100924805 Ga0070713_1009248052 112
210 3300005436 Ga0070713_100943399 Ga0070713_1009433992 112
211 3300005436 Ga0070713_101586723 Ga0070713_1015867231 112
212 3300005436 Ga0070713_101665585 Ga0070713_1016655852 112
213 3300005437 Ga0070710_10004047 Ga0070710_100040477 112
214 3300005437 Ga0070710_10007854 Ga0070710_100078543 112
215 3300005437 Ga0070710_10041847 Ga0070710_100418472 112
216 3300005437 Ga0070710_10085421 Ga0070710_100854211 112
217 3300005437 Ga0070710_10264828 Ga0070710_102648281 112
218 3300005437 Ga0070710_10414218 Ga0070710_104142182 112
219 3300005437 Ga0070710_11031233 Ga0070710_110312331 112
220 3300005438 Ga0070701_10018230 Ga0070701_100182304 112
221 3300005438 Ga0070701_10751698 Ga0070701_107516982 112
222 3300005439 Ga0070711_100000213 Ga0070711_10000021324 112
223 3300005439 Ga0070711_100001115 Ga0070711_10000111516 112
224 3300005439 Ga0070711_100021593 Ga0070711_1000215935 112
225 3300005439 Ga0070711_100052034 Ga0070711_1000520342 112
226 3300005439 Ga0070711_100103057 Ga0070711_1001030571 112
227 3300005439 Ga0070711_100159896 Ga0070711_1001598961 112
228 3300005439 Ga0070711_100336229 Ga0070711_1003362292 112
229 3300005439 Ga0070711_100425619 Ga0070711_1004256192 112
230 3300005439 Ga0070711_100636327 Ga0070711_1006363271 112
231 3300005439 Ga0070711_101185119 Ga0070711_1011851191 112
232 3300005440 Ga0070705_100000937 Ga0070705_1000009372 112
233 3300005441 Ga0070700_100013595 Ga0070700_1000135952 112
234 3300005441 Ga0070700_100307170 Ga0070700_1003071702 112
235 3300005441 Ga0070700_100492510 Ga0070700_1004925102 112
236 3300005441 Ga0070700_100503065 Ga0070700_1005030652 112
237 3300005444 Ga0070694_100182634 Ga0070694_1001826341 112
238 3300005445 Ga0070708_100004203 Ga0070708_1000042038 112
239 3300005445 Ga0070708_100155423 Ga0070708_1001554231 112
240 3300005445 Ga0070708_100376654 Ga0070708_1003766542 112
241 3300005445 Ga0070708_100783365 Ga0070708_1007833652 112
242 3300005455 Ga0070663_100003957 Ga0070663_1000039576 112
243 3300005455 Ga0070663_100013009 Ga0070663_1000130096 112
244 3300005455 Ga0070663_100019462 Ga0070663_1000194622 112
245 3300005455 Ga0070663_100111413 Ga0070663_1001114132 112
246 3300005455 Ga0070663_100489335 Ga0070663_1004893352 112
247 3300005455 Ga0070663_100737007 Ga0070663_1007370072 112
248 3300005455 Ga0070663_101705203 Ga0070663_1017052031 112
249 3300005456 Ga0070678_100000163 Ga0070678_10000016317 112
250 3300005456 Ga0070678_100045787 Ga0070678_1000457872 112
251 3300005456 Ga0070678_100364765 Ga0070678_1003647652 112
252 3300005456 Ga0070678_100688736 Ga0070678_1006887362 112
253 3300005456 Ga0070678_100900814 Ga0070678_1009008142 112
254 3300005456 Ga0070678_101117993 Ga0070678_1011179932 112
255 3300005456 Ga0070678_102318196 Ga0070678_1023181961 112
256 3300005457 Ga0070662_100009122 Ga0070662_1000091227 112
257 3300005457 Ga0070662_100018905 Ga0070662_1000189051 112
258 3300005457 Ga0070662_100412144 Ga0070662_1004121441 112
259 3300005457 Ga0070662_100418315 Ga0070662_1004183152 112
260 3300005458 Ga0070681_10009425 Ga0070681_100094252 112
261 3300005458 Ga0070681_10009818 Ga0070681_100098187 112
262 3300005458 Ga0070681_10023633 Ga0070681_100236335 112
263 3300005458 Ga0070681_10044143 Ga0070681_100441435 112
264 3300005458 Ga0070681_10080875 Ga0070681_100808752 112
265 3300005458 Ga0070681_10087148 Ga0070681_100871482 112
266 3300005458 Ga0070681_10229271 Ga0070681_102292712 112
267 3300005458 Ga0070681_10475498 Ga0070681_104754982 112
268 3300005458 Ga0070681_10532606 Ga0070681_105326062 112
269 3300005459 Ga0068867_100006765 Ga0068867_1000067657 112
270 3300005459 Ga0068867_100036780 Ga0068867_1000367802 112
271 3300005459 Ga0068867_100076061 Ga0068867_1000760612 112
272 3300005459 Ga0068867_100388855 Ga0068867_1003888553 112
273 3300005459 Ga0068867_100792331 Ga0068867_1007923312 112
274 3300005459 Ga0068867_101323988 Ga0068867_1013239881 112
275 3300005459 Ga0068867_102320932 Ga0068867_1023209321 112
276 3300005466 Ga0070685_10068149 Ga0070685_100681493 112
277 3300005466 Ga0070685_10290896 Ga0070685_102908961 112
278 3300005466 Ga0070685_10420391 Ga0070685_104203912 112
279 3300005467 Ga0070706_100003196 Ga0070706_10000319611 112
280 3300005467 Ga0070706_100003529 Ga0070706_10000352914 112
281 3300005468 Ga0070707_100014689 Ga0070707_1000146896 112
282 3300005468 Ga0070707_100666432 Ga0070707_1006664323 112
283 3300005468 Ga0070707_100933262 Ga0070707_1009332621 112
284 3300005468 Ga0070707_102187567 Ga0070707_1021875671 112
285 3300005471 Ga0070698_100064875 Ga0070698_1000648752 112
286 3300005471 Ga0070698_100172576 Ga0070698_1001725762 112
287 3300005471 Ga0070698_100578626 Ga0070698_1005786262 112
288 3300005518 Ga0070699_100058163 Ga0070699_1000581632 112
289 3300005518 Ga0070699_100082090 Ga0070699_1000820904 112
290 3300005518 Ga0070699_101508553 Ga0070699_1015085532 112
291 3300005530 Ga0070679_100006772 Ga0070679_1000067723 112
292 3300005530 Ga0070679_100021139 Ga0070679_1000211392 112
293 3300005530 Ga0070679_100059209 Ga0070679_1000592092 112
294 3300005530 Ga0070679_100079211 Ga0070679_1000792112 112
295 3300005530 Ga0070679_100087224 Ga0070679_1000872244 112
296 3300005530 Ga0070679_100099343 Ga0070679_1000993434 112
297 3300005530 Ga0070679_100118123 Ga0070679_1001181233 112
298 3300005530 Ga0070679_100150170 Ga0070679_1001501702 112
299 3300005530 Ga0070679_100179955 Ga0070679_1001799551 112
300 3300005530 Ga0070679_100258476 Ga0070679_1002584762 112
301 3300005535 Ga0070684_100058892 Ga0070684_1000588923 112
302 3300005535 Ga0070684_100081259 Ga0070684_1000812592 112
303 3300005535 Ga0070684_100085345 Ga0070684_1000853452 112
304 3300005535 Ga0070684_100130395 Ga0070684_1001303954 112
305 3300005535 Ga0070684_100153714 Ga0070684_1001537142 112
306 3300005535 Ga0070684_100463329 Ga0070684_1004633292 112
307 3300005535 Ga0070684_100746050 Ga0070684_1007460502 112
308 3300005535 Ga0070684_101087118 Ga0070684_1010871182 112
309 3300005536 Ga0070697_100001048 Ga0070697_10000104817 112
310 3300005536 Ga0070697_100001102 Ga0070697_1000011022 112
311 3300005536 Ga0070697_100711468 Ga0070697_1007114682 112
312 3300005536 Ga0070697_101123177 Ga0070697_1011231772 112
313 3300005536 Ga0070697_101424922 Ga0070697_1014249222 112
314 3300005536 Ga0070697_101852325 Ga0070697_1018523251 112
315 3300005539 Ga0068853_100000456 Ga0068853_1000004566 112
316 3300005539 Ga0068853_100001401 Ga0068853_10000140117 112
317 3300005539 Ga0068853_100018488 Ga0068853_1000184884 112
318 3300005539 Ga0068853_100025543 Ga0068853_1000255432 112
319 3300005539 Ga0068853_100038240 Ga0068853_1000382403 112
320 3300005539 Ga0068853_100045286 Ga0068853_1000452863 112
321 3300005539 Ga0068853_100072859 Ga0068853_1000728592 112
322 3300005539 Ga0068853_100088326 Ga0068853_1000883262 112
323 3300005539 Ga0068853_100293397 Ga0068853_1002933971 112
324 3300005539 Ga0068853_100739945 Ga0068853_1007399452 112
325 3300005539 Ga0068853_101400393 Ga0068853_1014003932 112
326 3300005543 Ga0070672_100017891 Ga0070672_1000178918 112
327 3300005543 Ga0070672_100236597 Ga0070672_1002365973 112
328 3300005543 Ga0070672_100387007 Ga0070672_1003870072 112
329 3300005543 Ga0070672_100412326 Ga0070672_1004123261 112
330 3300005543 Ga0070672_100719135 Ga0070672_1007191352 112
331 3300005543 Ga0070672_101647140 Ga0070672_1016471401 112
332 3300005544 Ga0070686_100001281 Ga0070686_10000128112 112
333 3300005544 Ga0070686_100091693 Ga0070686_1000916933 112
334 3300005544 Ga0070686_100587130 Ga0070686_1005871301 112
335 3300005544 Ga0070686_101430024 Ga0070686_1014300241 112
336 3300005545 Ga0070695_100011479 Ga0070695_1000114794 112
337 3300005545 Ga0070695_100173927 Ga0070695_1001739271 112
338 3300005545 Ga0070695_100312648 Ga0070695_1003126482 112
339 3300005546 Ga0070696_100000980 Ga0070696_1000009804 112
340 3300005546 Ga0070696_100031772 Ga0070696_1000317722 112
341 3300005546 Ga0070696_100055135 Ga0070696_1000551352 112
342 3300005546 Ga0070696_100635050 Ga0070696_1006350501 112
343 3300005546 Ga0070696_100732215 Ga0070696_1007322151 112
344 3300005547 Ga0070693_100000352 Ga0070693_10000035218 112
345 3300005547 Ga0070693_100008790 Ga0070693_1000087906 112
346 3300005547 Ga0070693_100084355 Ga0070693_1000843553 112
347 3300005547 Ga0070693_100164865 Ga0070693_1001648652 112
348 3300005547 Ga0070693_101340780 Ga0070693_1013407801 112
349 3300005548 Ga0070665_100009297 Ga0070665_1000092972 112
350 3300005548 Ga0070665_100020939 Ga0070665_1000209396 112
351 3300005548 Ga0070665_100025415 Ga0070665_1000254156 112
352 3300005548 Ga0070665_100064283 Ga0070665_1000642833 112
353 3300005548 Ga0070665_100092697 Ga0070665_1000926975 112
354 3300005548 Ga0070665_100119719 Ga0070665_1001197193 112
355 3300005548 Ga0070665_100199887 Ga0070665_1001998872 112
356 3300005548 Ga0070665_100213899 Ga0070665_1002138992 112
357 3300005548 Ga0070665_100228279 Ga0070665_1002282792 112
358 3300005548 Ga0070665_100349315 Ga0070665_1003493152 112
359 3300005548 Ga0070665_100585996 Ga0070665_1005859961 112
360 3300005548 Ga0070665_100627168 Ga0070665_1006271682 112
361 3300005548 Ga0070665_101491930 Ga0070665_1014919302 112
362 3300005548 Ga0070665_101658595 Ga0070665_1016585952 112
363 3300005549 Ga0070704_100012293 Ga0070704_1000122934 112
364 3300005549 Ga0070704_100040428 Ga0070704_1000404282 112
365 3300005549 Ga0070704_100621533 Ga0070704_1006215332 112
366 3300005549 Ga0070704_101281064 Ga0070704_1012810641 112
367 3300005549 Ga0070704_101544089 Ga0070704_1015440891 112
368 3300005563 Ga0068855_100000779 Ga0068855_10000077915 112
369 3300005563 Ga0068855_100003139 Ga0068855_10000313911 112
370 3300005563 Ga0068855_100028730 Ga0068855_1000287302 112
371 3300005563 Ga0068855_100031234 Ga0068855_1000312342 112
372 3300005563 Ga0068855_100048321 Ga0068855_1000483215 112
373 3300005563 Ga0068855_100084815 Ga0068855_1000848152 112
374 3300005563 Ga0068855_100123972 Ga0068855_1001239722 112
375 3300005563 Ga0068855_100134639 Ga0068855_1001346392 112
376 3300005563 Ga0068855_100190117 Ga0068855_1001901172 112
377 3300005563 Ga0068855_100217209 Ga0068855_1002172092 112
378 3300005563 Ga0068855_100222583 Ga0068855_1002225832 112
379 3300005563 Ga0068855_100235006 Ga0068855_1002350062 112
380 3300005563 Ga0068855_100289512 Ga0068855_1002895124 112
381 3300005563 Ga0068855_100635930 Ga0068855_1006359302 112
382 3300005563 Ga0068855_100776291 Ga0068855_1007762912 112
383 3300005563 Ga0068855_100846328 Ga0068855_1008463282 112
384 3300005563 Ga0068855_102205287 Ga0068855_1022052871 112
385 3300005563 Ga0068855_102289816 Ga0068855_1022898162 112
386 3300005564 Ga0070664_100004148 Ga0070664_10000414812 112
387 3300005564 Ga0070664_100013503 Ga0070664_1000135032 112
388 3300005564 Ga0070664_100090497 Ga0070664_1000904973 112
389 3300005564 Ga0070664_100429193 Ga0070664_1004291931 112
390 3300005564 Ga0070664_101813166 Ga0070664_1018131662 112
391 3300005577 Ga0068857_100025768 Ga0068857_1000257686 112
392 3300005577 Ga0068857_100037905 Ga0068857_1000379054 112
393 3300005577 Ga0068857_100130539 Ga0068857_1001305392 112
394 3300005577 Ga0068857_100696985 Ga0068857_1006969852 112
395 3300005577 Ga0068857_100738750 Ga0068857_1007387502 112
396 3300005577 Ga0068857_101574558 Ga0068857_1015745581 112
397 3300005578 Ga0068854_100001211 Ga0068854_1000012115 112
398 3300005578 Ga0068854_100001753 Ga0068854_1000017533 112
399 3300005578 Ga0068854_100002891 Ga0068854_1000028916 112
400 3300005578 Ga0068854_100012470 Ga0068854_1000124702 112
401 3300005578 Ga0068854_100013626 Ga0068854_1000136267 112
402 3300005578 Ga0068854_100082122 Ga0068854_1000821222 112
403 3300005578 Ga0068854_100105316 Ga0068854_1001053161 112
404 3300005578 Ga0068854_100173768 Ga0068854_1001737682 112
405 3300005578 Ga0068854_100505692 Ga0068854_1005056922 112
406 3300005578 Ga0068854_101114583 Ga0068854_1011145831 112
407 3300005578 Ga0068854_102137406 Ga0068854_1021374061 112
408 3300005614 Ga0068856_100011466 Ga0068856_1000114667 112
409 3300005614 Ga0068856_100017168 Ga0068856_1000171685 112
410 3300005614 Ga0068856_100017545 Ga0068856_1000175452 112
411 3300005614 Ga0068856_100032999 Ga0068856_1000329997 112
412 3300005614 Ga0068856_100042762 Ga0068856_1000427623 112
413 3300005614 Ga0068856_100060237 Ga0068856_1000602372 112
414 3300005614 Ga0068856_100121386 Ga0068856_1001213864 112
415 3300005614 Ga0068856_100170445 Ga0068856_1001704451 112
416 3300005614 Ga0068856_100218501 Ga0068856_1002185012 112
417 3300005614 Ga0068856_100402159 Ga0068856_1004021592 112
418 3300005614 Ga0068856_100413391 Ga0068856_1004133912 112
419 3300005614 Ga0068856_100493770 Ga0068856_1004937701 112
420 3300005614 Ga0068856_100502865 Ga0068856_1005028652 112
421 3300005614 Ga0068856_100562611 Ga0068856_1005626113 112
422 3300005614 Ga0068856_100665404 Ga0068856_1006654042 112
423 3300005614 Ga0068856_100793540 Ga0068856_1007935402 112
424 3300005614 Ga0068856_100847071 Ga0068856_1008470712 112
425 3300005614 Ga0068856_102538459 Ga0068856_1025384591 112
426 3300005615 Ga0070702_100000144 Ga0070702_1000001441 112
427 3300005615 Ga0070702_100838082 Ga0070702_1008380821 112
428 3300005615 Ga0070702_101773518 Ga0070702_1017735181 112
429 3300005616 Ga0068852_100000020 Ga0068852_10000002077 112
430 3300005616 Ga0068852_100038794 Ga0068852_1000387942 112
431 3300005616 Ga0068852_100065401 Ga0068852_1000654012 112
432 3300005616 Ga0068852_100070040 Ga0068852_1000700402 112
433 3300005616 Ga0068852_100071856 Ga0068852_1000718562 112
434 3300005616 Ga0068852_100095130 Ga0068852_1000951302 112
435 3300005616 Ga0068852_100126170 Ga0068852_1001261701 112
436 3300005616 Ga0068852_100261595 Ga0068852_1002615952 112
437 3300005616 Ga0068852_100385689 Ga0068852_1003856892 112
438 3300005616 Ga0068852_100528043 Ga0068852_1005280433 112
439 3300005616 Ga0068852_100569131 Ga0068852_1005691312 112
440 3300005616 Ga0068852_100638037 Ga0068852_1006380372 112
441 3300005616 Ga0068852_100752670 Ga0068852_1007526701 112
442 3300005616 Ga0068852_100934980 Ga0068852_1009349802 112
443 3300005616 Ga0068852_100995554 Ga0068852_1009955542 112
444 3300005616 Ga0068852_101920714 Ga0068852_1019207141 112
445 3300005617 Ga0068859_100011985 Ga0068859_1000119854 112
446 3300005617 Ga0068859_100023070 Ga0068859_1000230704 112
447 3300005617 Ga0068859_100029008 Ga0068859_1000290087 112
448 3300005617 Ga0068859_100288899 Ga0068859_1002888991 112
449 3300005617 Ga0068859_100290320 Ga0068859_1002903203 112
450 3300005617 Ga0068859_101400181 Ga0068859_1014001812 112
451 3300005617 Ga0068859_103082043 Ga0068859_1030820431 112
452 3300005618 Ga0068864_100019140 Ga0068864_1000191404 112
453 3300005618 Ga0068864_100026682 Ga0068864_1000266827 112
454 3300005618 Ga0068864_100628737 Ga0068864_1006287371 112
455 3300005618 Ga0068864_101108648 Ga0068864_1011086482 112
456 3300005718 Ga0068866_10001363 Ga0068866_1000136312 112
457 3300005718 Ga0068866_10212247 Ga0068866_102122471 112
458 3300005718 Ga0068866_10541625 Ga0068866_105416252 112
459 3300005718 Ga0068866_11058789 Ga0068866_110587891 112
460 3300005718 Ga0068866_11080153 Ga0068866_110801531 112
461 3300005719 Ga0068861_100006708 Ga0068861_1000067087 112
462 3300005719 Ga0068861_100076137 Ga0068861_1000761373 112
463 3300005719 Ga0068861_101272965 Ga0068861_1012729651 112
464 3300005719 Ga0068861_101845553 Ga0068861_1018455531 112
465 3300005834 Ga0068851_10003533 Ga0068851_100035334 112
466 3300005834 Ga0068851_10037043 Ga0068851_100370433 112
467 3300005834 Ga0068851_10059125 Ga0068851_100591252 112
468 3300005834 Ga0068851_10251801 Ga0068851_102518012 112
469 3300005834 Ga0068851_10264680 Ga0068851_102646802 112
470 3300005834 Ga0068851_10457287 Ga0068851_104572872 112
471 3300005834 Ga0068851_10615724 Ga0068851_106157241 112
472 3300005834 Ga0068851_10844480 Ga0068851_108444801 112
473 3300005840 Ga0068870_10091284 Ga0068870_100912843 112
474 3300005840 Ga0068870_10408623 Ga0068870_104086232 112
475 3300005840 Ga0068870_10871617 Ga0068870_108716172 112
476 3300005841 Ga0068863_100001553 Ga0068863_10000155324 112
477 3300005841 Ga0068863_100006574 Ga0068863_1000065745 112
478 3300005841 Ga0068863_100028069 Ga0068863_1000280693 112
479 3300005841 Ga0068863_100045655 Ga0068863_1000456554 112
480 3300005841 Ga0068863_100048529 Ga0068863_1000485292 112
481 3300005841 Ga0068863_100328696 Ga0068863_1003286964 112
482 3300005841 Ga0068863_100527425 Ga0068863_1005274252 112
483 3300005841 Ga0068863_100710913 Ga0068863_1007109132 112
484 3300005841 Ga0068863_101082177 Ga0068863_1010821771 112
485 3300005841 Ga0068863_101085088 Ga0068863_1010850882 112
486 3300005842 Ga0068858_100002502 Ga0068858_10000250212 112
487 3300005842 Ga0068858_100002502 Ga0068858_1000025025 112
488 3300005842 Ga0068858_100003338 Ga0068858_1000033388 112
489 3300005842 Ga0068858_100019098 Ga0068858_1000190984 112
490 3300005842 Ga0068858_100025835 Ga0068858_1000258356 112
491 3300005842 Ga0068858_100122384 Ga0068858_1001223844 112
492 3300005842 Ga0068858_100243981 Ga0068858_1002439813 112
493 3300005842 Ga0068858_100274960 Ga0068858_1002749602 112
494 3300005842 Ga0068858_100373881 Ga0068858_1003738812 112
495 3300005842 Ga0068858_100469109 Ga0068858_1004691091 112
496 3300005842 Ga0068858_100516026 Ga0068858_1005160262 112
497 3300005842 Ga0068858_100566557 Ga0068858_1005665572 112
498 3300005842 Ga0068858_100788693 Ga0068858_1007886932 112
499 3300005842 Ga0068858_101025104 Ga0068858_1010251042 112
500 3300005842 Ga0068858_101228545 Ga0068858_1012285451 112
501 3300005843 Ga0068860_100042051 Ga0068860_1000420517 112
502 3300005843 Ga0068860_100056723 Ga0068860_1000567231 112
503 3300005843 Ga0068860_100068229 Ga0068860_1000682294 112
504 3300005843 Ga0068860_100119123 Ga0068860_1001191232 112
505 3300005843 Ga0068860_100130727 Ga0068860_1001307274 112
506 3300005843 Ga0068860_100160165 Ga0068860_1001601651 112
507 3300005843 Ga0068860_100183930 Ga0068860_1001839304 112
508 3300005843 Ga0068860_100204686 Ga0068860_1002046863 112
509 3300005843 Ga0068860_100589934 Ga0068860_1005899342 112
510 3300005843 Ga0068860_101215263 Ga0068860_1012152631 112
511 3300005844 Ga0068862_100001405 Ga0068862_10000140516 112
512 3300005844 Ga0068862_100233050 Ga0068862_1002330502 112
513 3300005844 Ga0068862_100681386 Ga0068862_1006813862 112
514 3300005844 Ga0068862_100852334 Ga0068862_1008523342 112
515 3300005844 Ga0068862_101453547 Ga0068862_1014535472 112
516 3300005937 Ga0081455_10367389 Ga0081455_103673892 112
517 3300005983 Ga0081540_1146292 Ga0081540_11462922 112
518 3300006028 Ga0070717_10007095 Ga0070717_100070954 112
519 3300006028 Ga0070717_10007853 Ga0070717_100078532 112
520 3300006028 Ga0070717_10015061 Ga0070717_100150613 112
521 3300006028 Ga0070717_10043871 Ga0070717_100438715 112
522 3300006028 Ga0070717_10060444 Ga0070717_100604443 112
523 3300006028 Ga0070717_10087796 Ga0070717_100877962 112
524 3300006028 Ga0070717_10136753 Ga0070717_101367532 112
525 3300006028 Ga0070717_10380014 Ga0070717_103800142 112
526 3300006028 Ga0070717_10454186 Ga0070717_104541861 112
527 3300006028 Ga0070717_10512982 Ga0070717_105129822 112
528 3300006028 Ga0070717_10599603 Ga0070717_105996032 112
529 3300006028 Ga0070717_10849662 Ga0070717_108496622 112
530 3300006028 Ga0070717_10931013 Ga0070717_109310131 112
531 3300006058 Ga0075432_10076351 Ga0075432_100763512 112
532 3300006163 Ga0070715_10000351 Ga0070715_100003518 112
533 3300006163 Ga0070715_10002454 Ga0070715_100024544 112
534 3300006163 Ga0070715_10110153 Ga0070715_101101532 112
535 3300006163 Ga0070715_10180473 Ga0070715_101804732 112
536 3300006163 Ga0070715_10449323 Ga0070715_104493231 112
537 3300006163 Ga0070715_10555407 Ga0070715_105554071 112
538 3300006163 Ga0070715_10782831 Ga0070715_107828312 112
539 3300006173 Ga0070716_100002822 Ga0070716_1000028229 112
540 3300006173 Ga0070716_100013970 Ga0070716_1000139702 112
541 3300006173 Ga0070716_100083426 Ga0070716_1000834262 112
542 3300006173 Ga0070716_100101305 Ga0070716_1001013052 112
543 3300006173 Ga0070716_100188941 Ga0070716_1001889412 112
544 3300006173 Ga0070716_100208493 Ga0070716_1002084931 112
545 3300006173 Ga0070716_100395828 Ga0070716_1003958282 112
546 3300006173 Ga0070716_100755034 Ga0070716_1007550341 112
547 3300006173 Ga0070716_100780910 Ga0070716_1007809101 112
548 3300006175 Ga0070712_100000506 Ga0070712_10000050618 112
549 3300006175 Ga0070712_100000650 Ga0070712_10000065015 112
550 3300006175 Ga0070712_100002973 Ga0070712_1000029736 112
551 3300006175 Ga0070712_100015896 Ga0070712_1000158965 112
552 3300006175 Ga0070712_100048356 Ga0070712_1000483566 112
553 3300006175 Ga0070712_100053417 Ga0070712_1000534172 112
554 3300006175 Ga0070712_100539294 Ga0070712_1005392942 112
555 3300006175 Ga0070712_100763008 Ga0070712_1007630081 112
556 3300006175 Ga0070712_100849643 Ga0070712_1008496432 112
557 3300006175 Ga0070712_101015497 Ga0070712_1010154972 112
558 3300006175 Ga0070712_101570537 Ga0070712_1015705372 112
559 3300006237 Ga0097621_100023960 Ga0097621_1000239604 112
560 3300006237 Ga0097621_100025307 Ga0097621_1000253072 112
561 3300006237 Ga0097621_100033405 Ga0097621_1000334053 112
562 3300006237 Ga0097621_100038601 Ga0097621_1000386013 112
563 3300006237 Ga0097621_100069200 Ga0097621_1000692002 112
564 3300006237 Ga0097621_100100126 Ga0097621_1001001263 112
565 3300006237 Ga0097621_100174824 Ga0097621_1001748242 112
566 3300006237 Ga0097621_100203371 Ga0097621_1002033712 112
567 3300006237 Ga0097621_100210345 Ga0097621_1002103452 112
568 3300006237 Ga0097621_100342592 Ga0097621_1003425923 112
569 3300006237 Ga0097621_100469333 Ga0097621_1004693331 112
570 3300006237 Ga0097621_100935177 Ga0097621_1009351772 112
571 3300006237 Ga0097621_101354585 Ga0097621_1013545852 112
572 3300006237 Ga0097621_101518992 Ga0097621_1015189922 112
573 3300006237 Ga0097621_102238318 Ga0097621_1022383181 112
574 3300006358 Ga0068871_100000129 Ga0068871_10000012927 112
575 3300006358 Ga0068871_100013553 Ga0068871_1000135534 112
576 3300006358 Ga0068871_100019520 Ga0068871_1000195204 112
577 3300006358 Ga0068871_100054407 Ga0068871_1000544074 112
578 3300006358 Ga0068871_100091734 Ga0068871_1000917342 112
579 3300006358 Ga0068871_100119920 Ga0068871_1001199202 112
580 3300006358 Ga0068871_100333458 Ga0068871_1003334582 112
581 3300006358 Ga0068871_100645050 Ga0068871_1006450502 112
582 3300006358 Ga0068871_100757066 Ga0068871_1007570663 112
583 3300006358 Ga0068871_100884527 Ga0068871_1008845272 112
584 3300006358 Ga0068871_100946388 Ga0068871_1009463881 112
585 3300006358 Ga0068871_101543668 Ga0068871_1015436681 112
586 3300006358 Ga0068871_101559570 Ga0068871_1015595701 112
587 3300006844 Ga0075428_100320558 Ga0075428_1003205582 112
588 3300006844 Ga0075428_100398753 Ga0075428_1003987533 112
589 3300006846 Ga0075430_100532473 Ga0075430_1005324731 112
590 3300006847 Ga0075431_100095359 Ga0075431_1000953594 112
591 3300006847 Ga0075431_100118946 Ga0075431_1001189462 112
592 3300006847 Ga0075431_100561223 Ga0075431_1005612232 112
593 3300006852 Ga0075433_10001462 Ga0075433_1000146210 112
594 3300006852 Ga0075433_10009947 Ga0075433_100099479 112
595 3300006852 Ga0075433_10553220 Ga0075433_105532202 112
596 3300006852 Ga0075433_11143319 Ga0075433_111433192 112
597 3300006871 Ga0075434_100000295 Ga0075434_10000029510 112
598 3300006871 Ga0075434_100001801 Ga0075434_1000018015 112
599 3300006871 Ga0075434_100034621 Ga0075434_1000346216 112
600 3300006880 Ga0075429_100076875 Ga0075429_1000768753 112
601 3300006880 Ga0075429_100105501 Ga0075429_1001055014 112
602 3300006880 Ga0075429_100202909 Ga0075429_1002029093 112
603 3300006881 Ga0068865_100000403 Ga0068865_10000040321 112
604 3300006881 Ga0068865_100037352 Ga0068865_1000373522 112
605 3300006881 Ga0068865_100038581 Ga0068865_1000385814 112
606 3300006881 Ga0068865_100109262 Ga0068865_1001092622 112
607 3300006881 Ga0068865_100198106 Ga0068865_1001981061 112
608 3300006881 Ga0068865_100369886 Ga0068865_1003698862 112
609 3300006914 Ga0075436_100007723 Ga0075436_1000077233 112
610 3300006914 Ga0075436_100014105 Ga0075436_1000141051 112
611 3300006914 Ga0075436_100073100 Ga0075436_1000731002 112
612 3300006914 Ga0075436_100113107 Ga0075436_1001131072 112
613 3300006914 Ga0075436_100200804 Ga0075436_1002008042 112
614 3300006931 Ga0097620_100011985 Ga0097620_1000119854 112
615 3300006931 Ga0097620_100023070 Ga0097620_1000230704 112
616 3300006931 Ga0097620_100029010 Ga0097620_1000290107 112
617 3300006931 Ga0097620_100288892 Ga0097620_1002888922 112
618 3300006931 Ga0097620_100290311 Ga0097620_1002903112 112
619 3300006931 Ga0097620_101400606 Ga0097620_1014006062 112
620 3300006931 Ga0097620_103081995 Ga0097620_1030819951 112
621 3300007076 Ga0075435_100000025 Ga0075435_10000002566 112
622 3300007076 Ga0075435_100154072 Ga0075435_1001540722 112
623 3300007076 Ga0075435_100275390 Ga0075435_1002753902 112
624 3300007076 Ga0075435_100388084 Ga0075435_1003880842 112
625 3300007076 Ga0075435_101060253 Ga0075435_1010602532 112
626 3300007076 Ga0075435_101643958 Ga0075435_1016439581 112
627 3300007265 Ga0099794_10129063 Ga0099794_101290632 112
628 3300007265 Ga0099794_10473525 Ga0099794_104735251 112
629 3300007265 Ga0099794_10702230 Ga0099794_107022301 112
630 3300007788 Ga0099795_10107665 Ga0099795_101076652 112
631 3300007788 Ga0099795_10345922 Ga0099795_103459221 112
632 3300007788 Ga0099795_10401821 Ga0099795_104018212 112
633 3300007788 Ga0099795_10524627 Ga0099795_105246271 112
634 3300007788 Ga0099795_10615150 Ga0099795_106151501 112
635 3300009011 Ga0105251_10220384 Ga0105251_102203841 112
636 3300009036 Ga0105244_10162087 Ga0105244_101620872 112
637 3300009092 Ga0105250_10079778 Ga0105250_100797782 112
638 3300009092 Ga0105250_10126291 Ga0105250_101262912 112
639 3300009093 Ga0105240_10000145 Ga0105240_1000014561 112
640 3300009093 Ga0105240_10004691 Ga0105240_100046917 112
641 3300009093 Ga0105240_10021776 Ga0105240_100217766 112
642 3300009093 Ga0105240_10025618 Ga0105240_100256184 112
643 3300009093 Ga0105240_10026057 Ga0105240_100260575 112
644 3300009093 Ga0105240_10038510 Ga0105240_100385104 112
645 3300009093 Ga0105240_10071330 Ga0105240_100713302 112
646 3300009093 Ga0105240_10072810 Ga0105240_100728102 112
647 3300009093 Ga0105240_10080608 Ga0105240_100806082 112
648 3300009093 Ga0105240_10081899 Ga0105240_100818992 112
649 3300009093 Ga0105240_10115966 Ga0105240_101159662 112
650 3300009093 Ga0105240_10134435 Ga0105240_101344352 112
651 3300009093 Ga0105240_10135880 Ga0105240_101358802 112
652 3300009093 Ga0105240_10199401 Ga0105240_101994012 112
653 3300009093 Ga0105240_10205119 Ga0105240_102051194 112
654 3300009093 Ga0105240_10229055 Ga0105240_102290552 112
655 3300009093 Ga0105240_10258036 Ga0105240_102580362 112
656 3300009093 Ga0105240_10316502 Ga0105240_103165022 112
657 3300009093 Ga0105240_10685281 Ga0105240_106852812 112
658 3300009093 Ga0105240_10686199 Ga0105240_106861992 112
659 3300009093 Ga0105240_10718718 Ga0105240_107187181 112
660 3300009093 Ga0105240_10797263 Ga0105240_107972632 112
661 3300009093 Ga0105240_10805833 Ga0105240_108058332 112
662 3300009093 Ga0105240_10966022 Ga0105240_109660222 112
663 3300009093 Ga0105240_12192974 Ga0105240_121929742 112
664 3300009094 Ga0111539_10365779 Ga0111539_103657793 112
665 3300009094 Ga0111539_10903661 Ga0111539_109036612 112
666 3300009094 Ga0111539_11475617 Ga0111539_114756172 112
667 3300009098 Ga0105245_10001024 Ga0105245_1000102419 112
668 3300009098 Ga0105245_10001576 Ga0105245_1000157610 112
669 3300009098 Ga0105245_10001781 Ga0105245_1000178121 112
670 3300009098 Ga0105245_10020798 Ga0105245_100207983 112
671 3300009098 Ga0105245_10023214 Ga0105245_100232145 112
672 3300009098 Ga0105245_10030955 Ga0105245_100309555 112
673 3300009098 Ga0105245_10030993 Ga0105245_100309934 112
674 3300009098 Ga0105245_10048228 Ga0105245_100482283 112
675 3300009098 Ga0105245_10063234 Ga0105245_100632344 112
676 3300009098 Ga0105245_10139809 Ga0105245_101398091 112
677 3300009098 Ga0105245_10382022 Ga0105245_103820222 112
678 3300009098 Ga0105245_10420475 Ga0105245_104204751 112
679 3300009098 Ga0105245_11048007 Ga0105245_110480072 112
680 3300009098 Ga0105245_11579023 Ga0105245_115790231 112
681 3300009101 Ga0105247_10001124 Ga0105247_100011248 112
682 3300009101 Ga0105247_10076275 Ga0105247_100762753 112
683 3300009101 Ga0105247_10297823 Ga0105247_102978233 112
684 3300009101 Ga0105247_10413301 Ga0105247_104133011 112
685 3300009101 Ga0105247_10605147 Ga0105247_106051472 112
686 3300009101 Ga0105247_10627191 Ga0105247_106271912 112
687 3300009101 Ga0105247_10644008 Ga0105247_106440082 112
688 3300009101 Ga0105247_10938874 Ga0105247_109388741 112
689 3300009147 Ga0114129_10149799 Ga0114129_101497993 112
690 3300009147 Ga0114129_10463442 Ga0114129_104634423 112
691 3300009147 Ga0114129_10845814 Ga0114129_108458142 112
692 3300009147 Ga0114129_11335929 Ga0114129_113359291 112
693 3300009147 Ga0114129_11426095 Ga0114129_114260952 112
694 3300009147 Ga0114129_11428304 Ga0114129_114283042 112
695 3300009148 Ga0105243_10002082 Ga0105243_1000208216 112
696 3300009148 Ga0105243_11654019 Ga0105243_116540191 112
697 3300009174 Ga0105241_10004540 Ga0105241_100045402 112
698 3300009174 Ga0105241_10012338 Ga0105241_100123387 112
699 3300009174 Ga0105241_10014235 Ga0105241_100142351 112
700 3300009174 Ga0105241_10018963 Ga0105241_100189632 112
701 3300009174 Ga0105241_10022303 Ga0105241_100223031 112
702 3300009174 Ga0105241_10038529 Ga0105241_100385293 112
703 3300009174 Ga0105241_10135528 Ga0105241_101355282 112
704 3300009174 Ga0105241_10178395 Ga0105241_101783952 112
705 3300009174 Ga0105241_10387989 Ga0105241_103879892 112
706 3300009174 Ga0105241_10737395 Ga0105241_107373952 112
707 3300009174 Ga0105241_11596411 Ga0105241_115964111 112
708 3300009174 Ga0105241_11619404 Ga0105241_116194041 112
709 3300009174 Ga0105241_12158699 Ga0105241_121586991 112
710 3300009174 Ga0105241_12360473 Ga0105241_123604731 112
711 3300009176 Ga0105242_10001679 Ga0105242_100016792 112
712 3300009176 Ga0105242_10024870 Ga0105242_100248706 112
713 3300009176 Ga0105242_10026868 Ga0105242_100268682 112
714 3300009176 Ga0105242_10031137 Ga0105242_100311376 112
715 3300009176 Ga0105242_10233425 Ga0105242_102334252 112
716 3300009177 Ga0105248_10002287 Ga0105248_1000228711 112
717 3300009177 Ga0105248_10012972 Ga0105248_100129722 112
718 3300009177 Ga0105248_10018604 Ga0105248_100186047 112
719 3300009177 Ga0105248_10030100 Ga0105248_100301002 112
720 3300009177 Ga0105248_10034546 Ga0105248_100345462 112
721 3300009177 Ga0105248_10048853 Ga0105248_100488532 112
722 3300009177 Ga0105248_10060707 Ga0105248_100607073 112
723 3300009177 Ga0105248_10170391 Ga0105248_101703914 112
724 3300009177 Ga0105248_10272894 Ga0105248_102728942 112
725 3300009177 Ga0105248_10275431 Ga0105248_102754312 112
726 3300009177 Ga0105248_10410954 Ga0105248_104109543 112
727 3300009177 Ga0105248_11130205 Ga0105248_111302052 112
728 3300009177 Ga0105248_11441483 Ga0105248_114414831 112
729 3300009177 Ga0105248_12749082 Ga0105248_127490821 112
730 3300009177 Ga0105248_12955880 Ga0105248_129558801 112
731 3300009545 Ga0105237_10010596 Ga0105237_100105964 112
732 3300009545 Ga0105237_10030560 Ga0105237_100305604 112
733 3300009545 Ga0105237_10041331 Ga0105237_100413311 112
734 3300009545 Ga0105237_10053532 Ga0105237_100535325 112
735 3300009545 Ga0105237_10077921 Ga0105237_100779211 112
736 3300009545 Ga0105237_10081939 Ga0105237_100819392 112
737 3300009545 Ga0105237_10122216 Ga0105237_101222161 112
738 3300009545 Ga0105237_10208188 Ga0105237_102081882 112
739 3300009545 Ga0105237_10214350 Ga0105237_102143502 112
740 3300009545 Ga0105237_10265708 Ga0105237_102657082 112
741 3300009545 Ga0105237_10289797 Ga0105237_102897972 112
742 3300009545 Ga0105237_10448398 Ga0105237_104483982 112
743 3300009545 Ga0105237_10481667 Ga0105237_104816672 112
744 3300009545 Ga0105237_10825974 Ga0105237_108259741 112
745 3300009545 Ga0105237_11133179 Ga0105237_111331792 112
746 3300009545 Ga0105237_11706477 Ga0105237_117064771 112
747 3300009551 Ga0105238_10001529 Ga0105238_100015297 112
748 3300009551 Ga0105238_10006161 Ga0105238_100061617 112
749 3300009551 Ga0105238_10006777 Ga0105238_100067777 112
750 3300009551 Ga0105238_10011778 Ga0105238_100117786 112
751 3300009551 Ga0105238_10020785 Ga0105238_100207854 112
752 3300009551 Ga0105238_10024772 Ga0105238_100247726 112
753 3300009551 Ga0105238_10037550 Ga0105238_100375502 112
754 3300009551 Ga0105238_10046742 Ga0105238_100467422 112
755 3300009551 Ga0105238_10049427 Ga0105238_100494271 112
756 3300009551 Ga0105238_10131897 Ga0105238_101318973 112
757 3300009551 Ga0105238_10226027 Ga0105238_102260272 112
758 3300009551 Ga0105238_10645153 Ga0105238_106451531 112
759 3300009551 Ga0105238_10739601 Ga0105238_107396012 112
760 3300009551 Ga0105238_10836512 Ga0105238_108365121 112
761 3300009551 Ga0105238_10843907 Ga0105238_108439071 112
762 3300009551 Ga0105238_10875751 Ga0105238_108757512 112
763 3300009551 Ga0105238_11014402 Ga0105238_110144021 112
764 3300009551 Ga0105238_11017981 Ga0105238_110179811 112
765 3300009551 Ga0105238_11189787 Ga0105238_111897871 112
766 3300009551 Ga0105238_11215441 Ga0105238_112154412 112
767 3300009551 Ga0105238_11248380 Ga0105238_112483801 112
768 3300009553 Ga0105249_10008998 Ga0105249_100089982 112
769 3300009553 Ga0105249_10031865 Ga0105249_100318656 112
770 3300009553 Ga0105249_10039508 Ga0105249_100395085 112
771 3300009553 Ga0105249_10165531 Ga0105249_101655313 112
772 3300009553 Ga0105249_10318461 Ga0105249_103184612 112
773 3300009553 Ga0105249_10432111 Ga0105249_104321112 112
774 3300009553 Ga0105249_11293133 Ga0105249_112931331 112
775 3300009553 Ga0105249_11593097 Ga0105249_115930971 112
776 3300010159 Ga0099796_10294450 Ga0099796_102944501 112
777 3300010159 Ga0099796_10574503 Ga0099796_105745031 112
778 3300010375 Ga0105239_10003151 Ga0105239_100031513 112
779 3300010375 Ga0105239_10017516 Ga0105239_100175164 112
780 3300010375 Ga0105239_10043675 Ga0105239_100436756 112
781 3300010375 Ga0105239_10044763 Ga0105239_100447634 112
782 3300010375 Ga0105239_10113346 Ga0105239_101133463 112
783 3300010375 Ga0105239_10148021 Ga0105239_101480213 112
784 3300010375 Ga0105239_10224353 Ga0105239_102243532 112
785 3300010375 Ga0105239_10310762 Ga0105239_103107623 112
786 3300010375 Ga0105239_10380555 Ga0105239_103805553 112
787 3300010375 Ga0105239_10555620 Ga0105239_105556202 112
788 3300010375 Ga0105239_10667290 Ga0105239_106672902 112
789 3300010375 Ga0105239_10908126 Ga0105239_109081262 112
790 3300010375 Ga0105239_11059803 Ga0105239_110598031 112
791 3300010375 Ga0105239_11340470 Ga0105239_113404702 112
792 3300010375 Ga0105239_11526473 Ga0105239_115264732 112
793 3300010375 Ga0105239_11995666 Ga0105239_119956661 112
794 3300010375 Ga0105239_12388581 Ga0105239_123885811 112
795 3300010375 Ga0105239_12965415 Ga0105239_129654151 112
796 3300010375 Ga0105239_13498654 Ga0105239_134986542 112
797 3300011119 Ga0105246_10000623 Ga0105246_1000062317 112
798 3300011119 Ga0105246_10030324 Ga0105246_100303245 112
799 3300011119 Ga0105246_10032578 Ga0105246_100325782 112
800 3300011119 Ga0105246_10674149 Ga0105246_106741492 112
801 3300012510 Ga0157316_1024382 Ga0157316_10243822 112
802 3300013100 Ga0157373_10088591 Ga0157373_100885912 112
803 3300013100 Ga0157373_10110215 Ga0157373_101102152 112
804 3300013100 Ga0157373_10115492 Ga0157373_101154922 112
805 3300013100 Ga0157373_10340115 Ga0157373_103401151 112
806 3300013100 Ga0157373_10392901 Ga0157373_103929011 112
807 3300013102 Ga0157371_10013549 Ga0157371_100135493 112
808 3300013102 Ga0157371_10024040 Ga0157371_100240401 112
809 3300013102 Ga0157371_10223625 Ga0157371_102236252 112
810 3300013102 Ga0157371_10486855 Ga0157371_104868552 112
811 3300013104 Ga0157370_10000110 Ga0157370_1000011061 112
812 3300013104 Ga0157370_10010542 Ga0157370_100105422 112
813 3300013104 Ga0157370_10033050 Ga0157370_100330503 112
814 3300013104 Ga0157370_10033931 Ga0157370_100339312 112
815 3300013104 Ga0157370_10037468 Ga0157370_100374684 112
816 3300013104 Ga0157370_10054800 Ga0157370_100548001 112
817 3300013104 Ga0157370_10146565 Ga0157370_101465652 112
818 3300013104 Ga0157370_10181468 Ga0157370_101814682 112
819 3300013104 Ga0157370_10234869 Ga0157370_102348692 112
820 3300013104 Ga0157370_10351916 Ga0157370_103519162 112
821 3300013104 Ga0157370_10411456 Ga0157370_104114562 112
822 3300013104 Ga0157370_10494156 Ga0157370_104941562 112
823 3300013104 Ga0157370_10502531 Ga0157370_105025311 112
824 3300013104 Ga0157370_10587295 Ga0157370_105872952 112
825 3300013104 Ga0157370_10626201 Ga0157370_106262012 112
826 3300013104 Ga0157370_10772725 Ga0157370_107727252 112
827 3300013105 Ga0157369_10000162 Ga0157369_1000016261 112
828 3300013105 Ga0157369_10002576 Ga0157369_100025761 112
829 3300013105 Ga0157369_10002760 Ga0157369_1000276012 112
830 3300013105 Ga0157369_10012232 Ga0157369_100122327 112
831 3300013105 Ga0157369_10016602 Ga0157369_100166026 112
832 3300013105 Ga0157369_10016811 Ga0157369_100168115 112
833 3300013105 Ga0157369_10017943 Ga0157369_100179434 112
834 3300013105 Ga0157369_10040564 Ga0157369_100405643 112
835 3300013105 Ga0157369_10043129 Ga0157369_100431292 112
836 3300013105 Ga0157369_10055977 Ga0157369_100559775 112
837 3300013105 Ga0157369_10140129 Ga0157369_101401292 112
838 3300013105 Ga0157369_10195508 Ga0157369_101955082 112
839 3300013105 Ga0157369_10206263 Ga0157369_102062632 112
840 3300013105 Ga0157369_10267274 Ga0157369_102672742 112
841 3300013105 Ga0157369_10307921 Ga0157369_103079212 112
842 3300013105 Ga0157369_10656965 Ga0157369_106569652 112
843 3300013105 Ga0157369_10739846 Ga0157369_107398462 112
844 3300013105 Ga0157369_10747971 Ga0157369_107479711 112
845 3300013105 Ga0157369_11177490 Ga0157369_111774902 112
846 3300013105 Ga0157369_12012586 Ga0157369_120125862 112
847 3300013296 Ga0157374_10001094 Ga0157374_1000109413 112
848 3300013296 Ga0157374_10001844 Ga0157374_100018445 112
849 3300013296 Ga0157374_10002773 Ga0157374_100027738 112
850 3300013296 Ga0157374_10015115 Ga0157374_100151158 112
851 3300013296 Ga0157374_10015176 Ga0157374_100151766 112
852 3300013296 Ga0157374_10022411 Ga0157374_100224114 112
853 3300013296 Ga0157374_10027298 Ga0157374_100272986 112
854 3300013296 Ga0157374_10042374 Ga0157374_100423742 112
855 3300013296 Ga0157374_10062887 Ga0157374_100628874 112
856 3300013296 Ga0157374_10074128 Ga0157374_100741282 112
857 3300013296 Ga0157374_10089896 Ga0157374_100898962 112
858 3300013296 Ga0157374_10093275 Ga0157374_100932753 112
859 3300013296 Ga0157374_10098456 Ga0157374_100984562 112
860 3300013296 Ga0157374_10111719 Ga0157374_101117194 112
861 3300013296 Ga0157374_10289734 Ga0157374_102897342 112
862 3300013296 Ga0157374_10290850 Ga0157374_102908502 112
863 3300013296 Ga0157374_10497609 Ga0157374_104976092 112
864 3300013296 Ga0157374_10696099 Ga0157374_106960992 112
865 3300013296 Ga0157374_10789246 Ga0157374_107892461 112
866 3300013296 Ga0157374_11077274 Ga0157374_110772742 112
867 3300013296 Ga0157374_11129271 Ga0157374_111292712 112
868 3300013296 Ga0157374_11483277 Ga0157374_114832771 112
869 3300013296 Ga0157374_12073853 Ga0157374_120738531 112
870 3300013296 Ga0157374_12150581 Ga0157374_121505811 112
871 3300013296 Ga0157374_12254118 Ga0157374_122541181 112
872 3300013297 Ga0157378_10000852 Ga0157378_100008525 112
873 3300013297 Ga0157378_10001216 Ga0157378_1000121621 112
874 3300013297 Ga0157378_10001914 Ga0157378_1000191412 112
875 3300013297 Ga0157378_10006171 Ga0157378_100061718 112
876 3300013297 Ga0157378_10017818 Ga0157378_100178182 112
877 3300013297 Ga0157378_10017845 Ga0157378_100178454 112
878 3300013297 Ga0157378_10034547 Ga0157378_100345474 112
879 3300013297 Ga0157378_10043257 Ga0157378_100432574 112
880 3300013297 Ga0157378_10044149 Ga0157378_100441492 112
881 3300013297 Ga0157378_10098881 Ga0157378_100988812 112
882 3300013297 Ga0157378_10236094 Ga0157378_102360943 112
883 3300013297 Ga0157378_10462435 Ga0157378_104624352 112
884 3300013297 Ga0157378_10564275 Ga0157378_105642753 112
885 3300013297 Ga0157378_10863441 Ga0157378_108634412 112
886 3300013297 Ga0157378_12442240 Ga0157378_124422401 112
887 3300013306 Ga0163162_10003253 Ga0163162_100032539 112
888 3300013306 Ga0163162_10006554 Ga0163162_100065545 112
889 3300013306 Ga0163162_10007686 Ga0163162_100076863 112
890 3300013306 Ga0163162_10029772 Ga0163162_100297723 112
891 3300013306 Ga0163162_10029947 Ga0163162_100299477 112
892 3300013306 Ga0163162_10110901 Ga0163162_101109014 112
893 3300013306 Ga0163162_10124181 Ga0163162_101241811 112
894 3300013306 Ga0163162_10127674 Ga0163162_101276744 112
895 3300013306 Ga0163162_10173385 Ga0163162_101733853 112
896 3300013306 Ga0163162_10312934 Ga0163162_103129342 112
897 3300013306 Ga0163162_10482861 Ga0163162_104828612 112
898 3300013306 Ga0163162_10673765 Ga0163162_106737651 112
899 3300013306 Ga0163162_10682503 Ga0163162_106825032 112
900 3300013306 Ga0163162_11023364 Ga0163162_110233642 112
901 3300013306 Ga0163162_11043271 Ga0163162_110432711 112
902 3300013306 Ga0163162_11330793 Ga0163162_113307932 112
903 3300013306 Ga0163162_11516863 Ga0163162_115168632 112
904 3300013306 Ga0163162_11787388 Ga0163162_117873882 112
905 3300013307 Ga0157372_10000276 Ga0157372_1000027628 112
906 3300013307 Ga0157372_10002164 Ga0157372_1000216411 112
907 3300013307 Ga0157372_10004425 Ga0157372_100044252 112
908 3300013307 Ga0157372_10017408 Ga0157372_100174083 112
909 3300013307 Ga0157372_10021851 Ga0157372_100218512 112
910 3300013307 Ga0157372_10025779 Ga0157372_100257794 112
911 3300013307 Ga0157372_10043485 Ga0157372_100434852 112
912 3300013307 Ga0157372_10074180 Ga0157372_100741802 112
913 3300013307 Ga0157372_10088297 Ga0157372_100882972 112
914 3300013307 Ga0157372_10094515 Ga0157372_100945152 112
915 3300013307 Ga0157372_10094815 Ga0157372_100948154 112
916 3300013307 Ga0157372_10146864 Ga0157372_101468644 112
917 3300013307 Ga0157372_10165997 Ga0157372_101659973 112
918 3300013307 Ga0157372_10202511 Ga0157372_102025112 112
919 3300013307 Ga0157372_10278337 Ga0157372_102783372 112
920 3300013307 Ga0157372_10487286 Ga0157372_104872862 112
921 3300013307 Ga0157372_10661068 Ga0157372_106610682 112
922 3300013307 Ga0157372_10890178 Ga0157372_108901781 112
923 3300013307 Ga0157372_10902693 Ga0157372_109026932 112
924 3300013307 Ga0157372_11050876 Ga0157372_110508762 112
925 3300013307 Ga0157372_11146848 Ga0157372_111468481 112
926 3300013307 Ga0157372_11228828 Ga0157372_112288282 112
927 3300013307 Ga0157372_11357558 Ga0157372_113575581 112
928 3300013307 Ga0157372_11681584 Ga0157372_116815841 112
929 3300013307 Ga0157372_12255037 Ga0157372_122550371 112
930 3300013307 Ga0157372_13147991 Ga0157372_131479911 112
931 3300013308 Ga0157375_10001815 Ga0157375_1000181512 112
932 3300013308 Ga0157375_10006530 Ga0157375_100065304 112
933 3300013308 Ga0157375_10017741 Ga0157375_100177412 112
934 3300013308 Ga0157375_10018214 Ga0157375_100182145 112
935 3300013308 Ga0157375_10026750 Ga0157375_100267507 112
936 3300013308 Ga0157375_10067984 Ga0157375_100679843 112
937 3300013308 Ga0157375_10163131 Ga0157375_101631313 112
938 3300013308 Ga0157375_11188114 Ga0157375_111881141 112
939 3300013308 Ga0157375_11636243 Ga0157375_116362432 112
940 3300013308 Ga0157375_11693093 Ga0157375_116930931 112
941 3300013308 Ga0157375_11810415 Ga0157375_118104152 112
942 3300013308 Ga0157375_12087231 Ga0157375_120872311 112
943 3300013308 Ga0157375_12890382 Ga0157375_128903821 112
944 3300013308 Ga0157375_13010708 Ga0157375_130107081 112
945 3300014325 Ga0163163_10008343 Ga0163163_100083436 112
946 3300014325 Ga0163163_10056817 Ga0163163_100568172 112
947 3300014325 Ga0163163_10060127 Ga0163163_100601272 112
948 3300014325 Ga0163163_10377690 Ga0163163_103776903 112
949 3300014325 Ga0163163_10440100 Ga0163163_104401001 112
950 3300014325 Ga0163163_10497229 Ga0163163_104972291 112
951 3300014325 Ga0163163_10999668 Ga0163163_109996681 112
952 3300014325 Ga0163163_11026700 Ga0163163_110267002 112
953 3300014325 Ga0163163_11086664 Ga0163163_110866641 112
954 3300014325 Ga0163163_11174127 Ga0163163_111741271 112
955 3300014326 Ga0157380_10003685 Ga0157380_1000368510 112
956 3300014326 Ga0157380_10172710 Ga0157380_101727103 112
957 3300014326 Ga0157380_10201916 Ga0157380_102019162 112
958 3300014326 Ga0157380_11836563 Ga0157380_118365631 112
959 3300014497 Ga0182008_10140659 Ga0182008_101406592 112
960 3300014745 Ga0157377_10296143 Ga0157377_102961431 112
961 3300014745 Ga0157377_10371669 Ga0157377_103716692 112
962 3300014745 Ga0157377_10445271 Ga0157377_104452712 112
963 3300014745 Ga0157377_10460179 Ga0157377_104601792 112
964 3300014745 Ga0157377_11416708 Ga0157377_114167082 112
965 3300014968 Ga0157379_10000825 Ga0157379_1000082511 112
966 3300014968 Ga0157379_10003521 Ga0157379_1000352112 112
967 3300014968 Ga0157379_10046251 Ga0157379_100462512 112
968 3300014968 Ga0157379_10091153 Ga0157379_100911532 112
969 3300014968 Ga0157379_10091955 Ga0157379_100919552 112
970 3300014968 Ga0157379_10121200 Ga0157379_101212002 112
971 3300014968 Ga0157379_10151137 Ga0157379_101511372 112
972 3300014968 Ga0157379_10166226 Ga0157379_101662263 112
973 3300014968 Ga0157379_10190457 Ga0157379_101904571 112
974 3300014968 Ga0157379_10296941 Ga0157379_102969411 112
975 3300014968 Ga0157379_10306518 Ga0157379_103065182 112
976 3300014968 Ga0157379_10332935 Ga0157379_103329354 112
977 3300014968 Ga0157379_10425702 Ga0157379_104257022 112
978 3300014968 Ga0157379_10452641 Ga0157379_104526412 112
979 3300014969 Ga0157376_10004936 Ga0157376_1000493610 112
980 3300014969 Ga0157376_10028242 Ga0157376_100282424 112
981 3300014969 Ga0157376_10033123 Ga0157376_100331234 112
982 3300014969 Ga0157376_10034621 Ga0157376_100346215 112
983 3300014969 Ga0157376_10056935 Ga0157376_100569353 112
984 3300014969 Ga0157376_10065433 Ga0157376_100654332 112
985 3300014969 Ga0157376_10104339 Ga0157376_101043393 112
986 3300014969 Ga0157376_10156906 Ga0157376_101569062 112
987 3300014969 Ga0157376_10195561 Ga0157376_101955612 112
988 3300014969 Ga0157376_10295097 Ga0157376_102950972 112
989 3300014969 Ga0157376_10297136 Ga0157376_102971363 112
990 3300014969 Ga0157376_10315296 Ga0157376_103152962 112
991 3300014969 Ga0157376_10329098 Ga0157376_103290982 112
992 3300014969 Ga0157376_11403233 Ga0157376_114032331 112
993 3300014969 Ga0157376_11783198 Ga0157376_117831981 112
994 3300015261 Ga0182006_1025974 Ga0182006_10259742 112
995 3300017792 Ga0163161_10010112 Ga0163161_100101124 112
996 3300017792 Ga0163161_10193284 Ga0163161_101932842 112
997 3300017792 Ga0163161_10512528 Ga0163161_105125282 112
998 3300017792 Ga0163161_11364725 Ga0163161_113647251 112
999 3300020080 Ga0206350_11639771 Ga0206350_116397712 112
1000 3300020081 Ga0206354_11705963 Ga0206354_117059632 112
1001 3300021361 Ga0213872_10002030 Ga0213872_100020305 112
1002 3300021361 Ga0213872_10012963 Ga0213872_100129632 112
1003 3300021361 Ga0213872_10106788 Ga0213872_101067882 112
1004 3300021361 Ga0213872_10114652 Ga0213872_101146522 112
1005 3300021361 Ga0213872_10300041 Ga0213872_103000412 112
1006 3300021377 Ga0213874_10060779 Ga0213874_100607792 112
1007 3300021441 Ga0213871_10055645 Ga0213871_100556452 112
1008 3300021441 Ga0213871_10080713 Ga0213871_100807132 112
1009 3300024227 Ga0228598_1007218 Ga0228598_10072182 112
1010 3300025261 Ga0209233_1021489 Ga0209233_10214892 112
1011 3300025315 Ga0207697_10279538 Ga0207697_102795382 112
1012 3300025321 Ga0207656_10018418 Ga0207656_100184183 112
1013 3300025321 Ga0207656_10122187 Ga0207656_101221872 112
1014 3300025321 Ga0207656_10140433 Ga0207656_101404331 112
1015 3300025321 Ga0207656_10241699 Ga0207656_102416992 112
1016 3300025321 Ga0207656_10580996 Ga0207656_105809962 112
1017 3300025711 Ga0207696_1191954 Ga0207696_11919542 112
1018 3300025885 Ga0207653_10101732 Ga0207653_101017322 112
1019 3300025898 Ga0207692_10006591 Ga0207692_100065912 112
1020 3300025898 Ga0207692_10007842 Ga0207692_100078424 112
1021 3300025898 Ga0207692_10014058 Ga0207692_100140582 112
1022 3300025898 Ga0207692_10786691 Ga0207692_107866912 112
1023 3300025898 Ga0207692_10845036 Ga0207692_108450361 112
1024 3300025898 Ga0207692_11125645 Ga0207692_111256451 112
1025 3300025899 Ga0207642_10052886 Ga0207642_100528861 112
1026 3300025899 Ga0207642_10062041 Ga0207642_100620412 112
1027 3300025899 Ga0207642_10106637 Ga0207642_101066372 112
1028 3300025899 Ga0207642_10294244 Ga0207642_102942442 112
1029 3300025900 Ga0207710_10010209 Ga0207710_100102093 112
1030 3300025900 Ga0207710_10117631 Ga0207710_101176312 112
1031 3300025900 Ga0207710_10247018 Ga0207710_102470181 112
1032 3300025900 Ga0207710_10336491 Ga0207710_103364912 112
1033 3300025900 Ga0207710_10553897 Ga0207710_105538971 112
1034 3300025901 Ga0207688_10004014 Ga0207688_100040144 112
1035 3300025901 Ga0207688_10641226 Ga0207688_106412261 112
1036 3300025903 Ga0207680_10011264 Ga0207680_100112644 112
1037 3300025903 Ga0207680_10020889 Ga0207680_100208892 112
1038 3300025903 Ga0207680_10082401 Ga0207680_100824012 112
1039 3300025903 Ga0207680_10106888 Ga0207680_101068882 112
1040 3300025903 Ga0207680_10763409 Ga0207680_107634092 112
1041 3300025904 Ga0207647_10001229 Ga0207647_1000122920 112
1042 3300025904 Ga0207647_10001523 Ga0207647_1000152312 112
1043 3300025904 Ga0207647_10002120 Ga0207647_1000212010 112
1044 3300025904 Ga0207647_10004333 Ga0207647_100043337 112
1045 3300025904 Ga0207647_10071098 Ga0207647_100710981 112
1046 3300025904 Ga0207647_10207969 Ga0207647_102079692 112
1047 3300025905 Ga0207685_10005408 Ga0207685_100054082 112
1048 3300025905 Ga0207685_10019658 Ga0207685_100196581 112
1049 3300025905 Ga0207685_10117496 Ga0207685_101174962 112
1050 3300025905 Ga0207685_10140359 Ga0207685_101403592 112
1051 3300025905 Ga0207685_10689018 Ga0207685_106890181 112
1052 3300025906 Ga0207699_10005332 Ga0207699_100053323 112
1053 3300025906 Ga0207699_10034321 Ga0207699_100343216 112
1054 3300025906 Ga0207699_10037468 Ga0207699_100374681 112
1055 3300025906 Ga0207699_10095006 Ga0207699_100950062 112
1056 3300025906 Ga0207699_10366141 Ga0207699_103661412 112
1057 3300025906 Ga0207699_10555028 Ga0207699_105550282 112
1058 3300025906 Ga0207699_10688688 Ga0207699_106886882 112
1059 3300025906 Ga0207699_10744993 Ga0207699_107449931 112
1060 3300025906 Ga0207699_10947309 Ga0207699_109473091 112
1061 3300025906 Ga0207699_11016187 Ga0207699_110161871 112
1062 3300025907 Ga0207645_10001940 Ga0207645_1000194013 112
1063 3300025907 Ga0207645_10006711 Ga0207645_100067113 112
1064 3300025907 Ga0207645_10027694 Ga0207645_100276945 112
1065 3300025908 Ga0207643_10280250 Ga0207643_102802502 112
1066 3300025908 Ga0207643_10768457 Ga0207643_107684572 112
1067 3300025909 Ga0207705_10000013 Ga0207705_1000001373 112
1068 3300025909 Ga0207705_10000585 Ga0207705_1000058521 112
1069 3300025909 Ga0207705_10004143 Ga0207705_100041432 112
1070 3300025909 Ga0207705_10018627 Ga0207705_100186273 112
1071 3300025909 Ga0207705_10027208 Ga0207705_100272083 112
1072 3300025909 Ga0207705_10055786 Ga0207705_100557862 112
1073 3300025909 Ga0207705_10058290 Ga0207705_100582902 112
1074 3300025909 Ga0207705_10099463 Ga0207705_100994632 112
1075 3300025909 Ga0207705_10183271 Ga0207705_101832712 112
1076 3300025909 Ga0207705_10751584 Ga0207705_107515842 112
1077 3300025910 Ga0207684_10001356 Ga0207684_1000135610 112
1078 3300025910 Ga0207684_10084336 Ga0207684_100843362 112
1079 3300025910 Ga0207684_10119358 Ga0207684_101193582 112
1080 3300025910 Ga0207684_10279636 Ga0207684_102796362 112
1081 3300025910 Ga0207684_11744907 Ga0207684_117449071 112
1082 3300025911 Ga0207654_10002789 Ga0207654_100027894 112
1083 3300025911 Ga0207654_10005967 Ga0207654_100059672 112
1084 3300025911 Ga0207654_10014520 Ga0207654_100145201 112
1085 3300025911 Ga0207654_10131988 Ga0207654_101319882 112
1086 3300025911 Ga0207654_10158205 Ga0207654_101582052 112
1087 3300025911 Ga0207654_10190778 Ga0207654_101907782 112
1088 3300025911 Ga0207654_10249014 Ga0207654_102490142 112
1089 3300025911 Ga0207654_10292305 Ga0207654_102923052 112
1090 3300025911 Ga0207654_10429045 Ga0207654_104290451 112
1091 3300025911 Ga0207654_10731292 Ga0207654_107312922 112
1092 3300025911 Ga0207654_11432280 Ga0207654_114322801 112
1093 3300025912 Ga0207707_10030731 Ga0207707_100307312 112
1094 3300025912 Ga0207707_10041436 Ga0207707_100414362 112
1095 3300025912 Ga0207707_10068635 Ga0207707_100686352 112
1096 3300025912 Ga0207707_10118635 Ga0207707_101186352 112
1097 3300025912 Ga0207707_10251752 Ga0207707_102517522 112
1098 3300025912 Ga0207707_10401830 Ga0207707_104018301 112
1099 3300025912 Ga0207707_10478918 Ga0207707_104789182 112
1100 3300025912 Ga0207707_10502282 Ga0207707_105022821 112
1101 3300025912 Ga0207707_11181711 Ga0207707_111817112 112
1102 3300025912 Ga0207707_11474727 Ga0207707_114747272 112
1103 3300025913 Ga0207695_10000035 Ga0207695_10000035378 112
1104 3300025913 Ga0207695_10000047 Ga0207695_1000004766 112
1105 3300025913 Ga0207695_10010561 Ga0207695_100105613 112
1106 3300025913 Ga0207695_10020137 Ga0207695_1002013711 112
1107 3300025913 Ga0207695_10072734 Ga0207695_100727343 112
1108 3300025913 Ga0207695_10089813 Ga0207695_100898132 112
1109 3300025913 Ga0207695_10166666 Ga0207695_101666662 112
1110 3300025913 Ga0207695_10183809 Ga0207695_101838092 112
1111 3300025913 Ga0207695_10188887 Ga0207695_101888872 112
1112 3300025913 Ga0207695_10246144 Ga0207695_102461441 112
1113 3300025913 Ga0207695_10273370 Ga0207695_102733701 112
1114 3300025913 Ga0207695_10389116 Ga0207695_103891162 112
1115 3300025913 Ga0207695_10416068 Ga0207695_104160682 112
1116 3300025913 Ga0207695_10899738 Ga0207695_108997381 112
1117 3300025913 Ga0207695_11153016 Ga0207695_111530162 112
1118 3300025914 Ga0207671_10069308 Ga0207671_100693082 112
1119 3300025914 Ga0207671_10090324 Ga0207671_100903242 112
1120 3300025914 Ga0207671_10094962 Ga0207671_100949624 112
1121 3300025914 Ga0207671_10105929 Ga0207671_101059292 112
1122 3300025914 Ga0207671_10125219 Ga0207671_101252192 112
1123 3300025914 Ga0207671_10135588 Ga0207671_101355882 112
1124 3300025914 Ga0207671_10183605 Ga0207671_101836052 112
1125 3300025914 Ga0207671_10242995 Ga0207671_102429954 112
1126 3300025914 Ga0207671_10298715 Ga0207671_102987152 112
1127 3300025914 Ga0207671_10855865 Ga0207671_108558652 112
1128 3300025915 Ga0207693_10000065 Ga0207693_1000006557 112
1129 3300025915 Ga0207693_10000328 Ga0207693_1000032817 112
1130 3300025915 Ga0207693_10001244 Ga0207693_100012442 112
1131 3300025915 Ga0207693_10014186 Ga0207693_100141861 112
1132 3300025915 Ga0207693_10028178 Ga0207693_100281781 112
1133 3300025915 Ga0207693_10064050 Ga0207693_100640504 112
1134 3300025915 Ga0207693_10657471 Ga0207693_106574712 112
1135 3300025915 Ga0207693_11188679 Ga0207693_111886791 112
1136 3300025916 Ga0207663_10008681 Ga0207663_100086812 112
1137 3300025916 Ga0207663_10016485 Ga0207663_100164852 112
1138 3300025916 Ga0207663_10035597 Ga0207663_100355972 112
1139 3300025916 Ga0207663_10093605 Ga0207663_100936051 112
1140 3300025916 Ga0207663_10124953 Ga0207663_101249532 112
1141 3300025916 Ga0207663_10149712 Ga0207663_101497122 112
1142 3300025916 Ga0207663_10224814 Ga0207663_102248142 112
1143 3300025916 Ga0207663_10399399 Ga0207663_103993992 112
1144 3300025916 Ga0207663_10561288 Ga0207663_105612881 112
1145 3300025916 Ga0207663_10657392 Ga0207663_106573922 112
1146 3300025916 Ga0207663_10981830 Ga0207663_109818301 112
1147 3300025916 Ga0207663_10983675 Ga0207663_109836752 112
1148 3300025916 Ga0207663_10990870 Ga0207663_109908702 112
1149 3300025916 Ga0207663_11321583 Ga0207663_113215832 112
1150 3300025916 Ga0207663_11372126 Ga0207663_113721261 112
1151 3300025917 Ga0207660_10033768 Ga0207660_100337682 112
1152 3300025917 Ga0207660_10052348 Ga0207660_100523484 112
1153 3300025917 Ga0207660_11076671 Ga0207660_110766712 112
1154 3300025917 Ga0207660_11361921 Ga0207660_113619211 112
1155 3300025918 Ga0207662_10180736 Ga0207662_101807363 112
1156 3300025918 Ga0207662_10393861 Ga0207662_103938612 112
1157 3300025919 Ga0207657_10000099 Ga0207657_100000996 112
1158 3300025919 Ga0207657_10000664 Ga0207657_1000066423 112
1159 3300025919 Ga0207657_10002042 Ga0207657_1000204213 112
1160 3300025919 Ga0207657_10009952 Ga0207657_100099525 112
1161 3300025919 Ga0207657_10009959 Ga0207657_100099592 112
1162 3300025919 Ga0207657_10060185 Ga0207657_100601852 112
1163 3300025919 Ga0207657_10082714 Ga0207657_100827144 112
1164 3300025919 Ga0207657_10395626 Ga0207657_103956262 112
1165 3300025920 Ga0207649_10003008 Ga0207649_1000300810 112
1166 3300025920 Ga0207649_10004398 Ga0207649_100043983 112
1167 3300025920 Ga0207649_10005481 Ga0207649_100054817 112
1168 3300025920 Ga0207649_10033259 Ga0207649_100332592 112
1169 3300025920 Ga0207649_10067829 Ga0207649_100678292 112
1170 3300025920 Ga0207649_10178279 Ga0207649_101782792 112
1171 3300025920 Ga0207649_10622203 Ga0207649_106222032 112
1172 3300025920 Ga0207649_11102760 Ga0207649_111027602 112
1173 3300025921 Ga0207652_10007556 Ga0207652_100075562 112
1174 3300025921 Ga0207652_10021099 Ga0207652_100210992 112
1175 3300025921 Ga0207652_10025973 Ga0207652_100259733 112
1176 3300025921 Ga0207652_10059268 Ga0207652_100592681 112
1177 3300025921 Ga0207652_10115865 Ga0207652_101158652 112
1178 3300025921 Ga0207652_10137314 Ga0207652_101373143 112
1179 3300025921 Ga0207652_10201782 Ga0207652_102017822 112
1180 3300025921 Ga0207652_10208608 Ga0207652_102086081 112
1181 3300025921 Ga0207652_10219023 Ga0207652_102190231 112
1182 3300025921 Ga0207652_10283282 Ga0207652_102832822 112
1183 3300025922 Ga0207646_10000020 Ga0207646_100000202 112
1184 3300025922 Ga0207646_10400938 Ga0207646_104009382 112
1185 3300025922 Ga0207646_10504138 Ga0207646_105041381 112
1186 3300025922 Ga0207646_11342293 Ga0207646_113422931 112
1187 3300025923 Ga0207681_10167233 Ga0207681_101672332 112
1188 3300025923 Ga0207681_10386613 Ga0207681_103866132 112
1189 3300025923 Ga0207681_10406145 Ga0207681_104061452 112
1190 3300025923 Ga0207681_10748137 Ga0207681_107481372 112
1191 3300025924 Ga0207694_10001171 Ga0207694_100011715 112
1192 3300025924 Ga0207694_10001342 Ga0207694_100013429 112
1193 3300025924 Ga0207694_10009268 Ga0207694_100092688 112
1194 3300025924 Ga0207694_10026083 Ga0207694_100260832 112
1195 3300025924 Ga0207694_10028788 Ga0207694_100287887 112
1196 3300025924 Ga0207694_10039165 Ga0207694_100391655 112
1197 3300025924 Ga0207694_10060752 Ga0207694_100607522 112
1198 3300025924 Ga0207694_10062118 Ga0207694_100621181 112
1199 3300025924 Ga0207694_10086457 Ga0207694_100864572 112
1200 3300025924 Ga0207694_10099657 Ga0207694_100996572 112
1201 3300025924 Ga0207694_10111398 Ga0207694_101113982 112
1202 3300025924 Ga0207694_10113635 Ga0207694_101136352 112
1203 3300025924 Ga0207694_10138356 Ga0207694_101383562 112
1204 3300025924 Ga0207694_10204190 Ga0207694_102041902 112
1205 3300025924 Ga0207694_10364031 Ga0207694_103640312 112
1206 3300025924 Ga0207694_10701846 Ga0207694_107018462 112
1207 3300025924 Ga0207694_10812496 Ga0207694_108124961 112
1208 3300025924 Ga0207694_10968273 Ga0207694_109682731 112
1209 3300025925 Ga0207650_11916914 Ga0207650_119169142 112
1210 3300025926 Ga0207659_10831255 Ga0207659_108312552 112
1211 3300025926 Ga0207659_11360314 Ga0207659_113603142 112
1212 3300025927 Ga0207687_10013538 Ga0207687_100135381 112
1213 3300025927 Ga0207687_10021376 Ga0207687_100213762 112
1214 3300025927 Ga0207687_10068353 Ga0207687_100683531 112
1215 3300025927 Ga0207687_10114084 Ga0207687_101140842 112
1216 3300025927 Ga0207687_10128331 Ga0207687_101283313 112
1217 3300025927 Ga0207687_10163849 Ga0207687_101638492 112
1218 3300025927 Ga0207687_10277034 Ga0207687_102770342 112
1219 3300025927 Ga0207687_10286663 Ga0207687_102866632 112
1220 3300025927 Ga0207687_10893853 Ga0207687_108938532 112
1221 3300025928 Ga0207700_10000988 Ga0207700_1000098813 112
1222 3300025928 Ga0207700_10055797 Ga0207700_100557971 112
1223 3300025928 Ga0207700_10136488 Ga0207700_101364883 112
1224 3300025928 Ga0207700_10206905 Ga0207700_102069052 112
1225 3300025928 Ga0207700_10213247 Ga0207700_102132473 112
1226 3300025928 Ga0207700_10219478 Ga0207700_102194782 112
1227 3300025928 Ga0207700_10435470 Ga0207700_104354702 112
1228 3300025928 Ga0207700_10558029 Ga0207700_105580292 112
1229 3300025928 Ga0207700_10584569 Ga0207700_105845692 112
1230 3300025928 Ga0207700_10605466 Ga0207700_106054662 112
1231 3300025928 Ga0207700_10669129 Ga0207700_106691292 112
1232 3300025928 Ga0207700_10841443 Ga0207700_108414432 112
1233 3300025928 Ga0207700_10878310 Ga0207700_108783101 112
1234 3300025928 Ga0207700_11407557 Ga0207700_114075571 112
1235 3300025928 Ga0207700_11728478 Ga0207700_117284781 112
1236 3300025929 Ga0207664_10049185 Ga0207664_100491854 112
1237 3300025929 Ga0207664_10062192 Ga0207664_100621922 112
1238 3300025929 Ga0207664_10317487 Ga0207664_103174871 112
1239 3300025929 Ga0207664_10399607 Ga0207664_103996072 112
1240 3300025929 Ga0207664_10726452 Ga0207664_107264522 112
1241 3300025929 Ga0207664_10822830 Ga0207664_108228302 112
1242 3300025929 Ga0207664_10897158 Ga0207664_108971581 112
1243 3300025929 Ga0207664_11086845 Ga0207664_110868452 112
1244 3300025931 Ga0207644_10006838 Ga0207644_100068382 112
1245 3300025931 Ga0207644_10065803 Ga0207644_100658034 112
1246 3300025931 Ga0207644_10094028 Ga0207644_100940282 112
1247 3300025931 Ga0207644_10489242 Ga0207644_104892422 112
1248 3300025932 Ga0207690_10000932 Ga0207690_1000093220 112
1249 3300025932 Ga0207690_10004700 Ga0207690_100047002 112
1250 3300025932 Ga0207690_10012962 Ga0207690_100129623 112
1251 3300025932 Ga0207690_10024883 Ga0207690_100248832 112
1252 3300025932 Ga0207690_10037151 Ga0207690_100371512 112
1253 3300025932 Ga0207690_10113764 Ga0207690_101137642 112
1254 3300025932 Ga0207690_10121718 Ga0207690_101217182 112
1255 3300025932 Ga0207690_11019489 Ga0207690_110194892 112
1256 3300025933 Ga0207706_10000247 Ga0207706_1000024734 112
1257 3300025933 Ga0207706_10002670 Ga0207706_100026702 112
1258 3300025933 Ga0207706_10007404 Ga0207706_100074042 112
1259 3300025933 Ga0207706_10045081 Ga0207706_100450812 112
1260 3300025933 Ga0207706_10163663 Ga0207706_101636632 112
1261 3300025933 Ga0207706_10817884 Ga0207706_108178841 112
1262 3300025934 Ga0207686_10032419 Ga0207686_100324192 112
1263 3300025934 Ga0207686_10076618 Ga0207686_100766182 112
1264 3300025934 Ga0207686_10310555 Ga0207686_103105553 112
1265 3300025934 Ga0207686_10935815 Ga0207686_109358151 112
1266 3300025934 Ga0207686_10944810 Ga0207686_109448102 112
1267 3300025935 Ga0207709_10149123 Ga0207709_101491232 112
1268 3300025935 Ga0207709_10759776 Ga0207709_107597761 112
1269 3300025936 Ga0207670_10079658 Ga0207670_100796581 112
1270 3300025936 Ga0207670_10199360 Ga0207670_101993602 112
1271 3300025936 Ga0207670_10483541 Ga0207670_104835412 112
1272 3300025936 Ga0207670_11356782 Ga0207670_113567821 112
1273 3300025937 Ga0207669_10001810 Ga0207669_1000181011 112
1274 3300025937 Ga0207669_11001969 Ga0207669_110019692 112
1275 3300025938 Ga0207704_10002045 Ga0207704_100020459 112
1276 3300025938 Ga0207704_10031994 Ga0207704_100319944 112
1277 3300025938 Ga0207704_10143939 Ga0207704_101439392 112
1278 3300025938 Ga0207704_10375440 Ga0207704_103754402 112
1279 3300025938 Ga0207704_10454514 Ga0207704_104545141 112
1280 3300025938 Ga0207704_10873823 Ga0207704_108738231 112
1281 3300025938 Ga0207704_11121172 Ga0207704_111211721 112
1282 3300025939 Ga0207665_10000262 Ga0207665_1000026230 112
1283 3300025939 Ga0207665_10001298 Ga0207665_100012986 112
1284 3300025939 Ga0207665_10019608 Ga0207665_100196082 112
1285 3300025939 Ga0207665_10021989 Ga0207665_100219891 112
1286 3300025939 Ga0207665_10209549 Ga0207665_102095492 112
1287 3300025939 Ga0207665_10233336 Ga0207665_102333362 112
1288 3300025939 Ga0207665_10300828 Ga0207665_103008281 112
1289 3300025939 Ga0207665_10550791 Ga0207665_105507912 112
1290 3300025939 Ga0207665_11089414 Ga0207665_110894142 112
1291 3300025939 Ga0207665_11113867 Ga0207665_111138671 112
1292 3300025940 Ga0207691_10015768 Ga0207691_100157689 112
1293 3300025940 Ga0207691_10246731 Ga0207691_102467312 112
1294 3300025940 Ga0207691_10247576 Ga0207691_102475762 112
1295 3300025940 Ga0207691_10733881 Ga0207691_107338812 112
1296 3300025940 Ga0207691_10889684 Ga0207691_108896842 112
1297 3300025940 Ga0207691_11390159 Ga0207691_113901591 112
1298 3300025940 Ga0207691_11447591 Ga0207691_114475911 112
1299 3300025941 Ga0207711_10008693 Ga0207711_100086934 112
1300 3300025941 Ga0207711_10010686 Ga0207711_100106866 112
1301 3300025941 Ga0207711_10025132 Ga0207711_100251325 112
1302 3300025941 Ga0207711_10097773 Ga0207711_100977733 112
1303 3300025941 Ga0207711_10210552 Ga0207711_102105522 112
1304 3300025941 Ga0207711_10403786 Ga0207711_104037861 112
1305 3300025941 Ga0207711_10822098 Ga0207711_108220981 112
1306 3300025942 Ga0207689_10001371 Ga0207689_1000137111 112
1307 3300025942 Ga0207689_10001371 Ga0207689_1000137118 112
1308 3300025942 Ga0207689_10018344 Ga0207689_100183447 112
1309 3300025942 Ga0207689_10093620 Ga0207689_100936202 112
1310 3300025942 Ga0207689_10330520 Ga0207689_103305202 112
1311 3300025944 Ga0207661_10024681 Ga0207661_100246813 112
1312 3300025944 Ga0207661_10076799 Ga0207661_100767992 112
1313 3300025944 Ga0207661_10103949 Ga0207661_101039491 112
1314 3300025944 Ga0207661_10162999 Ga0207661_101629992 112
1315 3300025944 Ga0207661_10734076 Ga0207661_107340762 112
1316 3300025944 Ga0207661_11130012 Ga0207661_111300122 112
1317 3300025945 Ga0207679_10277363 Ga0207679_102773632 112
1318 3300025945 Ga0207679_10399509 Ga0207679_103995092 112
1319 3300025945 Ga0207679_11029435 Ga0207679_110294351 112
1320 3300025945 Ga0207679_11266115 Ga0207679_112661152 112
1321 3300025949 Ga0207667_10001640 Ga0207667_1000164022 112
1322 3300025949 Ga0207667_10004151 Ga0207667_1000415114 112
1323 3300025949 Ga0207667_10005659 Ga0207667_100056592 112
1324 3300025949 Ga0207667_10011338 Ga0207667_100113387 112
1325 3300025949 Ga0207667_10017720 Ga0207667_100177206 112
1326 3300025949 Ga0207667_10029273 Ga0207667_100292734 112
1327 3300025949 Ga0207667_10058296 Ga0207667_100582962 112
1328 3300025949 Ga0207667_10075770 Ga0207667_100757702 112
1329 3300025949 Ga0207667_10113060 Ga0207667_101130602 112
1330 3300025949 Ga0207667_10114527 Ga0207667_101145272 112
1331 3300025949 Ga0207667_10189703 Ga0207667_101897032 112
1332 3300025949 Ga0207667_10199773 Ga0207667_101997732 112
1333 3300025949 Ga0207667_10580612 Ga0207667_105806122 112
1334 3300025949 Ga0207667_10625322 Ga0207667_106253221 112
1335 3300025949 Ga0207667_11990843 Ga0207667_119908432 112
1336 3300025960 Ga0207651_10001394 Ga0207651_1000139410 112
1337 3300025960 Ga0207651_10360944 Ga0207651_103609441 112
1338 3300025960 Ga0207651_10722276 Ga0207651_107222761 112
1339 3300025960 Ga0207651_11048146 Ga0207651_110481461 112
1340 3300025960 Ga0207651_11081129 Ga0207651_110811291 112
1341 3300025960 Ga0207651_11834526 Ga0207651_118345262 112
1342 3300025961 Ga0207712_10014792 Ga0207712_100147922 112
1343 3300025961 Ga0207712_10026458 Ga0207712_100264582 112
1344 3300025961 Ga0207712_10241024 Ga0207712_102410242 112
1345 3300025961 Ga0207712_10321110 Ga0207712_103211102 112
1346 3300025961 Ga0207712_10358895 Ga0207712_103588952 112
1347 3300025961 Ga0207712_11492706 Ga0207712_114927062 112
1348 3300025961 Ga0207712_11497598 Ga0207712_114975981 112
1349 3300025961 Ga0207712_11786121 Ga0207712_117861211 112
1350 3300025972 Ga0207668_10000960 Ga0207668_100009603 112
1351 3300025972 Ga0207668_10025595 Ga0207668_100255954 112
1352 3300025972 Ga0207668_10641733 Ga0207668_106417331 112
1353 3300025972 Ga0207668_11120599 Ga0207668_111205991 112
1354 3300025981 Ga0207640_10001234 Ga0207640_100012343 112
1355 3300025981 Ga0207640_10010087 Ga0207640_100100871 112
1356 3300025981 Ga0207640_10020019 Ga0207640_100200192 112
1357 3300025981 Ga0207640_10022284 Ga0207640_100222841 112
1358 3300025981 Ga0207640_10049273 Ga0207640_100492734 112
1359 3300025981 Ga0207640_10091246 Ga0207640_100912461 112
1360 3300025981 Ga0207640_10758438 Ga0207640_107584381 112
1361 3300025986 Ga0207658_10058854 Ga0207658_100588542 112
1362 3300025986 Ga0207658_10343165 Ga0207658_103431651 112
1363 3300026023 Ga0207677_10008264 Ga0207677_100082642 112
1364 3300026023 Ga0207677_10020444 Ga0207677_100204441 112
1365 3300026023 Ga0207677_10036199 Ga0207677_100361992 112
1366 3300026023 Ga0207677_10093476 Ga0207677_100934762 112
1367 3300026023 Ga0207677_10174502 Ga0207677_101745021 112
1368 3300026023 Ga0207677_10194111 Ga0207677_101941111 112
1369 3300026023 Ga0207677_10588036 Ga0207677_105880362 112
1370 3300026023 Ga0207677_11010080 Ga0207677_110100802 112
1371 3300026023 Ga0207677_11472871 Ga0207677_114728711 112
1372 3300026035 Ga0207703_10002024 Ga0207703_1000202411 112
1373 3300026035 Ga0207703_10002024 Ga0207703_100020244 112
1374 3300026035 Ga0207703_10060004 Ga0207703_100600045 112
1375 3300026035 Ga0207703_10085878 Ga0207703_100858782 112
1376 3300026035 Ga0207703_10107189 Ga0207703_101071892 112
1377 3300026035 Ga0207703_10193265 Ga0207703_101932653 112
1378 3300026035 Ga0207703_10204541 Ga0207703_102045411 112
1379 3300026035 Ga0207703_10478168 Ga0207703_104781682 112
1380 3300026035 Ga0207703_10491038 Ga0207703_104910381 112
1381 3300026035 Ga0207703_10653083 Ga0207703_106530831 112
1382 3300026035 Ga0207703_10653335 Ga0207703_106533352 112
1383 3300026035 Ga0207703_10669541 Ga0207703_106695411 112
1384 3300026035 Ga0207703_10713393 Ga0207703_107133932 112
1385 3300026035 Ga0207703_10812299 Ga0207703_108122992 112
1386 3300026041 Ga0207639_10000293 Ga0207639_1000029330 112
1387 3300026041 Ga0207639_10001054 Ga0207639_100010547 112
1388 3300026041 Ga0207639_10004120 Ga0207639_100041205 112
1389 3300026041 Ga0207639_10007772 Ga0207639_100077728 112
1390 3300026041 Ga0207639_10041868 Ga0207639_100418682 112
1391 3300026041 Ga0207639_10059166 Ga0207639_100591662 112
1392 3300026041 Ga0207639_10102725 Ga0207639_101027252 112
1393 3300026041 Ga0207639_10105193 Ga0207639_101051932 112
1394 3300026041 Ga0207639_10654656 Ga0207639_106546562 112
1395 3300026041 Ga0207639_10723150 Ga0207639_107231502 112
1396 3300026041 Ga0207639_11226240 Ga0207639_112262401 112
1397 3300026041 Ga0207639_11957287 Ga0207639_119572872 112
1398 3300026067 Ga0207678_10000247 Ga0207678_1000024723 112
1399 3300026067 Ga0207678_10009516 Ga0207678_100095162 112
1400 3300026067 Ga0207678_10010640 Ga0207678_100106407 112
1401 3300026067 Ga0207678_10017164 Ga0207678_100171643 112
1402 3300026067 Ga0207678_10058881 Ga0207678_100588812 112
1403 3300026067 Ga0207678_10200784 Ga0207678_102007842 112
1404 3300026067 Ga0207678_10241428 Ga0207678_102414282 112
1405 3300026067 Ga0207678_10385675 Ga0207678_103856752 112
1406 3300026067 Ga0207678_10735763 Ga0207678_107357632 112
1407 3300026067 Ga0207678_10777240 Ga0207678_107772402 112
1408 3300026075 Ga0207708_10001039 Ga0207708_1000103910 112
1409 3300026075 Ga0207708_10100063 Ga0207708_101000632 112
1410 3300026075 Ga0207708_10558969 Ga0207708_105589692 112
1411 3300026075 Ga0207708_10569135 Ga0207708_105691352 112
1412 3300026078 Ga0207702_10019919 Ga0207702_100199195 112
1413 3300026078 Ga0207702_10021465 Ga0207702_100214652 112
1414 3300026078 Ga0207702_10066455 Ga0207702_100664555 112
1415 3300026078 Ga0207702_10120209 Ga0207702_101202091 112
1416 3300026078 Ga0207702_10121692 Ga0207702_101216922 112
1417 3300026078 Ga0207702_10144911 Ga0207702_101449112 112
1418 3300026078 Ga0207702_10153014 Ga0207702_101530141 112
1419 3300026078 Ga0207702_10182041 Ga0207702_101820414 112
1420 3300026078 Ga0207702_10206468 Ga0207702_102064682 112
1421 3300026078 Ga0207702_10276688 Ga0207702_102766882 112
1422 3300026078 Ga0207702_10333440 Ga0207702_103334402 112
1423 3300026078 Ga0207702_10396667 Ga0207702_103966672 112
1424 3300026078 Ga0207702_10404701 Ga0207702_104047012 112
1425 3300026078 Ga0207702_10704632 Ga0207702_107046322 112
1426 3300026078 Ga0207702_10783728 Ga0207702_107837282 112
1427 3300026078 Ga0207702_11001212 Ga0207702_110012122 112
1428 3300026078 Ga0207702_11222987 Ga0207702_112229871 112
1429 3300026088 Ga0207641_10008364 Ga0207641_100083642 112
1430 3300026088 Ga0207641_10035600 Ga0207641_100356001 112
1431 3300026088 Ga0207641_10038875 Ga0207641_100388753 112
1432 3300026088 Ga0207641_10063858 Ga0207641_100638584 112
1433 3300026088 Ga0207641_10077861 Ga0207641_100778614 112
1434 3300026088 Ga0207641_10158928 Ga0207641_101589284 112
1435 3300026088 Ga0207641_10285525 Ga0207641_102855252 112
1436 3300026088 Ga0207641_10528916 Ga0207641_105289162 112
1437 3300026089 Ga0207648_10023117 Ga0207648_100231172 112
1438 3300026089 Ga0207648_10052048 Ga0207648_100520483 112
1439 3300026089 Ga0207648_10087936 Ga0207648_100879365 112
1440 3300026089 Ga0207648_10246862 Ga0207648_102468622 112
1441 3300026089 Ga0207648_10411447 Ga0207648_104114472 112
1442 3300026089 Ga0207648_10554492 Ga0207648_105544922 112
1443 3300026095 Ga0207676_10050011 Ga0207676_100500114 112
1444 3300026095 Ga0207676_10115545 Ga0207676_101155452 112
1445 3300026095 Ga0207676_10256790 Ga0207676_102567902 112
1446 3300026095 Ga0207676_10287893 Ga0207676_102878931 112
1447 3300026095 Ga0207676_11385700 Ga0207676_113857002 112
1448 3300026116 Ga0207674_10005608 Ga0207674_1000560810 112
1449 3300026116 Ga0207674_10114569 Ga0207674_101145695 112
1450 3300026116 Ga0207674_10155960 Ga0207674_101559602 112
1451 3300026116 Ga0207674_10329564 Ga0207674_103295642 112
1452 3300026116 Ga0207674_10452405 Ga0207674_104524052 112
1453 3300026116 Ga0207674_10946456 Ga0207674_109464561 112
1454 3300026116 Ga0207674_10982683 Ga0207674_109826831 112
1455 3300026116 Ga0207674_11677450 Ga0207674_116774502 112
1456 3300026116 Ga0207674_12070088 Ga0207674_120700881 112
1457 3300026118 Ga0207675_100000047 Ga0207675_10000004772 112
1458 3300026118 Ga0207675_100041148 Ga0207675_1000411483 112
1459 3300026118 Ga0207675_100657529 Ga0207675_1006575291 112
1460 3300026118 Ga0207675_101162152 Ga0207675_1011621522 112
1461 3300026118 Ga0207675_101645824 Ga0207675_1016458242 112
1462 3300026121 Ga0207683_10000542 Ga0207683_1000054216 112
1463 3300026121 Ga0207683_10240800 Ga0207683_102408002 112
1464 3300026121 Ga0207683_10256449 Ga0207683_102564492 112
1465 3300026121 Ga0207683_10260685 Ga0207683_102606853 112
1466 3300026121 Ga0207683_10336546 Ga0207683_103365462 112
1467 3300026121 Ga0207683_10488646 Ga0207683_104886462 112
1468 3300026121 Ga0207683_10529931 Ga0207683_105299312 112
1469 3300026121 Ga0207683_11167727 Ga0207683_111677273 112
1470 3300026142 Ga0207698_10000025 Ga0207698_1000002587 112
1471 3300026142 Ga0207698_10006816 Ga0207698_100068166 112
1472 3300026142 Ga0207698_10027915 Ga0207698_100279152 112
1473 3300026142 Ga0207698_10036137 Ga0207698_100361372 112
1474 3300026142 Ga0207698_10052969 Ga0207698_100529692 112
1475 3300026142 Ga0207698_10055169 Ga0207698_100551692 112
1476 3300026142 Ga0207698_10055630 Ga0207698_100556302 112
1477 3300026142 Ga0207698_10271514 Ga0207698_102715141 112
1478 3300026142 Ga0207698_10326295 Ga0207698_103262952 112
1479 3300026142 Ga0207698_10363007 Ga0207698_103630072 112
1480 3300026142 Ga0207698_10575743 Ga0207698_105757431 112
1481 3300026142 Ga0207698_10618633 Ga0207698_106186331 112
1482 3300026142 Ga0207698_10694450 Ga0207698_106944502 112
1483 3300026142 Ga0207698_10950519 Ga0207698_109505192 112
1484 3300026142 Ga0207698_11783981 Ga0207698_117839811 112
1485 3300026142 Ga0207698_12312536 Ga0207698_123125361 112
1486 3300027512 Ga0209179_1018751 Ga0209179_10187512 112
1487 3300027671 Ga0209588_1004779 Ga0209588_10047792 112
1488 3300027671 Ga0209588_1037126 Ga0209588_10371262 112
1489 3300027671 Ga0209588_1091054 Ga0209588_10910543 112
1490 3300027671 Ga0209588_1115147 Ga0209588_11151472 112
1491 3300027717 Ga0209998_10005918 Ga0209998_100059181 112
1492 3300027907 Ga0207428_10022192 Ga0207428_100221922 112
1493 3300027907 Ga0207428_10078778 Ga0207428_100787782 112
1494 3300028017 Ga0265356_1037157 Ga0265356_10371571 112
1495 3300028379 Ga0268266_10002668 Ga0268266_100026687 112
1496 3300028379 Ga0268266_10008204 Ga0268266_100082045 112
1497 3300028379 Ga0268266_10010857 Ga0268266_100108572 112
1498 3300028379 Ga0268266_10024026 Ga0268266_100240261 112
1499 3300028379 Ga0268266_10045033 Ga0268266_100450334 112
1500 3300028379 Ga0268266_10064377 Ga0268266_100643772 112
1501 3300028379 Ga0268266_10072580 Ga0268266_100725802 112
1502 3300028379 Ga0268266_10079901 Ga0268266_100799012 112
1503 3300028379 Ga0268266_10273915 Ga0268266_102739152 112
1504 3300028379 Ga0268266_10346165 Ga0268266_103461651 112
1505 3300028379 Ga0268266_10508283 Ga0268266_105082832 112
1506 3300028379 Ga0268266_10554558 Ga0268266_105545581 112
1507 3300028379 Ga0268266_10581847 Ga0268266_105818472 112
1508 3300028379 Ga0268266_10835704 Ga0268266_108357042 112
1509 3300028379 Ga0268266_11259377 Ga0268266_112593772 112
1510 3300028379 Ga0268266_11964639 Ga0268266_119646391 112
1511 3300028380 Ga0268265_10005462 Ga0268265_100054622 112
1512 3300028380 Ga0268265_10038432 Ga0268265_100384324 112
1513 3300028380 Ga0268265_10107741 Ga0268265_101077412 112
1514 3300028380 Ga0268265_10821694 Ga0268265_108216942 112
1515 3300028381 Ga0268264_10028119 Ga0268264_100281194 112
1516 3300028381 Ga0268264_10069509 Ga0268264_100695092 112
1517 3300028381 Ga0268264_10138584 Ga0268264_101385842 112
1518 3300028381 Ga0268264_10307894 Ga0268264_103078941 112
1519 3300028381 Ga0268264_10658833 Ga0268264_106588332 112
1520 3300028381 Ga0268264_10676965 Ga0268264_106769652 112
1521 3300028381 Ga0268264_10716993 Ga0268264_107169932 112
1522 3300028381 Ga0268264_11284742 Ga0268264_112847422 112
1523 3300028381 Ga0268264_11982388 Ga0268264_119823882 112
1524 3300028381 Ga0268264_12255397 Ga0268264_122553972 112
1525 3300028563 Ga0265319_1001189 Ga0265319_10011899 112
1526 3300028573 Ga0265334_10122514 Ga0265334_101225142 112
1527 3300028577 Ga0265318_10000394 Ga0265318_1000039412 112
1528 3300028577 Ga0265318_10005472 Ga0265318_100054723 112
1529 3300028577 Ga0265318_10021336 Ga0265318_100213362 112
1530 3300028577 Ga0265318_10064003 Ga0265318_100640031 112
1531 3300028653 Ga0265323_10018816 Ga0265323_100188162 112
1532 3300028654 Ga0265322_10244707 Ga0265322_102447071 112
1533 3300028666 Ga0265336_10055991 Ga0265336_100559913 112
1534 3300028800 Ga0265338_10008713 Ga0265338_100087133 112
1535 3300028800 Ga0265338_10011499 Ga0265338_100114997 112
1536 3300028800 Ga0265338_10014549 Ga0265338_100145494 112
1537 3300028800 Ga0265338_10060534 Ga0265338_100605344 112
1538 3300028800 Ga0265338_10109006 Ga0265338_101090062 112
1539 3300028800 Ga0265338_10116207 Ga0265338_101162072 112
1540 3300028800 Ga0265338_10136962 Ga0265338_101369622 112
1541 3300028800 Ga0265338_10145640 Ga0265338_101456402 112
1542 3300028800 Ga0265338_10225920 Ga0265338_102259202 112
1543 3300028800 Ga0265338_10253230 Ga0265338_102532302 112
1544 3300028800 Ga0265338_10356232 Ga0265338_103562322 112
1545 3300028800 Ga0265338_10422171 Ga0265338_104221712 112
1546 3300028800 Ga0265338_11035448 Ga0265338_110354482 112
1547 3300031090 Ga0265760_10010384 Ga0265760_100103842 112
1548 3300031090 Ga0265760_10040675 Ga0265760_100406752 112
1549 3300031090 Ga0265760_10119507 Ga0265760_101195072 112
1550 3300031090 Ga0265760_10171008 Ga0265760_101710082 112
1551 3300031235 Ga0265330_10000982 Ga0265330_100009829 112
1552 3300031235 Ga0265330_10001198 Ga0265330_100011986 112
1553 3300031235 Ga0265330_10087886 Ga0265330_100878861 112
1554 3300031235 Ga0265330_10159892 Ga0265330_101598921 112
1555 3300031235 Ga0265330_10168233 Ga0265330_101682332 112
1556 3300031238 Ga0265332_10008188 Ga0265332_100081881 112
1557 3300031238 Ga0265332_10018958 Ga0265332_100189585 112
1558 3300031238 Ga0265332_10033970 Ga0265332_100339702 112
1559 3300031239 Ga0265328_10021411 Ga0265328_100214115 112
1560 3300031239 Ga0265328_10085468 Ga0265328_100854682 112
1561 3300031240 Ga0265320_10000019 Ga0265320_1000001959 112
1562 3300031240 Ga0265320_10086969 Ga0265320_100869692 112
1563 3300031241 Ga0265325_10000197 Ga0265325_1000019714 112
1564 3300031241 Ga0265325_10000338 Ga0265325_1000033820 112
1565 3300031241 Ga0265325_10003237 Ga0265325_1000323711 112
1566 3300031241 Ga0265325_10006727 Ga0265325_100067271 112
1567 3300031241 Ga0265325_10019057 Ga0265325_100190573 112
1568 3300031241 Ga0265325_10023575 Ga0265325_100235752 112
1569 3300031241 Ga0265325_10039083 Ga0265325_100390832 112
1570 3300031241 Ga0265325_10119370 Ga0265325_101193702 112
1571 3300031241 Ga0265325_10126169 Ga0265325_101261692 112
1572 3300031241 Ga0265325_10209458 Ga0265325_102094582 112
1573 3300031242 Ga0265329_10000010 Ga0265329_1000001029 112
1574 3300031242 Ga0265329_10075969 Ga0265329_100759692 112
1575 3300031242 Ga0265329_10121085 Ga0265329_101210851 112
1576 3300031247 Ga0265340_10090178 Ga0265340_100901782 112
1577 3300031247 Ga0265340_10165139 Ga0265340_101651392 112
1578 3300031247 Ga0265340_10209379 Ga0265340_102093791 112
1579 3300031249 Ga0265339_10000025 Ga0265339_10000025126 112
1580 3300031249 Ga0265339_10001701 Ga0265339_1000170111 112
1581 3300031249 Ga0265339_10018805 Ga0265339_100188052 112
1582 3300031249 Ga0265339_10021372 Ga0265339_100213724 112
1583 3300031249 Ga0265339_10033613 Ga0265339_100336132 112
1584 3300031249 Ga0265339_10042409 Ga0265339_100424092 112
1585 3300031249 Ga0265339_10055961 Ga0265339_100559612 112
1586 3300031249 Ga0265339_10086378 Ga0265339_100863782 112
1587 3300031249 Ga0265339_10106250 Ga0265339_101062502 112
1588 3300031249 Ga0265339_10219271 Ga0265339_102192712 112
1589 3300031249 Ga0265339_10383116 Ga0265339_103831161 112
1590 3300031249 Ga0265339_10438392 Ga0265339_104383921 112
1591 3300031250 Ga0265331_10000028 Ga0265331_1000002889 112
1592 3300031250 Ga0265331_10003298 Ga0265331_1000329811 112
1593 3300031250 Ga0265331_10016230 Ga0265331_100162304 112
1594 3300031344 Ga0265316_10000092 Ga0265316_1000009257 112
1595 3300031344 Ga0265316_10001094 Ga0265316_1000109412 112
1596 3300031344 Ga0265316_10005678 Ga0265316_100056785 112
1597 3300031344 Ga0265316_10011953 Ga0265316_100119534 112
1598 3300031344 Ga0265316_10016793 Ga0265316_100167938 112
1599 3300031344 Ga0265316_10017213 Ga0265316_100172132 112
1600 3300031344 Ga0265316_10021441 Ga0265316_100214413 112
1601 3300031344 Ga0265316_10188077 Ga0265316_101880772 112
1602 3300031344 Ga0265316_10255681 Ga0265316_102556812 112
1603 3300031344 Ga0265316_10390648 Ga0265316_103906482 112
1604 3300031344 Ga0265316_11006997 Ga0265316_110069971 112
1605 3300031344 Ga0265316_11230697 Ga0265316_112306971 112
1606 3300031344 Ga0265316_11235776 Ga0265316_112357761 112
1607 3300031595 Ga0265313_10000208 Ga0265313_100002088 112
1608 3300031595 Ga0265313_10000434 Ga0265313_1000043422 112
1609 3300031595 Ga0265313_10003074 Ga0265313_100030746 112
1610 3300031595 Ga0265313_10010684 Ga0265313_100106847 112
1611 3300031595 Ga0265313_10033940 Ga0265313_100339402 112
1612 3300031595 Ga0265313_10122818 Ga0265313_101228182 112
1613 3300031595 Ga0265313_10124931 Ga0265313_101249311 112
1614 3300031595 Ga0265313_10138472 Ga0265313_101384721 112
1615 3300031595 Ga0265313_10187250 Ga0265313_101872501 112
1616 3300031595 Ga0265313_10227235 Ga0265313_102272352 112
1617 3300031595 Ga0265313_10368243 Ga0265313_103682431 112
1618 3300031711 Ga0265314_10001131 Ga0265314_100011312 112
1619 3300031711 Ga0265314_10059832 Ga0265314_100598322 112
1620 3300031711 Ga0265314_10183231 Ga0265314_101832311 112
1621 3300031711 Ga0265314_10577818 Ga0265314_105778181 112
1622 3300031712 Ga0265342_10000074 Ga0265342_1000007440 112
1623 3300031712 Ga0265342_10000236 Ga0265342_1000023651 112
1624 3300031712 Ga0265342_10000757 Ga0265342_1000075720 112
1625 3300031712 Ga0265342_10000883 Ga0265342_1000088316 112
1626 3300031712 Ga0265342_10028498 Ga0265342_100284983 112
1627 3300031712 Ga0265342_10029681 Ga0265342_100296813 112
1628 3300031712 Ga0265342_10030451 Ga0265342_100304512 112
1629 3300031712 Ga0265342_10044897 Ga0265342_100448973 112
1630 3300031712 Ga0265342_10076489 Ga0265342_100764893 112
1631 3300031712 Ga0265342_10209163 Ga0265342_102091632 112
1632 3300031728 Ga0316578_10602776 Ga0316578_106027762 112
1633 3300031731 Ga0307405_10045681 Ga0307405_100456812 112
1634 3300031824 Ga0307413_10109210 Ga0307413_101092101 112
1635 3300031852 Ga0307410_11790927 Ga0307410_117909272 112
1636 3300031901 Ga0307406_11106382 Ga0307406_111063822 112
1637 3300031903 Ga0307407_10446110 Ga0307407_104461102 112
1638 3300031911 Ga0307412_10522458 Ga0307412_105224582 112
1639 3300031995 Ga0307409_100018671 Ga0307409_1000186713 112
1640 3300031995 Ga0307409_100100117 Ga0307409_1001001172 112
1641 3300032004 Ga0307414_10085137 Ga0307414_100851372 112
1642 3300032005 Ga0307411_10052293 Ga0307411_100522932 112
1643 3300032126 Ga0307415_100033729 Ga0307415_1000337293 112
1644 3300032126 Ga0307415_100679672 Ga0307415_1006796722 112
1645 3300033180 Ga0307510_10085679 Ga0307510_100856792 112
1646 3300033541 Ga0316596_1079859 Ga0316596_10798592 112
1647 3300034817 Ga0373948_0211148 Ga0373948_0211148_158_496 112
1648 3300034820 Ga0373959_0035525 Ga0373959_0035525_409_747 112
1649 3300034957 Ga0373938_0234681 Ga0373938_0234681_70_408 112
1650 3300035083 Ga0373926_0000590 Ga0373926_0000590_1890_2231 112
1651 3300035083 Ga0373926_0008226 Ga0373926_0008226_271_612 112
1652 3300035084 Ga0373928_0167799 Ga0373928_0167799_174_512 112
1653 3300035084 Ga0373928_0168117 Ga0373928_0168117_60_398 112
1654 3300035085 Ga0373929_0028648 Ga0373929_0028648_608_946 112
1655 3300035086 Ga0373934_0083563 Ga0373934_0083563_139_480 112
1656 3300035088 Ga0373940_0033797 Ga0373940_0033797_337_675 112
1657 3300035089 Ga0373944_0255152 Ga0373944_0255152_187_525 112
1658 3300035111 Ga0373923_0001644 Ga0373923_0001644_3328_3669 112
1659 3300035111 Ga0373923_0013016 Ga0373923_0013016_2466_2807 112
1660 3300035111 Ga0373923_0351645 Ga0373923_0351645_62_400 112
1661 3300035112 Ga0373932_0013065 Ga0373932_0013065_1018_1356 112
1662 3300035112 Ga0373932_0115040 Ga0373932_0115040_244_582 112
1663 3300035114 Ga0373939_0036969 Ga0373939_0036969_344_682 112
1664 3300035114 Ga0373939_0042245 Ga0373939_0042245_961_1299 112
1665 3300035114 Ga0373939_0313388 Ga0373939_0313388_62_400 112
1666 3300035115 Ga0373941_0007336 Ga0373941_0007336_321_659 112
1667 3300035115 Ga0373941_0073860 Ga0373941_0073860_238_576 112
1668 3300035116 Ga0373945_0443407 Ga0373945_0443407_218_556 112
1669 3300035116 Ga0373945_0520774 Ga0373945_0520774_56_397 112
1670 3300035118 Ga0373954_0654138 Ga0373954_0654138_154_492 112
1671 3300035120 Ga0373957_0347973 Ga0373957_0347973_180_521 112
1672 3300035121 Ga0373960_0346973 Ga0373960_0346973_55_393 112
1673 3300035171 Ga0373946_0365902 Ga0373946_0365902_218_559 112
1674 3300035172 Ga0373955_0112482 Ga0373955_0112482_920_1261 112
1675 3300035172 Ga0373955_0337423 Ga0373955_0337423_99_437 112
1676 3300035172 Ga0373955_0805167 Ga0373955_0805167_51_389 112
1677 3300035172 Ga0373955_1024685 Ga0373955_1024685_150_491 112
1678 3300035207 Ga0373942_0025727 Ga0373942_0025727_346_684 112
1679 3300035241 Ga0373961_0290729 Ga0373961_0290729_246_584 112
1680 3300035242 Ga0373962_0342870 Ga0373962_0342870_113_451 112
1681 3300035410 Ga0373924_0060463 Ga0373924_0060463_444_785 112
1682 3300035410 Ga0373924_0113851 Ga0373924_0113851_210_548 112
1683 3300035410 Ga0373924_0252217 Ga0373924_0252217_21_362 112
1684 3300035691 Ga0373931_0006143 Ga0373931_0006143_4551_4889 112
1685 3300035691 Ga0373931_0030272 Ga0373931_0030272_54_392 112
1686 3300035691 Ga0373931_0054992 Ga0373931_0054992_642_980 112
1687 3300035691 Ga0373931_0070227 Ga0373931_0070227_760_1098 112
1688 3300035691 Ga0373931_0116012 Ga0373931_0116012_804_1142 112
1689 3300035691 Ga0373931_0494378 Ga0373931_0494378_186_524 112
1690 3300035692 Ga0373935_0001751 Ga0373935_0001751_2588_2929 112
1691 3300035692 Ga0373935_0006950 Ga0373935_0006950_3435_3776 112
1692 3300035692 Ga0373935_0584958 Ga0373935_0584958_269_607 112
1693 3300035692 Ga0373935_0587658 Ga0373935_0587658_402_740 112
1694 3300035692 Ga0373935_0730413 Ga0373935_0730413_96_434 112
1695 3300035695 Ga0373927_0003077 Ga0373927_0003077_8853_9194 112
1696 3300035695 Ga0373927_0011498 Ga0373927_0011498_3655_3996 112
1697 3300035724 Ga0373933_0110681 Ga0373933_0110681_1059_1397 112
1698 3300035724 Ga0373933_0181696 Ga0373933_0181696_407_748 112
1699 3300035724 Ga0373933_0199882 Ga0373933_0199882_83_424 112
1700 3300035724 Ga0373933_0442054 Ga0373933_0442054_449_790 112
1701 3300035725 Ga0373947_0019403 Ga0373947_0019403_2304_2645 112
1702 3300035725 Ga0373947_0054534 Ga0373947_0054534_1701_2042 112
1703 3300035725 Ga0373947_0217946 Ga0373947_0217946_464_802 112
1704 3300036401 Ga0373937_0020897 Ga0373937_0020897_372_713 112
1705 3300036401 Ga0373937_0056082 Ga0373937_0056082_689_1030 112
1706 3300036401 Ga0373937_0237661 Ga0373937_0237661_1173_1511 112
1707 3300036401 Ga0373937_0458455 Ga0373937_0458455_837_1178 112
1708 3300036401 Ga0373937_0996434 Ga0373937_0996434_32_370 112
1709 3300036401 Ga0373937_1562192 Ga0373937_1562192_22_360 112
1710 3300036401 Ga0373937_1614261 Ga0373937_1614261_152_490 112
1711 3300037068 Ga0373925_0044083 Ga0373925_0044083_1363_1701 112
1712 3300037068 Ga0373925_0126209 Ga0373925_0126209_288_629 112
1713 3300037068 Ga0373925_0883010 Ga0373925_0883010_223_561 112
1714 3300037312 Ga0395899_0622241 Ga0395899_0622241_42_380 112
1715 3300037418 Ga0395900_0210569 Ga0395900_0210569_335_673 112
1716 3300037418 Ga0395900_1215979 Ga0395900_1215979_126_464 112
1717 3300037466 Ga0395898_0011521 Ga0395898_0011521_5293_5631 112
1718 3300037471 Ga0395905_0004814 Ga0395905_0004814_1402_1740 112
1719 3300037471 Ga0395905_0536100 Ga0395905_0536100_118_456 112
1720 3300037853 Ga0436364_1498740 Ga0436364_1498740_126_464 112
1721 3300038443 Ga0395901_0013981 Ga0395901_0013981_6079_6417 112
1722 3300038996 Ga0242420_027410 Ga0242420_027410_483_821 112
1723 3300039437 Ga0436365_0620187 Ga0436365_0620187_191_556 112
1724 3300039437 Ga0436365_0987606 Ga0436365_0987606_4888_5226 112
1725 3300039438 Ga0436360_0084770 Ga0436360_0084770_249_587 112
1726 3300039438 Ga0436360_0127249 Ga0436360_0127249_13_357 112
1727 3300039438 Ga0436360_0161883 Ga0436360_0161883_11582_11920 112
1728 3300039438 Ga0436360_0294598 Ga0436360_0294598_81_419 112
1729 3300039438 Ga0436360_1036151 Ga0436360_1036151_2556_2894 112
1730 3300039447 Ga0436361_0092825 Ga0436361_0092825_65_409 112
1731 3300039447 Ga0436361_0190313 Ga0436361_0190313_913_1251 112
1732 3300039447 Ga0436361_0297841 Ga0436361_0297841_149_487 112
1733 3300039447 Ga0436361_0307406 Ga0436361_0307406_8528_8866 112
1734 3300039447 Ga0436361_0340747 Ga0436361_0340747_923_1261 112
1735 3300039447 Ga0436361_0696344 Ga0436361_0696344_7246_7584 112
1736 3300039447 Ga0436361_0753515 Ga0436361_0753515_170_508 112
1737 3300039447 Ga0436361_0964497 Ga0436361_0964497_28_366 112
1738 3300039450 Ga0436363_1022683 Ga0436363_1022683_395_733 112
1739 3300039450 Ga0436363_1330865 Ga0436363_1330865_1449_1787 112
1740 3300039450 Ga0436363_1371418 Ga0436363_1371418_277_621 112
1741 3300039450 Ga0436363_1670999 Ga0436363_1670999_441_782 112
1742 3300041496 Ga0451839_0917702 Ga0451839_0917702_124_468 112
1743 3300042005 Ga0439448_0005158 Ga0439448_0005158_3130_3498 112
1744 3300042005 Ga0439448_0109968 Ga0439448_0109968_589_927 112
1745 3300042016 Ga0439463_106542 Ga0439463_106542_159_497 112
1746 3300042876 Ga0451577_0087527 Ga0451577_0087527_2207_2545 112
1747 3300044673 Ga0453683_0144199 Ga0453683_0144199_1141_1479 112
1748 3300044673 Ga0453683_0447391 Ga0453683_0447391_223_561 112
1749 3300044684 Ga0466966_0017437 Ga0466966_0017437_3409_3747 112
1750 3300044693 Ga0466961_0145000 Ga0466961_0145000_1107_1451 112
1751 3300044694 Ga0466963_0270734 Ga0466963_0270734_260_598 112
1752 3300044694 Ga0466963_0316956 Ga0466963_0316956_306_644 112
1753 3300044694 Ga0466963_0663895 Ga0466963_0663895_183_521 112
1754 3300044706 Ga0466964_0585746 Ga0466964_0585746_120_458 112
1755 3300044712 Ga0453684_0074070 Ga0453684_0074070_919_1257 112
1756 3300044712 Ga0453684_2062107 Ga0453684_2062107_20_376 112
1757 3300045049 Ga0466959_0103956 Ga0466959_0103956_257_601 112
1758 3300045049 Ga0466959_1023293 Ga0466959_1023293_50_388 112
1759 3300045051 Ga0451576_0073884 Ga0451576_0073884_500_838 112
1760 3300045051 Ga0451576_0312156 Ga0451576_0312156_508_846 112
1761 3300045051 Ga0451576_0769788 Ga0451576_0769788_586_924 112
1762 3300045051 Ga0451576_1508552 Ga0451576_1508552_200_538 112
1763 3300045051 Ga0451576_1732008 Ga0451576_1732008_241_579 112
1764 3300045836 Ga0466958_0079703 Ga0466958_0079703_42_386 112
1765 3300045976 Ga0466967_0144534 Ga0466967_0144534_275_613 112
1766 3300045976 Ga0466967_0223948 Ga0466967_0223948_369_707 112
1767 3300045976 Ga0466967_0425611 Ga0466967_0425611_80_424 112
1768 3300045976 Ga0466967_1043058 Ga0466967_1043058_378_716 112
1769 3300045976 Ga0466967_1165739 Ga0466967_1165739_313_651 112
1770 3300045976 Ga0466967_1474979 Ga0466967_1474979_290_628 112
1771 3300045976 Ga0466967_1909412 Ga0466967_1909412_185_523 112
1772 3300046454 Ga0495592_0011212 Ga0495592_0011212_3029_3370 112
1773 3300046454 Ga0495592_0036721 Ga0495592_0036721_3059_3448 112
1774 3300046454 Ga0495592_0284476 Ga0495592_0284476_444_785 112
1775 3300046455 Ga0495603_0122093 Ga0495603_0122093_864_1202 112
1776 3300046459 Ga0495629_0006654 Ga0495629_0006654_3317_3655 112
1777 3300046459 Ga0495629_0116230 Ga0495629_0116230_344_682 112
1778 3300046459 Ga0495629_0347915 Ga0495629_0347915_41_379 112
1779 3300046460 Ga0495638_0182404 Ga0495638_0182404_233_571 112
1780 3300046460 Ga0495638_0406266 Ga0495638_0406266_179_517 112
1781 3300046462 Ga0495651_0000126 Ga0495651_0000126_46754_47095 112
1782 3300046462 Ga0495651_0000811 Ga0495651_0000811_10658_10999 112
1783 3300046462 Ga0495651_0001612 Ga0495651_0001612_13586_13927 112
1784 3300046462 Ga0495651_0007961 Ga0495651_0007961_3136_3525 112
1785 3300046462 Ga0495651_0009443 Ga0495651_0009443_884_1222 112
1786 3300046462 Ga0495651_0038281 Ga0495651_0038281_408_749 112
1787 3300046462 Ga0495651_0148056 Ga0495651_0148056_1331_1669 112
1788 3300046463 Ga0495653_0019028 Ga0495653_0019028_221_562 112
1789 3300046463 Ga0495653_0032798 Ga0495653_0032798_58_399 112
1790 3300046463 Ga0495653_0038863 Ga0495653_0038863_2680_3018 112
1791 3300046463 Ga0495653_0101086 Ga0495653_0101086_1586_1927 112
1792 3300046463 Ga0495653_0110481 Ga0495653_0110481_1457_1846 112
1793 3300046463 Ga0495653_0531180 Ga0495653_0531180_378_719 112
1794 3300046471 Ga0495650_0000038 Ga0495650_0000038_131796_132134 112
1795 3300046471 Ga0495650_0006759 Ga0495650_0006759_3953_4291 112
1796 3300046472 Ga0495580_0008492 Ga0495580_0008492_5286_5627 112
1797 3300046472 Ga0495580_0022118 Ga0495580_0022118_2858_3199 112
1798 3300046472 Ga0495580_0034827 Ga0495580_0034827_3225_3563 112
1799 3300046472 Ga0495580_0038206 Ga0495580_0038206_2929_3267 112
1800 3300046472 Ga0495580_0039802 Ga0495580_0039802_359_700 112
1801 3300046472 Ga0495580_0083582 Ga0495580_0083582_1690_2028 112
1802 3300046472 Ga0495580_0119089 Ga0495580_0119089_320_658 112
1803 3300046472 Ga0495580_0335591 Ga0495580_0335591_515_853 112
1804 3300046472 Ga0495580_0412200 Ga0495580_0412200_175_513 112
1805 3300046472 Ga0495580_0805659 Ga0495580_0805659_84_422 112
1806 3300046473 Ga0495582_0003388 Ga0495582_0003388_6398_6736 112
1807 3300046473 Ga0495582_0032500 Ga0495582_0032500_368_709 112
1808 3300046473 Ga0495582_0141284 Ga0495582_0141284_810_1148 112
1809 3300046473 Ga0495582_0270656 Ga0495582_0270656_548_886 112
1810 3300046473 Ga0495582_0288461 Ga0495582_0288461_478_816 112
1811 3300046473 Ga0495582_0333190 Ga0495582_0333190_310_648 112
1812 3300046473 Ga0495582_0372810 Ga0495582_0372810_331_705 112
1813 3300046473 Ga0495582_0381966 Ga0495582_0381966_456_794 112
1814 3300046474 Ga0495605_0480013 Ga0495605_0480013_40_378 112
1815 3300046475 Ga0495639_0001954 Ga0495639_0001954_4304_4642 112
1816 3300046475 Ga0495639_0538793 Ga0495639_0538793_218_559 112
1817 3300046476 Ga0495662_0001280 Ga0495662_0001280_8302_8640 112
1818 3300046476 Ga0495662_0125524 Ga0495662_0125524_877_1215 112
1819 3300046477 Ga0495664_0009472 Ga0495664_0009472_2305_2643 112
1820 3300046477 Ga0495664_0035747 Ga0495664_0035747_773_1114 112
1821 3300046477 Ga0495664_0058773 Ga0495664_0058773_75_413 112
1822 3300046477 Ga0495664_0092440 Ga0495664_0092440_1229_1618 112
1823 3300046477 Ga0495664_0103053 Ga0495664_0103053_1235_1573 112
1824 3300046477 Ga0495664_0108090 Ga0495664_0108090_1227_1568 112
1825 3300046477 Ga0495664_0300578 Ga0495664_0300578_322_660 112
1826 3300046477 Ga0495664_0569227 Ga0495664_0569227_105_446 112
1827 3300046491 Ga0495584_0043018 Ga0495584_0043018_1651_1989 112
1828 3300046491 Ga0495584_0086954 Ga0495584_0086954_1172_1510 112
1829 3300046492 Ga0495585_0100664 Ga0495585_0100664_1195_1533 112
1830 3300046492 Ga0495585_0192349 Ga0495585_0192349_540_878 112
1831 3300046492 Ga0495585_0336109 Ga0495585_0336109_232_570 112
1832 3300046499 Ga0495594_0000395 Ga0495594_0000395_12464_12802 112
1833 3300046499 Ga0495594_0000883 Ga0495594_0000883_2811_3149 112
1834 3300046499 Ga0495594_0245182 Ga0495594_0245182_508_882 112
1835 3300046499 Ga0495594_0689832 Ga0495594_0689832_15_353 112
1836 3300046506 Ga0495583_0016461 Ga0495583_0016461_2453_2791 112
1837 3300046506 Ga0495583_0070964 Ga0495583_0070964_327_665 112
1838 3300046506 Ga0495583_0081339 Ga0495583_0081339_460_798 112
1839 3300046507 Ga0495606_0060363 Ga0495606_0060363_538_876 112
1840 3300046507 Ga0495606_0316719 Ga0495606_0316719_391_729 112
1841 3300046511 Ga0495608_0002780 Ga0495608_0002780_712_1053 112
1842 3300046511 Ga0495608_0014164 Ga0495608_0014164_2507_2848 112
1843 3300046511 Ga0495608_0068360 Ga0495608_0068360_1551_1892 112
1844 3300046511 Ga0495608_0166204 Ga0495608_0166204_523_912 112
1845 3300046512 Ga0495610_0221920 Ga0495610_0221920_331_669 112
1846 3300046513 Ga0495616_0053817 Ga0495616_0053817_55_393 112
1847 3300046514 Ga0495618_0131744 Ga0495618_0131744_226_567 112
1848 3300046514 Ga0495618_0190200 Ga0495618_0190200_527_868 112
1849 3300046516 Ga0495628_0002365 Ga0495628_0002365_12001_12342 112
1850 3300046516 Ga0495628_0002992 Ga0495628_0002992_11521_11910 112
1851 3300046516 Ga0495628_0006375 Ga0495628_0006375_6990_7331 112
1852 3300046516 Ga0495628_0015511 Ga0495628_0015511_1256_1597 112
1853 3300046516 Ga0495628_0018771 Ga0495628_0018771_976_1326 112
1854 3300046516 Ga0495628_0028060 Ga0495628_0028060_788_1126 112
1855 3300046516 Ga0495628_0038578 Ga0495628_0038578_3229_3570 112
1856 3300046516 Ga0495628_0185669 Ga0495628_0185669_862_1200 112
1857 3300046516 Ga0495628_0389584 Ga0495628_0389584_648_989 112
1858 3300046516 Ga0495628_0883172 Ga0495628_0883172_252_593 112
1859 3300046517 Ga0495630_0026462 Ga0495630_0026462_1412_1753 112
1860 3300046517 Ga0495630_0069009 Ga0495630_0069009_173_514 112
1861 3300046517 Ga0495630_0165903 Ga0495630_0165903_885_1226 112
1862 3300046517 Ga0495630_0354317 Ga0495630_0354317_573_914 112
1863 3300046517 Ga0495630_0394134 Ga0495630_0394134_404_745 112
1864 3300046517 Ga0495630_0398065 Ga0495630_0398065_555_905 112
1865 3300046517 Ga0495630_0524694 Ga0495630_0524694_333_671 112
1866 3300046517 Ga0495630_0604466 Ga0495630_0604466_442_783 112
1867 3300046517 Ga0495630_0972771 Ga0495630_0972771_145_486 112
1868 3300046519 Ga0495632_0109131 Ga0495632_0109131_812_1150 112
1869 3300046525 Ga0495663_0184935 Ga0495663_0184935_194_532 112
1870 3300046526 Ga0495666_0000810 Ga0495666_0000810_8871_9209 112
1871 3300046526 Ga0495666_0037434 Ga0495666_0037434_438_779 112
1872 3300046528 Ga0495642_0179715 Ga0495642_0179715_509_847 112
1873 3300046529 Ga0495652_0001558 Ga0495652_0001558_10610_10951 112
1874 3300046529 Ga0495652_0004388 Ga0495652_0004388_13011_13400 112
1875 3300046529 Ga0495652_0005489 Ga0495652_0005489_3058_3399 112
1876 3300046529 Ga0495652_0007766 Ga0495652_0007766_2859_3197 112
1877 3300046529 Ga0495652_0008023 Ga0495652_0008023_4785_5126 112
1878 3300046529 Ga0495652_0061067 Ga0495652_0061067_1834_2172 112
1879 3300046529 Ga0495652_0104318 Ga0495652_0104318_1926_2264 112
1880 3300046529 Ga0495652_0641662 Ga0495652_0641662_301_639 112
1881 3300046529 Ga0495652_0996912 Ga0495652_0996912_133_474 112
1882 3300046531 Ga0495665_0000528 Ga0495665_0000528_11470_11811 112
1883 3300046531 Ga0495665_0002595 Ga0495665_0002595_8344_8682 112
1884 3300046531 Ga0495665_0035102 Ga0495665_0035102_931_1272 112
1885 3300046531 Ga0495665_0332577 Ga0495665_0332577_107_448 112
1886 3300046531 Ga0495665_0494353 Ga0495665_0494353_127_468 112
1887 3300046531 Ga0495665_0617814 Ga0495665_0617814_109_447 112
1888 3300046533 Ga0495640_0007633 Ga0495640_0007633_5929_6267 112
1889 3300046533 Ga0495640_0020406 Ga0495640_0020406_822_1163 112
1890 3300046533 Ga0495640_0051762 Ga0495640_0051762_1518_1859 112
1891 3300046533 Ga0495640_0188749 Ga0495640_0188749_438_776 112
1892 3300046533 Ga0495640_0330388 Ga0495640_0330388_493_831 112
1893 3300046535 Ga0495586_0001563 Ga0495586_0001563_2869_3210 112
1894 3300046535 Ga0495586_0002392 Ga0495586_0002392_5103_5441 112
1895 3300046535 Ga0495586_0003622 Ga0495586_0003622_2981_3322 112
1896 3300046535 Ga0495586_0035722 Ga0495586_0035722_10_348 112
1897 3300046535 Ga0495586_0260286 Ga0495586_0260286_155_496 112
1898 3300046535 Ga0495586_0318852 Ga0495586_0318852_375_716 112
1899 3300046536 Ga0495587_0003845 Ga0495587_0003845_3214_3555 112
1900 3300046536 Ga0495587_0008849 Ga0495587_0008849_2967_3356 112
1901 3300046536 Ga0495587_0050541 Ga0495587_0050541_1093_1431 112
1902 3300046536 Ga0495587_0062291 Ga0495587_0062291_1755_2096 112
1903 3300046536 Ga0495587_0188617 Ga0495587_0188617_814_1152 112
1904 3300046542 Ga0495597_0113612 Ga0495597_0113612_342_680 112
1905 3300046543 Ga0495645_0002780 Ga0495645_0002780_3939_4277 112
1906 3300046543 Ga0495645_0014391 Ga0495645_0014391_3409_3747 112
1907 3300046543 Ga0495645_0014486 Ga0495645_0014486_4414_4755 112
1908 3300046543 Ga0495645_0073648 Ga0495645_0073648_1394_1783 112
1909 3300046543 Ga0495645_0086349 Ga0495645_0086349_75_416 112
1910 3300046543 Ga0495645_0116157 Ga0495645_0116157_91_432 112
1911 3300046543 Ga0495645_0124885 Ga0495645_0124885_1013_1351 112
1912 3300046543 Ga0495645_0187975 Ga0495645_0187975_506_844 112
1913 3300046543 Ga0495645_0398573 Ga0495645_0398573_101_439 112
1914 3300046543 Ga0495645_0539698 Ga0495645_0539698_136_474 112
1915 3300046557 Ga0495622_0406112 Ga0495622_0406112_121_459 112
1916 3300046559 Ga0495667_0000405 Ga0495667_0000405_8645_8986 112
1917 3300046559 Ga0495667_0000531 Ga0495667_0000531_19926_20315 112
1918 3300046559 Ga0495667_0014467 Ga0495667_0014467_1015_1353 112
1919 3300046559 Ga0495667_0028890 Ga0495667_0028890_112_453 112
1920 3300046559 Ga0495667_0052279 Ga0495667_0052279_125_466 112
1921 3300046559 Ga0495667_0132603 Ga0495667_0132603_201_542 112
1922 3300046559 Ga0495667_0140847 Ga0495667_0140847_477_818 112
1923 3300046559 Ga0495667_0276525 Ga0495667_0276525_576_923 112
1924 3300046559 Ga0495667_0307440 Ga0495667_0307440_32_370 112
1925 3300046559 Ga0495667_0450525 Ga0495667_0450525_417_755 112
1926 3300046559 Ga0495667_0765047 Ga0495667_0765047_41_379 112
1927 3300046615 Ga0495656_0421037 Ga0495656_0421037_172_510 112
1928 3300046616 Ga0495668_0052867 Ga0495668_0052867_385_723 112
1929 3300046642 Ga0495634_0008727 Ga0495634_0008727_3989_4327 112
1930 3300046642 Ga0495634_0134684 Ga0495634_0134684_972_1313 112
1931 3300046642 Ga0495634_0189402 Ga0495634_0189402_212_553 112
1932 3300046642 Ga0495634_0362461 Ga0495634_0362461_331_669 112
1933 3300046642 Ga0495634_0663052 Ga0495634_0663052_167_505 112
1934 3300046660 Ga0495625_0002916 Ga0495625_0002916_4689_5027 112
1935 3300046660 Ga0495625_0039604 Ga0495625_0039604_1730_2068 112
1936 3300046660 Ga0495625_0114010 Ga0495625_0114010_768_1106 112
1937 3300046660 Ga0495625_0304577 Ga0495625_0304577_508_846 112
1938 3300046663 Ga0495635_0008384 Ga0495635_0008384_1661_2002 112
1939 3300046663 Ga0495635_0011585 Ga0495635_0011585_2530_2868 112
1940 3300046663 Ga0495635_0067774 Ga0495635_0067774_1574_1915 112
1941 3300046663 Ga0495635_0235504 Ga0495635_0235504_320_709 112
1942 3300046663 Ga0495635_0275036 Ga0495635_0275036_447_785 112
1943 3300046663 Ga0495635_0276602 Ga0495635_0276602_718_1065 112
1944 3300046674 Ga0495588_0174182 Ga0495588_0174182_430_768 112
1945 3300046674 Ga0495588_0232053 Ga0495588_0232053_365_703 112
1946 3300046675 Ga0495657_0002645 Ga0495657_0002645_6488_6829 112
1947 3300046675 Ga0495657_0020289 Ga0495657_0020289_61_408 112
1948 3300046675 Ga0495657_0028816 Ga0495657_0028816_1069_1419 112
1949 3300046675 Ga0495657_0040181 Ga0495657_0040181_640_981 112
1950 3300046675 Ga0495657_0282249 Ga0495657_0282249_343_684 112
1951 3300046678 Ga0495599_0004912 Ga0495599_0004912_1657_1995 112
1952 3300046678 Ga0495599_0046201 Ga0495599_0046201_299_688 112
1953 3300046678 Ga0495599_0169005 Ga0495599_0169005_936_1274 112
1954 3300046678 Ga0495599_0224172 Ga0495599_0224172_757_1095 112
1955 3300046678 Ga0495599_0303923 Ga0495599_0303923_144_485 112
1956 3300046678 Ga0495599_0421251 Ga0495599_0421251_235_573 112
1957 3300046678 Ga0495599_0601234 Ga0495599_0601234_43_393 112
1958 3300046679 Ga0495623_0002161 Ga0495623_0002161_3125_3466 112
1959 3300046679 Ga0495623_0003440 Ga0495623_0003440_5397_5738 112
1960 3300046679 Ga0495623_0016316 Ga0495623_0016316_745_1083 112
1961 3300046680 Ga0495646_0004076 Ga0495646_0004076_5941_6282 112
1962 3300046680 Ga0495646_0046178 Ga0495646_0046178_2232_2573 112
1963 3300046680 Ga0495646_0046723 Ga0495646_0046723_755_1093 112
1964 3300046680 Ga0495646_0124688 Ga0495646_0124688_651_989 112
1965 3300046681 Ga0495647_0047650 Ga0495647_0047650_310_648 112
1966 3300046684 Ga0495669_0421991 Ga0495669_0421991_142_480 112
1967 3300046689 Ga0495613_0004130 Ga0495613_0004130_7227_7565 112
1968 3300046689 Ga0495613_0038032 Ga0495613_0038032_2968_3309 112
1969 3300046689 Ga0495613_0060170 Ga0495613_0060170_916_1257 112
1970 3300046689 Ga0495613_0071418 Ga0495613_0071418_486_824 112
1971 3300046689 Ga0495613_0090638 Ga0495613_0090638_596_934 112
1972 3300046689 Ga0495613_0135104 Ga0495613_0135104_92_430 112
1973 3300046689 Ga0495613_0319476 Ga0495613_0319476_326_667 112
1974 3300046689 Ga0495613_0345747 Ga0495613_0345747_483_857 112
1975 3300046689 Ga0495613_0392001 Ga0495613_0392001_372_713 112
1976 3300046690 Ga0495624_0003027 Ga0495624_0003027_3419_3757 112
1977 3300046690 Ga0495624_0004591 Ga0495624_0004591_4946_5287 112
1978 3300046690 Ga0495624_0734767 Ga0495624_0734767_93_434 112
1979 3300046690 Ga0495624_0776566 Ga0495624_0776566_22_363 112
1980 3300046691 Ga0495670_0392847 Ga0495670_0392847_68_406 112
1981 3300046694 Ga0495649_0007234 Ga0495649_0007234_3879_4217 112
1982 3300046694 Ga0495649_0191087 Ga0495649_0191087_705_1043 112
1983 3300046694 Ga0495649_0273977 Ga0495649_0273977_172_510 112
1984 3300046694 Ga0495649_0274626 Ga0495649_0274626_44_382 112
1985 3300046794 Ga0495589_0069623 Ga0495589_0069623_1265_1603 112
1986 3300046794 Ga0495589_0370357 Ga0495589_0370357_143_481 112
1987 3300046809 Ga0495600_0000532 Ga0495600_0000532_5289_5630 112
1988 3300046809 Ga0495600_0050474 Ga0495600_0050474_138_476 112
1989 3300046809 Ga0495600_0080903 Ga0495600_0080903_1067_1405 112
1990 3300046809 Ga0495600_0452199 Ga0495600_0452199_23_364 112
1991 3300047315 Ga0495581_0012382 Ga0495581_0012382_1067_1405 112
1992 3300047315 Ga0495581_0480264 Ga0495581_0480264_103_444 112
1993 3300047315 Ga0495581_0682842 Ga0495581_0682842_212_550 112
1994 3300047315 Ga0495581_0856895 Ga0495581_0856895_150_491 112
1995 3300047317 Ga0495604_0000485 Ga0495604_0000485_17493_17882 112
1996 3300047317 Ga0495604_0003584 Ga0495604_0003584_7071_7412 112
1997 3300047317 Ga0495604_0015963 Ga0495604_0015963_2552_2890 112
1998 3300047317 Ga0495604_0020087 Ga0495604_0020087_912_1250 112
1999 3300047317 Ga0495604_0021328 Ga0495604_0021328_3601_3939 112
2000 3300047317 Ga0495604_0033224 Ga0495604_0033224_2832_3173 112
2001 3300047317 Ga0495604_0187869 Ga0495604_0187869_888_1229 112
2002 3300047317 Ga0495604_0245130 Ga0495604_0245130_58_399 112
2003 3300047317 Ga0495604_0250773 Ga0495604_0250773_392_730 112
2004 3300047317 Ga0495604_0766648 Ga0495604_0766648_161_502 112
2005 3300047317 Ga0495604_0779029 Ga0495604_0779029_36_386 112
2006 3300047319 Ga0495674_0005644 Ga0495674_0005644_4879_5220 112
2007 3300047319 Ga0495674_0006959 Ga0495674_0006959_3568_3909 112
2008 3300047319 Ga0495674_0016535 Ga0495674_0016535_864_1253 112
2009 3300047319 Ga0495674_0017768 Ga0495674_0017768_4060_4401 112
2010 3300047319 Ga0495674_0019627 Ga0495674_0019627_3574_3912 112
2011 3300047319 Ga0495674_0038007 Ga0495674_0038007_1780_2118 112
2012 3300047319 Ga0495674_0052634 Ga0495674_0052634_1067_1405 112
2013 3300047319 Ga0495674_0108464 Ga0495674_0108464_143_484 112
2014 3300047319 Ga0495674_0111492 Ga0495674_0111492_1570_1911 112
2015 3300047319 Ga0495674_0126982 Ga0495674_0126982_1674_2015 112
2016 3300047319 Ga0495674_0141476 Ga0495674_0141476_488_829 112
2017 3300047319 Ga0495674_0227305 Ga0495674_0227305_91_429 112
2018 3300047319 Ga0495674_0277138 Ga0495674_0277138_415_753 112
2019 3300047319 Ga0495674_0363225 Ga0495674_0363225_671_1012 112
2020 3300047319 Ga0495674_1039512 Ga0495674_1039512_238_576 112
2021 3300047321 Ga0495676_0005277 Ga0495676_0005277_7508_7846 112
2022 3300047321 Ga0495676_0269100 Ga0495676_0269100_286_627 112
2023 3300047321 Ga0495676_0289859 Ga0495676_0289859_683_1024 112
2024 3300047322 Ga0495680_0002495 Ga0495680_0002495_15146_15487 112
2025 3300047322 Ga0495680_0002614 Ga0495680_0002614_11503_11844 112
2026 3300047322 Ga0495680_0007678 Ga0495680_0007678_3014_3403 112
2027 3300047322 Ga0495680_0024503 Ga0495680_0024503_1875_2213 112
2028 3300047322 Ga0495680_0044450 Ga0495680_0044450_109_483 112
2029 3300047322 Ga0495680_0619488 Ga0495680_0619488_89_430 112
2030 3300047322 Ga0495680_0637149 Ga0495680_0637149_72_422 112
2031 3300047323 Ga0495683_0070080 Ga0495683_0070080_353_691 112
2032 3300047323 Ga0495683_0106793 Ga0495683_0106793_249_587 112
2033 3300047444 Ga0495675_0000052 Ga0495675_0000052_50480_50821 112
2034 3300047444 Ga0495675_0003417 Ga0495675_0003417_2582_2923 112
2035 3300047444 Ga0495675_0008394 Ga0495675_0008394_390_779 112
2036 3300047444 Ga0495675_0012542 Ga0495675_0012542_3225_3566 112
2037 3300047444 Ga0495675_0014507 Ga0495675_0014507_3622_3960 112
2038 3300047444 Ga0495675_0198921 Ga0495675_0198921_656_994 112
2039 3300047444 Ga0495675_0252268 Ga0495675_0252268_197_547 112
2040 3300047444 Ga0495675_0482552 Ga0495675_0482552_32_370 112
2041 3300047469 Ga0495673_0088976 Ga0495673_0088976_584_922 112
2042 3300047471 Ga0495684_0001568 Ga0495684_0001568_17947_18297 112
2043 3300047471 Ga0495684_0004732 Ga0495684_0004732_8112_8459 112
2044 3300047471 Ga0495684_0008544 Ga0495684_0008544_4457_4846 112
2045 3300047471 Ga0495684_0011987 Ga0495684_0011987_5838_6179 112
2046 3300047471 Ga0495684_0022420 Ga0495684_0022420_3365_3703 112
2047 3300047471 Ga0495684_0059419 Ga0495684_0059419_463_804 112
2048 3300047471 Ga0495684_0068917 Ga0495684_0068917_2174_2515 112
2049 3300047471 Ga0495684_0324696 Ga0495684_0324696_44_382 112
2050 3300047471 Ga0495684_0397246 Ga0495684_0397246_171_509 112
2051 3300047471 Ga0495684_0629986 Ga0495684_0629986_268_609 112
2052 3300047472 Ga0495686_0007930 Ga0495686_0007930_4391_4744 112
2053 3300047472 Ga0495686_0080325 Ga0495686_0080325_1371_1709 112
2054 3300047472 Ga0495686_0672154 Ga0495686_0672154_11_349 112
2055 3300047673 Ga0495593_0002284 Ga0495593_0002284_8732_9073 112
2056 3300047673 Ga0495593_0016562 Ga0495593_0016562_3551_3892 112
2057 3300047673 Ga0495593_0322545 Ga0495593_0322545_234_575 112
2058 3300048088 Ga0495602_0036602 Ga0495602_0036602_640_981 112
2059 3300048088 Ga0495602_0050354 Ga0495602_0050354_3164_3505 112
2060 3300048088 Ga0495602_0069298 Ga0495602_0069298_1115_1453 112
2061 3300048088 Ga0495602_0148069 Ga0495602_0148069_1194_1544 112
2062 3300048088 Ga0495602_0280879 Ga0495602_0280879_388_726 112
2063 3300048088 Ga0495602_0568883 Ga0495602_0568883_121_459 112
2064 3300048089 Ga0495614_0001902 Ga0495614_0001902_8358_8696 112
2065 3300048089 Ga0495614_0011116 Ga0495614_0011116_1242_1583 112
2066 3300048089 Ga0495614_0036592 Ga0495614_0036592_696_1034 112
2067 3300048089 Ga0495614_0181402 Ga0495614_0181402_425_766 112
2068 3300048903 Ga0496100_0007601 Ga0496100_0007601_2201_2539 112
2069 3300048903 Ga0496100_0029040 Ga0496100_0029040_1854_2192 112
2070 3300048903 Ga0496100_0061559 Ga0496100_0061559_2115_2453 112
2071 3300048903 Ga0496100_0154076 Ga0496100_0154076_459_797 112
2072 3300048903 Ga0496100_0324730 Ga0496100_0324730_461_799 112
2073 3300048903 Ga0496100_0931766 Ga0496100_0931766_321_659 112
2074 3300048903 Ga0496100_1131048 Ga0496100_1131048_12_350 112
2075 3300048904 Ga0496101_0002089 Ga0496101_0002089_8779_9117 112
2076 3300048904 Ga0496101_0052756 Ga0496101_0052756_451_789 112
2077 3300048904 Ga0496101_0104226 Ga0496101_0104226_722_1060 112
2078 3300048904 Ga0496101_0250462 Ga0496101_0250462_743_1081 112
2079 3300048904 Ga0496101_0627423 Ga0496101_0627423_267_605 112
2080 3300048904 Ga0496101_0724387 Ga0496101_0724387_242_580 112
2081 3300048904 Ga0496101_0785465 Ga0496101_0785465_166_504 112
2082 3300048904 Ga0496101_1014760 Ga0496101_1014760_101_439 112
2083 3300048904 Ga0496101_1029425 Ga0496101_1029425_282_620 112
2084 3300048905 Ga0496102_0016235 Ga0496102_0016235_4719_5057 112
2085 3300048905 Ga0496102_0020787 Ga0496102_0020787_4480_4818 112
2086 3300048905 Ga0496102_0038436 Ga0496102_0038436_2984_3322 112
2087 3300048905 Ga0496102_0098401 Ga0496102_0098401_2342_2680 112
2088 3300048905 Ga0496102_0529950 Ga0496102_0529950_729_1067 112
2089 3300048905 Ga0496102_0555868 Ga0496102_0555868_248_586 112
2090 3300048905 Ga0496102_1009786 Ga0496102_1009786_55_393 112
2091 3300048906 Ga0496103_0008849 Ga0496103_0008849_816_1154 112
2092 3300048906 Ga0496103_0008856 Ga0496103_0008856_5610_5948 112
2093 3300048906 Ga0496103_0026334 Ga0496103_0026334_3084_3422 112
2094 3300048906 Ga0496103_0159917 Ga0496103_0159917_225_563 112
2095 3300048906 Ga0496103_0263269 Ga0496103_0263269_79_417 112
2096 3300048906 Ga0496103_0403411 Ga0496103_0403411_175_513 112
2097 3300048907 Ga0496104_0010970 Ga0496104_0010970_5558_5896 112
2098 3300048907 Ga0496104_0018250 Ga0496104_0018250_451_789 112
2099 3300048907 Ga0496104_0043933 Ga0496104_0043933_3799_4137 112
2100 3300048907 Ga0496104_0071634 Ga0496104_0071634_166_504 112
2101 3300048907 Ga0496104_0094575 Ga0496104_0094575_16_354 112
2102 3300048907 Ga0496104_0127483 Ga0496104_0127483_1049_1387 112
2103 3300048907 Ga0496104_0151160 Ga0496104_0151160_1348_1686 112
2104 3300048907 Ga0496104_0393359 Ga0496104_0393359_848_1186 112
2105 3300048907 Ga0496104_0534404 Ga0496104_0534404_609_947 112
2106 3300048907 Ga0496104_0625202 Ga0496104_0625202_150_551 112
2107 3300048907 Ga0496104_0854807 Ga0496104_0854807_214_555 112
2108 3300048907 Ga0496104_1823923 Ga0496104_1823923_115_453 112
2109 3300048908 Ga0496105_0014746 Ga0496105_0014746_4721_5059 112
2110 3300048908 Ga0496105_0047425 Ga0496105_0047425_2661_2999 112
2111 3300048908 Ga0496105_0081353 Ga0496105_0081353_2286_2624 112
2112 3300048908 Ga0496105_0085574 Ga0496105_0085574_1165_1503 112
2113 3300048908 Ga0496105_0192182 Ga0496105_0192182_805_1143 112
2114 3300048908 Ga0496105_0397245 Ga0496105_0397245_182_520 112
2115 3300048909 Ga0496106_0000863 Ga0496106_0000863_9457_9795 112
2116 3300048909 Ga0496106_0017625 Ga0496106_0017625_4777_5115 112
2117 3300048909 Ga0496106_0059652 Ga0496106_0059652_2423_2761 112
2118 3300048909 Ga0496106_0067384 Ga0496106_0067384_504_842 112
2119 3300048909 Ga0496106_0067877 Ga0496106_0067877_833_1171 112
2120 3300048909 Ga0496106_0170426 Ga0496106_0170426_1104_1442 112
2121 3300048909 Ga0496106_0444250 Ga0496106_0444250_448_786 112
2122 3300048909 Ga0496106_1049573 Ga0496106_1049573_59_397 112
2123 3300048910 Ga0496107_0000335 Ga0496107_0000335_14003_14341 112
2124 3300048910 Ga0496107_0128643 Ga0496107_0128643_1123_1461 112
2125 3300048910 Ga0496107_0152542 Ga0496107_0152542_793_1131 112
2126 3300048910 Ga0496107_0161917 Ga0496107_0161917_790_1128 112
2127 3300048910 Ga0496107_0353762 Ga0496107_0353762_660_998 112
2128 3300048910 Ga0496107_0382180 Ga0496107_0382180_614_952 112
2129 3300048910 Ga0496107_0887245 Ga0496107_0887245_61_399 112
2130 3300048911 Ga0496108_0028874 Ga0496108_0028874_919_1257 112
2131 3300048911 Ga0496108_0430852 Ga0496108_0430852_623_961 112
2132 3300048912 Ga0496109_0021621 Ga0496109_0021621_3483_3821 112
2133 3300048912 Ga0496109_0054159 Ga0496109_0054159_510_848 112
2134 3300048912 Ga0496109_0120590 Ga0496109_0120590_631_969 112
2135 3300048912 Ga0496109_0464332 Ga0496109_0464332_659_997 112
2136 3300048912 Ga0496109_1232237 Ga0496109_1232237_263_601 112
2137 3300048912 Ga0496109_1587858 Ga0496109_1587858_185_523 112
2138 3300048913 Ga0496110_0111670 Ga0496110_0111670_1348_1686 112
2139 3300048913 Ga0496110_0373870 Ga0496110_0373870_451_789 112
2140 3300048913 Ga0496110_0453810 Ga0496110_0453810_653_991 112
2141 3300048913 Ga0496110_0497867 Ga0496110_0497867_263_601 112
2142 3300048913 Ga0496110_0619269 Ga0496110_0619269_405_743 112
2143 3300048913 Ga0496110_0781326 Ga0496110_0781326_353_691 112
2144 3300048914 Ga0496111_0022443 Ga0496111_0022443_451_789 112
2145 3300048914 Ga0496111_0194491 Ga0496111_0194491_968_1306 112
2146 3300048914 Ga0496111_0235601 Ga0496111_0235601_420_758 112
2147 3300048915 Ga0496112_0020896 Ga0496112_0020896_2425_2763 112
2148 3300048915 Ga0496112_0068925 Ga0496112_0068925_18_359 112
2149 3300048915 Ga0496112_0226683 Ga0496112_0226683_1219_1557 112
2150 3300048915 Ga0496112_0281806 Ga0496112_0281806_312_650 112
2151 3300048915 Ga0496112_0608526 Ga0496112_0608526_591_929 112
2152 3300048915 Ga0496112_0718331 Ga0496112_0718331_526_864 112
2153 3300048915 Ga0496112_0752524 Ga0496112_0752524_433_771 112
2154 3300048915 Ga0496112_0872792 Ga0496112_0872792_261_602 112
2155 3300048915 Ga0496112_0942296 Ga0496112_0942296_224_562 112
2156 3300048915 Ga0496112_1208920 Ga0496112_1208920_167_505 112
2157 3300048915 Ga0496112_1478034 Ga0496112_1478034_63_401 112
2158 3300048916 Ga0496113_0054462 Ga0496113_0054462_2288_2626 112
2159 3300048916 Ga0496113_0193852 Ga0496113_0193852_1135_1473 112
2160 3300048916 Ga0496113_0194230 Ga0496113_0194230_944_1282 112
2161 3300048916 Ga0496113_0685314 Ga0496113_0685314_442_780 112
2162 3300048917 Ga0496114_0001714 Ga0496114_0001714_15307_15645 112
2163 3300048917 Ga0496114_0047247 Ga0496114_0047247_2107_2445 112
2164 3300048917 Ga0496114_0051397 Ga0496114_0051397_1869_2207 112
2165 3300048917 Ga0496114_0327732 Ga0496114_0327732_793_1131 112
2166 3300048917 Ga0496114_1513758 Ga0496114_1513758_49_387 112
2167 3300048918 Ga0496115_0019333 Ga0496115_0019333_632_970 112
2168 3300048918 Ga0496115_0041560 Ga0496115_0041560_510_848 112
2169 3300048918 Ga0496115_0106514 Ga0496115_0106514_543_881 112
2170 3300048918 Ga0496115_1162299 Ga0496115_1162299_128_469 112
2171 3300048923 Ga0496120_0254803 Ga0496120_0254803_268_606 112
2172 3300048929 Ga0496126_0000004 Ga0496126_0000004_706853_707191 112
2173 3300048929 Ga0496126_0000770 Ga0496126_0000770_18875_19213 112
2174 3300048929 Ga0496126_0010867 Ga0496126_0010867_3437_3775 112
2175 3300049460 Ga0495682_0026280 Ga0495682_0026280_1217_1555 112
2176 3300049460 Ga0495682_0071017 Ga0495682_0071017_469_807 112
2177 3300049518 Ga0501295_017782 Ga0501295_017782_741_1085 112
2178 3300049527 Ga0501311_060812 Ga0501311_060812_127_471 112
2179 3300049528 Ga0501312_032476 Ga0501312_032476_337_681 112
2180 3300049568 Ga0501031_0098143 Ga0501031_0098143_858_1196 112
2181 3300049568 Ga0501031_0115471 Ga0501031_0115471_1030_1368 112
2182 3300049568 Ga0501031_0240935 Ga0501031_0240935_341_679 112
2183 3300049568 Ga0501031_0276266 Ga0501031_0276266_18_356 112
2184 3300049568 Ga0501031_0556249 Ga0501031_0556249_86_424 112
2185 3300049568 Ga0501031_0821416 Ga0501031_0821416_210_548 112
2186 3300049569 Ga0501032_0123645 Ga0501032_0123645_780_1118 112
2187 3300049569 Ga0501032_0166955 Ga0501032_0166955_869_1207 112
2188 3300049570 Ga0501033_0167382 Ga0501033_0167382_659_997 112
2189 3300049572 Ga0501036_0137059 Ga0501036_0137059_1424_1762 112
2190 3300049572 Ga0501036_0196013 Ga0501036_0196013_652_1011 112
2191 3300049572 Ga0501036_0758565 Ga0501036_0758565_273_611 112
2192 3300049572 Ga0501036_1185812 Ga0501036_1185812_62_400 112
2193 3300049572 Ga0501036_1312112 Ga0501036_1312112_21_359 112
2194 3300049572 Ga0501036_1378618 Ga0501036_1378618_128_466 112
2195 3300049573 Ga0501037_0188200 Ga0501037_0188200_36_374 112
2196 3300049574 Ga0501038_0165646 Ga0501038_0165646_440_778 112
2197 3300049574 Ga0501038_0224378 Ga0501038_0224378_177_515 112
2198 3300049574 Ga0501038_0292395 Ga0501038_0292395_439_777 112
2199 3300049574 Ga0501038_0294434 Ga0501038_0294434_729_1067 112
2200 3300049574 Ga0501038_0801696 Ga0501038_0801696_308_646 112
2201 3300049575 Ga0501039_0229855 Ga0501039_0229855_854_1192 112
2202 3300049575 Ga0501039_0685983 Ga0501039_0685983_420_758 112
2203 3300049575 Ga0501039_0755135 Ga0501039_0755135_389_748 112
2204 3300049575 Ga0501039_0970668 Ga0501039_0970668_16_354 112
2205 3300049576 Ga0501040_0051676 Ga0501040_0051676_1585_1923 112
2206 3300049576 Ga0501040_0472963 Ga0501040_0472963_53_391 112
2207 3300049576 Ga0501040_0670789 Ga0501040_0670789_325_663 112
2208 3300049576 Ga0501040_1234028 Ga0501040_1234028_82_441 112
2209 3300049577 Ga0501041_0015485 Ga0501041_0015485_3263_3622 112
2210 3300049577 Ga0501041_0040540 Ga0501041_0040540_329_667 112
2211 3300049577 Ga0501041_0253893 Ga0501041_0253893_276_614 112
2212 3300049577 Ga0501041_0391432 Ga0501041_0391432_353_691 112
2213 3300049577 Ga0501041_0682442 Ga0501041_0682442_31_369 112
2214 3300049578 Ga0501042_0057102 Ga0501042_0057102_713_1051 112
2215 3300049578 Ga0501042_0062154 Ga0501042_0062154_403_762 112
2216 3300049578 Ga0501042_0104537 Ga0501042_0104537_536_874 112
2217 3300049578 Ga0501042_0550399 Ga0501042_0550399_180_518 112
2218 3300049579 Ga0501043_0239742 Ga0501043_0239742_1016_1354 112
2219 3300049579 Ga0501043_0286126 Ga0501043_0286126_797_1135 112
2220 3300049579 Ga0501043_0906633 Ga0501043_0906633_62_421 112
2221 3300049579 Ga0501043_1054921 Ga0501043_1054921_72_410 112
2222 3300049580 Ga0501046_0204496 Ga0501046_0204496_283_642 112
2223 3300049580 Ga0501046_0388470 Ga0501046_0388470_346_684 112
2224 3300049580 Ga0501046_0621448 Ga0501046_0621448_236_574 112
2225 3300049580 Ga0501046_0836527 Ga0501046_0836527_170_508 112
2226 3300049581 Ga0501047_0147313 Ga0501047_0147313_1848_2186 112
2227 3300049582 Ga0501048_0087289 Ga0501048_0087289_1415_1753 112
2228 3300049582 Ga0501048_0557053 Ga0501048_0557053_449_787 112
2229 3300049582 Ga0501048_0726503 Ga0501048_0726503_91_462 112
2230 3300049583 Ga0501067_0205867 Ga0501067_0205867_582_920 112
2231 3300049586 Ga0501070_0078965 Ga0501070_0078965_524_862 112
2232 3300049586 Ga0501070_0602490 Ga0501070_0602490_198_536 112
2233 3300049587 Ga0501071_0052272 Ga0501071_0052272_683_1021 112
2234 3300049587 Ga0501071_0517177 Ga0501071_0517177_169_507 112
2235 3300049587 Ga0501071_1360203 Ga0501071_1360203_197_535 112
2236 3300049588 Ga0501072_0196262 Ga0501072_0196262_942_1280 112
2237 3300049588 Ga0501072_0336896 Ga0501072_0336896_619_978 112
2238 3300049588 Ga0501072_1093998 Ga0501072_1093998_230_568 112
2239 3300049589 Ga0501073_0034581 Ga0501073_0034581_335_673 112
2240 3300049589 Ga0501073_0076495 Ga0501073_0076495_777_1115 112
2241 3300049589 Ga0501073_0387833 Ga0501073_0387833_551_910 112
2242 3300049590 Ga0501074_0104380 Ga0501074_0104380_385_723 112
2243 3300049590 Ga0501074_0173668 Ga0501074_0173668_451_789 112
2244 3300049590 Ga0501074_1039204 Ga0501074_1039204_11_370 112
2245 3300049590 Ga0501074_1305152 Ga0501074_1305152_52_390 112
2246 3300049591 Ga0501075_0379676 Ga0501075_0379676_580_918 112
2247 3300049591 Ga0501075_0397727 Ga0501075_0397727_204_563 112
2248 3300049591 Ga0501075_1485494 Ga0501075_1485494_13_360 112
2249 3300049592 Ga0501076_0068609 Ga0501076_0068609_259_618 112
2250 3300049592 Ga0501076_0198781 Ga0501076_0198781_346_684 112
2251 3300049592 Ga0501076_0241742 Ga0501076_0241742_454_792 112
2252 3300049592 Ga0501076_0268516 Ga0501076_0268516_699_1037 112
2253 3300049592 Ga0501076_0761333 Ga0501076_0761333_199_537 112
2254 3300049593 Ga0501077_0074786 Ga0501077_0074786_800_1159 112
2255 3300049593 Ga0501077_0523648 Ga0501077_0523648_247_585 112
2256 3300049593 Ga0501077_0759049 Ga0501077_0759049_67_405 112
2257 3300049593 Ga0501077_0879319 Ga0501077_0879319_111_449 112
2258 3300049660 Ga0501216_087684 Ga0501216_087684_53_397 112
2259 3300049679 Ga0501249_016405 Ga0501249_016405_123_467 112
2260 3300049741 Ga0501079_0373748 Ga0501079_0373748_540_899 112
2261 3300049742 Ga0501080_0210324 Ga0501080_0210324_829_1167 112
2262 3300049742 Ga0501080_0308003 Ga0501080_0308003_86_424 112
2263 3300049742 Ga0501080_0698019 Ga0501080_0698019_208_546 112
2264 3300049742 Ga0501080_0705672 Ga0501080_0705672_282_641 112
2265 3300049743 Ga0501081_0051625 Ga0501081_0051625_641_1000 112
2266 3300049743 Ga0501081_0239298 Ga0501081_0239298_458_796 112
2267 3300049743 Ga0501081_0345231 Ga0501081_0345231_274_612 112
2268 3300049744 Ga0501083_0119421 Ga0501083_0119421_782_1141 112
2269 3300049744 Ga0501083_0307903 Ga0501083_0307903_349_687 112
2270 3300049763 Ga0501266_059993 Ga0501266_059993_113_457 112
2271 3300049769 Ga0501272_041591 Ga0501272_041591_244_588 112
2272 3300049822 Ga0501035_0102424 Ga0501035_0102424_947_1285 112
2273 3300049822 Ga0501035_0502323 Ga0501035_0502323_119_478 112
2274 3300049822 Ga0501035_0683690 Ga0501035_0683690_240_578 112
2275 3300049822 Ga0501035_0842940 Ga0501035_0842940_179_517 112
2276 3300049823 Ga0501044_0176181 Ga0501044_0176181_1588_1926 112
2277 3300049823 Ga0501044_0715575 Ga0501044_0715575_455_814 112
2278 3300049824 Ga0501045_0057169 Ga0501045_0057169_1105_1464 112
2279 3300049824 Ga0501045_0213780 Ga0501045_0213780_809_1147 112
2280 3300049824 Ga0501045_0611379 Ga0501045_0611379_14_352 112
2281 3300050507 nmdc:mga05p37_1023337_c1 nmdc:mga05p37_1023337_c1_134_472 112
2282 3300050507 nmdc:mga05p37_137341_c1 nmdc:mga05p37_137341_c1_405_743 112
2283 3300050507 nmdc:mga05p37_408816_c1 nmdc:mga05p37_408816_c1_694_1032 112
2284 3300050507 nmdc:mga05p37_794116_c1 nmdc:mga05p37_794116_c1_569_907 112
2285 3300050507 nmdc:mga05p37_84017_c1 nmdc:mga05p37_84017_c1_381_719 112
2286 3300050508 nmdc:mga09592_256597_c1 nmdc:mga09592_256597_c1_127_465 112
2287 3300050508 nmdc:mga09592_53592_c1 nmdc:mga09592_53592_c1_2810_3148 112
2288 3300050508 nmdc:mga09592_639785_c1 nmdc:mga09592_639785_c1_408_746 112
2289 3300050509 nmdc:mga0qj67_581855_c1 nmdc:mga0qj67_581855_c1_135_473 112
2290 3300050509 nmdc:mga0qj67_81500_c1 nmdc:mga0qj67_81500_c1_924_1262 112
2291 3300050510 nmdc:mga06r32_114685_c1 nmdc:mga06r32_114685_c1_1438_1776 112
2292 3300050510 nmdc:mga06r32_464495_c1 nmdc:mga06r32_464495_c1_455_793 112
2293 3300050511 nmdc:mga08y16_419572_c1 nmdc:mga08y16_419572_c1_911_1249 112
2294 3300050511 nmdc:mga08y16_759004_c1 nmdc:mga08y16_759004_c1_509_847 112
2295 3300050512 nmdc:mga0n895_1018405_c1 nmdc:mga0n895_1018405_c1_395_733 112
2296 3300050512 nmdc:mga0n895_103_c1 nmdc:mga0n895_103_c1_39847_40185 112
2297 3300050512 nmdc:mga0n895_233_c1 nmdc:mga0n895_233_c1_10116_10454 112
2298 3300050512 nmdc:mga0n895_43795_c1 nmdc:mga0n895_43795_c1_80_418 112
2299 3300050512 nmdc:mga0n895_63955_c1 nmdc:mga0n895_63955_c1_2925_3263 112
2300 3300050513 nmdc:mga0rr50_101056_c1 nmdc:mga0rr50_101056_c1_391_729 112
2301 3300050513 nmdc:mga0rr50_1224010_c1 nmdc:mga0rr50_1224010_c1_59_397 112
2302 3300050513 nmdc:mga0rr50_337766_c1 nmdc:mga0rr50_337766_c1_326_664 112
2303 3300050513 nmdc:mga0rr50_350402_c1 nmdc:mga0rr50_350402_c1_132_473 112
2304 3300050513 nmdc:mga0rr50_436909_c1 nmdc:mga0rr50_436909_c1_501_839 112
2305 3300050513 nmdc:mga0rr50_493_c1 nmdc:mga0rr50_493_c1_20464_20802 112
2306 3300050514 nmdc:mga08x19_12489_c1 nmdc:mga08x19_12489_c1_4448_4792 112
2307 3300050514 nmdc:mga08x19_23477_c1 nmdc:mga08x19_23477_c1_945_1283 112
2308 3300050514 nmdc:mga08x19_259901_c1 nmdc:mga08x19_259901_c1_695_1039 112
2309 3300050514 nmdc:mga08x19_64753_c1 nmdc:mga08x19_64753_c1_1825_2163 112
2310 3300050515 nmdc:mga0a205_171_c1 nmdc:mga0a205_171_c1_22675_23013 112
2311 3300050515 nmdc:mga0a205_21442_c1 nmdc:mga0a205_21442_c1_202_540 112
2312 3300050515 nmdc:mga0a205_270691_c1 nmdc:mga0a205_270691_c1_1047_1385 112
2313 3300050515 nmdc:mga0a205_349732_c1 nmdc:mga0a205_349732_c1_890_1228 112
2314 3300050515 nmdc:mga0a205_57633_c1 nmdc:mga0a205_57633_c1_223_561 112
2315 3300050515 nmdc:mga0a205_697251_c1 nmdc:mga0a205_697251_c1_297_635 112
2316 3300050515 nmdc:mga0a205_949559_c1 nmdc:mga0a205_949559_c1_342_680 112
2317 3300053077 Ga0495601_0004254 Ga0495601_0004254_7589_7927 112
2318 3300053077 Ga0495601_0225537 Ga0495601_0225537_188_526 112
2319 3300053077 Ga0495601_0531209 Ga0495601_0531209_261_602 112
2320 3300053078 Ga0495612_0001587 Ga0495612_0001587_2063_2404 112
2321 3300053078 Ga0495612_0011361 Ga0495612_0011361_1741_2082 112
2322 3300053078 Ga0495612_0357546 Ga0495612_0357546_154_492 112
2323 3300053078 Ga0495612_0423433 Ga0495612_0423433_178_516 112
2324 3300053083 Ga0495655_0000429 Ga0495655_0000429_6211_6549 112
2325 3300053085 Ga0495619_0039417 Ga0495619_0039417_1647_1985 112
2326 3300053085 Ga0495619_0297264 Ga0495619_0297264_497_838 112
2327 3300053087 Ga0500643_042192 Ga0500643_042192_383_721 112
2328 3300053093 Ga0500651_0000005 Ga0500651_0000005_222446_222784 112
2329 3300053119 Ga0500595_000011 Ga0500595_000011_20288_20626 112
2330 3300054114 Ga0501084_0039274 Ga0501084_0039274_296_634 112
2331 3300054114 Ga0501084_0645739 Ga0501084_0645739_530_868 112
2332 3300054114 Ga0501084_0665742 Ga0501084_0665742_406_765 112
2333 3300054114 Ga0501084_0789770 Ga0501084_0789770_32_370 112
2334 3300054114 Ga0501084_1243521 Ga0501084_1243521_195_533 112
2335 3300054114 Ga0501084_1878385 Ga0501084_1878385_64_402 112
2336 3300059503 Ga0587080_049109 Ga0587080_049109_178_516 112
2337 3300059504 Ga0587082_072414 Ga0587082_072414_28_366 112
2338 3300059505 Ga0587083_0017438 Ga0587083_0017438_552_890 112
2339 3300059505 Ga0587083_0035865 Ga0587083_0035865_294_632 112
2340 3300059506 Ga0587085_035212 Ga0587085_035212_212_550 112
2341 3300059507 Ga0587086_007380 Ga0587086_007380_333_671 112
2342 3300059508 Ga0587088_047426 Ga0587088_047426_256_594 112
2343 3300059509 Ga0587089_034761 Ga0587089_034761_218_556 112
2344 3300059512 Ga0587092_061532 Ga0587092_061532_350_688 112
2345 3300059513 Ga0587094_017661 Ga0587094_017661_340_678 112
2346 3300059623 Ga0587101_029992 Ga0587101_029992_292_630 112
2347 3300059627 Ga0587117_026016 Ga0587117_026016_264_602 112
2348 3300059627 Ga0587117_032244 Ga0587117_032244_23_361 112
2349 3300059630 Ga0587128_002947 Ga0587128_002947_1081_1419 112
2350 3300059630 Ga0587128_003083 Ga0587128_003083_278_616 112
2351 3300059640 Ga0587067_043751 Ga0587067_043751_220_558 112
2352 3300059641 Ga0587068_040459 Ga0587068_040459_180_518 112
2353 3300059642 Ga0587069_033667 Ga0587069_033667_268_606 112
2354 3300059643 Ga0587072_108340 Ga0587072_108340_256_594 112
2355 3300059644 Ga0587075_006474 Ga0587075_006474_885_1223 112
2356 3300059645 Ga0587076_048897 Ga0587076_048897_263_601 112
2357 3300060344 Ga0587071_048605 Ga0587071_048605_310_648 112
2358 3300060346 Ga0587111_0112439 Ga0587111_0112439_175_513 112
2359 3300060353 Ga0501082_0202875 Ga0501082_0202875_877_1236 112
2360 3300060353 Ga0501082_0247351 Ga0501082_0247351_294_632 112
2361 3300060353 Ga0501082_0320357 Ga0501082_0320357_265_603 112
2362 3300060353 Ga0501082_0406378 Ga0501082_0406378_643_981 112
2363 3300060353 Ga0501082_1605652 Ga0501082_1605652_180_518 112
2364 3300061719 Ga0466962_0163346 Ga0466962_0163346_210_554 112
2365 3300061734 Ga0530510_0021810 Ga0530510_0021810_442_780 112
2366 3300061734 Ga0530510_0084725 Ga0530510_0084725_1108_1446 112
2367 3300061734 Ga0530510_0144521 Ga0530510_0144521_1330_1689 112
2368 3300061734 Ga0530510_0504054 Ga0530510_0504054_569_907 112
2369 3300061734 Ga0530510_0563530 Ga0530510_0563530_193_531 112
2370 3300061734 Ga0530510_1058934 Ga0530510_1058934_100_438 112

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00543

P-II

Nitrogen regulatory protein P-II

3

109

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p4y-assembly4.cif.gz_K glnk2 from methanothermococcus thermolithotrophicus in the apo state at a resolution of 2.3 a 0.9861 2 112
1v3r-assembly1.cif.gz_B crystal structure of tt1020 from thermus thermophilus hb8 0.9827 1 108
1vfj-assembly1.cif.gz_C crystal structure of tt1020 from thermus thermophilus hb8 0.9826 1 108
1v3s-assembly1.cif.gz_C crystal structure of tt1020 from thermus thermophilus hb8 0.9825 1 108
5l9n-assembly1.cif.gz_A structure of uridylylated glnb from escherichia coli bound to atp 0.9782 1 108
ID Description Score Start End Superfamily
4oznB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9469 2 112 3.30.70.120
2o66C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9442 2 111 3.30.70.120
4usiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9327 2 108 3.30.70.120
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.914 1 111 3.30.70.120
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9048 1 111 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A357BKJ3-F1-model_v4 P-II family nitrogen regulator 0.9466 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A357BKJ3-F1-model_v4 P-II family nitrogen regulator 0.9375 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A1F7F2C5-F1-model_v4 Transcriptional regulator 0.9264 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A7C3Q2H0-F1-model_v4 P-II family nitrogen regulator 0.9216 1 109 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A1G1KQM7-F1-model_v4 Transcriptional regulator 0.9203 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234

Feature Viewer

pLDDT pTM Quality
89.53 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map