F496752

General Info

Members Datasets Scaffolds Average Seq Length
2374 762 4748 101

Family's Representative Sequence

Representative Sequence 3300049585|Ga0501069_0190746|Ga0501069_0190746_509_853
Length 114
Sequence MRRHPPYQGGEGMTLDLSHYLTLAAILFAISVVGIFLNRRNLIVLLMAIELMLLAVNLNFIAFSHYLGNAAGQVFVFFILTVAAAESAIGLAILVVLFRNINTIDVEDLDSLRG

Samples

Sample ID Description Type Environment
1 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
8 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
9 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
12 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
13 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
16 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
23 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
27 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
28 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
29 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
30 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
31 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
32 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
33 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
34 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
35 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
36 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
39 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
40 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
44 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
45 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
46 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
47 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
48 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
49 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
50 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
51 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
52 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
53 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
54 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
55 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
56 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
57 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
58 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
59 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
60 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
61 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
62 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
63 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
64 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
65 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
66 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
67 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
68 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
69 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
70 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
71 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
72 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
73 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
74 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
75 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
76 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
77 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
78 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
79 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
80 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
81 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
82 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
83 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
84 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
85 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
86 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
87 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
88 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
89 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
90 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
91 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
92 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
93 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
94 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
95 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
96 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
97 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
98 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
99 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
100 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
101 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
102 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
103 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
104 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
105 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
106 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
107 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
108 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
109 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
110 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
111 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
112 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
113 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
114 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
115 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
116 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
117 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
118 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
119 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
120 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
121 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
122 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
123 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
124 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
125 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
126 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
127 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
128 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
129 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
130 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
131 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
132 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
133 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
134 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
135 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
136 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
137 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
138 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
139 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
140 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
141 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
142 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
143 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
144 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
145 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
146 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
147 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
148 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
149 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
150 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
151 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
152 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
153 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
154 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
155 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
156 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
157 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
158 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
159 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
160 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
161 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
162 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
163 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
164 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
165 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
166 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
167 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
168 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
169 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
170 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
171 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
172 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
173 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
174 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
175 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
176 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
177 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
178 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
179 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
180 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
181 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
182 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
183 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
184 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
185 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
186 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
187 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
188 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
189 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
190 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
192 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
193 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
194 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
195 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
202 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
203 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
204 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
207 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
208 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
209 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
210 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
212 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
213 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
214 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
215 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
216 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
217 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
219 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
220 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
292 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
293 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
295 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
296 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
297 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
298 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
299 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
300 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
301 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
302 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
303 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
304 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
306 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
307 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
308 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
309 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
310 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
311 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
315 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
316 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
317 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
318 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
319 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
320 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
321 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
322 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
323 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
324 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
325 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
326 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
327 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
328 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
329 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
330 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
331 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
332 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
333 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
334 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
335 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
336 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
337 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
338 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
339 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
340 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
341 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
342 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
343 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
344 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
345 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
346 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
347 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
348 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
349 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
350 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
351 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
352 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
353 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
354 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
355 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
356 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
357 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
358 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
359 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
360 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
361 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
362 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
363 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
364 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
365 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
366 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
367 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
368 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
369 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
370 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
371 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
372 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
373 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
374 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
375 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
376 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
377 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
378 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
379 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
380 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
381 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
382 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
383 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
384 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
385 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
386 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
387 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
388 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
389 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
390 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
391 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
392 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
393 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
394 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
395 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
396 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
397 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
398 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
399 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
400 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
401 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
402 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
403 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
404 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
405 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
406 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
407 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
408 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
409 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
410 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
411 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
412 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
413 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
414 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
415 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
416 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
417 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
418 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
419 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
420 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
421 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
422 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
423 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
424 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
425 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
426 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
427 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
428 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
429 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
430 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
431 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
432 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
433 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
434 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
435 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
436 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
437 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
438 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
439 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
440 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
441 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
442 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
443 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
444 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
445 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
446 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
447 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
448 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
449 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
450 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
451 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
452 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
453 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
454 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
455 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
456 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
457 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
458 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
459 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
460 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
461 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
462 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
463 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
464 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
465 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
466 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
467 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
468 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
469 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
470 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
471 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
472 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
473 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
474 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
475 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
476 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
477 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
478 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
479 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
480 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
481 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
482 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
483 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
484 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
485 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
486 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
487 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
488 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
489 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
490 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
491 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
492 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
493 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
494 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
495 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
496 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
497 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
498 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
499 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
500 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
501 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
502 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
503 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
504 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
505 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
506 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
507 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
508 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
509 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
510 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
511 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
512 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
513 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
514 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
515 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
516 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
517 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
518 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
519 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
520 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
521 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
522 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
523 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
524 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
525 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
526 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
527 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
528 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
529 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
530 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
531 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
532 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
533 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
534 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
535 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
536 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
537 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
538 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
539 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
540 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
541 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
542 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
543 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
544 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
545 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
546 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
547 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
548 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
549 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
550 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
551 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
552 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
553 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
554 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
555 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
556 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
557 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
558 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
559 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
560 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
561 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
562 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
563 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
564 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
565 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
566 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
567 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
568 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
569 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
570 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
571 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
572 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
573 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
574 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
575 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
576 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
577 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
578 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
579 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
580 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
581 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
582 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
583 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
584 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
585 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
586 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
587 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
588 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
589 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
590 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
591 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
592 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
593 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
594 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
595 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
596 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
597 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
598 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
599 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
600 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
601 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
602 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
603 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
604 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
605 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
606 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
607 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
608 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
609 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
610 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
611 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
612 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
613 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
614 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
615 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
616 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
617 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
618 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
619 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
620 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
621 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
622 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
623 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
624 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
625 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
626 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
627 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
628 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
629 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
630 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
631 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
632 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
633 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
634 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
635 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
636 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
637 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
638 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
639 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
640 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
641 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
642 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
643 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
644 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
645 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
646 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
647 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
648 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
649 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
650 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
651 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
652 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
653 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
654 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
655 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
656 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
657 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
658 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
659 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
660 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
661 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
662 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
663 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
664 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
665 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
666 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
667 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
668 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
669 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
670 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
671 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
672 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
673 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
674 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
675 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
676 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
677 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
678 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
679 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
680 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
681 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
682 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
683 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
684 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
685 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
686 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
687 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
688 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
689 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
690 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
691 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
692 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
693 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
694 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
695 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
696 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
697 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
698 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
699 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
700 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
701 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
702 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
703 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
704 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
705 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
706 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
707 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
708 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
709 2643221556 Massilia sp. Root1485 Isolate Unclassified
710 2643221638 Duganella sp. Root336D2 Isolate Unclassified
711 2643221645 Massilia sp. Root351 Isolate Unclassified
712 2643221664 Massilia sp. Root418 Isolate Unclassified
713 2643221684 Massilia sp. Root133 Isolate Unclassified
714 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
715 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
716 2738541280 Massilia sp. GV090 Isolate Unclassified
717 2738541300 Massilia sp. GV016 Isolate Unclassified
718 2738543018 Massilia sp. GV045 Isolate Unclassified
719 2738543030 Massilia sp. GV097 Isolate Unclassified
720 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
721 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
722 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
723 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
724 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
725 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
726 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
727 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
728 2818991452 Burkholderia cepacia 561 Isolate Unclassified
729 2842711865 Duganella sp. R-73148 Isolate Unclassified
730 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
731 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
732 2857553236 Duganella sp. R-74557 Isolate Unclassified
733 2857558681 Duganella sp. R-74565 Isolate Unclassified
734 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
735 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
736 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
737 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
738 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
739 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
740 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
741 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
742 2904424332 Duganella sp. 1411 Isolate Rhizosphere
743 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
744 2904564687 Burkholderia sp. 571 Isolate Unclassified
745 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
746 2919476304 Duganella sp. 3397 Isolate Unclassified
747 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
748 2928163908 Burkholderia sp. 567 Isolate Unclassified
749 2928170801 Burkholderia sp. 572 Isolate Unclassified
750 2928536128 Burkholderia sola 565 Isolate Unclassified
751 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
752 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
753 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
754 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
755 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
756 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
757 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
758 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
759 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
760 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
761 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
762 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.85
Metatranscriptomes 3.45
Isolates 2.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.4
Nodule 0.42
Rhizoplane 3.07
Rhizosphere 85.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501069_0190746 3300049585 Bacteria 1186
2 JGI24736J21556_1005532 3300001904 Bacteria 2132
3 JGI24736J21556_1030490 3300001904 Bacteria 833
4 JGI24739J22299_10075201 3300001989 Bacteria 1045
5 JGI24739J22299_10090660 3300001989 Bacteria 931
6 JGI24739J22299_10093162 3300001989 Bacteria 915
7 JGI24739J22299_10150065 3300001989 Bacteria 689
8 JGI24737J22298_10021955 3300001990 Bacteria 2030
9 JGI24735J21928_10004761 3300002067 Bacteria 4529
10 JGI24735J21928_10045752 3300002067 Bacteria 1270
11 JGI24742J22300_10040961 3300002244 Bacteria 825
12 JGI25155J39150_1000720 3300002704 Bacteria 5784
13 JGI25155J39150_1000725 3300002704 Bacteria 5727
14 JGI25156J39149_1000539 3300002705 Bacteria 21759
15 JGI25156J39149_1003832 3300002705 Bacteria 4785
16 JGI25162J39368_1003949 3300002737 Bacteria 3795
17 JGI25154J39366_1000471 3300002738 Bacteria 21074
18 JGI25154J39366_1001331 3300002738 Bacteria 9086
19 JGI25154J39366_1001346 3300002738 Bacteria 9004
20 JGI25158J39367_1000859 3300002739 Bacteria 5792
21 JGI25157J39369_1000359 3300002741 Bacteria 31770
22 JGI25152J39213_1038240 3300002773 Bacteria 690
23 JGI25150J39212_1002919 3300002774 Bacteria 4131
24 JGI25159J45721_1001302 3300002987 Bacteria 10528
25 Ga0006759J45824_1073084 3300003163 Bacteria 2615
26 JGI25151J46595_10015102 3300003187 Bacteria 3420
27 JGI25153J46596_10039306 3300003215 Bacteria 1479
28 JGI25153J46596_10041657 3300003215 Bacteria 1410
29 rootL2_10035855 3300003322 Bacteria 1198
30 JGI25160J50197_1010821 3300003354 Bacteria 3273
31 Ga0007417J51691_1052140 3300003544 Bacteria 618
32 Ga0007410J51695_1037975 3300003574 Bacteria 4043
33 Ga0007409J51694_1013012 3300003575 Bacteria 10513
34 Ga0007409J51694_1026750 3300003575 Bacteria 5092
35 Ga0007416J51690_1021228 3300003577 Bacteria 10458
36 Ga0032354_1056868 3300003693 Bacteria 5896
37 Ga0055532_1000023 3300003758 Bacteria 248212
38 Ga0055532_1013264 3300003758 Bacteria 941
39 Ga0055525_1000001 3300003759 Bacteria 1016948
40 Ga0055527_1006290 3300003760 Bacteria 1492
41 Ga0055527_1011250 3300003760 Bacteria 1025
42 Ga0055535_1010124 3300003761 Bacteria 1570
43 Ga0055535_1016202 3300003761 Bacteria 1025
44 Ga0055535_1016203 3300003761 Bacteria 1025
45 Ga0055542_1003930 3300003762 Bacteria 3808
46 Ga0055542_1004189 3300003762 Bacteria 3603
47 Ga0055542_1013692 3300003762 Bacteria 1356
48 Ga0055529_1000080 3300003763 Bacteria 148614
49 Ga0055529_1006072 3300003763 Bacteria 1709
50 Ga0055529_1014636 3300003763 Bacteria 993
51 Ga0055526_1001704 3300003771 Bacteria 15350
52 Ga0055526_1002909 3300003771 Bacteria 11254
53 Ga0055526_1002911 3300003771 Bacteria 11252
54 Ga0055526_1022939 3300003771 Bacteria 2101
55 Ga0055537_1000012 3300003773 Bacteria 133761
56 Ga0055537_1004026 3300003773 Bacteria 4324
57 Ga0055524_1000021 3300003775 Bacteria 227578
58 Ga0055524_1010983 3300003775 Bacteria 3566
59 Ga0055524_1030369 3300003775 Bacteria 1577
60 Ga0055534_1000529 3300003784 Bacteria 20625
61 Ga0055528_1000073 3300003790 Bacteria 77054
62 Ga0055528_1006103 3300003790 Bacteria 5505
63 Ga0055528_1008801 3300003790 Bacteria 4277
64 Ga0055528_1011504 3300003790 Bacteria 3506
65 Ga0055531_10048281 3300003794 Bacteria 1149
66 Ga0055541_1009639 3300003841 Bacteria 1483
67 Ga0058692_1005164 3300003856 Bacteria 3755
68 Ga0055543_1033000 3300004625 Bacteria 897
69 Ga0065165_1000156 3300005262 Bacteria 119261
70 Ga0065165_1034885 3300005262 Bacteria 1550
71 Ga0065714_10104740 3300005288 Bacteria 1567
72 Ga0065704_10162523 3300005289 Bacteria 1344
73 Ga0065704_10492334 3300005289 Bacteria 673
74 Ga0065712_10081344 3300005290 Bacteria 3015
75 Ga0065712_10086540 3300005290 Bacteria 2630
76 Ga0065715_10126937 3300005293 Bacteria 2098
77 Ga0065715_10201625 3300005293 Bacteria 1335
78 Ga0065715_10397033 3300005293 Bacteria 866
79 Ga0065707_10105719 3300005295 Bacteria 2626
80 Ga0065707_10625010 3300005295 Bacteria 677
81 Ga0070658_10171325 3300005327 Bacteria 1823
82 Ga0070658_10514554 3300005327 Bacteria 1034
83 Ga0070676_10210673 3300005328 Bacteria 1279
84 Ga0070676_10429392 3300005328 Bacteria 925
85 Ga0070676_10945398 3300005328 Bacteria 644
86 Ga0070683_100018665 3300005329 Bacteria 6147
87 Ga0070683_100487012 3300005329 Bacteria 1178
88 Ga0070690_100001009 3300005330 Bacteria 14387
89 Ga0070690_100002775 3300005330 Bacteria 9465
90 Ga0070690_100002867 3300005330 Bacteria 9296
91 Ga0070690_100377503 3300005330 Bacteria 1035
92 Ga0070690_100704220 3300005330 Bacteria 776
93 Ga0070670_100008912 3300005331 Bacteria 8565
94 Ga0070670_100806807 3300005331 Bacteria 848
95 Ga0070670_100925450 3300005331 Bacteria 791
96 Ga0070670_101182415 3300005331 Bacteria 699
97 Ga0070677_10085884 3300005333 Bacteria 1358
98 Ga0068869_100001595 3300005334 Bacteria 13483
99 Ga0068869_100063014 3300005334 Bacteria 2722
100 Ga0068869_100094726 3300005334 Bacteria 2252
101 Ga0068869_100245546 3300005334 Bacteria 1428
102 Ga0068869_100666502 3300005334 Bacteria 884
103 Ga0068869_101319928 3300005334 Bacteria 637
104 Ga0068869_102066678 3300005334 Bacteria 512
105 Ga0070666_10253033 3300005335 Bacteria 1247
106 Ga0070666_10426392 3300005335 Bacteria 956
107 Ga0070680_100013746 3300005336 Bacteria 6313
108 Ga0070680_100058208 3300005336 Bacteria 3160
109 Ga0070680_100202711 3300005336 Bacteria 1673
110 Ga0070680_100222721 3300005336 Bacteria 1592
111 Ga0070682_100090946 3300005337 Bacteria 1997
112 Ga0070682_100216980 3300005337 Bacteria 1359
113 Ga0070682_100242388 3300005337 Bacteria 1295
114 Ga0070682_100522181 3300005337 Bacteria 924
115 Ga0070682_100791080 3300005337 Bacteria 770
116 Ga0068868_100005336 3300005338 Bacteria 9021
117 Ga0068868_100007038 3300005338 Bacteria 7995
118 Ga0068868_100238554 3300005338 Bacteria 1527
119 Ga0068868_100367190 3300005338 Bacteria 1236
120 Ga0068868_100529446 3300005338 Bacteria 1036
121 Ga0068868_101477755 3300005338 Bacteria 636
122 Ga0068868_102102863 3300005338 Bacteria 537
123 Ga0070660_100002701 3300005339 Bacteria 12178
124 Ga0070660_100149159 3300005339 Bacteria 1879
125 Ga0070660_101599813 3300005339 Bacteria 554
126 Ga0070689_100003115 3300005340 Bacteria 10952
127 Ga0070689_100005312 3300005340 Bacteria 8780
128 Ga0070689_100120991 3300005340 Bacteria 2091
129 Ga0070689_100395249 3300005340 Bacteria 1167
130 Ga0070689_100835885 3300005340 Bacteria 812
131 Ga0070691_10000927 3300005341 Bacteria 11893
132 Ga0070691_10010007 3300005341 Bacteria 4321
133 Ga0070691_10489895 3300005341 Bacteria 709
134 Ga0070687_100000367 3300005343 Bacteria 15417
135 Ga0070687_100074624 3300005343 Bacteria 1832
136 Ga0070687_100175900 3300005343 Bacteria 1278
137 Ga0070687_100411817 3300005343 Bacteria 889
138 Ga0070687_100522856 3300005343 Bacteria 803
139 Ga0070687_100765048 3300005343 Bacteria 681
140 Ga0070661_100007249 3300005344 Bacteria 7647
141 Ga0070661_100207600 3300005344 Bacteria 1498
142 Ga0070692_10000993 3300005345 Bacteria 9719
143 Ga0070692_10069478 3300005345 Bacteria 1874
144 Ga0070692_10075084 3300005345 Bacteria 1809
145 Ga0070692_10095036 3300005345 Bacteria 1626
146 Ga0070692_10413409 3300005345 Bacteria 854
147 Ga0070692_10918085 3300005345 Bacteria 606
148 Ga0070692_11249156 3300005345 Bacteria 531
149 Ga0070668_100253113 3300005347 Bacteria 1463
150 Ga0070668_101844152 3300005347 Bacteria 556
151 Ga0070669_100034552 3300005353 Bacteria 3660
152 Ga0070669_100049156 3300005353 Bacteria 3079
153 Ga0070669_100293599 3300005353 Bacteria 1305
154 Ga0070675_100039670 3300005354 Bacteria 3843
155 Ga0070675_100044347 3300005354 Bacteria 3637
156 Ga0070675_100402268 3300005354 Bacteria 1222
157 Ga0070675_101066640 3300005354 Bacteria 742
158 Ga0070671_100038050 3300005355 Bacteria 3993
159 Ga0070671_100558018 3300005355 Bacteria 988
160 Ga0070671_102096695 3300005355 Bacteria 504
161 Ga0070674_100066570 3300005356 Bacteria 2532
162 Ga0070674_100127966 3300005356 Bacteria 1889
163 Ga0070674_100164801 3300005356 Bacteria 1685
164 Ga0070674_100504462 3300005356 Bacteria 1008
165 Ga0070674_101202538 3300005356 Bacteria 673
166 Ga0070674_101901993 3300005356 Bacteria 541
167 Ga0070673_100024655 3300005364 Bacteria 4415
168 Ga0070673_100051130 3300005364 Bacteria 3234
169 Ga0070673_101339269 3300005364 Bacteria 673
170 Ga0070688_100075036 3300005365 Bacteria 2173
171 Ga0070688_100289505 3300005365 Bacteria 1180
172 Ga0070688_100432243 3300005365 Bacteria 981
173 Ga0070688_100746052 3300005365 Bacteria 762
174 Ga0070688_101018476 3300005365 Bacteria 659
175 Ga0070659_100000069 3300005366 Bacteria 81078
176 Ga0070659_100149269 3300005366 Bacteria 1906
177 Ga0070659_100183772 3300005366 Bacteria 1716
178 Ga0070667_100051694 3300005367 Bacteria 3465
179 Ga0070667_100171074 3300005367 Bacteria 1918
180 Ga0070667_100171495 3300005367 Bacteria 1915
181 Ga0070703_10040538 3300005406 Bacteria 1448
182 Ga0070703_10125036 3300005406 Bacteria 938
183 Ga0070709_10836217 3300005434 Bacteria 724
184 Ga0070709_11208089 3300005434 Bacteria 608
185 Ga0070709_11448720 3300005434 Bacteria 557
186 Ga0070714_100009259 3300005435 Bacteria 7738
187 Ga0070713_100000033 3300005436 Bacteria 86758
188 Ga0070713_100205825 3300005436 Bacteria 1779
189 Ga0070710_10126218 3300005437 Bacteria 1555
190 Ga0070701_10010798 3300005438 Bacteria 4054
191 Ga0070701_10012435 3300005438 Bacteria 3840
192 Ga0070701_10068602 3300005438 Bacteria 1889
193 Ga0070701_10101896 3300005438 Bacteria 1592
194 Ga0070701_10128394 3300005438 Bacteria 1438
195 Ga0070711_100116707 3300005439 Bacteria 1967
196 Ga0070711_100143083 3300005439 Bacteria 1795
197 Ga0070705_100000337 3300005440 Bacteria 27585
198 Ga0070705_100017946 3300005440 Bacteria 3700
199 Ga0070705_100019507 3300005440 Bacteria 3569
200 Ga0070705_100275503 3300005440 Bacteria 1193
201 Ga0070705_100770436 3300005440 Bacteria 763
202 Ga0070705_101185526 3300005440 Bacteria 628
203 Ga0070705_101213804 3300005440 Bacteria 622
204 Ga0070700_100001013 3300005441 Bacteria 13883
205 Ga0070700_100003020 3300005441 Bacteria 8628
206 Ga0070700_100239557 3300005441 Bacteria 1296
207 Ga0070700_100335549 3300005441 Bacteria 1116
208 Ga0070700_100598458 3300005441 Bacteria 863
209 Ga0070700_100606317 3300005441 Bacteria 858
210 Ga0070700_101451055 3300005441 Bacteria 582
211 Ga0070694_100001944 3300005444 Bacteria 12250
212 Ga0070694_100015443 3300005444 Bacteria 4798
213 Ga0070694_100018554 3300005444 Bacteria 4415
214 Ga0070694_100182528 3300005444 Bacteria 1553
215 Ga0070694_100608694 3300005444 Bacteria 880
216 Ga0070694_101204988 3300005444 Bacteria 634
217 Ga0070708_100038088 3300005445 Bacteria 4199
218 Ga0070708_100139816 3300005445 Bacteria 2245
219 Ga0070708_101353564 3300005445 Bacteria 664
220 Ga0070663_100000948 3300005455 Bacteria 15775
221 Ga0070663_100165072 3300005455 Bacteria 1707
222 Ga0070663_100806931 3300005455 Bacteria 805
223 Ga0070663_101234909 3300005455 Bacteria 658
224 Ga0070678_100006957 3300005456 Bacteria 6677
225 Ga0070678_100037773 3300005456 Bacteria 3394
226 Ga0070678_100093579 3300005456 Bacteria 2311
227 Ga0070678_100565762 3300005456 Bacteria 1011
228 Ga0070678_100587316 3300005456 Bacteria 993
229 Ga0070678_100771209 3300005456 Bacteria 871
230 Ga0070678_101221283 3300005456 Bacteria 698
231 Ga0070662_100008477 3300005457 Bacteria 6706
232 Ga0070662_100599011 3300005457 Bacteria 927
233 Ga0070662_101342092 3300005457 Bacteria 616
234 Ga0070662_101783977 3300005457 Bacteria 531
235 Ga0070662_101834102 3300005457 Bacteria 524
236 Ga0070681_10014534 3300005458 Bacteria 7834
237 Ga0070681_10247182 3300005458 Bacteria 1697
238 Ga0070681_10337430 3300005458 Bacteria 1417
239 Ga0070681_10734325 3300005458 Bacteria 904
240 Ga0070681_11315233 3300005458 Bacteria 646
241 Ga0070681_11441575 3300005458 Bacteria 613
242 Ga0068867_100001711 3300005459 Bacteria 15285
243 Ga0068867_100103377 3300005459 Bacteria 2179
244 Ga0068867_100103681 3300005459 Bacteria 2176
245 Ga0068867_100197805 3300005459 Bacteria 1607
246 Ga0068867_100255209 3300005459 Bacteria 1427
247 Ga0068867_100277743 3300005459 Bacteria 1372
248 Ga0068867_100458482 3300005459 Bacteria 1088
249 Ga0068867_100489189 3300005459 Bacteria 1055
250 Ga0068867_100585877 3300005459 Bacteria 971
251 Ga0068867_100634421 3300005459 Bacteria 935
252 Ga0068867_101525580 3300005459 Bacteria 623
253 Ga0070685_10002374 3300005466 Bacteria 9687
254 Ga0070685_11369508 3300005466 Bacteria 542
255 Ga0070685_11562588 3300005466 Bacteria 510
256 Ga0070706_100039082 3300005467 Bacteria 4381
257 Ga0070706_100491786 3300005467 Bacteria 1141
258 Ga0070706_100527406 3300005467 Bacteria 1099
259 Ga0070707_100082853 3300005468 Bacteria 3098
260 Ga0070707_100123962 3300005468 Bacteria 2509
261 Ga0070698_100362862 3300005471 Bacteria 1381
262 Ga0070698_101359718 3300005471 Bacteria 661
263 Ga0070699_100009169 3300005518 Bacteria 8578
264 Ga0070699_100017481 3300005518 Bacteria 6155
265 Ga0070699_100357307 3300005518 Bacteria 1317
266 Ga0070699_100617587 3300005518 Bacteria 989
267 Ga0070699_100698645 3300005518 Bacteria 927
268 Ga0070699_102212258 3300005518 Bacteria 502
269 Ga0070679_100057970 3300005530 Bacteria 3859
270 Ga0070679_100073581 3300005530 Bacteria 3408
271 Ga0070679_100477043 3300005530 Bacteria 1192
272 Ga0070679_101926360 3300005530 Bacteria 540
273 Ga0070684_100111325 3300005535 Bacteria 2455
274 Ga0070684_100504493 3300005535 Bacteria 1121
275 Ga0070684_101482983 3300005535 Bacteria 639
276 Ga0070697_100002415 3300005536 Bacteria 14379
277 Ga0070697_100109125 3300005536 Bacteria 2304
278 Ga0070697_100492962 3300005536 Bacteria 1071
279 Ga0070697_100994230 3300005536 Bacteria 746
280 Ga0070697_101204996 3300005536 Bacteria 675
281 Ga0068853_100431783 3300005539 Bacteria 1237
282 Ga0070672_100096087 3300005543 Bacteria 2397
283 Ga0070672_100454426 3300005543 Bacteria 1104
284 Ga0070672_100550151 3300005543 Bacteria 1002
285 Ga0070672_100670308 3300005543 Bacteria 907
286 Ga0070672_100686925 3300005543 Bacteria 896
287 Ga0070686_100005023 3300005544 Bacteria 7305
288 Ga0070686_100025094 3300005544 Bacteria 3581
289 Ga0070686_100058485 3300005544 Bacteria 2480
290 Ga0070686_100060262 3300005544 Bacteria 2448
291 Ga0070686_101335319 3300005544 Bacteria 600
292 Ga0070686_101508217 3300005544 Bacteria 567
293 Ga0070695_100020705 3300005545 Bacteria 4017
294 Ga0070695_100031232 3300005545 Bacteria 3320
295 Ga0070695_100277680 3300005545 Bacteria 1230
296 Ga0070695_100436886 3300005545 Bacteria 1000
297 Ga0070695_101690757 3300005545 Bacteria 530
298 Ga0070696_100006757 3300005546 Bacteria 7660
299 Ga0070696_100008352 3300005546 Bacteria 6927
300 Ga0070696_100018750 3300005546 Bacteria 4680
301 Ga0070696_100031693 3300005546 Bacteria 3624
302 Ga0070696_100035629 3300005546 Bacteria 3428
303 Ga0070696_100563106 3300005546 Bacteria 914
304 Ga0070696_100586763 3300005546 Bacteria 897
305 Ga0070696_100772219 3300005546 Bacteria 789
306 Ga0070693_100001128 3300005547 Bacteria 11961
307 Ga0070693_100035072 3300005547 Bacteria 2780
308 Ga0070693_100044381 3300005547 Bacteria 2515
309 Ga0070693_100046721 3300005547 Bacteria 2460
310 Ga0070693_100413948 3300005547 Bacteria 938
311 Ga0070693_100584035 3300005547 Bacteria 804
312 Ga0070693_101661734 3300005547 Bacteria 503
313 Ga0070665_100004533 3300005548 Bacteria 14554
314 Ga0070665_100067776 3300005548 Bacteria 3578
315 Ga0070665_100740544 3300005548 Bacteria 996
316 Ga0070704_100002157 3300005549 Bacteria 10959
317 Ga0070704_100091407 3300005549 Bacteria 2269
318 Ga0070704_100108830 3300005549 Bacteria 2105
319 Ga0070704_100255028 3300005549 Bacteria 1442
320 Ga0070704_100353296 3300005549 Bacteria 1241
321 Ga0070704_100856915 3300005549 Bacteria 815
322 Ga0070704_101168360 3300005549 Bacteria 701
323 Ga0068855_100006293 3300005563 Bacteria 14471
324 Ga0068855_100022593 3300005563 Bacteria 7537
325 Ga0068855_101499089 3300005563 Bacteria 692
326 Ga0068855_102088925 3300005563 Bacteria 571
327 Ga0068855_102570993 3300005563 Bacteria 505
328 Ga0070664_100121232 3300005564 Bacteria 2290
329 Ga0070664_100435723 3300005564 Bacteria 1202
330 Ga0070664_101989115 3300005564 Bacteria 551
331 Ga0068857_100716138 3300005577 Bacteria 952
332 Ga0068857_101431922 3300005577 Bacteria 672
333 Ga0068854_100003089 3300005578 Bacteria 10367
334 Ga0068854_100039233 3300005578 Bacteria 3335
335 Ga0068854_100196663 3300005578 Bacteria 1582
336 Ga0068854_101215624 3300005578 Bacteria 676
337 Ga0068854_101847736 3300005578 Bacteria 554
338 Ga0068856_100015760 3300005614 Bacteria 7308
339 Ga0068856_100092377 3300005614 Bacteria 3011
340 Ga0068856_100910117 3300005614 Bacteria 898
341 Ga0068856_101442387 3300005614 Bacteria 702
342 Ga0070702_100000173 3300005615 Bacteria 20607
343 Ga0070702_100000786 3300005615 Bacteria 12069
344 Ga0070702_100043672 3300005615 Bacteria 2526
345 Ga0070702_100067317 3300005615 Bacteria 2103
346 Ga0070702_100148943 3300005615 Bacteria 1500
347 Ga0068852_100154774 3300005616 Bacteria 2135
348 Ga0068852_100434550 3300005616 Bacteria 1297
349 Ga0068852_100815903 3300005616 Bacteria 947
350 Ga0068852_100898805 3300005616 Bacteria 902
351 Ga0068859_100001101 3300005617 Bacteria 27548
352 Ga0068859_100026412 3300005617 Bacteria 5822
353 Ga0068859_101033390 3300005617 Bacteria 903
354 Ga0068859_102739600 3300005617 Bacteria 542
355 Ga0068864_100001698 3300005618 Bacteria 18102
356 Ga0068864_100011774 3300005618 Bacteria 7225
357 Ga0068864_100054311 3300005618 Bacteria 3457
358 Ga0068866_10003479 3300005718 Bacteria 6451
359 Ga0068866_10475879 3300005718 Bacteria 822
360 Ga0068861_100002373 3300005719 Bacteria 12263
361 Ga0068861_100011414 3300005719 Bacteria 6175
362 Ga0068861_100809863 3300005719 Bacteria 880
363 Ga0068861_100875968 3300005719 Bacteria 848
364 Ga0068851_10074453 3300005834 Bacteria 1763
365 Ga0068851_10640704 3300005834 Bacteria 650
366 Ga0068870_10020158 3300005840 Bacteria 3243
367 Ga0068870_10076877 3300005840 Bacteria 1835
368 Ga0068870_10101667 3300005840 Bacteria 1626
369 Ga0068870_10204282 3300005840 Bacteria 1200
370 Ga0068870_10292158 3300005840 Bacteria 1026
371 Ga0068870_10298042 3300005840 Bacteria 1017
372 Ga0068863_100001850 3300005841 Bacteria 21037
373 Ga0068863_100010828 3300005841 Bacteria 8842
374 Ga0068863_100963914 3300005841 Bacteria 855
375 Ga0068858_100001448 3300005842 Bacteria 24421
376 Ga0068858_100002333 3300005842 Bacteria 19189
377 Ga0068858_100085925 3300005842 Bacteria 2927
378 Ga0068858_100504148 3300005842 Bacteria 1169
379 Ga0068858_100926275 3300005842 Bacteria 853
380 Ga0068860_100012728 3300005843 Bacteria 8275
381 Ga0068860_100021165 3300005843 Bacteria 6299
382 Ga0068860_100090825 3300005843 Bacteria 2909
383 Ga0068860_100272407 3300005843 Bacteria 1652
384 Ga0068860_100339252 3300005843 Bacteria 1477
385 Ga0068860_101139523 3300005843 Bacteria 800
386 Ga0068862_100010175 3300005844 Bacteria 7763
387 Ga0068862_100282036 3300005844 Bacteria 1523
388 Ga0068862_100780673 3300005844 Bacteria 931
389 Ga0068862_101169866 3300005844 Bacteria 767
390 Ga0068862_101370799 3300005844 Bacteria 710
391 Ga0081455_10185826 3300005937 Bacteria 1570
392 Ga0070717_10054394 3300006028 Bacteria 3301
393 Ga0070717_11706388 3300006028 Bacteria 570
394 Ga0075368_10000736 3300006042 Bacteria 10040
395 Ga0075368_10412859 3300006042 Bacteria 594
396 Ga0075363_100007656 3300006048 Bacteria 4981
397 Ga0075364_10053044 3300006051 Bacteria 2650
398 Ga0075364_10274581 3300006051 Bacteria 1146
399 Ga0070715_10001565 3300006163 Bacteria 6711
400 Ga0070715_10394870 3300006163 Bacteria 767
401 Ga0070715_10441151 3300006163 Bacteria 733
402 Ga0070716_100203858 3300006173 Bacteria 1317
403 Ga0070716_100631682 3300006173 Bacteria 809
404 Ga0070716_100797665 3300006173 Bacteria 731
405 Ga0070712_100039099 3300006175 Bacteria 3245
406 Ga0070712_100578365 3300006175 Bacteria 949
407 Ga0070712_100608067 3300006175 Bacteria 926
408 Ga0070712_101257228 3300006175 Bacteria 644
409 Ga0075362_10007883 3300006177 Bacteria 4050
410 Ga0075362_10069337 3300006177 Bacteria 1607
411 Ga0075362_10366639 3300006177 Bacteria 723
412 Ga0075367_10365613 3300006178 Bacteria 911
413 Ga0075367_10739734 3300006178 Bacteria 626
414 Ga0075367_10905519 3300006178 Bacteria 562
415 Ga0075369_10016462 3300006186 Bacteria 2984
416 Ga0075369_10062872 3300006186 Bacteria 1623
417 Ga0075366_10039997 3300006195 Bacteria 2772
418 Ga0075366_10041485 3300006195 Bacteria 2725
419 Ga0075366_10112375 3300006195 Bacteria 1639
420 Ga0075366_10478935 3300006195 Bacteria 769
421 Ga0097621_100001873 3300006237 Bacteria 14405
422 Ga0097621_100029495 3300006237 Bacteria 4333
423 Ga0097621_100201076 3300006237 Bacteria 1730
424 Ga0097621_100316444 3300006237 Bacteria 1381
425 Ga0097621_100632032 3300006237 Bacteria 981
426 Ga0097621_100932336 3300006237 Bacteria 810
427 Ga0075370_10011662 3300006353 Bacteria 4625
428 Ga0075370_10311672 3300006353 Bacteria 937
429 Ga0075370_10818962 3300006353 Bacteria 568
430 Ga0068871_100000683 3300006358 Bacteria 23106
431 Ga0068871_100004579 3300006358 Bacteria 9643
432 Ga0068871_100005465 3300006358 Bacteria 8914
433 Ga0068871_100094806 3300006358 Bacteria 2491
434 Ga0068871_100119439 3300006358 Bacteria 2225
435 Ga0068871_100187842 3300006358 Bacteria 1778
436 Ga0068871_100456051 3300006358 Bacteria 1147
437 Ga0068871_100520904 3300006358 Bacteria 1074
438 Ga0068871_100739142 3300006358 Bacteria 904
439 Ga0075428_100000739 3300006844 Bacteria 33928
440 Ga0075428_100031700 3300006844 Bacteria 5839
441 Ga0075428_101054364 3300006844 Bacteria 859
442 Ga0075430_100049871 3300006846 Bacteria 3532
443 Ga0075430_100388341 3300006846 Bacteria 1152
444 Ga0075431_100076505 3300006847 Bacteria 3454
445 Ga0075431_100489816 3300006847 Bacteria 1221
446 Ga0075433_10005869 3300006852 Bacteria 9673
447 Ga0075433_10331567 3300006852 Bacteria 1345
448 Ga0075434_100001032 3300006871 Bacteria 22671
449 Ga0075434_100032843 3300006871 Bacteria 5119
450 Ga0075434_100595219 3300006871 Bacteria 1125
451 Ga0075434_101803666 3300006871 Bacteria 618
452 Ga0075429_100006847 3300006880 Bacteria 9892
453 Ga0068865_100000525 3300006881 Bacteria 21434
454 Ga0068865_100008874 3300006881 Bacteria 6219
455 Ga0068865_100040838 3300006881 Bacteria 3154
456 Ga0068865_100142185 3300006881 Bacteria 1810
457 Ga0068865_100145376 3300006881 Bacteria 1793
458 Ga0068865_100253997 3300006881 Bacteria 1389
459 Ga0068865_101792555 3300006881 Bacteria 554
460 Ga0075436_100000593 3300006914 Bacteria 23748
461 Ga0075436_100004032 3300006914 Bacteria 10071
462 Ga0075436_100100551 3300006914 Bacteria 2014
463 Ga0075436_100193939 3300006914 Bacteria 1438
464 Ga0075436_100343477 3300006914 Bacteria 1075
465 Ga0097620_100001101 3300006931 Bacteria 27548
466 Ga0097620_100026411 3300006931 Bacteria 5822
467 Ga0097620_101033401 3300006931 Bacteria 903
468 Ga0097620_102739579 3300006931 Bacteria 542
469 Ga0079104_1007537 3300006946 Bacteria 3922
470 Ga0079104_1073049 3300006946 Bacteria 717
471 Ga0099826_10000002 3300006948 Bacteria 1125830
472 Ga0075435_100001154 3300007076 Bacteria 16862
473 Ga0075435_100136269 3300007076 Bacteria 2057
474 Ga0075435_100704185 3300007076 Bacteria 878
475 Ga0075435_100998947 3300007076 Bacteria 731
476 Ga0075435_101196417 3300007076 Bacteria 665
477 Ga0099794_10008812 3300007265 Bacteria 4204
478 Ga0099794_10014278 3300007265 Bacteria 3476
479 Ga0105244_10002910 3300009036 Bacteria 12645
480 Ga0105244_10026470 3300009036 Bacteria 3138
481 Ga0105244_10074139 3300009036 Bacteria 1693
482 Ga0105244_10080953 3300009036 Bacteria 1608
483 Ga0105250_10012744 3300009092 Bacteria 3463
484 Ga0105250_10471920 3300009092 Bacteria 566
485 Ga0105240_10059642 3300009093 Bacteria 4761
486 Ga0105240_10440776 3300009093 Bacteria 1459
487 Ga0105240_10544914 3300009093 Bacteria 1284
488 Ga0105240_10813815 3300009093 Bacteria 1011
489 Ga0111539_10016757 3300009094 Bacteria 9082
490 Ga0111539_10035731 3300009094 Bacteria 6014
491 Ga0111539_10067447 3300009094 Bacteria 4225
492 Ga0111539_10190070 3300009094 Bacteria 2396
493 Ga0111539_10449066 3300009094 Bacteria 1501
494 Ga0111539_10614705 3300009094 Bacteria 1266
495 Ga0111539_11647413 3300009094 Bacteria 744
496 Ga0105245_10000207 3300009098 Bacteria 55562
497 Ga0105245_10002185 3300009098 Bacteria 17735
498 Ga0105245_10009972 3300009098 Bacteria 8274
499 Ga0105245_10047291 3300009098 Bacteria 3846
500 Ga0105245_10065006 3300009098 Bacteria 3298
501 Ga0105245_10296783 3300009098 Bacteria 1584
502 Ga0105245_10600671 3300009098 Bacteria 1127
503 Ga0105245_11851361 3300009098 Bacteria 656
504 Ga0105247_10854581 3300009101 Bacteria 699
505 Ga0114129_10002453 3300009147 Bacteria 25761
506 Ga0114129_12058377 3300009147 Bacteria 689
507 Ga0114129_13007808 3300009147 Bacteria 554
508 Ga0114129_13442050 3300009147 Bacteria 508
509 Ga0105243_10002103 3300009148 Bacteria 16844
510 Ga0105243_10034302 3300009148 Bacteria 3927
511 Ga0105243_10229178 3300009148 Bacteria 1647
512 Ga0105243_10240291 3300009148 Bacteria 1611
513 Ga0105243_10273712 3300009148 Bacteria 1517
514 Ga0105243_10488771 3300009148 Bacteria 1163
515 Ga0105243_10526241 3300009148 Bacteria 1125
516 Ga0105241_10027264 3300009174 Bacteria 4254
517 Ga0105241_10084895 3300009174 Bacteria 2487
518 Ga0105241_10215242 3300009174 Bacteria 1612
519 Ga0105241_10352599 3300009174 Bacteria 1278
520 Ga0105241_10426444 3300009174 Bacteria 1168
521 Ga0105241_11632607 3300009174 Bacteria 624
522 Ga0105242_10003926 3300009176 Bacteria 11556
523 Ga0105242_10028574 3300009176 Bacteria 4442
524 Ga0105242_10029121 3300009176 Bacteria 4402
525 Ga0105242_10078387 3300009176 Bacteria 2758
526 Ga0105242_10135719 3300009176 Bacteria 2129
527 Ga0105242_10211028 3300009176 Bacteria 1730
528 Ga0105242_10246046 3300009176 Bacteria 1610
529 Ga0105242_10288371 3300009176 Bacteria 1494
530 Ga0105242_10550654 3300009176 Bacteria 1106
531 Ga0105242_10705721 3300009176 Bacteria 987
532 Ga0105242_10793245 3300009176 Bacteria 937
533 Ga0105242_10959647 3300009176 Bacteria 860
534 Ga0105248_10074665 3300009177 Bacteria 3811
535 Ga0105248_10487409 3300009177 Bacteria 1390
536 Ga0105237_10237724 3300009545 Bacteria 1823
537 Ga0105237_10422571 3300009545 Bacteria 1338
538 Ga0105237_11492344 3300009545 Bacteria 683
539 Ga0105237_11696217 3300009545 Bacteria 639
540 Ga0105237_11992775 3300009545 Bacteria 589
541 Ga0105238_10014457 3300009551 Bacteria 7982
542 Ga0105238_10166660 3300009551 Bacteria 2179
543 Ga0105238_10324128 3300009551 Bacteria 1527
544 Ga0105238_10800005 3300009551 Bacteria 958
545 Ga0105238_11324159 3300009551 Bacteria 746
546 Ga0105249_10501152 3300009553 Bacteria 1259
547 Ga0105249_10509420 3300009553 Bacteria 1250
548 Ga0105249_10691656 3300009553 Bacteria 1079
549 Ga0105249_11224652 3300009553 Bacteria 822
550 Ga0105249_11350139 3300009553 Bacteria 785
551 Ga0105249_12279995 3300009553 Bacteria 614
552 Ga0105239_10009227 3300010375 Bacteria 11158
553 Ga0105239_10243567 3300010375 Bacteria 2018
554 Ga0105239_10774454 3300010375 Bacteria 1099
555 Ga0105239_12934718 3300010375 Bacteria 556
556 Ga0105246_10142109 3300011119 Bacteria 1806
557 Ga0105246_10161956 3300011119 Bacteria 1705
558 Ga0105246_10267141 3300011119 Bacteria 1366
559 Ga0105246_11016956 3300011119 Bacteria 751
560 Ga0105246_11041241 3300011119 Bacteria 743
561 Ga0105246_11226184 3300011119 Bacteria 692
562 Ga0105246_11243297 3300011119 Bacteria 687
563 Ga0157341_1002745 3300012494 Bacteria 1185
564 Ga0157347_1033888 3300012502 Bacteria 651
565 Ga0157327_1012740 3300012512 Bacteria 834
566 Ga0157373_10088518 3300013100 Bacteria 2181
567 Ga0157373_10263286 3300013100 Bacteria 1220
568 Ga0157373_10486590 3300013100 Bacteria 890
569 Ga0157373_10579918 3300013100 Bacteria 815
570 Ga0157373_10965097 3300013100 Bacteria 635
571 Ga0157373_11355520 3300013100 Bacteria 540
572 Ga0157371_10049583 3300013102 Bacteria 2982
573 Ga0157371_10502672 3300013102 Bacteria 895
574 Ga0157371_10888147 3300013102 Bacteria 675
575 Ga0157371_11236536 3300013102 Bacteria 576
576 Ga0157370_10062393 3300013104 Bacteria 3535
577 Ga0157370_10286291 3300013104 Bacteria 1522
578 Ga0157369_10137815 3300013105 Bacteria 2583
579 Ga0157369_10838119 3300013105 Bacteria 944
580 Ga0157374_10373902 3300013296 Bacteria 1419
581 Ga0157374_10378539 3300013296 Bacteria 1410
582 Ga0157374_10823628 3300013296 Bacteria 944
583 Ga0157378_10001175 3300013297 Bacteria 23842
584 Ga0157378_10099224 3300013297 Bacteria 2657
585 Ga0157378_10622956 3300013297 Bacteria 1092
586 Ga0163162_10082727 3300013306 Bacteria 3282
587 Ga0163162_10161956 3300013306 Bacteria 2359
588 Ga0163162_10335810 3300013306 Bacteria 1644
589 Ga0163162_10344066 3300013306 Bacteria 1624
590 Ga0163162_10413738 3300013306 Bacteria 1481
591 Ga0163162_10544677 3300013306 Bacteria 1289
592 Ga0157372_10149662 3300013307 Bacteria 2693
593 Ga0157372_10157848 3300013307 Bacteria 2620
594 Ga0157372_11084170 3300013307 Bacteria 927
595 Ga0157372_11114294 3300013307 Bacteria 913
596 Ga0157372_11384010 3300013307 Bacteria 811
597 Ga0157375_10047744 3300013308 Bacteria 4183
598 Ga0157375_10308546 3300013308 Bacteria 1746
599 Ga0157375_10729740 3300013308 Bacteria 1143
600 Ga0157375_11469622 3300013308 Bacteria 804
601 Ga0163163_10009593 3300014325 Bacteria 8649
602 Ga0163163_10019560 3300014325 Bacteria 6361
603 Ga0163163_10846802 3300014325 Bacteria 978
604 Ga0163163_12237882 3300014325 Bacteria 606
605 Ga0157380_10022168 3300014326 Bacteria 4776
606 Ga0157380_10533822 3300014326 Bacteria 1147
607 Ga0157380_10690874 3300014326 Bacteria 1024
608 Ga0157380_10828368 3300014326 Bacteria 945
609 Ga0182008_10001210 3300014497 Bacteria 17771
610 Ga0182008_10160810 3300014497 Bacteria 1130
611 Ga0157377_10111584 3300014745 Bacteria 1644
612 Ga0157377_10269917 3300014745 Bacteria 1110
613 Ga0157377_10420019 3300014745 Bacteria 915
614 Ga0157379_10006994 3300014968 Bacteria 9753
615 Ga0157379_10361025 3300014968 Bacteria 1331
616 Ga0157379_10413899 3300014968 Bacteria 1241
617 Ga0157379_10760102 3300014968 Bacteria 913
618 Ga0157379_10793644 3300014968 Bacteria 893
619 Ga0157379_11010040 3300014968 Bacteria 793
620 Ga0157376_10041180 3300014969 Bacteria 3781
621 Ga0157376_10044345 3300014969 Bacteria 3655
622 Ga0157376_10071273 3300014969 Bacteria 2953
623 Ga0157376_10368791 3300014969 Bacteria 1379
624 Ga0157376_10440993 3300014969 Bacteria 1268
625 Ga0157376_10776137 3300014969 Bacteria 969
626 Ga0157376_12141178 3300014969 Bacteria 598
627 Ga0182006_1000002 3300015261 Bacteria 887990
628 Ga0182006_1000026 3300015261 Bacteria 253543
629 Ga0182006_1037733 3300015261 Bacteria 1914
630 Ga0182006_1068722 3300015261 Bacteria 1318
631 Ga0182006_1145629 3300015261 Bacteria 806
632 Ga0182006_1241352 3300015261 Bacteria 594
633 Ga0182007_10000159 3300015262 Bacteria 46374
634 Ga0182007_10024981 3300015262 Bacteria 2085
635 Ga0182007_10080783 3300015262 Bacteria 1066
636 Ga0182007_10082433 3300015262 Bacteria 1055
637 Ga0182005_1000002 3300015265 Bacteria 908499
638 Ga0182005_1000007 3300015265 Bacteria 490994
639 Ga0182005_1020747 3300015265 Bacteria 1805
640 Ga0163161_10021691 3300017792 Bacteria 4514
641 Ga0163161_10045173 3300017792 Bacteria 3176
642 Ga0163161_10047644 3300017792 Bacteria 3094
643 Ga0163161_10174521 3300017792 Bacteria 1645
644 Ga0163161_11853290 3300017792 Bacteria 537
645 Ga0206351_10512431 3300020077 Bacteria 625
646 Ga0206350_10748337 3300020080 Bacteria 664
647 Ga0154015_1698159 3300020610 Bacteria 564
648 Ga0213872_10000028 3300021361 Bacteria 148766
649 Ga0213872_10000921 3300021361 Bacteria 20878
650 Ga0213872_10097561 3300021361 Bacteria 1312
651 Ga0213872_10255684 3300021361 Bacteria 737
652 Ga0213876_10330753 3300021384 Bacteria 810
653 Ga0209435_100013 3300025206 Bacteria 366789
654 Ga0209435_100862 3300025206 Bacteria 4685
655 Ga0209436_100857 3300025208 Bacteria 12209
656 Ga0209566_100521 3300025225 Bacteria 26331
657 Ga0209674_109866 3300025226 Bacteria 1046
658 Ga0209672_100033 3300025228 Bacteria 315326
659 Ga0209672_100114 3300025228 Bacteria 90538
660 Ga0209147_100030 3300025229 Bacteria 366789
661 Ga0209147_100161 3300025229 Bacteria 90627
662 Ga0209147_100390 3300025229 Bacteria 30099
663 Ga0209147_110450 3300025229 Bacteria 1062
664 Ga0209563_100007 3300025230 Bacteria 1579402
665 Ga0209258_100100 3300025242 Bacteria 214027
666 Ga0209258_100205 3300025242 Bacteria 119727
667 Ga0209258_100263 3300025242 Bacteria 90453
668 Ga0207425_1000001 3300025245 Bacteria 2525432
669 Ga0207425_1000143 3300025245 Bacteria 62334
670 Ga0209646_1000010 3300025246 Bacteria 573803
671 Ga0209646_1000034 3300025246 Bacteria 366789
672 Ga0209646_1000135 3300025246 Bacteria 124235
673 Ga0209026_1000022 3300025250 Bacteria 366789
674 Ga0209026_1004343 3300025250 Bacteria 4245
675 Ga0209026_1007871 3300025250 Bacteria 2313
676 Ga0209677_102467 3300025253 Bacteria 6934
677 Ga0209148_1000432 3300025254 Bacteria 46257
678 Ga0209148_1001082 3300025254 Bacteria 16579
679 Ga0209148_1001416 3300025254 Bacteria 12285
680 Ga0209148_1016550 3300025254 Bacteria 1267
681 Ga0209148_1030510 3300025254 Bacteria 807
682 Ga0209759_1000018 3300025256 Bacteria 366789
683 Ga0209759_1000133 3300025256 Bacteria 126928
684 Ga0209759_1000890 3300025256 Bacteria 22545
685 Ga0209129_1000001 3300025258 Bacteria 1452436
686 Ga0209233_1090303 3300025261 Bacteria 526
687 Ga0209565_1000057 3300025263 Bacteria 196908
688 Ga0209565_1001088 3300025263 Bacteria 13531
689 Ga0209565_1004368 3300025263 Bacteria 4313
690 Ga0209565_1006127 3300025263 Bacteria 3413
691 Ga0209455_1000037 3300025272 Bacteria 464097
692 Ga0209455_1000192 3300025272 Bacteria 90553
693 Ga0209673_1000051 3300025273 Bacteria 282161
694 Ga0209673_1000332 3300025273 Bacteria 86973
695 Ga0209673_1010506 3300025273 Bacteria 3898
696 Ga0209130_1000268 3300025284 Bacteria 65115
697 Ga0209130_1004305 3300025284 Bacteria 5493
698 Ga0209675_1000027 3300025291 Bacteria 282175
699 Ga0209675_1002448 3300025291 Bacteria 9538
700 Ga0209675_1048852 3300025291 Bacteria 883
701 Ga0209025_1001845 3300025294 Bacteria 24883
702 Ga0209564_1000009 3300025295 Bacteria 950196
703 Ga0209564_1000033 3300025295 Bacteria 446200
704 Ga0209564_1000094 3300025295 Bacteria 243176
705 Ga0209564_1002669 3300025295 Bacteria 13536
706 Ga0209564_1003700 3300025295 Bacteria 10066
707 Ga0209758_1000073 3300025297 Bacteria 276262
708 Ga0209758_1001766 3300025297 Bacteria 23985
709 Ga0209050_1000046 3300025298 Bacteria 386466
710 Ga0209256_1000044 3300025299 Bacteria 337264
711 Ga0209256_1000139 3300025299 Bacteria 155515
712 Ga0209256_1003060 3300025299 Bacteria 12314
713 Ga0209256_1006799 3300025299 Bacteria 5903
714 Ga0207426_1001318 3300025302 Bacteria 21153
715 Ga0207426_1030983 3300025302 Bacteria 1749
716 Ga0209051_1007011 3300025303 Bacteria 6243
717 Ga0209257_1000728 3300025304 Bacteria 49918
718 Ga0207697_10039612 3300025315 Bacteria 1933
719 Ga0207697_10342404 3300025315 Bacteria 664
720 Ga0207656_10405524 3300025321 Bacteria 685
721 Ga0207696_1022174 3300025711 Bacteria 2022
722 Ga0207655_1010587 3300025728 Bacteria 5578
723 Ga0207655_1046953 3300025728 Bacteria 1787
724 Ga0207655_1096525 3300025728 Bacteria 1028
725 Ga0207655_1147135 3300025728 Bacteria 749
726 Ga0207653_10044471 3300025885 Bacteria 1464
727 Ga0207653_10056955 3300025885 Bacteria 1311
728 Ga0207653_10421718 3300025885 Bacteria 523
729 Ga0207682_10026427 3300025893 Bacteria 2308
730 Ga0207682_10104475 3300025893 Bacteria 1241
731 Ga0207692_10056492 3300025898 Bacteria 2014
732 Ga0207692_10336212 3300025898 Bacteria 928
733 Ga0207642_10047120 3300025899 Bacteria 1925
734 Ga0207642_10131008 3300025899 Bacteria 1309
735 Ga0207710_10446685 3300025900 Bacteria 667
736 Ga0207688_10108080 3300025901 Bacteria 1612
737 Ga0207688_10207192 3300025901 Bacteria 1177
738 Ga0207680_10066788 3300025903 Bacteria 2213
739 Ga0207680_10411094 3300025903 Bacteria 957
740 Ga0207647_10000981 3300025904 Bacteria 22111
741 Ga0207647_10051255 3300025904 Bacteria 2552
742 Ga0207647_10749190 3300025904 Bacteria 529
743 Ga0207699_10840643 3300025906 Bacteria 676
744 Ga0207699_11123785 3300025906 Bacteria 582
745 Ga0207645_10122932 3300025907 Bacteria 1686
746 Ga0207643_10005920 3300025908 Bacteria 6530
747 Ga0207643_10014328 3300025908 Bacteria 4305
748 Ga0207643_10067012 3300025908 Bacteria 2060
749 Ga0207643_10084057 3300025908 Bacteria 1847
750 Ga0207643_10134663 3300025908 Bacteria 1472
751 Ga0207643_10969372 3300025908 Bacteria 550
752 Ga0207705_10281000 3300025909 Bacteria 1274
753 Ga0207705_10316254 3300025909 Bacteria 1199
754 Ga0207684_10279875 3300025910 Bacteria 1439
755 Ga0207684_10376536 3300025910 Bacteria 1221
756 Ga0207684_10500548 3300025910 Bacteria 1041
757 Ga0207654_10030723 3300025911 Bacteria 2952
758 Ga0207654_10077230 3300025911 Bacteria 1996
759 Ga0207654_10118379 3300025911 Bacteria 1659
760 Ga0207654_10360049 3300025911 Bacteria 1003
761 Ga0207654_11044637 3300025911 Bacteria 595
762 Ga0207707_10033786 3300025912 Bacteria 4476
763 Ga0207707_10053572 3300025912 Bacteria 3512
764 Ga0207707_10399872 3300025912 Bacteria 1179
765 Ga0207707_10427013 3300025912 Bacteria 1136
766 Ga0207695_10001528 3300025913 Bacteria 38261
767 Ga0207695_10012279 3300025913 Bacteria 10287
768 Ga0207695_10302505 3300025913 Bacteria 1491
769 Ga0207695_10361267 3300025913 Bacteria 1339
770 Ga0207695_11141749 3300025913 Bacteria 659
771 Ga0207671_10008283 3300025914 Bacteria 8841
772 Ga0207693_10001263 3300025915 Bacteria 22541
773 Ga0207693_10189721 3300025915 Bacteria 1618
774 Ga0207693_10268559 3300025915 Bacteria 1337
775 Ga0207693_10944929 3300025915 Bacteria 660
776 Ga0207663_10307781 3300025916 Bacteria 1186
777 Ga0207663_10542816 3300025916 Bacteria 908
778 Ga0207660_10047276 3300025917 Bacteria 3041
779 Ga0207660_10047629 3300025917 Bacteria 3032
780 Ga0207660_10142159 3300025917 Bacteria 1835
781 Ga0207660_10180225 3300025917 Bacteria 1640
782 Ga0207662_10000577 3300025918 Bacteria 16347
783 Ga0207662_10067141 3300025918 Bacteria 2162
784 Ga0207662_10128095 3300025918 Bacteria 1598
785 Ga0207657_10000068 3300025919 Bacteria 96575
786 Ga0207657_10001348 3300025919 Bacteria 26123
787 Ga0207657_10184294 3300025919 Bacteria 1686
788 Ga0207657_10468472 3300025919 Bacteria 988
789 Ga0207649_10181300 3300025920 Bacteria 1474
790 Ga0207649_10640928 3300025920 Bacteria 820
791 Ga0207652_10394896 3300025921 Bacteria 1248
792 Ga0207652_11155970 3300025921 Bacteria 675
793 Ga0207646_10075873 3300025922 Bacteria 3004
794 Ga0207646_10419930 3300025922 Bacteria 1207
795 Ga0207681_10002320 3300025923 Bacteria 12099
796 Ga0207681_10021046 3300025923 Bacteria 4140
797 Ga0207681_11324076 3300025923 Bacteria 605
798 Ga0207694_10005697 3300025924 Bacteria 9550
799 Ga0207694_10173702 3300025924 Bacteria 1745
800 Ga0207694_10833845 3300025924 Bacteria 779
801 Ga0207650_10010546 3300025925 Bacteria 6343
802 Ga0207650_10726181 3300025925 Bacteria 840
803 Ga0207650_11698397 3300025925 Bacteria 535
804 Ga0207659_10002190 3300025926 Bacteria 11611
805 Ga0207659_10073385 3300025926 Bacteria 2505
806 Ga0207659_10184790 3300025926 Bacteria 1654
807 Ga0207659_10338378 3300025926 Bacteria 1246
808 Ga0207659_11574010 3300025926 Bacteria 561
809 Ga0207687_10002891 3300025927 Bacteria 11663
810 Ga0207687_10033850 3300025927 Bacteria 3467
811 Ga0207687_10061275 3300025927 Bacteria 2657
812 Ga0207687_10132207 3300025927 Bacteria 1883
813 Ga0207687_10189604 3300025927 Bacteria 1599
814 Ga0207700_10000099 3300025928 Bacteria 53179
815 Ga0207700_10023848 3300025928 Bacteria 4227
816 Ga0207700_10037033 3300025928 Bacteria 3529
817 Ga0207664_10000454 3300025929 Bacteria 29097
818 Ga0207644_10004698 3300025931 Bacteria 8874
819 Ga0207644_10142857 3300025931 Bacteria 1845
820 Ga0207644_10443426 3300025931 Bacteria 1066
821 Ga0207690_10000027 3300025932 Bacteria 162225
822 Ga0207690_10078703 3300025932 Bacteria 2295
823 Ga0207706_10006695 3300025933 Bacteria 10654
824 Ga0207706_10082422 3300025933 Bacteria 2827
825 Ga0207706_10113429 3300025933 Bacteria 2384
826 Ga0207706_10372542 3300025933 Bacteria 1240
827 Ga0207706_10405415 3300025933 Bacteria 1182
828 Ga0207706_10550041 3300025933 Bacteria 994
829 Ga0207686_10000488 3300025934 Bacteria 26043
830 Ga0207686_10000586 3300025934 Bacteria 22804
831 Ga0207686_10002850 3300025934 Bacteria 9326
832 Ga0207686_10149169 3300025934 Bacteria 1626
833 Ga0207686_10150170 3300025934 Bacteria 1621
834 Ga0207686_10162748 3300025934 Bacteria 1566
835 Ga0207686_10325907 3300025934 Bacteria 1149
836 Ga0207686_10571203 3300025934 Bacteria 886
837 Ga0207686_10890787 3300025934 Bacteria 717
838 Ga0207686_11728651 3300025934 Bacteria 517
839 Ga0207709_10001240 3300025935 Bacteria 18327
840 Ga0207709_10004162 3300025935 Bacteria 8418
841 Ga0207709_10055857 3300025935 Bacteria 2441
842 Ga0207709_10155586 3300025935 Bacteria 1588
843 Ga0207709_10239248 3300025935 Bacteria 1320
844 Ga0207709_10332762 3300025935 Bacteria 1140
845 Ga0207709_10459528 3300025935 Bacteria 986
846 Ga0207709_10766363 3300025935 Bacteria 777
847 Ga0207709_10801541 3300025935 Bacteria 760
848 Ga0207670_10001102 3300025936 Bacteria 14210
849 Ga0207670_10021580 3300025936 Bacteria 3976
850 Ga0207670_10149171 3300025936 Bacteria 1733
851 Ga0207670_10627845 3300025936 Bacteria 884
852 Ga0207670_10836371 3300025936 Bacteria 768
853 Ga0207669_10050794 3300025937 Bacteria 2481
854 Ga0207669_10189862 3300025937 Bacteria 1481
855 Ga0207669_10258572 3300025937 Bacteria 1301
856 Ga0207669_10482318 3300025937 Bacteria 989
857 Ga0207704_10000475 3300025938 Bacteria 17855
858 Ga0207704_10160498 3300025938 Bacteria 1599
859 Ga0207704_10218818 3300025938 Bacteria 1407
860 Ga0207704_11061273 3300025938 Bacteria 687
861 Ga0207665_10014048 3300025939 Bacteria 5268
862 Ga0207665_10455767 3300025939 Bacteria 982
863 Ga0207691_10062473 3300025940 Bacteria 3379
864 Ga0207691_10082111 3300025940 Bacteria 2896
865 Ga0207691_10106456 3300025940 Bacteria 2498
866 Ga0207691_10232780 3300025940 Bacteria 1595
867 Ga0207691_10546899 3300025940 Bacteria 982
868 Ga0207711_10001033 3300025941 Bacteria 26678
869 Ga0207711_10309689 3300025941 Bacteria 1458
870 Ga0207711_11138565 3300025941 Bacteria 721
871 Ga0207711_11986836 3300025941 Bacteria 524
872 Ga0207689_10000384 3300025942 Bacteria 41557
873 Ga0207689_10000808 3300025942 Bacteria 30211
874 Ga0207689_10029109 3300025942 Bacteria 4616
875 Ga0207689_10058383 3300025942 Bacteria 3174
876 Ga0207689_10058570 3300025942 Bacteria 3168
877 Ga0207689_10615687 3300025942 Bacteria 914
878 Ga0207689_10666864 3300025942 Bacteria 877
879 Ga0207661_10567734 3300025944 Bacteria 1040
880 Ga0207661_10811040 3300025944 Bacteria 862
881 Ga0207679_10115933 3300025945 Bacteria 2123
882 Ga0207679_10441804 3300025945 Bacteria 1152
883 Ga0207679_11268919 3300025945 Bacteria 676
884 Ga0207667_10039769 3300025949 Bacteria 5009
885 Ga0207667_10062976 3300025949 Bacteria 3877
886 Ga0207667_10071588 3300025949 Bacteria 3604
887 Ga0207667_11268120 3300025949 Bacteria 714
888 Ga0207667_11519163 3300025949 Bacteria 640
889 Ga0207651_10003957 3300025960 Bacteria 7358
890 Ga0207651_10015772 3300025960 Bacteria 4402
891 Ga0207651_10667491 3300025960 Bacteria 914
892 Ga0207712_10022912 3300025961 Bacteria 4117
893 Ga0207712_10228310 3300025961 Bacteria 1493
894 Ga0207712_10306446 3300025961 Bacteria 1305
895 Ga0207712_10388700 3300025961 Bacteria 1170
896 Ga0207712_10497804 3300025961 Bacteria 1041
897 Ga0207668_10181985 3300025972 Bacteria 1659
898 Ga0207668_10229957 3300025972 Bacteria 1494
899 Ga0207668_10258472 3300025972 Bacteria 1418
900 Ga0207668_10755003 3300025972 Bacteria 858
901 Ga0207640_10029906 3300025981 Bacteria 3350
902 Ga0207640_10295906 3300025981 Bacteria 1278
903 Ga0207640_10909140 3300025981 Bacteria 769
904 Ga0207658_10032488 3300025986 Bacteria 3715
905 Ga0207658_10173117 3300025986 Bacteria 1780
906 Ga0207658_10210850 3300025986 Bacteria 1628
907 Ga0207677_10002051 3300026023 Bacteria 10615
908 Ga0207677_10159068 3300026023 Bacteria 1753
909 Ga0207677_10281942 3300026023 Bacteria 1364
910 Ga0207677_10524577 3300026023 Bacteria 1028
911 Ga0207677_11210109 3300026023 Bacteria 692
912 Ga0207703_10001476 3300026035 Bacteria 21438
913 Ga0207703_10001709 3300026035 Bacteria 19718
914 Ga0207703_11300927 3300026035 Bacteria 699
915 Ga0207639_10423545 3300026041 Bacteria 1204
916 Ga0207639_10708266 3300026041 Bacteria 934
917 Ga0207639_11062049 3300026041 Bacteria 759
918 Ga0207639_11699868 3300026041 Bacteria 591
919 Ga0207678_10002813 3300026067 Bacteria 15784
920 Ga0207678_10057117 3300026067 Bacteria 3359
921 Ga0207678_10059618 3300026067 Bacteria 3284
922 Ga0207678_10218891 3300026067 Bacteria 1630
923 Ga0207678_10877631 3300026067 Bacteria 793
924 Ga0207678_11761218 3300026067 Bacteria 543
925 Ga0207708_10000156 3300026075 Bacteria 54425
926 Ga0207708_10007769 3300026075 Bacteria 7941
927 Ga0207708_10050862 3300026075 Bacteria 3154
928 Ga0207708_10459646 3300026075 Bacteria 1061
929 Ga0207708_10544887 3300026075 Bacteria 978
930 Ga0207708_10775684 3300026075 Bacteria 824
931 Ga0207702_10014860 3300026078 Bacteria 6458
932 Ga0207702_10362633 3300026078 Bacteria 1389
933 Ga0207702_10417239 3300026078 Bacteria 1297
934 Ga0207702_10573009 3300026078 Bacteria 1106
935 Ga0207702_10881170 3300026078 Bacteria 887
936 Ga0207702_11101363 3300026078 Bacteria 788
937 Ga0207702_11531296 3300026078 Bacteria 660
938 Ga0207702_12173321 3300026078 Bacteria 544
939 Ga0207641_10016890 3300026088 Bacteria 5976
940 Ga0207641_10339069 3300026088 Bacteria 1430
941 Ga0207641_10982728 3300026088 Bacteria 840
942 Ga0207648_10000128 3300026089 Bacteria 75279
943 Ga0207648_10002472 3300026089 Bacteria 19861
944 Ga0207648_10005495 3300026089 Bacteria 12773
945 Ga0207648_10025971 3300026089 Bacteria 5209
946 Ga0207648_10259915 3300026089 Bacteria 1549
947 Ga0207648_10434447 3300026089 Bacteria 1193
948 Ga0207648_10609220 3300026089 Bacteria 1007
949 Ga0207648_11291970 3300026089 Bacteria 686
950 Ga0207648_11879985 3300026089 Bacteria 560
951 Ga0207676_10000174 3300026095 Bacteria 56439
952 Ga0207676_10007775 3300026095 Bacteria 7623
953 Ga0207676_11062734 3300026095 Bacteria 799
954 Ga0207674_10005547 3300026116 Bacteria 14978
955 Ga0207674_10316922 3300026116 Bacteria 1509
956 Ga0207674_10353792 3300026116 Bacteria 1420
957 Ga0207675_100000215 3300026118 Bacteria 54261
958 Ga0207675_100000408 3300026118 Bacteria 41228
959 Ga0207675_100009821 3300026118 Bacteria 8959
960 Ga0207675_100165026 3300026118 Bacteria 2115
961 Ga0207675_100684500 3300026118 Bacteria 1033
962 Ga0207675_101485820 3300026118 Bacteria 698
963 Ga0207683_10001993 3300026121 Bacteria 18067
964 Ga0207683_10012879 3300026121 Bacteria 7138
965 Ga0207683_10043918 3300026121 Bacteria 3906
966 Ga0207683_10173906 3300026121 Bacteria 1951
967 Ga0207683_10651065 3300026121 Bacteria 976
968 Ga0207683_10744807 3300026121 Bacteria 909
969 Ga0207698_10254086 3300026142 Bacteria 1610
970 Ga0207698_10386136 3300026142 Bacteria 1334
971 Ga0207698_10394735 3300026142 Bacteria 1320
972 Ga0207698_10935404 3300026142 Bacteria 875
973 Ga0207698_11311021 3300026142 Bacteria 739
974 Ga0209281_1012000 3300027111 Bacteria 1920
975 Ga0209371_1000448 3300027312 Bacteria 41139
976 Ga0209969_1000391 3300027360 Bacteria 5844
977 Ga0209967_1000346 3300027364 Bacteria 6174
978 Ga0209981_1006208 3300027378 Bacteria 1596
979 Ga0209981_1024360 3300027378 Bacteria 873
980 Ga0209996_1014353 3300027395 Bacteria 1076
981 Ga0210000_1005995 3300027462 Bacteria 1769
982 Ga0210000_1045302 3300027462 Bacteria 702
983 Ga0209995_1004306 3300027471 Bacteria 2275
984 Ga0209968_1049772 3300027526 Bacteria 726
985 Ga0209999_1004967 3300027543 Bacteria 2394
986 Ga0209999_1009591 3300027543 Bacteria 1748
987 Ga0209999_1036179 3300027543 Bacteria 922
988 Ga0209970_1015173 3300027614 Bacteria 1281
989 Ga0209983_1016239 3300027665 Bacteria 1537
990 Ga0209282_1000001 3300027666 Bacteria 2450367
991 Ga0209588_1102153 3300027671 Bacteria 922
992 Ga0209588_1130375 3300027671 Bacteria 802
993 Ga0209588_1164561 3300027671 Bacteria 700
994 Ga0209971_1006394 3300027682 Bacteria 2787
995 Ga0209971_1171336 3300027682 Bacteria 535
996 Ga0209966_1026619 3300027695 Bacteria 1153
997 Ga0209966_1177484 3300027695 Bacteria 500
998 Ga0209998_10045879 3300027717 Bacteria 1002
999 Ga0209813_10017820 3300027866 Bacteria 1954
1000 Ga0209974_10018316 3300027876 Bacteria 2323
1001 Ga0207428_10004612 3300027907 Bacteria 13060
1002 Ga0207428_10007629 3300027907 Bacteria 9851
1003 Ga0207428_10222717 3300027907 Bacteria 1413
1004 Ga0207428_10228212 3300027907 Bacteria 1394
1005 Ga0207428_10242943 3300027907 Bacteria 1345
1006 Ga0207428_10760392 3300027907 Bacteria 690
1007 Ga0268266_10008065 3300028379 Bacteria 9410
1008 Ga0268266_10047065 3300028379 Bacteria 3693
1009 Ga0268265_10001364 3300028380 Bacteria 20788
1010 Ga0268265_10002399 3300028380 Bacteria 14163
1011 Ga0268265_10033020 3300028380 Bacteria 3758
1012 Ga0268265_10041740 3300028380 Bacteria 3398
1013 Ga0268265_10867311 3300028380 Bacteria 884
1014 Ga0268264_10053808 3300028381 Bacteria 3359
1015 Ga0268264_10063078 3300028381 Bacteria 3114
1016 Ga0268264_10421553 3300028381 Bacteria 1287
1017 Ga0268264_11185149 3300028381 Bacteria 773
1018 Ga0268264_12376970 3300028381 Bacteria 536
1019 Ga0265324_10000006 3300029957 Bacteria 267048
1020 Ga0265324_10016237 3300029957 Bacteria 2723
1021 Ga0268256_1000823 3300030500 Bacteria 22186
1022 Ga0307511_10000248 3300030521 Bacteria 55337
1023 Ga0316177_1163550 3300030731 Bacteria 2582
1024 Ga0314311_1225052 3300030733 Bacteria 1072
1025 Ga0316179_1096458 3300030734 Bacteria 1039
1026 Ga0316178_1028413 3300030735 Bacteria 1529
1027 Ga0316178_1146804 3300030735 Bacteria 528
1028 Ga0316178_1169113 3300030735 Bacteria 533
1029 Ga0316180_1167461 3300030736 Bacteria 1716
1030 Ga0316183_1193877 3300030742 Bacteria 1134
1031 Ga0316182_1436475 3300030745 Bacteria 1301
1032 Ga0265332_10003769 3300031238 Bacteria 7247
1033 Ga0265328_10002778 3300031239 Bacteria 7837
1034 Ga0265328_10007837 3300031239 Bacteria 4437
1035 Ga0265328_10043022 3300031239 Bacteria 1662
1036 Ga0265320_10073544 3300031240 Bacteria 1606
1037 Ga0265325_10000110 3300031241 Bacteria 56687
1038 Ga0265339_10221934 3300031249 Bacteria 924
1039 Ga0265331_10002297 3300031250 Bacteria 13027
1040 Ga0265331_10002426 3300031250 Bacteria 12637
1041 Ga0265331_10005458 3300031250 Bacteria 7674
1042 Ga0265331_10120852 3300031250 Bacteria 1198
1043 Ga0265327_10000588 3300031251 Bacteria 61029
1044 Ga0265327_10000809 3300031251 Bacteria 47572
1045 Ga0265327_10002222 3300031251 Bacteria 21132
1046 Ga0265327_10045923 3300031251 Bacteria 2317
1047 Ga0265327_10056979 3300031251 Bacteria 2012
1048 Ga0265316_10075296 3300031344 Bacteria 2596
1049 Ga0265316_10101868 3300031344 Bacteria 2181
1050 Ga0265316_10119684 3300031344 Bacteria 1989
1051 Ga0307513_11043829 3300031456 Bacteria 528
1052 Ga0307509_10536082 3300031507 Bacteria 850
1053 Ga0307408_100002707 3300031548 Bacteria 12301
1054 Ga0307408_100022174 3300031548 Bacteria 4310
1055 Ga0307408_100103451 3300031548 Bacteria 2174
1056 Ga0307408_100646686 3300031548 Bacteria 945
1057 Ga0307408_100792260 3300031548 Bacteria 859
1058 Ga0265313_10168109 3300031595 Bacteria 928
1059 Ga0316575_10011355 3300031665 Bacteria 3295
1060 Ga0265314_10000245 3300031711 Bacteria 79757
1061 Ga0265314_10009646 3300031711 Bacteria 8130
1062 Ga0265314_10016544 3300031711 Bacteria 5819
1063 Ga0265314_10126042 3300031711 Bacteria 1604
1064 Ga0265342_10473914 3300031712 Bacteria 641
1065 Ga0316576_10303711 3300031727 Bacteria 1192
1066 Ga0316576_10915028 3300031727 Bacteria 628
1067 Ga0307516_10755847 3300031730 Bacteria 632
1068 Ga0307405_10247730 3300031731 Bacteria 1324
1069 Ga0307405_10881972 3300031731 Bacteria 755
1070 Ga0307518_10117882 3300031838 Bacteria 1883
1071 Ga0307406_10573976 3300031901 Bacteria 926
1072 Ga0307406_10584348 3300031901 Bacteria 919
1073 Ga0307406_11398175 3300031901 Bacteria 613
1074 Ga0307406_12066410 3300031901 Bacteria 510
1075 Ga0307407_11198047 3300031903 Bacteria 593
1076 Ga0307412_10965583 3300031911 Bacteria 751
1077 Ga0307412_11289824 3300031911 Bacteria 657
1078 Ga0307416_100022459 3300032002 Bacteria 4555
1079 Ga0307416_100667029 3300032002 Bacteria 1126
1080 Ga0307416_101485459 3300032002 Bacteria 783
1081 Ga0307416_102545616 3300032002 Bacteria 610
1082 Ga0307414_10030059 3300032004 Bacteria 3544
1083 Ga0307411_10185351 3300032005 Bacteria 1584
1084 Ga0307411_11409969 3300032005 Bacteria 638
1085 Ga0307411_11426161 3300032005 Bacteria 634
1086 Ga0307415_101193524 3300032126 Bacteria 717
1087 Ga0307415_101367772 3300032126 Bacteria 673
1088 Ga0316583_10062422 3300032133 Bacteria 1305
1089 Ga0307507_10104184 3300033179 Bacteria 2356
1090 Ga0373950_0117658 3300034818 Bacteria 585
1091 Ga0373929_0086328 3300035085 Bacteria 772
1092 Ga0373934_0176786 3300035086 Bacteria 877
1093 Ga0373940_0030517 3300035088 Bacteria 1434
1094 Ga0373944_0001197 3300035089 Bacteria 6490
1095 Ga0373944_0069188 3300035089 Bacteria 1147
1096 Ga0373949_0037050 3300035090 Bacteria 1185
1097 Ga0373949_0135114 3300035090 Bacteria 703
1098 Ga0373951_0015446 3300035091 Bacteria 1720
1099 Ga0373952_0226126 3300035092 Bacteria 558
1100 Ga0373952_0294254 3300035092 Bacteria 504
1101 Ga0373923_0066800 3300035111 Bacteria 1537
1102 Ga0373932_0001629 3300035112 Bacteria 6164
1103 Ga0373932_0130555 3300035112 Bacteria 846
1104 Ga0373936_0003926 3300035113 Bacteria 5600
1105 Ga0373936_0014734 3300035113 Bacteria 2992
1106 Ga0373936_0110541 3300035113 Bacteria 1167
1107 Ga0373936_0111839 3300035113 Bacteria 1160
1108 Ga0373936_0545757 3300035113 Bacteria 541
1109 Ga0373939_0041526 3300035114 Bacteria 1387
1110 Ga0373939_0189054 3300035114 Bacteria 772
1111 Ga0373939_0439442 3300035114 Bacteria 547
1112 Ga0373941_0076465 3300035115 Bacteria 1122
1113 Ga0373941_0172249 3300035115 Bacteria 807
1114 Ga0373941_0270086 3300035115 Bacteria 670
1115 Ga0373945_0025125 3300035116 Bacteria 2068
1116 Ga0373945_0240091 3300035116 Bacteria 763
1117 Ga0373953_0022608 3300035117 Bacteria 2372
1118 Ga0373953_0054507 3300035117 Bacteria 1622
1119 Ga0373953_0198630 3300035117 Bacteria 867
1120 Ga0373954_0024099 3300035118 Bacteria 2773
1121 Ga0373954_0345868 3300035118 Bacteria 734
1122 Ga0373956_0025761 3300035119 Bacteria 2544
1123 Ga0373956_0079120 3300035119 Bacteria 1506
1124 Ga0373956_0109451 3300035119 Bacteria 1285
1125 Ga0373957_0157691 3300035120 Bacteria 934
1126 Ga0373960_0091904 3300035121 Bacteria 971
1127 Ga0373943_0021046 3300035170 Bacteria 3011
1128 Ga0373943_0038187 3300035170 Bacteria 2307
1129 Ga0373943_0046400 3300035170 Bacteria 2120
1130 Ga0373943_0138726 3300035170 Bacteria 1308
1131 Ga0373943_0175304 3300035170 Bacteria 1175
1132 Ga0373943_0574636 3300035170 Bacteria 662
1133 Ga0373946_0074089 3300035171 Bacteria 1477
1134 Ga0373946_0086439 3300035171 Bacteria 1382
1135 Ga0373946_0144620 3300035171 Bacteria 1105
1136 Ga0373946_0187562 3300035171 Bacteria 984
1137 Ga0373946_0220506 3300035171 Bacteria 915
1138 Ga0373955_0045169 3300035172 Bacteria 2376
1139 Ga0373955_0144808 3300035172 Bacteria 1395
1140 Ga0373955_0196502 3300035172 Bacteria 1200
1141 Ga0373955_0227939 3300035172 Bacteria 1114
1142 Ga0373955_0310073 3300035172 Bacteria 952
1143 Ga0373955_0475990 3300035172 Bacteria 762
1144 Ga0373942_0029303 3300035207 Bacteria 1443
1145 Ga0373942_0092566 3300035207 Bacteria 913
1146 Ga0373942_0190317 3300035207 Bacteria 676
1147 Ga0373962_0226282 3300035242 Bacteria 642
1148 Ga0373962_0243852 3300035242 Bacteria 622
1149 Ga0316574_0000854 3300035398 Bacteria 13382
1150 Ga0316574_0002988 3300035398 Bacteria 8620
1151 Ga0373924_0043068 3300035410 Bacteria 1853
1152 Ga0373924_0161259 3300035410 Bacteria 983
1153 Ga0373924_0185598 3300035410 Bacteria 915
1154 Ga0373924_0388207 3300035410 Bacteria 623
1155 Ga0373931_0000424 3300035691 Bacteria 17213
1156 Ga0373931_0018892 3300035691 Bacteria 3433
1157 Ga0373931_0109568 3300035691 Bacteria 1565
1158 Ga0373931_0406430 3300035691 Bacteria 863
1159 Ga0373935_0008550 3300035692 Bacteria 6127
1160 Ga0373935_0027021 3300035692 Bacteria 3547
1161 Ga0373935_0686211 3300035692 Bacteria 753
1162 Ga0373935_0726761 3300035692 Bacteria 731
1163 Ga0373935_0863263 3300035692 Bacteria 669
1164 Ga0373927_0002911 3300035695 Bacteria 12449
1165 Ga0373927_0016489 3300035695 Bacteria 4871
1166 Ga0373927_0017456 3300035695 Bacteria 4721
1167 Ga0373927_0444198 3300035695 Bacteria 856
1168 Ga0373927_0536273 3300035695 Bacteria 773
1169 Ga0373933_0005103 3300035724 Bacteria 7163
1170 Ga0373933_0060834 3300035724 Bacteria 2277
1171 Ga0373933_0061327 3300035724 Bacteria 2269
1172 Ga0373933_0236829 3300035724 Bacteria 1173
1173 Ga0373933_0238831 3300035724 Bacteria 1168
1174 Ga0373933_0307873 3300035724 Bacteria 1026
1175 Ga0373933_0890428 3300035724 Bacteria 586
1176 Ga0373947_0012180 3300035725 Bacteria 4924
1177 Ga0373947_0054393 3300035725 Bacteria 2415
1178 Ga0373947_0187151 3300035725 Bacteria 1350
1179 Ga0373947_0239003 3300035725 Bacteria 1198
1180 Ga0373947_0300938 3300035725 Bacteria 1069
1181 Ga0373947_0525852 3300035725 Bacteria 804
1182 Ga0373937_0107343 3300036401 Bacteria 2596
1183 Ga0373937_0216611 3300036401 Bacteria 1802
1184 Ga0373937_0487814 3300036401 Bacteria 1170
1185 Ga0373937_0657684 3300036401 Bacteria 993
1186 Ga0373937_0726714 3300036401 Bacteria 940
1187 Ga0316582_0162139 3300036647 Bacteria 1515
1188 Ga0373925_0012636 3300037068 Bacteria 6116
1189 Ga0373925_0068651 3300037068 Bacteria 2676
1190 Ga0373925_0074773 3300037068 Bacteria 2566
1191 Ga0373925_0228787 3300037068 Bacteria 1486
1192 Ga0373925_0273745 3300037068 Bacteria 1358
1193 Ga0373925_0293246 3300037068 Bacteria 1312
1194 Ga0373925_0874968 3300037068 Bacteria 740
1195 Ga0395899_0000505 3300037312 Bacteria 43367
1196 Ga0395899_0003409 3300037312 Bacteria 12614
1197 Ga0395899_0234206 3300037312 Bacteria 1266
1198 Ga0395900_0006268 3300037418 Bacteria 12412
1199 Ga0395900_0206565 3300037418 Bacteria 1985
1200 Ga0395900_1289413 3300037418 Bacteria 644
1201 Ga0395898_0536946 3300037466 Bacteria 1111
1202 Ga0395898_0946296 3300037466 Bacteria 798
1203 Ga0395898_1150299 3300037466 Bacteria 708
1204 Ga0395905_0008791 3300037471 Bacteria 9928
1205 Ga0395905_0067029 3300037471 Bacteria 3361
1206 Ga0395905_0155785 3300037471 Bacteria 2149
1207 Ga0395905_0365479 3300037471 Bacteria 1336
1208 Ga0395905_0467096 3300037471 Bacteria 1160
1209 Ga0395901_0000182 3300038443 Bacteria 81583
1210 Ga0395901_0230027 3300038443 Bacteria 1936
1211 Ga0395901_0346653 3300038443 Bacteria 1533
1212 Ga0395901_0796187 3300038443 Bacteria 934
1213 Ga0395901_0879150 3300038443 Bacteria 879
1214 Ga0400490_47983 3300038726 Bacteria 10023
1215 Ga0242420_095243 3300038996 Bacteria 629
1216 Ga0400483_225090 3300039062 Bacteria 1314
1217 Ga0436365_0581961 3300039437 Bacteria 3143
1218 Ga0436365_1017355 3300039437 Bacteria 2303
1219 Ga0436360_0570562 3300039438 Bacteria 1087
1220 Ga0436360_1263300 3300039438 Bacteria 633
1221 Ga0436361_0009988 3300039447 Bacteria 9004
1222 Ga0436361_0200247 3300039447 Bacteria 777
1223 Ga0436361_0514914 3300039447 Bacteria 1093
1224 Ga0436361_0521959 3300039447 Bacteria 968
1225 Ga0436361_0687444 3300039447 Bacteria 109830
1226 Ga0436361_0928362 3300039447 Bacteria 955
1227 Ga0436363_0091266 3300039450 Bacteria 595
1228 Ga0436363_0620330 3300039450 Bacteria 564
1229 Ga0439461_0012185 3300041410 Bacteria 1605
1230 Ga0439465_0232265 3300041413 Bacteria 679
1231 Ga0451789_1216037 3300041443 Bacteria 621
1232 Ga0451797_1582190 3300041453 Bacteria 531
1233 Ga0451804_0575511 3300041463 Bacteria 644
1234 Ga0451835_0475987 3300041492 Bacteria 749
1235 Ga0451839_0318377 3300041496 Bacteria 718
1236 Ga0451853_3182744 3300041512 Bacteria 1124
1237 Ga0439433_0023110 3300041999 Bacteria 1398
1238 Ga0439433_0099279 3300041999 Bacteria 721
1239 Ga0439441_006635 3300042001 Bacteria 1842
1240 Ga0439441_176546 3300042001 Bacteria 512
1241 Ga0439449_0024567 3300042007 Bacteria 2252
1242 Ga0439450_003397 3300042008 Bacteria 2628
1243 Ga0439450_212025 3300042008 Bacteria 520
1244 Ga0439451_034850 3300042009 Bacteria 1012
1245 Ga0439454_074802 3300042011 Bacteria 606
1246 Ga0450911_025560 3300042115 Bacteria 766
1247 Ga0450917_019401 3300042120 Bacteria 598
1248 Ga0450897_007065 3300042128 Bacteria 1017
1249 Ga0450898_018404 3300042134 Bacteria 1210
1250 Ga0450898_023425 3300042134 Bacteria 1098
1251 Ga0450904_000933 3300042139 Bacteria 4637
1252 Ga0439446_0004083 3300042156 Bacteria 3679
1253 Ga0439458_0010675 3300042157 Bacteria 2049
1254 Ga0439434_0000207 3300042435 Bacteria 16234
1255 Ga0439435_0000263 3300042436 Bacteria 7702
1256 Ga0439435_0002006 3300042436 Bacteria 3932
1257 Ga0439460_0005416 3300042461 Bacteria 3129
1258 Ga0439460_0006906 3300042461 Bacteria 2827
1259 Ga0450893_0007475 3300042532 Bacteria 1776
1260 Ga0451577_0009550 3300042876 Bacteria 9330
1261 Ga0451577_0341078 3300042876 Bacteria 1359
1262 Ga0451577_0387767 3300042876 Bacteria 1268
1263 Ga0451577_0826646 3300042876 Bacteria 836
1264 Ga0466969_0432385 3300044656 Bacteria 598
1265 Ga0466972_0000070 3300044658 Bacteria 100242
1266 Ga0466972_0246959 3300044658 Bacteria 834
1267 Ga0466972_0390617 3300044658 Bacteria 652
1268 Ga0466982_0359842 3300044672 Bacteria 804
1269 Ga0453683_0258207 3300044673 Bacteria 1111
1270 Ga0453683_0401251 3300044673 Bacteria 884
1271 Ga0466965_0006917 3300044683 Bacteria 5189
1272 Ga0466965_0057320 3300044683 Bacteria 1941
1273 Ga0466965_0113751 3300044683 Bacteria 1393
1274 Ga0466965_0282826 3300044683 Bacteria 896
1275 Ga0466966_0195263 3300044684 Bacteria 1225
1276 Ga0466966_0385009 3300044684 Bacteria 842
1277 Ga0466961_0157343 3300044693 Bacteria 1417
1278 Ga0466961_0338418 3300044693 Bacteria 916
1279 Ga0466963_0298143 3300044694 Bacteria 1133
1280 Ga0466964_0019249 3300044706 Bacteria 2622
1281 Ga0466964_0242455 3300044706 Bacteria 885
1282 Ga0453684_0000237 3300044712 Bacteria 236999
1283 Ga0453684_0796826 3300044712 Bacteria 1019
1284 Ga0453684_2306124 3300044712 Bacteria 535
1285 Ga0466970_0022377 3300044765 Bacteria 3299
1286 Ga0466970_0114882 3300044765 Bacteria 1471
1287 Ga0466970_0276104 3300044765 Bacteria 944
1288 Ga0466957_0091828 3300044842 Bacteria 1903
1289 Ga0466960_0180323 3300044901 Bacteria 1144
1290 Ga0466960_0228618 3300044901 Bacteria 1026
1291 Ga0466960_0299615 3300044901 Bacteria 905
1292 Ga0451576_0000034 3300045051 Bacteria 390778
1293 Ga0451576_0000906 3300045051 Bacteria 56126
1294 Ga0451576_0001076 3300045051 Bacteria 50068
1295 Ga0451576_0002763 3300045051 Bacteria 25371
1296 Ga0451576_0005425 3300045051 Bacteria 16007
1297 Ga0451576_0031091 3300045051 Bacteria 5695
1298 Ga0451576_0038069 3300045051 Bacteria 5091
1299 Ga0451576_0284224 3300045051 Bacteria 1730
1300 Ga0451576_0568075 3300045051 Bacteria 1192
1301 Ga0466958_0138819 3300045836 Bacteria 1529
1302 Ga0466967_0119186 3300045976 Bacteria 2435
1303 Ga0495617_000037 3300046452 Bacteria 134553
1304 Ga0495617_000039 3300046452 Bacteria 128069
1305 Ga0495617_000940 3300046452 Bacteria 13541
1306 Ga0495617_029977 3300046452 Bacteria 1829
1307 Ga0495617_065190 3300046452 Bacteria 1201
1308 Ga0495617_149382 3300046452 Bacteria 743
1309 Ga0495627_000008 3300046453 Bacteria 572150
1310 Ga0495627_015998 3300046453 Bacteria 2578
1311 Ga0495627_018004 3300046453 Bacteria 2391
1312 Ga0495627_020896 3300046453 Bacteria 2175
1313 Ga0495627_122687 3300046453 Bacteria 733
1314 Ga0495592_0051886 3300046454 Bacteria 3046
1315 Ga0495592_0075221 3300046454 Bacteria 2452
1316 Ga0495603_0006152 3300046455 Bacteria 7175
1317 Ga0495603_0043579 3300046455 Bacteria 2679
1318 Ga0495603_0047463 3300046455 Bacteria 2557
1319 Ga0495603_0093673 3300046455 Bacteria 1755
1320 Ga0495603_0152350 3300046455 Bacteria 1342
1321 Ga0495590_0000089 3300046457 Bacteria 57394
1322 Ga0495590_0000256 3300046457 Bacteria 28990
1323 Ga0495590_0002299 3300046457 Bacteria 7959
1324 Ga0495590_0008133 3300046457 Bacteria 4017
1325 Ga0495590_0131777 3300046457 Bacteria 899
1326 Ga0495629_0142860 3300046459 Bacteria 1665
1327 Ga0495629_0280428 3300046459 Bacteria 1143
1328 Ga0495629_0491197 3300046459 Bacteria 828
1329 Ga0495629_0555635 3300046459 Bacteria 770
1330 Ga0495629_0558981 3300046459 Bacteria 767
1331 Ga0495638_0000329 3300046460 Bacteria 60063
1332 Ga0495638_0010359 3300046460 Bacteria 6483
1333 Ga0495638_0017274 3300046460 Bacteria 4815
1334 Ga0495638_0078869 3300046460 Bacteria 2003
1335 Ga0495638_0161272 3300046460 Bacteria 1293
1336 Ga0495638_0186403 3300046460 Bacteria 1180
1337 Ga0495638_0458401 3300046460 Bacteria 649
1338 Ga0495641_0057113 3300046461 Bacteria 1768
1339 Ga0495641_0068108 3300046461 Bacteria 1600
1340 Ga0495651_0026064 3300046462 Bacteria 4552
1341 Ga0495651_0248309 3300046462 Bacteria 1217
1342 Ga0495651_0858063 3300046462 Bacteria 557
1343 Ga0495653_0000038 3300046463 Bacteria 120385
1344 Ga0495653_0021439 3300046463 Bacteria 5234
1345 Ga0495653_0033733 3300046463 Bacteria 4052
1346 Ga0495653_0045738 3300046463 Bacteria 3392
1347 Ga0495653_0062116 3300046463 Bacteria 2824
1348 Ga0495653_0073237 3300046463 Bacteria 2556
1349 Ga0495653_0286533 3300046463 Bacteria 1079
1350 Ga0495653_0659477 3300046463 Bacteria 638
1351 Ga0495650_0000048 3300046471 Bacteria 334427
1352 Ga0495650_0001026 3300046471 Bacteria 31382
1353 Ga0495650_0003518 3300046471 Bacteria 11346
1354 Ga0495650_0010456 3300046471 Bacteria 5176
1355 Ga0495650_0059767 3300046471 Bacteria 1533
1356 Ga0495650_0059820 3300046471 Bacteria 1532
1357 Ga0495650_0162181 3300046471 Bacteria 796
1358 Ga0495650_0224807 3300046471 Bacteria 645
1359 Ga0495580_0002487 3300046472 Bacteria 16090
1360 Ga0495580_0072315 3300046472 Bacteria 2408
1361 Ga0495580_0371054 3300046472 Bacteria 967
1362 Ga0495580_0420938 3300046472 Bacteria 898
1363 Ga0495580_0946361 3300046472 Bacteria 551
1364 Ga0495582_0008768 3300046473 Bacteria 5579
1365 Ga0495582_0009830 3300046473 Bacteria 5267
1366 Ga0495582_0015683 3300046473 Bacteria 4159
1367 Ga0495582_0032967 3300046473 Bacteria 2846
1368 Ga0495582_0110455 3300046473 Bacteria 1544
1369 Ga0495582_0456930 3300046473 Bacteria 737
1370 Ga0495605_0002030 3300046474 Bacteria 12766
1371 Ga0495605_0016179 3300046474 Bacteria 4040
1372 Ga0495605_0018129 3300046474 Bacteria 3779
1373 Ga0495605_0038869 3300046474 Bacteria 2385
1374 Ga0495605_0042704 3300046474 Bacteria 2251
1375 Ga0495605_0083768 3300046474 Bacteria 1488
1376 Ga0495605_0115435 3300046474 Bacteria 1221
1377 Ga0495639_0001363 3300046475 Bacteria 10968
1378 Ga0495639_0015247 3300046475 Bacteria 3331
1379 Ga0495639_0016761 3300046475 Bacteria 3181
1380 Ga0495639_0036360 3300046475 Bacteria 2205
1381 Ga0495639_0230513 3300046475 Bacteria 912
1382 Ga0495662_0003932 3300046476 Bacteria 7498
1383 Ga0495662_0014304 3300046476 Bacteria 3860
1384 Ga0495662_0018247 3300046476 Bacteria 3394
1385 Ga0495662_0202882 3300046476 Bacteria 977
1386 Ga0495664_0096519 3300046477 Bacteria 1779
1387 Ga0495664_0178081 3300046477 Bacteria 1289
1388 Ga0495664_0553842 3300046477 Bacteria 685
1389 Ga0495584_0000006 3300046491 Bacteria 301775
1390 Ga0495584_0000679 3300046491 Bacteria 22629
1391 Ga0495584_0004790 3300046491 Bacteria 7232
1392 Ga0495584_0008034 3300046491 Bacteria 5484
1393 Ga0495584_0045789 3300046491 Bacteria 2206
1394 Ga0495584_0111483 3300046491 Bacteria 1384
1395 Ga0495584_0298359 3300046491 Bacteria 818
1396 Ga0495584_0334524 3300046491 Bacteria 769
1397 Ga0495585_0011506 3300046492 Bacteria 5235
1398 Ga0495585_0012995 3300046492 Bacteria 4887
1399 Ga0495585_0089092 3300046492 Bacteria 1663
1400 Ga0495585_0103811 3300046492 Bacteria 1517
1401 Ga0495585_0114472 3300046492 Bacteria 1431
1402 Ga0495585_0125801 3300046492 Bacteria 1352
1403 Ga0495585_0132197 3300046492 Bacteria 1312
1404 Ga0495585_0141740 3300046492 Bacteria 1258
1405 Ga0495585_0174688 3300046492 Bacteria 1107
1406 Ga0495585_0199213 3300046492 Bacteria 1020
1407 Ga0495585_0246622 3300046492 Bacteria 892
1408 Ga0495585_0265905 3300046492 Bacteria 851
1409 Ga0495594_0006812 3300046499 Bacteria 5870
1410 Ga0495594_0011294 3300046499 Bacteria 4640
1411 Ga0495594_0025057 3300046499 Bacteria 3205
1412 Ga0495594_0038079 3300046499 Bacteria 2624
1413 Ga0495594_0061269 3300046499 Bacteria 2082
1414 Ga0495594_0086172 3300046499 Bacteria 1757
1415 Ga0495594_0091226 3300046499 Bacteria 1707
1416 Ga0495594_0121769 3300046499 Bacteria 1475
1417 Ga0495594_0182800 3300046499 Bacteria 1193
1418 Ga0495596_0001262 3300046500 Bacteria 14661
1419 Ga0495596_0002979 3300046500 Bacteria 8785
1420 Ga0495596_0016589 3300046500 Bacteria 3056
1421 Ga0495596_0110255 3300046500 Bacteria 1068
1422 Ga0495607_0000146 3300046501 Bacteria 74540
1423 Ga0495607_0012687 3300046501 Bacteria 5550
1424 Ga0495607_0043832 3300046501 Bacteria 2642
1425 Ga0495607_0047575 3300046501 Bacteria 2512
1426 Ga0495607_0108759 3300046501 Bacteria 1472
1427 Ga0495607_0131367 3300046501 Bacteria 1302
1428 Ga0495607_0151172 3300046501 Bacteria 1188
1429 Ga0495607_0161243 3300046501 Bacteria 1139
1430 Ga0495607_0173846 3300046501 Bacteria 1085
1431 Ga0495607_0463128 3300046501 Bacteria 567
1432 Ga0495583_0000035 3300046506 Bacteria 246849
1433 Ga0495583_0000464 3300046506 Bacteria 59972
1434 Ga0495583_0000515 3300046506 Bacteria 55250
1435 Ga0495583_0000941 3300046506 Bacteria 33886
1436 Ga0495583_0025532 3300046506 Bacteria 2949
1437 Ga0495583_0026085 3300046506 Bacteria 2905
1438 Ga0495583_0037110 3300046506 Bacteria 2312
1439 Ga0495606_0000011 3300046507 Bacteria 296816
1440 Ga0495606_0000064 3300046507 Bacteria 183631
1441 Ga0495606_0008212 3300046507 Bacteria 9127
1442 Ga0495606_0015425 3300046507 Bacteria 5885
1443 Ga0495606_0015437 3300046507 Bacteria 5883
1444 Ga0495606_0031884 3300046507 Bacteria 3658
1445 Ga0495606_0041980 3300046507 Bacteria 3063
1446 Ga0495606_0076629 3300046507 Bacteria 2089
1447 Ga0495606_0079664 3300046507 Bacteria 2039
1448 Ga0495606_0087399 3300046507 Bacteria 1924
1449 Ga0495606_0107100 3300046507 Bacteria 1691
1450 Ga0495606_0225456 3300046507 Bacteria 1053
1451 Ga0495606_0258014 3300046507 Bacteria 963
1452 Ga0495606_0585633 3300046507 Bacteria 549
1453 Ga0495608_0060034 3300046511 Bacteria 2503
1454 Ga0495608_0243247 3300046511 Bacteria 1123
1455 Ga0495608_0307552 3300046511 Bacteria 981
1456 Ga0495610_0000003 3300046512 Bacteria 1203910
1457 Ga0495610_0000147 3300046512 Bacteria 77304
1458 Ga0495610_0020763 3300046512 Bacteria 3636
1459 Ga0495610_0030292 3300046512 Bacteria 2837
1460 Ga0495610_0075901 3300046512 Bacteria 1555
1461 Ga0495610_0111465 3300046512 Bacteria 1211
1462 Ga0495610_0269380 3300046512 Bacteria 667
1463 Ga0495616_0005111 3300046513 Bacteria 8150
1464 Ga0495616_0010998 3300046513 Bacteria 5206
1465 Ga0495616_0033526 3300046513 Bacteria 2674
1466 Ga0495616_0068125 3300046513 Bacteria 1728
1467 Ga0495616_0081978 3300046513 Bacteria 1541
1468 Ga0495616_0090764 3300046513 Bacteria 1446
1469 Ga0495616_0093850 3300046513 Bacteria 1416
1470 Ga0495616_0103929 3300046513 Bacteria 1328
1471 Ga0495616_0103962 3300046513 Bacteria 1328
1472 Ga0495616_0138043 3300046513 Bacteria 1112
1473 Ga0495618_0059440 3300046514 Bacteria 2422
1474 Ga0495620_0005610 3300046515 Bacteria 6987
1475 Ga0495628_0001929 3300046516 Bacteria 18824
1476 Ga0495628_1053217 3300046516 Bacteria 557
1477 Ga0495630_0011239 3300046517 Bacteria 6476
1478 Ga0495630_0016385 3300046517 Bacteria 5414
1479 Ga0495630_0104553 3300046517 Bacteria 2143
1480 Ga0495630_0214172 3300046517 Bacteria 1470
1481 Ga0495630_0356463 3300046517 Bacteria 1119
1482 Ga0495630_0589118 3300046517 Bacteria 853
1483 Ga0495631_0011492 3300046518 Bacteria 4352
1484 Ga0495631_0025302 3300046518 Bacteria 2734
1485 Ga0495631_0059603 3300046518 Bacteria 1658
1486 Ga0495631_0086696 3300046518 Bacteria 1348
1487 Ga0495631_0117343 3300046518 Bacteria 1144
1488 Ga0495631_0253159 3300046518 Bacteria 750
1489 Ga0495631_0326922 3300046518 Bacteria 652
1490 Ga0495632_0000250 3300046519 Bacteria 53467
1491 Ga0495632_0019797 3300046519 Bacteria 3658
1492 Ga0495632_0046632 3300046519 Bacteria 2152
1493 Ga0495632_0055038 3300046519 Bacteria 1948
1494 Ga0495632_0275491 3300046519 Bacteria 750
1495 Ga0495637_0000004 3300046520 Bacteria 589740
1496 Ga0495637_0002614 3300046520 Bacteria 9881
1497 Ga0495637_0020216 3300046520 Bacteria 3066
1498 Ga0495643_0000933 3300046522 Bacteria 30408
1499 Ga0495643_0006906 3300046522 Bacteria 7391
1500 Ga0495643_0031051 3300046522 Bacteria 2977
1501 Ga0495643_0045226 3300046522 Bacteria 2390
1502 Ga0495643_0045455 3300046522 Bacteria 2383
1503 Ga0495643_0099955 3300046522 Bacteria 1487
1504 Ga0495643_0100936 3300046522 Bacteria 1479
1505 Ga0495643_0116765 3300046522 Bacteria 1351
1506 Ga0495643_0254848 3300046522 Bacteria 817
1507 Ga0495644_0005823 3300046523 Bacteria 4813
1508 Ga0495644_0011056 3300046523 Bacteria 3479
1509 Ga0495644_0012807 3300046523 Bacteria 3224
1510 Ga0495644_0039079 3300046523 Bacteria 1789
1511 Ga0495644_0052182 3300046523 Bacteria 1535
1512 Ga0495644_0059009 3300046523 Bacteria 1442
1513 Ga0495644_0064010 3300046523 Bacteria 1382
1514 Ga0495644_0082189 3300046523 Bacteria 1214
1515 Ga0495644_0094584 3300046523 Bacteria 1128
1516 Ga0495644_0173745 3300046523 Bacteria 827
1517 Ga0495644_0350380 3300046523 Bacteria 581
1518 Ga0495644_0445199 3300046523 Bacteria 515
1519 Ga0495648_0000001 3300046524 Bacteria 696872
1520 Ga0495648_0002588 3300046524 Bacteria 16566
1521 Ga0495648_0007597 3300046524 Bacteria 8656
1522 Ga0495648_0026333 3300046524 Bacteria 3917
1523 Ga0495648_0035961 3300046524 Bacteria 3203
1524 Ga0495648_0041230 3300046524 Bacteria 2918
1525 Ga0495648_0058058 3300046524 Bacteria 2316
1526 Ga0495648_0065957 3300046524 Bacteria 2124
1527 Ga0495648_0072601 3300046524 Bacteria 1991
1528 Ga0495648_0077815 3300046524 Bacteria 1899
1529 Ga0495648_0093764 3300046524 Bacteria 1673
1530 Ga0495648_0096077 3300046524 Bacteria 1647
1531 Ga0495648_0381431 3300046524 Bacteria 635
1532 Ga0495663_0018551 3300046525 Bacteria 1981
1533 Ga0495663_0058761 3300046525 Bacteria 1205
1534 Ga0495663_0095728 3300046525 Bacteria 972
1535 Ga0495666_0002752 3300046526 Bacteria 8787
1536 Ga0495666_0006205 3300046526 Bacteria 6017
1537 Ga0495666_0011231 3300046526 Bacteria 4467
1538 Ga0495666_0012973 3300046526 Bacteria 4153
1539 Ga0495666_0060314 3300046526 Bacteria 1813
1540 Ga0495666_0157285 3300046526 Bacteria 1055
1541 Ga0495666_0186219 3300046526 Bacteria 957
1542 Ga0495666_0205407 3300046526 Bacteria 905
1543 Ga0495666_0447872 3300046526 Bacteria 578
1544 Ga0495642_0000366 3300046528 Bacteria 24393
1545 Ga0495642_0037261 3300046528 Bacteria 1967
1546 Ga0495642_0043210 3300046528 Bacteria 1837
1547 Ga0495642_0051391 3300046528 Bacteria 1695
1548 Ga0495642_0113555 3300046528 Bacteria 1159
1549 Ga0495642_0121583 3300046528 Bacteria 1120
1550 Ga0495642_0136233 3300046528 Bacteria 1058
1551 Ga0495642_0197240 3300046528 Bacteria 877
1552 Ga0495642_0268587 3300046528 Bacteria 746
1553 Ga0495652_0029810 3300046529 Bacteria 4790
1554 Ga0495652_0456531 3300046529 Bacteria 893
1555 Ga0495652_0681737 3300046529 Bacteria 693
1556 Ga0495654_0000028 3300046530 Bacteria 223384
1557 Ga0495654_0038980 3300046530 Bacteria 2373
1558 Ga0495654_0052592 3300046530 Bacteria 1982
1559 Ga0495654_0066092 3300046530 Bacteria 1725
1560 Ga0495654_0068091 3300046530 Bacteria 1692
1561 Ga0495654_0079581 3300046530 Bacteria 1539
1562 Ga0495654_0094274 3300046530 Bacteria 1385
1563 Ga0495654_0112433 3300046530 Bacteria 1241
1564 Ga0495654_0338477 3300046530 Bacteria 607
1565 Ga0495665_0005600 3300046531 Bacteria 6766
1566 Ga0495665_0031234 3300046531 Bacteria 2850
1567 Ga0495665_0037697 3300046531 Bacteria 2579
1568 Ga0495665_0050815 3300046531 Bacteria 2197
1569 Ga0495665_0070023 3300046531 Bacteria 1848
1570 Ga0495665_0311788 3300046531 Bacteria 804
1571 Ga0495665_0571292 3300046531 Bacteria 566
1572 Ga0495640_0000332 3300046533 Bacteria 32858
1573 Ga0495640_0040721 3300046533 Bacteria 3251
1574 Ga0495640_0042765 3300046533 Bacteria 3159
1575 Ga0495640_0054180 3300046533 Bacteria 2749
1576 Ga0495640_0263223 3300046533 Bacteria 1077
1577 Ga0495640_0316478 3300046533 Bacteria 967
1578 Ga0495586_0001612 3300046535 Bacteria 12371
1579 Ga0495586_0002680 3300046535 Bacteria 9632
1580 Ga0495586_0047882 3300046535 Bacteria 2308
1581 Ga0495586_0057896 3300046535 Bacteria 2103
1582 Ga0495586_0126869 3300046535 Bacteria 1427
1583 Ga0495586_0133520 3300046535 Bacteria 1390
1584 Ga0495587_0013600 3300046536 Bacteria 5113
1585 Ga0495587_0054498 3300046536 Bacteria 2356
1586 Ga0495587_0120716 3300046536 Bacteria 1501
1587 Ga0495587_0162193 3300046536 Bacteria 1272
1588 Ga0495587_0519753 3300046536 Bacteria 657
1589 Ga0495587_0633605 3300046536 Bacteria 588
1590 Ga0495598_0039369 3300046537 Bacteria 1374
1591 Ga0495598_0051470 3300046537 Bacteria 1241
1592 Ga0495598_0235033 3300046537 Bacteria 674
1593 Ga0495609_0000202 3300046538 Bacteria 59327
1594 Ga0495609_0000632 3300046538 Bacteria 27358
1595 Ga0495609_0000731 3300046538 Bacteria 24981
1596 Ga0495609_0005004 3300046538 Bacteria 7088
1597 Ga0495609_0011146 3300046538 Bacteria 4291
1598 Ga0495609_0019147 3300046538 Bacteria 3169
1599 Ga0495609_0050578 3300046538 Bacteria 1852
1600 Ga0495609_0093344 3300046538 Bacteria 1308
1601 Ga0495609_0148567 3300046538 Bacteria 997
1602 Ga0495609_0199620 3300046538 Bacteria 836
1603 Ga0495621_0010474 3300046539 Bacteria 2838
1604 Ga0495621_0011182 3300046539 Bacteria 2769
1605 Ga0495621_0013172 3300046539 Bacteria 2594
1606 Ga0495621_0107235 3300046539 Bacteria 1068
1607 Ga0495621_0164068 3300046539 Bacteria 880
1608 Ga0495597_0010170 3300046542 Bacteria 4609
1609 Ga0495597_0022198 3300046542 Bacteria 2945
1610 Ga0495597_0043912 3300046542 Bacteria 1988
1611 Ga0495597_0049650 3300046542 Bacteria 1853
1612 Ga0495597_0054930 3300046542 Bacteria 1747
1613 Ga0495597_0069719 3300046542 Bacteria 1516
1614 Ga0495597_0081127 3300046542 Bacteria 1387
1615 Ga0495597_0081891 3300046542 Bacteria 1379
1616 Ga0495597_0151049 3300046542 Bacteria 953
1617 Ga0495597_0205414 3300046542 Bacteria 787
1618 Ga0495597_0235955 3300046542 Bacteria 722
1619 Ga0495597_0345635 3300046542 Bacteria 571
1620 Ga0495645_0196737 3300046543 Bacteria 1370
1621 Ga0495645_0280617 3300046543 Bacteria 1095
1622 Ga0495622_0000068 3300046557 Bacteria 90633
1623 Ga0495622_0006132 3300046557 Bacteria 5585
1624 Ga0495622_0029717 3300046557 Bacteria 2553
1625 Ga0495622_0061892 3300046557 Bacteria 1732
1626 Ga0495622_0104183 3300046557 Bacteria 1299
1627 Ga0495622_0105294 3300046557 Bacteria 1292
1628 Ga0495622_0122940 3300046557 Bacteria 1184
1629 Ga0495622_0167628 3300046557 Bacteria 988
1630 Ga0495622_0184950 3300046557 Bacteria 933
1631 Ga0495633_0006613 3300046558 Bacteria 6842
1632 Ga0495633_0007375 3300046558 Bacteria 6335
1633 Ga0495633_0008653 3300046558 Bacteria 5714
1634 Ga0495633_0034176 3300046558 Bacteria 2446
1635 Ga0495633_0034661 3300046558 Bacteria 2426
1636 Ga0495633_0093371 3300046558 Bacteria 1398
1637 Ga0495633_0100650 3300046558 Bacteria 1341
1638 Ga0495633_0121004 3300046558 Bacteria 1212
1639 Ga0495633_0135146 3300046558 Bacteria 1140
1640 Ga0495633_0147848 3300046558 Bacteria 1085
1641 Ga0495633_0153652 3300046558 Bacteria 1062
1642 Ga0495633_0168545 3300046558 Bacteria 1009
1643 Ga0495633_0196114 3300046558 Bacteria 927
1644 Ga0495633_0243807 3300046558 Bacteria 820
1645 Ga0495633_0480125 3300046558 Bacteria 561
1646 Ga0495667_0008831 3300046559 Bacteria 6853
1647 Ga0495667_0025952 3300046559 Bacteria 3946
1648 Ga0495667_0339598 3300046559 Bacteria 950
1649 Ga0495656_0153543 3300046615 Bacteria 1113
1650 Ga0495656_0160500 3300046615 Bacteria 1092
1651 Ga0495656_0191516 3300046615 Bacteria 1010
1652 Ga0495656_0203451 3300046615 Bacteria 983
1653 Ga0495656_0295141 3300046615 Bacteria 829
1654 Ga0495656_0691904 3300046615 Bacteria 548
1655 Ga0495656_0791185 3300046615 Bacteria 512
1656 Ga0495668_0000048 3300046616 Bacteria 217867
1657 Ga0495668_0001049 3300046616 Bacteria 29314
1658 Ga0495668_0001239 3300046616 Bacteria 25630
1659 Ga0495668_0012767 3300046616 Bacteria 4974
1660 Ga0495668_0015049 3300046616 Bacteria 4526
1661 Ga0495668_0024042 3300046616 Bacteria 3467
1662 Ga0495668_0074781 3300046616 Bacteria 1860
1663 Ga0495668_0103640 3300046616 Bacteria 1556
1664 Ga0495668_0133401 3300046616 Bacteria 1359
1665 Ga0495668_0135939 3300046616 Bacteria 1345
1666 Ga0495668_0408171 3300046616 Bacteria 746
1667 Ga0495634_0019021 3300046642 Bacteria 4883
1668 Ga0495634_0141276 3300046642 Bacteria 1528
1669 Ga0495634_0225284 3300046642 Bacteria 1155
1670 Ga0495634_0343268 3300046642 Bacteria 895
1671 Ga0495611_0001880 3300046648 Bacteria 10002
1672 Ga0495611_0010338 3300046648 Bacteria 3948
1673 Ga0495611_0024049 3300046648 Bacteria 2647
1674 Ga0495611_0039658 3300046648 Bacteria 2097
1675 Ga0495611_0088858 3300046648 Bacteria 1426
1676 Ga0495611_0220431 3300046648 Bacteria 882
1677 Ga0495625_0005736 3300046660 Bacteria 11222
1678 Ga0495625_0008141 3300046660 Bacteria 8981
1679 Ga0495625_0013178 3300046660 Bacteria 6659
1680 Ga0495625_0019706 3300046660 Bacteria 5223
1681 Ga0495625_0033686 3300046660 Bacteria 3784
1682 Ga0495625_0080087 3300046660 Bacteria 2275
1683 Ga0495625_0154224 3300046660 Bacteria 1542
1684 Ga0495625_0186460 3300046660 Bacteria 1376
1685 Ga0495625_0212373 3300046660 Bacteria 1271
1686 Ga0495625_0384700 3300046660 Bacteria 879
1687 Ga0495625_0624382 3300046660 Bacteria 644
1688 Ga0495635_0013701 3300046663 Bacteria 5673
1689 Ga0495635_0019832 3300046663 Bacteria 4684
1690 Ga0495635_0030213 3300046663 Bacteria 3765
1691 Ga0495635_0061139 3300046663 Bacteria 2587
1692 Ga0495635_0526042 3300046663 Bacteria 777
1693 Ga0495635_0584544 3300046663 Bacteria 730
1694 Ga0495659_0001303 3300046664 Bacteria 8570
1695 Ga0495659_0003422 3300046664 Bacteria 5070
1696 Ga0495659_0023879 3300046664 Bacteria 2080
1697 Ga0495659_0025638 3300046664 Bacteria 2019
1698 Ga0495661_0000894 3300046665 Bacteria 27503
1699 Ga0495661_0027661 3300046665 Bacteria 3637
1700 Ga0495661_0037675 3300046665 Bacteria 3017
1701 Ga0495661_0040131 3300046665 Bacteria 2905
1702 Ga0495661_0047776 3300046665 Bacteria 2604
1703 Ga0495661_0066666 3300046665 Bacteria 2117
1704 Ga0495661_0092034 3300046665 Bacteria 1723
1705 Ga0495661_0110406 3300046665 Bacteria 1533
1706 Ga0495661_0144680 3300046665 Bacteria 1289
1707 Ga0495661_0182630 3300046665 Bacteria 1110
1708 Ga0495661_0274760 3300046665 Bacteria 851
1709 Ga0495661_0307386 3300046665 Bacteria 791
1710 Ga0495588_0000174 3300046674 Bacteria 81329
1711 Ga0495588_0013191 3300046674 Bacteria 3931
1712 Ga0495588_0017660 3300046674 Bacteria 3469
1713 Ga0495588_0028280 3300046674 Bacteria 2804
1714 Ga0495588_0028920 3300046674 Bacteria 2777
1715 Ga0495588_0036538 3300046674 Bacteria 2492
1716 Ga0495588_0085138 3300046674 Bacteria 1652
1717 Ga0495588_0094769 3300046674 Bacteria 1565
1718 Ga0495588_0113679 3300046674 Bacteria 1426
1719 Ga0495588_0145496 3300046674 Bacteria 1252
1720 Ga0495588_0248952 3300046674 Bacteria 937
1721 Ga0495588_0452445 3300046674 Bacteria 673
1722 Ga0495588_0544026 3300046674 Bacteria 608
1723 Ga0495657_0061543 3300046675 Bacteria 2482
1724 Ga0495599_0070371 3300046678 Bacteria 2184
1725 Ga0495599_0212083 3300046678 Bacteria 1187
1726 Ga0495623_0062383 3300046679 Bacteria 2336
1727 Ga0495623_0088447 3300046679 Bacteria 1906
1728 Ga0495623_0126919 3300046679 Bacteria 1531
1729 Ga0495646_0117109 3300046680 Bacteria 1511
1730 Ga0495646_0171456 3300046680 Bacteria 1195
1731 Ga0495646_0256228 3300046680 Bacteria 936
1732 Ga0495647_0018160 3300046681 Bacteria 2499
1733 Ga0495647_0019605 3300046681 Bacteria 2419
1734 Ga0495647_0032169 3300046681 Bacteria 1954
1735 Ga0495647_0441362 3300046681 Bacteria 601
1736 Ga0495658_0013899 3300046683 Bacteria 4103
1737 Ga0495658_0023459 3300046683 Bacteria 3275
1738 Ga0495658_0059219 3300046683 Bacteria 2192
1739 Ga0495658_0277342 3300046683 Bacteria 1057
1740 Ga0495658_0318448 3300046683 Bacteria 985
1741 Ga0495669_0007067 3300046684 Bacteria 4700
1742 Ga0495669_0030462 3300046684 Bacteria 2368
1743 Ga0495669_0032428 3300046684 Bacteria 2296
1744 Ga0495669_0102634 3300046684 Bacteria 1329
1745 Ga0495669_0122337 3300046684 Bacteria 1220
1746 Ga0495669_0312111 3300046684 Bacteria 758
1747 Ga0495613_0006401 3300046689 Bacteria 8799
1748 Ga0495613_0012801 3300046689 Bacteria 6237
1749 Ga0495613_0206651 3300046689 Bacteria 1382
1750 Ga0495624_0098156 3300046690 Bacteria 1804
1751 Ga0495624_0113806 3300046690 Bacteria 1663
1752 Ga0495624_0200579 3300046690 Bacteria 1212
1753 Ga0495624_0574798 3300046690 Bacteria 672
1754 Ga0495670_0007032 3300046691 Bacteria 5539
1755 Ga0495670_0009786 3300046691 Bacteria 4712
1756 Ga0495670_0011696 3300046691 Bacteria 4320
1757 Ga0495670_0106314 3300046691 Bacteria 1449
1758 Ga0495670_0227423 3300046691 Bacteria 991
1759 Ga0495670_0244567 3300046691 Bacteria 955
1760 Ga0495670_0262056 3300046691 Bacteria 922
1761 Ga0495670_0392516 3300046691 Bacteria 749
1762 Ga0495670_0815647 3300046691 Bacteria 509
1763 Ga0495671_0000001 3300046692 Bacteria 1169494
1764 Ga0495671_0019237 3300046692 Bacteria 3613
1765 Ga0495671_0043851 3300046692 Bacteria 2244
1766 Ga0495671_0057396 3300046692 Bacteria 1926
1767 Ga0495671_0068086 3300046692 Bacteria 1750
1768 Ga0495671_0128812 3300046692 Bacteria 1234
1769 Ga0495649_0086174 3300046694 Bacteria 1676
1770 Ga0495649_0089196 3300046694 Bacteria 1644
1771 Ga0495649_0111267 3300046694 Bacteria 1452
1772 Ga0495649_0136693 3300046694 Bacteria 1291
1773 Ga0495649_0164836 3300046694 Bacteria 1161
1774 Ga0495649_0196964 3300046694 Bacteria 1047
1775 Ga0495649_0407926 3300046694 Bacteria 681
1776 Ga0495589_0005458 3300046794 Bacteria 6709
1777 Ga0495589_0016939 3300046794 Bacteria 3741
1778 Ga0495589_0038017 3300046794 Bacteria 2410
1779 Ga0495589_0074369 3300046794 Bacteria 1658
1780 Ga0495589_0075171 3300046794 Bacteria 1647
1781 Ga0495589_0106592 3300046794 Bacteria 1354
1782 Ga0495589_0189849 3300046794 Bacteria 972
1783 Ga0495589_0275352 3300046794 Bacteria 783
1784 Ga0495589_0448607 3300046794 Bacteria 590
1785 Ga0495589_0526539 3300046794 Bacteria 539
1786 Ga0495600_0001395 3300046809 Bacteria 13324
1787 Ga0495600_0003020 3300046809 Bacteria 9822
1788 Ga0495600_0009571 3300046809 Bacteria 5991
1789 Ga0495660_0000157 3300046810 Bacteria 73772
1790 Ga0495660_0008377 3300046810 Bacteria 6046
1791 Ga0495660_0011707 3300046810 Bacteria 5089
1792 Ga0495660_0019417 3300046810 Bacteria 3902
1793 Ga0495660_0021276 3300046810 Bacteria 3714
1794 Ga0495660_0034095 3300046810 Bacteria 2850
1795 Ga0495660_0041115 3300046810 Bacteria 2561
1796 Ga0495660_0144672 3300046810 Bacteria 1179
1797 Ga0495660_0184876 3300046810 Bacteria 1005
1798 Ga0495660_0203368 3300046810 Bacteria 944
1799 Ga0495581_0029270 3300047315 Bacteria 3192
1800 Ga0495581_0061774 3300047315 Bacteria 2165
1801 Ga0495581_0077497 3300047315 Bacteria 1923
1802 Ga0495581_0089854 3300047315 Bacteria 1781
1803 Ga0495581_0399830 3300047315 Bacteria 801
1804 Ga0495604_0013374 3300047317 Bacteria 6535
1805 Ga0495604_0025790 3300047317 Bacteria 4681
1806 Ga0495604_0070450 3300047317 Bacteria 2647
1807 Ga0495604_0215863 3300047317 Bacteria 1323
1808 Ga0495636_0013522 3300047318 Bacteria 3240
1809 Ga0495636_0028161 3300047318 Bacteria 2289
1810 Ga0495636_0030003 3300047318 Bacteria 2221
1811 Ga0495636_0030241 3300047318 Bacteria 2213
1812 Ga0495636_0190048 3300047318 Bacteria 934
1813 Ga0495636_0318890 3300047318 Bacteria 729
1814 Ga0495636_0328059 3300047318 Bacteria 719
1815 Ga0495636_0334901 3300047318 Bacteria 712
1816 Ga0495636_0581236 3300047318 Bacteria 546
1817 Ga0495674_0047498 3300047319 Bacteria 3806
1818 Ga0495674_0085356 3300047319 Bacteria 2704
1819 Ga0495674_0940357 3300047319 Bacteria 665
1820 Ga0495672_0000097 3300047320 Bacteria 141608
1821 Ga0495672_0000126 3300047320 Bacteria 117782
1822 Ga0495672_0000259 3300047320 Bacteria 73356
1823 Ga0495672_0000302 3300047320 Bacteria 66589
1824 Ga0495672_0014901 3300047320 Bacteria 5301
1825 Ga0495672_0016317 3300047320 Bacteria 5009
1826 Ga0495672_0054303 3300047320 Bacteria 2342
1827 Ga0495672_0064756 3300047320 Bacteria 2091
1828 Ga0495672_0127119 3300047320 Bacteria 1346
1829 Ga0495676_0024464 3300047321 Bacteria 5228
1830 Ga0495676_0040241 3300047321 Bacteria 3860
1831 Ga0495676_0061436 3300047321 Bacteria 2939
1832 Ga0495676_0116285 3300047321 Bacteria 1953
1833 Ga0495676_0320558 3300047321 Bacteria 1041
1834 Ga0495680_0001868 3300047322 Bacteria 22155
1835 Ga0495680_0021668 3300047322 Bacteria 5374
1836 Ga0495680_0192327 3300047322 Bacteria 1467
1837 Ga0495680_0235599 3300047322 Bacteria 1302
1838 Ga0495680_0248495 3300047322 Bacteria 1261
1839 Ga0495683_0004993 3300047323 Bacteria 7431
1840 Ga0495683_0008550 3300047323 Bacteria 5474
1841 Ga0495683_0050632 3300047323 Bacteria 2078
1842 Ga0495683_0094864 3300047323 Bacteria 1441
1843 Ga0495683_0164529 3300047323 Bacteria 1023
1844 Ga0495683_0324519 3300047323 Bacteria 655
1845 Ga0495687_000002 3300047443 Bacteria 1085770
1846 Ga0495687_000457 3300047443 Bacteria 49882
1847 Ga0495687_000702 3300047443 Bacteria 37364
1848 Ga0495687_000994 3300047443 Bacteria 28433
1849 Ga0495687_006365 3300047443 Bacteria 7254
1850 Ga0495687_008955 3300047443 Bacteria 5661
1851 Ga0495687_010475 3300047443 Bacteria 5082
1852 Ga0495687_014535 3300047443 Bacteria 4046
1853 Ga0495687_066666 3300047443 Bacteria 1460
1854 Ga0495675_0007368 3300047444 Bacteria 6778
1855 Ga0495675_0106251 3300047444 Bacteria 1754
1856 Ga0495675_0184835 3300047444 Bacteria 1274
1857 Ga0495675_0236560 3300047444 Bacteria 1100
1858 Ga0495675_0408643 3300047444 Bacteria 790
1859 Ga0495675_0436126 3300047444 Bacteria 759
1860 Ga0495677_0001656 3300047445 Bacteria 8951
1861 Ga0495677_0004036 3300047445 Bacteria 5667
1862 Ga0495677_0056792 3300047445 Bacteria 1446
1863 Ga0495677_0093616 3300047445 Bacteria 1133
1864 Ga0495677_0096683 3300047445 Bacteria 1115
1865 Ga0495677_0116460 3300047445 Bacteria 1018
1866 Ga0495677_0116588 3300047445 Bacteria 1017
1867 Ga0495677_0133294 3300047445 Bacteria 951
1868 Ga0495677_0163324 3300047445 Bacteria 860
1869 Ga0495677_0171047 3300047445 Bacteria 840
1870 Ga0495677_0260767 3300047445 Bacteria 678
1871 Ga0495677_0280720 3300047445 Bacteria 653
1872 Ga0495679_001915 3300047446 Bacteria 11141
1873 Ga0495679_002551 3300047446 Bacteria 9192
1874 Ga0495679_009967 3300047446 Bacteria 3763
1875 Ga0495679_015702 3300047446 Bacteria 2761
1876 Ga0495679_205866 3300047446 Bacteria 516
1877 Ga0495685_000019 3300047447 Bacteria 73831
1878 Ga0495685_004108 3300047447 Bacteria 4681
1879 Ga0495685_027283 3300047447 Bacteria 1964
1880 Ga0495685_030523 3300047447 Bacteria 1853
1881 Ga0495685_051327 3300047447 Bacteria 1398
1882 Ga0495685_059272 3300047447 Bacteria 1291
1883 Ga0495673_0000097 3300047469 Bacteria 182247
1884 Ga0495673_0000100 3300047469 Bacteria 173962
1885 Ga0495673_0017896 3300047469 Bacteria 3585
1886 Ga0495673_0135162 3300047469 Bacteria 966
1887 Ga0495673_0224214 3300047469 Bacteria 694
1888 Ga0495681_0040152 3300047470 Bacteria 2280
1889 Ga0495681_0044744 3300047470 Bacteria 2124
1890 Ga0495681_0049709 3300047470 Bacteria 1980
1891 Ga0495681_0073885 3300047470 Bacteria 1538
1892 Ga0495681_0126294 3300047470 Bacteria 1093
1893 Ga0495681_0137367 3300047470 Bacteria 1035
1894 Ga0495681_0199071 3300047470 Bacteria 813
1895 Ga0495681_0336725 3300047470 Bacteria 576
1896 Ga0495684_0098504 3300047471 Bacteria 2210
1897 Ga0495686_0005033 3300047472 Bacteria 10612
1898 Ga0495686_0018140 3300047472 Bacteria 4728
1899 Ga0495686_0018201 3300047472 Bacteria 4719
1900 Ga0495686_0064771 3300047472 Bacteria 2261
1901 Ga0495686_0140863 3300047472 Bacteria 1423
1902 Ga0495686_0213745 3300047472 Bacteria 1100
1903 Ga0495686_0220372 3300047472 Bacteria 1079
1904 Ga0495593_0026048 3300047673 Bacteria 3232
1905 Ga0495593_0030667 3300047673 Bacteria 2941
1906 Ga0495593_0063593 3300047673 Bacteria 1927
1907 Ga0495593_0083801 3300047673 Bacteria 1646
1908 Ga0495593_0087694 3300047673 Bacteria 1604
1909 Ga0495593_0313336 3300047673 Bacteria 784
1910 Ga0495593_0400699 3300047673 Bacteria 686
1911 Ga0495602_0034817 3300048088 Bacteria 4704
1912 Ga0495602_0146972 3300048088 Bacteria 1858
1913 Ga0495602_0216990 3300048088 Bacteria 1447
1914 Ga0495602_0254281 3300048088 Bacteria 1307
1915 Ga0495602_0527923 3300048088 Bacteria 821
1916 Ga0495614_0133794 3300048089 Bacteria 1098
1917 Ga0495614_0157033 3300048089 Bacteria 1016
1918 Ga0495614_0158387 3300048089 Bacteria 1012
1919 Ga0495614_0603571 3300048089 Bacteria 527
1920 Ga0495615_0008199 3300048090 Bacteria 2011
1921 Ga0495615_0039914 3300048090 Bacteria 1166
1922 Ga0495615_0090517 3300048090 Bacteria 852
1923 Ga0495615_0101707 3300048090 Bacteria 813
1924 Ga0495626_0000016 3300048091 Bacteria 232214
1925 Ga0495626_0000026 3300048091 Bacteria 207698
1926 Ga0495626_0002931 3300048091 Bacteria 11353
1927 Ga0495626_0007918 3300048091 Bacteria 5881
1928 Ga0495626_0009392 3300048091 Bacteria 5287
1929 Ga0495626_0039663 3300048091 Bacteria 2227
1930 Ga0495626_0059472 3300048091 Bacteria 1743
1931 Ga0495626_0063508 3300048091 Bacteria 1674
1932 Ga0495626_0328037 3300048091 Bacteria 600
1933 Ga0496100_0007351 3300048903 Bacteria 6069
1934 Ga0496100_0505931 3300048903 Bacteria 931
1935 Ga0496100_0512356 3300048903 Bacteria 925
1936 Ga0496101_0021065 3300048904 Bacteria 4474
1937 Ga0496101_0663724 3300048904 Bacteria 824
1938 Ga0496101_0721375 3300048904 Bacteria 787
1939 Ga0496101_1011655 3300048904 Bacteria 653
1940 Ga0496101_1264700 3300048904 Bacteria 577
1941 Ga0496101_1544142 3300048904 Bacteria 516
1942 Ga0496102_0001202 3300048905 Bacteria 23500
1943 Ga0496102_0229748 3300048905 Bacteria 1749
1944 Ga0496102_0273261 3300048905 Bacteria 1593
1945 Ga0496102_0436832 3300048905 Bacteria 1228
1946 Ga0496102_0596621 3300048905 Bacteria 1027
1947 Ga0496102_0850748 3300048905 Bacteria 834
1948 Ga0496102_1406222 3300048905 Bacteria 617
1949 Ga0496103_0011633 3300048906 Bacteria 5218
1950 Ga0496103_0033010 3300048906 Bacteria 3161
1951 Ga0496103_0052491 3300048906 Bacteria 2525
1952 Ga0496103_0223449 3300048906 Bacteria 1211
1953 Ga0496103_0436650 3300048906 Bacteria 840
1954 Ga0496103_0643335 3300048906 Bacteria 674
1955 Ga0496104_0338190 3300048907 Bacteria 1418
1956 Ga0496104_0470315 3300048907 Bacteria 1168
1957 Ga0496104_0490806 3300048907 Bacteria 1139
1958 Ga0496105_0214483 3300048908 Bacteria 1568
1959 Ga0496105_0262170 3300048908 Bacteria 1397
1960 Ga0496105_0424723 3300048908 Bacteria 1052
1961 Ga0496105_0790792 3300048908 Bacteria 722
1962 Ga0496106_0283638 3300048909 Bacteria 1327
1963 Ga0496106_0325348 3300048909 Bacteria 1234
1964 Ga0496106_0663760 3300048909 Bacteria 832
1965 Ga0496107_0023356 3300048910 Bacteria 4373
1966 Ga0496107_0114465 3300048910 Bacteria 1984
1967 Ga0496107_0358940 3300048910 Bacteria 1084
1968 Ga0496107_0424302 3300048910 Bacteria 989
1969 Ga0496107_0462972 3300048910 Bacteria 941
1970 Ga0496107_1170906 3300048910 Bacteria 553
1971 Ga0496108_0024232 3300048911 Bacteria 4997
1972 Ga0496108_0448377 3300048911 Bacteria 1127
1973 Ga0496108_0664557 3300048911 Bacteria 905
1974 Ga0496108_0992952 3300048911 Bacteria 717
1975 Ga0496109_0133179 3300048912 Bacteria 2321
1976 Ga0496109_0984215 3300048912 Bacteria 781
1977 Ga0496110_0137215 3300048913 Bacteria 2211
1978 Ga0496110_0711128 3300048913 Bacteria 906
1979 Ga0496111_0198780 3300048914 Bacteria 1490
1980 Ga0496111_0373526 3300048914 Bacteria 1055
1981 Ga0496111_0413525 3300048914 Bacteria 996
1982 Ga0496111_1218834 3300048914 Bacteria 533
1983 Ga0496112_0005841 3300048915 Bacteria 10715
1984 Ga0496112_0164242 3300048915 Bacteria 2186
1985 Ga0496112_0346973 3300048915 Bacteria 1427
1986 Ga0496112_1111606 3300048915 Bacteria 708
1987 Ga0496113_0147492 3300048916 Bacteria 1854
1988 Ga0496114_0106830 3300048917 Bacteria 2395
1989 Ga0496114_0113531 3300048917 Bacteria 2322
1990 Ga0496114_0273592 3300048917 Bacteria 1488
1991 Ga0496114_0288596 3300048917 Bacteria 1447
1992 Ga0496114_1053278 3300048917 Bacteria 697
1993 Ga0496115_0001055 3300048918 Bacteria 19985
1994 Ga0496115_0276137 3300048918 Bacteria 1380
1995 Ga0496115_0663026 3300048918 Bacteria 823
1996 Ga0496115_0665170 3300048918 Bacteria 822
1997 Ga0496115_0856686 3300048918 Bacteria 703
1998 Ga0496116_0069056 3300048919 Bacteria 2249
1999 Ga0496116_0088689 3300048919 Bacteria 1889
2000 Ga0496116_0121005 3300048919 Bacteria 1515
2001 Ga0496116_0170227 3300048919 Bacteria 1181
2002 Ga0496117_0000001 3300048920 Bacteria 2526244
2003 Ga0496117_0001602 3300048920 Bacteria 32006
2004 Ga0496117_0030143 3300048920 Bacteria 4168
2005 Ga0496118_0000002 3300048921 Bacteria 1690764
2006 Ga0496118_0004742 3300048921 Bacteria 15913
2007 Ga0496118_0030437 3300048921 Bacteria 4504
2008 Ga0496118_0485019 3300048921 Bacteria 619
2009 Ga0496119_0124513 3300048922 Bacteria 1412
2010 Ga0496119_0332915 3300048922 Bacteria 740
2011 Ga0496120_0087336 3300048923 Bacteria 1674
2012 Ga0496121_0000001 3300048924 Bacteria 1830318
2013 Ga0496121_0015019 3300048924 Bacteria 8151
2014 Ga0496121_0030639 3300048924 Bacteria 4936
2015 Ga0496121_0099689 3300048924 Bacteria 2244
2016 Ga0496121_0186736 3300048924 Bacteria 1490
2017 Ga0496121_0267654 3300048924 Bacteria 1176
2018 Ga0496122_0138190 3300048925 Bacteria 1530
2019 Ga0496122_0158809 3300048925 Bacteria 1382
2020 Ga0496122_0202223 3300048925 Bacteria 1160
2021 Ga0496122_0301213 3300048925 Bacteria 864
2022 Ga0496123_0013346 3300048926 Bacteria 6906
2023 Ga0496123_0018581 3300048926 Bacteria 5520
2024 Ga0496123_0264373 3300048926 Bacteria 841
2025 Ga0496124_0009480 3300048927 Bacteria 10025
2026 Ga0496124_0028304 3300048927 Bacteria 5015
2027 Ga0496124_0034796 3300048927 Bacteria 4414
2028 Ga0496124_0127088 3300048927 Bacteria 2029
2029 Ga0496124_0161584 3300048927 Bacteria 1745
2030 Ga0496124_0179046 3300048927 Bacteria 1633
2031 Ga0496124_0208501 3300048927 Bacteria 1480
2032 Ga0496124_0311278 3300048927 Bacteria 1132
2033 Ga0496124_0680300 3300048927 Bacteria 655
2034 Ga0496124_0767445 3300048927 Bacteria 602
2035 Ga0496125_0000001 3300048928 Bacteria 1766138
2036 Ga0496125_0014630 3300048928 Bacteria 7628
2037 Ga0496126_0000034 3300048929 Bacteria 362440
2038 Ga0496126_0014001 3300048929 Bacteria 8128
2039 Ga0496126_0452947 3300048929 Bacteria 1032
2040 Ga0496126_0510864 3300048929 Bacteria 959
2041 Ga0496126_0555819 3300048929 Bacteria 910
2042 Ga0496126_0625220 3300048929 Bacteria 846
2043 Ga0496126_0691004 3300048929 Bacteria 794
2044 Ga0466983_0814339 3300048986 Bacteria 564
2045 Ga0501306_023443 3300049127 Bacteria 876
2046 Ga0501306_094074 3300049127 Bacteria 530
2047 Ga0501308_000043 3300049128 Bacteria 5019
2048 Ga0501308_004623 3300049128 Bacteria 1336
2049 Ga0501309_002926 3300049129 Bacteria 1894
2050 Ga0501309_010747 3300049129 Bacteria 1184
2051 Ga0501310_000314 3300049130 Bacteria 4465
2052 Ga0501310_023165 3300049130 Bacteria 788
2053 Ga0501304_000103 3300049160 Bacteria 3162
2054 Ga0501304_010860 3300049160 Bacteria 801
2055 Ga0501307_004362 3300049162 Bacteria 1439
2056 Ga0501307_009157 3300049162 Bacteria 1128
2057 Ga0501307_013604 3300049162 Bacteria 984
2058 Ga0495678_000128 3300049459 Bacteria 89099
2059 Ga0495678_004908 3300049459 Bacteria 7558
2060 Ga0495678_009158 3300049459 Bacteria 4928
2061 Ga0495678_017087 3300049459 Bacteria 3297
2062 Ga0495678_022689 3300049459 Bacteria 2740
2063 Ga0495678_025494 3300049459 Bacteria 2537
2064 Ga0495678_067621 3300049459 Bacteria 1319
2065 Ga0495682_0007646 3300049460 Bacteria 4288
2066 Ga0495682_0046808 3300049460 Bacteria 1578
2067 Ga0495682_0059187 3300049460 Bacteria 1384
2068 Ga0495682_0315331 3300049460 Bacteria 551
2069 Ga0501291_052603 3300049514 Bacteria 746
2070 Ga0501298_097590 3300049521 Bacteria 666
2071 Ga0501299_014456 3300049522 Bacteria 1374
2072 Ga0501303_009692 3300049526 Bacteria 893
2073 Ga0501311_001467 3300049527 Bacteria 2058
2074 Ga0501311_005169 3300049527 Bacteria 1420
2075 Ga0501311_104620 3300049527 Bacteria 504
2076 Ga0501312_015087 3300049528 Bacteria 1093
2077 Ga0501312_107741 3300049528 Bacteria 529
2078 Ga0501313_006566 3300049529 Bacteria 1263
2079 Ga0501314_013894 3300049530 Bacteria 784
2080 Ga0501315_003168 3300049531 Bacteria 1624
2081 Ga0501315_008242 3300049531 Bacteria 1207
2082 Ga0501315_018201 3300049531 Bacteria 925
2083 Ga0501315_058801 3300049531 Bacteria 618
2084 Ga0501316_002918 3300049532 Bacteria 1624
2085 Ga0501316_003463 3300049532 Bacteria 1535
2086 Ga0501318_007306 3300049534 Bacteria 1151
2087 Ga0501319_021994 3300049535 Bacteria 577
2088 Ga0501320_010242 3300049536 Bacteria 952
2089 Ga0501320_019732 3300049536 Bacteria 771
2090 Ga0501320_021934 3300049536 Bacteria 745
2091 Ga0501321_007332 3300049537 Bacteria 1143
2092 Ga0501322_001671 3300049538 Bacteria 1281
2093 Ga0501322_017103 3300049538 Bacteria 612
2094 Ga0501323_002866 3300049539 Bacteria 1715
2095 Ga0501323_013157 3300049539 Bacteria 1020
2096 Ga0501323_043258 3300049539 Bacteria 666
2097 Ga0501324_004785 3300049540 Bacteria 1090
2098 Ga0501325_017223 3300049541 Bacteria 730
2099 Ga0501326_02490 3300049542 Bacteria 909
2100 Ga0501326_09563 3300049542 Bacteria 574
2101 Ga0501335_006342 3300049551 Bacteria 1076
2102 Ga0501031_0047354 3300049568 Bacteria 2803
2103 Ga0501032_0088596 3300049569 Bacteria 2055
2104 Ga0501033_0002051 3300049570 Bacteria 17522
2105 Ga0501034_0005225 3300049571 Bacteria 14241
2106 Ga0501036_0003558 3300049572 Bacteria 12457
2107 Ga0501036_0371290 3300049572 Bacteria 1194
2108 Ga0501036_0714024 3300049572 Bacteria 828
2109 Ga0501036_1385522 3300049572 Bacteria 570
2110 Ga0501037_0019590 3300049573 Bacteria 4993
2111 Ga0501037_0292291 3300049573 Bacteria 1133
2112 Ga0501038_0000564 3300049574 Bacteria 32743
2113 Ga0501038_0758494 3300049574 Bacteria 723
2114 Ga0501039_0000137 3300049575 Bacteria 50348
2115 Ga0501039_0024770 3300049575 Bacteria 4610
2116 Ga0501039_0396181 3300049575 Bacteria 1084
2117 Ga0501039_0861283 3300049575 Bacteria 706
2118 Ga0501040_0000301 3300049576 Bacteria 28846
2119 Ga0501040_0152623 3300049576 Bacteria 1630
2120 Ga0501040_0613662 3300049576 Bacteria 786
2121 Ga0501040_0638417 3300049576 Bacteria 769
2122 Ga0501041_0000043 3300049577 Bacteria 43612
2123 Ga0501041_0047018 3300049577 Bacteria 2626
2124 Ga0501041_0241653 3300049577 Bacteria 1135
2125 Ga0501042_0000604 3300049578 Bacteria 19154
2126 Ga0501042_0263106 3300049578 Bacteria 1245
2127 Ga0501042_0525467 3300049578 Bacteria 860
2128 Ga0501042_1052716 3300049578 Bacteria 593
2129 Ga0501043_0425944 3300049579 Bacteria 1000
2130 Ga0501043_1263034 3300049579 Bacteria 516
2131 Ga0501046_0000328 3300049580 Bacteria 47729
2132 Ga0501046_0707038 3300049580 Bacteria 710
2133 Ga0501048_0001946 3300049582 Bacteria 15680
2134 Ga0501048_0069740 3300049582 Bacteria 2483
2135 Ga0501048_0212479 3300049582 Bacteria 1372
2136 Ga0501048_0333054 3300049582 Bacteria 1082
2137 Ga0501068_0008756 3300049584 Bacteria 5647
2138 Ga0501068_0321198 3300049584 Bacteria 992
2139 Ga0501069_0673430 3300049585 Bacteria 623
2140 Ga0501069_0914522 3300049585 Bacteria 534
2141 Ga0501069_1004263 3300049585 Bacteria 510
2142 Ga0501070_0191012 3300049586 Bacteria 1683
2143 Ga0501070_0312293 3300049586 Bacteria 1279
2144 Ga0501070_0895039 3300049586 Bacteria 693
2145 Ga0501070_1360618 3300049586 Bacteria 540
2146 Ga0501071_0017983 3300049587 Bacteria 4888
2147 Ga0501071_1201881 3300049587 Bacteria 586
2148 Ga0501072_0000555 3300049588 Bacteria 26861
2149 Ga0501072_0002944 3300049588 Bacteria 12813
2150 Ga0501072_0204103 3300049588 Bacteria 1576
2151 Ga0501072_0451307 3300049588 Bacteria 1018
2152 Ga0501073_0000117 3300049589 Bacteria 50986
2153 Ga0501073_0630446 3300049589 Bacteria 740
2154 Ga0501073_0994509 3300049589 Bacteria 577
2155 Ga0501074_0011250 3300049590 Bacteria 6504
2156 Ga0501074_0315689 3300049590 Bacteria 1110
2157 Ga0501074_0493033 3300049590 Bacteria 868
2158 Ga0501075_0003437 3300049591 Bacteria 10600
2159 Ga0501075_0062124 3300049591 Bacteria 2816
2160 Ga0501076_0000284 3300049592 Bacteria 31537
2161 Ga0501076_0218443 3300049592 Bacteria 1558
2162 Ga0501076_1698990 3300049592 Bacteria 518
2163 Ga0501077_0000236 3300049593 Bacteria 32672
2164 Ga0501077_0715745 3300049593 Bacteria 643
2165 Ga0501202_170050 3300049652 Bacteria 582
2166 Ga0501227_003010 3300049665 Bacteria 3681
2167 Ga0501238_000630 3300049671 Bacteria 4007
2168 Ga0501249_020941 3300049679 Bacteria 1425
2169 Ga0501253_051963 3300049683 Bacteria 861
2170 Ga0501257_037433 3300049686 Bacteria 1183
2171 Ga0501079_0005362 3300049741 Bacteria 9549
2172 Ga0501079_0014496 3300049741 Bacteria 6011
2173 Ga0501079_0495653 3300049741 Bacteria 960
2174 Ga0501080_0000743 3300049742 Bacteria 26380
2175 Ga0501080_0267888 3300049742 Bacteria 1555
2176 Ga0501080_0663173 3300049742 Bacteria 922
2177 Ga0501080_0678475 3300049742 Bacteria 910
2178 Ga0501080_1080765 3300049742 Bacteria 693
2179 Ga0501081_0000621 3300049743 Bacteria 20225
2180 Ga0501083_0522610 3300049744 Bacteria 772
2181 Ga0501083_0523133 3300049744 Bacteria 772
2182 Ga0501241_038231 3300049758 Bacteria 924
2183 Ga0501269_000234 3300049766 Bacteria 16178
2184 Ga0501279_012469 3300049775 Bacteria 1156
2185 Ga0501279_021347 3300049775 Bacteria 924
2186 Ga0501280_000570 3300049776 Bacteria 8565
2187 Ga0501035_0147039 3300049822 Bacteria 2046
2188 Ga0501035_0216993 3300049822 Bacteria 1635
2189 Ga0501035_0306964 3300049822 Bacteria 1336
2190 Ga0501035_0873524 3300049822 Bacteria 714
2191 Ga0501035_1040808 3300049822 Bacteria 642
2192 Ga0501045_0018761 3300049824 Bacteria 4923
2193 nmdc:mga03683_3602_c1 3300050489 Bacteria 5025
2194 nmdc:mga03683_44815_c1 3300050489 Bacteria 1829
2195 nmdc:mga03n38_46902_c1 3300050490 Bacteria 1910
2196 nmdc:mga00v17_242948_c1 3300050491 Bacteria 1168
2197 nmdc:mga00v17_55062_c1 3300050491 Bacteria 2428
2198 nmdc:mga00v17_68635_c1 3300050491 Bacteria 2192
2199 nmdc:mga0yw44_187786_c1 3300050492 Bacteria 1362
2200 nmdc:mga0k408_1337_c1 3300050493 Bacteria 13338
2201 nmdc:mga0k408_234616_c1 3300050493 Bacteria 1095
2202 nmdc:mga0k408_44254_c1 3300050493 Bacteria 2566
2203 nmdc:mga0k408_729910_c1 3300050493 Bacteria 579
2204 nmdc:mga06z11_27247_c1 3300050494 Bacteria 2731
2205 nmdc:mga06z11_790959_c1 3300050494 Bacteria 578
2206 nmdc:mga04h51_49073_c1 3300050495 Bacteria 1409
2207 nmdc:mga07m45_8520_c1 3300050496 Bacteria 5276
2208 nmdc:mga05p37_114_c1 3300050507 Bacteria 73016
2209 nmdc:mga05p37_1353913_c1 3300050507 Bacteria 721
2210 nmdc:mga05p37_411155_c1 3300050507 Bacteria 1577
2211 nmdc:mga05p37_733178_c1 3300050507 Bacteria 1092
2212 nmdc:mga09592_273648_c1 3300050508 Bacteria 1465
2213 nmdc:mga09592_3662_c1 3300050508 Bacteria 11248
2214 nmdc:mga0qj67_1051544_c1 3300050509 Bacteria 637
2215 nmdc:mga0qj67_210782_c1 3300050509 Bacteria 1578
2216 nmdc:mga0qj67_726061_c1 3300050509 Bacteria 789
2217 nmdc:mga06r32_391648_c1 3300050510 Bacteria 1372
2218 nmdc:mga06r32_97009_c1 3300050510 Bacteria 2888
2219 nmdc:mga08y16_150766_c1 3300050511 Bacteria 2417
2220 nmdc:mga08y16_15466_c1 3300050511 Bacteria 8025
2221 nmdc:mga08y16_54698_c1 3300050511 Bacteria 4171
2222 nmdc:mga08y16_54862_c1 3300050511 Bacteria 4165
2223 nmdc:mga08y16_563594_c1 3300050511 Bacteria 1152
2224 nmdc:mga08y16_67290_c1 3300050511 Bacteria 3737
2225 nmdc:mga0n895_1305518_c1 3300050512 Bacteria 696
2226 nmdc:mga0n895_632826_c1 3300050512 Bacteria 1070
2227 nmdc:mga0n895_9031_c1 3300050512 Bacteria 8694
2228 nmdc:mga0n895_96963_c1 3300050512 Bacteria 2954
2229 nmdc:mga0rr50_2846_c1 3300050513 Bacteria 9838
2230 nmdc:mga0rr50_376197_c1 3300050513 Bacteria 1197
2231 nmdc:mga0rr50_414384_c1 3300050513 Bacteria 1139
2232 nmdc:mga0rr50_688253_c1 3300050513 Bacteria 873
2233 nmdc:mga08x19_19018_c1 3300050514 Bacteria 4212
2234 nmdc:mga08x19_190761_c1 3300050514 Bacteria 1402
2235 nmdc:mga08x19_2760_c1 3300050514 Bacteria 10597
2236 nmdc:mga08x19_299758_c1 3300050514 Bacteria 1116
2237 nmdc:mga0a205_1305498_c1 3300050515 Bacteria 573
2238 nmdc:mga0a205_1465299_c1 3300050515 Bacteria 531
2239 nmdc:mga0a205_215246_c1 3300050515 Bacteria 1808
2240 nmdc:mga0a205_5446_c3 3300050515 Bacteria 4904
2241 nmdc:mga0sz30_22870_c1 3300050516 Bacteria 2539
2242 nmdc:mga0sz30_68027_c1 3300050516 Bacteria 1530
2243 Ga0495601_0015794 3300053077 Bacteria 4569
2244 Ga0495601_0235787 3300053077 Bacteria 1195
2245 Ga0495601_0237000 3300053077 Bacteria 1191
2246 Ga0495612_0148845 3300053078 Bacteria 1018
2247 Ga0495595_0005218 3300053084 Bacteria 5247
2248 Ga0495619_0010461 3300053085 Bacteria 5834
2249 Ga0495619_0098728 3300053085 Bacteria 1985
2250 Ga0500646_0027739 3300053090 Bacteria 1542
2251 Ga0500583_0139275 3300053092 Bacteria 1205
2252 Ga0500566_0348121 3300053094 Bacteria 680
2253 Ga0500566_0463779 3300053094 Bacteria 552
2254 Ga0500650_0126388 3300053098 Bacteria 1190
2255 Ga0500594_0170832 3300053118 Bacteria 706
2256 Ga0500618_001153 3300053125 Bacteria 12820
2257 Ga0500618_014656 3300053125 Bacteria 1997
2258 Ga0500618_026153 3300053125 Bacteria 1394
2259 Ga0500559_0240280 3300053136 Bacteria 854
2260 Ga0500559_0296255 3300053136 Bacteria 760
2261 Ga0500568_0173286 3300053139 Bacteria 794
2262 Ga0500586_051917 3300053145 Bacteria 1415
2263 Ga0500586_104605 3300053145 Bacteria 990
2264 Ga0500604_0067134 3300053151 Bacteria 1137
2265 Ga0500637_0279950 3300053178 Bacteria 919
2266 Ga0500637_0551044 3300053178 Bacteria 558
2267 Ga0500552_019037 3300053733 Bacteria 958
2268 Ga0501084_0013751 3300054114 Bacteria 6698
2269 Ga0501084_0206426 3300054114 Bacteria 1658
2270 Ga0501084_0373441 3300054114 Bacteria 1205
2271 Ga0501084_1135141 3300054114 Bacteria 656
2272 Ga0590071_012073 3300059421 Bacteria 2025
2273 Ga0590074_022298 3300059423 Bacteria 1094
2274 Ga0590075_053262 3300059424 Bacteria 1039
2275 Ga0587066_003481 3300059490 Bacteria 1854
2276 Ga0587066_041096 3300059490 Bacteria 872
2277 Ga0587070_006668 3300059491 Bacteria 1568
2278 Ga0587077_007430 3300059493 Bacteria 1595
2279 Ga0587077_011691 3300059493 Bacteria 1387
2280 Ga0587077_119379 3300059493 Bacteria 656
2281 Ga0587080_003759 3300059503 Bacteria 1918
2282 Ga0587080_093142 3300059503 Bacteria 635
2283 Ga0587083_0025865 3300059505 Bacteria 1129
2284 Ga0587083_0117552 3300059505 Bacteria 683
2285 Ga0587090_019409 3300059510 Bacteria 1048
2286 Ga0587091_049512 3300059511 Bacteria 858
2287 Ga0587098_010079 3300059604 Bacteria 1039
2288 Ga0587106_033341 3300059605 Bacteria 838
2289 Ga0587125_050587 3300059607 Bacteria 585
2290 Ga0587109_123270 3300059624 Bacteria 617
2291 Ga0587067_006206 3300059640 Bacteria 1656
2292 Ga0587068_000149 3300059641 Bacteria 5013
2293 Ga0587068_069828 3300059641 Bacteria 691
2294 Ga0587072_038719 3300059643 Bacteria 919
2295 Ga0587075_054888 3300059644 Bacteria 705
2296 Ga0587076_002189 3300059645 Bacteria 2157
2297 Ga0587079_001531 3300059647 Bacteria 2620
2298 Ga0587102_000546 3300059649 Bacteria 2209
2299 Ga0587105_000829 3300059651 Bacteria 1436
2300 Ga0587107_053588 3300059652 Bacteria 691
2301 Ga0587124_036669 3300059660 Bacteria 560
2302 Ga0587071_012908 3300060344 Bacteria 1432
2303 Ga0587111_0052221 3300060346 Bacteria 906
2304 Ga0587111_0154241 3300060346 Bacteria 619
2305 Ga0501082_0001199 3300060353 Bacteria 22801
2306 Ga0501082_1852334 3300060353 Bacteria 526
2307 Ga0466962_0059050 3300061719 Bacteria 1830
2308 Ga0466962_0069487 3300061719 Bacteria 1682
2309 Ga0530510_0000177 3300061734 Bacteria 38962
2310 Ga0530510_1152037 3300061734 Bacteria 594
2311 2511250887 2511231003 Bacteria 5606035
2312 2513953027 2513237150 Bacteria 6553639
2313 2514043870 2513237165 Bacteria 6771773
2314 2526211213 2526164512 Bacteria 4025691
2315 2550692653 2548876994 Bacteria 4904866
2316 2599738353 2599185239 Bacteria 8686614
2317 2599746475 2599185240 Bacteria 7968121
2318 2600208381 2599185355 Bacteria 7968906
2319 2601667525 2600255292 Bacteria 6300551
2320 2643787150 2643221554 Bacteria 6603920
2321 2643802178 2643221556 Bacteria 7251154
2322 2644215763 2643221638 Bacteria 6579467
2323 2644254240 2643221645 Bacteria 7207331
2324 2644358095 2643221664 Bacteria 7272945
2325 2644475687 2643221684 Bacteria 7145183
2326 2676745341 2675903129 Bacteria 7964495
2327 2723877067 2721755763 Bacteria 4464185
2328 2738741059 2738541280 Bacteria 6630198
2329 2738845518 2738541300 Bacteria 6675882
2330 2739276573 2738543018 Bacteria 6718814
2331 2739345617 2738543030 Bacteria 6719714
2332 2808971981 2808606384 Bacteria 8474373
2333 2808981618 2808606386 Bacteria 4471946
2334 2809006810 2808606390 Bacteria 8476311
2335 2809013948 2808606391 Bacteria 8308166
2336 2809129201 2808606415 Bacteria 4576710
2337 2809145243 2808606418 Bacteria 6724496
2338 2809148821 2808606419 Bacteria 4576925
2339 2819591584 2818991445 Bacteria 4955017
2340 2819633520 2818991452 Bacteria 8442785
2341 2842714226 2842711865 Bacteria 7155354
2342 2852621359 2852618963 Bacteria 4577824
2343 2857551753 2857547612 Bacteria 6179999
2344 2857554307 2857553236 Bacteria 6166726
2345 2857559916 2857558681 Bacteria 6617694
2346 2857578614 2857576091 Bacteria 5465855
2347 2863425695 2863421361 Bacteria 7300805
2348 2870070704 2870068957 Bacteria 8925310
2349 2884812849 2884811622 Bacteria 5552861
2350 2884837394 2884836552 Bacteria 5219991
2351 2884853685 2884852848 Bacteria 5221161
2352 2885085589 2885080285 Bacteria 6355622
2353 2896155198 2896154374 Bacteria 5221518
2354 2904426204 2904424332 Bacteria 7633521
2355 2904483438 2904479285 Bacteria 5073931
2356 2904569900 2904564687 Bacteria 7609577
2357 2904577080 2904571731 Bacteria 7608790
2358 2919478573 2919476304 Bacteria 5888696
2359 2928161639 2928157003 Bacteria 7522202
2360 2928168467 2928163908 Bacteria 7561269
2361 2928174806 2928170801 Bacteria 8785406
2362 2928542470 2928536128 Bacteria 7657547
2363 2932411136 2932410948 Bacteria 6312192
2364 2932419297 2932416698 Bacteria 6315112
2365 2981993627 2981990288 Bacteria 7590678
2366 642415144 641736154 Bacteria 7689995
2367 644747359 644736347 Bacteria 6476522
2368 8018850889 8018845410 Bacteria 8933938
2369 8020940982 8020938398 Bacteria 7472757
2370 8020952343 8020945358 Bacteria 8467355
2371 8020958404 8020953355 Bacteria 7439080
2372 8021125189 8021120328 Bacteria 8782274
2373 8039103490 8039098773 Bacteria 6602928
2374 8047673970 8047673197 Bacteria 7395230
2375 Ga0501069_0190746
2376 JGI24736J21556_1005532
2377 JGI24736J21556_1030490
2378 JGI24739J22299_10075201
2379 JGI24739J22299_10090660
2380 JGI24739J22299_10093162
2381 JGI24739J22299_10150065
2382 JGI24737J22298_10021955
2383 JGI24735J21928_10004761
2384 JGI24735J21928_10045752
2385 JGI24742J22300_10040961
2386 JGI25155J39150_1000720
2387 JGI25155J39150_1000725
2388 JGI25156J39149_1000539
2389 JGI25156J39149_1003832
2390 JGI25162J39368_1003949
2391 JGI25154J39366_1000471
2392 JGI25154J39366_1001331
2393 JGI25154J39366_1001346
2394 JGI25158J39367_1000859
2395 JGI25157J39369_1000359
2396 JGI25152J39213_1038240
2397 JGI25150J39212_1002919
2398 JGI25159J45721_1001302
2399 Ga0006759J45824_1073084
2400 JGI25151J46595_10015102
2401 JGI25153J46596_10039306
2402 JGI25153J46596_10041657
2403 rootL2_10035855
2404 JGI25160J50197_1010821
2405 Ga0007417J51691_1052140
2406 Ga0007410J51695_1037975
2407 Ga0007409J51694_1013012
2408 Ga0007409J51694_1026750
2409 Ga0007416J51690_1021228
2410 Ga0032354_1056868
2411 Ga0055532_1000023
2412 Ga0055532_1013264
2413 Ga0055525_1000001
2414 Ga0055527_1006290
2415 Ga0055527_1011250
2416 Ga0055535_1010124
2417 Ga0055535_1016202
2418 Ga0055535_1016203
2419 Ga0055542_1003930
2420 Ga0055542_1004189
2421 Ga0055542_1013692
2422 Ga0055529_1000080
2423 Ga0055529_1006072
2424 Ga0055529_1014636
2425 Ga0055526_1001704
2426 Ga0055526_1002909
2427 Ga0055526_1002911
2428 Ga0055526_1022939
2429 Ga0055537_1000012
2430 Ga0055537_1004026
2431 Ga0055524_1000021
2432 Ga0055524_1010983
2433 Ga0055524_1030369
2434 Ga0055534_1000529
2435 Ga0055528_1000073
2436 Ga0055528_1006103
2437 Ga0055528_1008801
2438 Ga0055528_1011504
2439 Ga0055531_10048281
2440 Ga0055541_1009639
2441 Ga0058692_1005164
2442 Ga0055543_1033000
2443 Ga0065165_1000156
2444 Ga0065165_1034885
2445 Ga0065714_10104740
2446 Ga0065704_10162523
2447 Ga0065704_10492334
2448 Ga0065712_10081344
2449 Ga0065712_10086540
2450 Ga0065715_10126937
2451 Ga0065715_10201625
2452 Ga0065715_10397033
2453 Ga0065707_10105719
2454 Ga0065707_10625010
2455 Ga0070658_10171325
2456 Ga0070658_10514554
2457 Ga0070676_10210673
2458 Ga0070676_10429392
2459 Ga0070676_10945398
2460 Ga0070683_100018665
2461 Ga0070683_100487012
2462 Ga0070690_100001009
2463 Ga0070690_100002775
2464 Ga0070690_100002867
2465 Ga0070690_100377503
2466 Ga0070690_100704220
2467 Ga0070670_100008912
2468 Ga0070670_100806807
2469 Ga0070670_100925450
2470 Ga0070670_101182415
2471 Ga0070677_10085884
2472 Ga0068869_100001595
2473 Ga0068869_100063014
2474 Ga0068869_100094726
2475 Ga0068869_100245546
2476 Ga0068869_100666502
2477 Ga0068869_101319928
2478 Ga0068869_102066678
2479 Ga0070666_10253033
2480 Ga0070666_10426392
2481 Ga0070680_100013746
2482 Ga0070680_100058208
2483 Ga0070680_100202711
2484 Ga0070680_100222721
2485 Ga0070682_100090946
2486 Ga0070682_100216980
2487 Ga0070682_100242388
2488 Ga0070682_100522181
2489 Ga0070682_100791080
2490 Ga0068868_100005336
2491 Ga0068868_100007038
2492 Ga0068868_100238554
2493 Ga0068868_100367190
2494 Ga0068868_100529446
2495 Ga0068868_101477755
2496 Ga0068868_102102863
2497 Ga0070660_100002701
2498 Ga0070660_100149159
2499 Ga0070660_101599813
2500 Ga0070689_100003115
2501 Ga0070689_100005312
2502 Ga0070689_100120991
2503 Ga0070689_100395249
2504 Ga0070689_100835885
2505 Ga0070691_10000927
2506 Ga0070691_10010007
2507 Ga0070691_10489895
2508 Ga0070687_100000367
2509 Ga0070687_100074624
2510 Ga0070687_100175900
2511 Ga0070687_100411817
2512 Ga0070687_100522856
2513 Ga0070687_100765048
2514 Ga0070661_100007249
2515 Ga0070661_100207600
2516 Ga0070692_10000993
2517 Ga0070692_10069478
2518 Ga0070692_10075084
2519 Ga0070692_10095036
2520 Ga0070692_10413409
2521 Ga0070692_10918085
2522 Ga0070692_11249156
2523 Ga0070668_100253113
2524 Ga0070668_101844152
2525 Ga0070669_100034552
2526 Ga0070669_100049156
2527 Ga0070669_100293599
2528 Ga0070675_100039670
2529 Ga0070675_100044347
2530 Ga0070675_100402268
2531 Ga0070675_101066640
2532 Ga0070671_100038050
2533 Ga0070671_100558018
2534 Ga0070671_102096695
2535 Ga0070674_100066570
2536 Ga0070674_100127966
2537 Ga0070674_100164801
2538 Ga0070674_100504462
2539 Ga0070674_101202538
2540 Ga0070674_101901993
2541 Ga0070673_100024655
2542 Ga0070673_100051130
2543 Ga0070673_101339269
2544 Ga0070688_100075036
2545 Ga0070688_100289505
2546 Ga0070688_100432243
2547 Ga0070688_100746052
2548 Ga0070688_101018476
2549 Ga0070659_100000069
2550 Ga0070659_100149269
2551 Ga0070659_100183772
2552 Ga0070667_100051694
2553 Ga0070667_100171074
2554 Ga0070667_100171495
2555 Ga0070703_10040538
2556 Ga0070703_10125036
2557 Ga0070709_10836217
2558 Ga0070709_11208089
2559 Ga0070709_11448720
2560 Ga0070714_100009259
2561 Ga0070713_100000033
2562 Ga0070713_100205825
2563 Ga0070710_10126218
2564 Ga0070701_10010798
2565 Ga0070701_10012435
2566 Ga0070701_10068602
2567 Ga0070701_10101896
2568 Ga0070701_10128394
2569 Ga0070711_100116707
2570 Ga0070711_100143083
2571 Ga0070705_100000337
2572 Ga0070705_100017946
2573 Ga0070705_100019507
2574 Ga0070705_100275503
2575 Ga0070705_100770436
2576 Ga0070705_101185526
2577 Ga0070705_101213804
2578 Ga0070700_100001013
2579 Ga0070700_100003020
2580 Ga0070700_100239557
2581 Ga0070700_100335549
2582 Ga0070700_100598458
2583 Ga0070700_100606317
2584 Ga0070700_101451055
2585 Ga0070694_100001944
2586 Ga0070694_100015443
2587 Ga0070694_100018554
2588 Ga0070694_100182528
2589 Ga0070694_100608694
2590 Ga0070694_101204988
2591 Ga0070708_100038088
2592 Ga0070708_100139816
2593 Ga0070708_101353564
2594 Ga0070663_100000948
2595 Ga0070663_100165072
2596 Ga0070663_100806931
2597 Ga0070663_101234909
2598 Ga0070678_100006957
2599 Ga0070678_100037773
2600 Ga0070678_100093579
2601 Ga0070678_100565762
2602 Ga0070678_100587316
2603 Ga0070678_100771209
2604 Ga0070678_101221283
2605 Ga0070662_100008477
2606 Ga0070662_100599011
2607 Ga0070662_101342092
2608 Ga0070662_101783977
2609 Ga0070662_101834102
2610 Ga0070681_10014534
2611 Ga0070681_10247182
2612 Ga0070681_10337430
2613 Ga0070681_10734325
2614 Ga0070681_11315233
2615 Ga0070681_11441575
2616 Ga0068867_100001711
2617 Ga0068867_100103377
2618 Ga0068867_100103681
2619 Ga0068867_100197805
2620 Ga0068867_100255209
2621 Ga0068867_100277743
2622 Ga0068867_100458482
2623 Ga0068867_100489189
2624 Ga0068867_100585877
2625 Ga0068867_100634421
2626 Ga0068867_101525580
2627 Ga0070685_10002374
2628 Ga0070685_11369508
2629 Ga0070685_11562588
2630 Ga0070706_100039082
2631 Ga0070706_100491786
2632 Ga0070706_100527406
2633 Ga0070707_100082853
2634 Ga0070707_100123962
2635 Ga0070698_100362862
2636 Ga0070698_101359718
2637 Ga0070699_100009169
2638 Ga0070699_100017481
2639 Ga0070699_100357307
2640 Ga0070699_100617587
2641 Ga0070699_100698645
2642 Ga0070699_102212258
2643 Ga0070679_100057970
2644 Ga0070679_100073581
2645 Ga0070679_100477043
2646 Ga0070679_101926360
2647 Ga0070684_100111325
2648 Ga0070684_100504493
2649 Ga0070684_101482983
2650 Ga0070697_100002415
2651 Ga0070697_100109125
2652 Ga0070697_100492962
2653 Ga0070697_100994230
2654 Ga0070697_101204996
2655 Ga0068853_100431783
2656 Ga0070672_100096087
2657 Ga0070672_100454426
2658 Ga0070672_100550151
2659 Ga0070672_100670308
2660 Ga0070672_100686925
2661 Ga0070686_100005023
2662 Ga0070686_100025094
2663 Ga0070686_100058485
2664 Ga0070686_100060262
2665 Ga0070686_101335319
2666 Ga0070686_101508217
2667 Ga0070695_100020705
2668 Ga0070695_100031232
2669 Ga0070695_100277680
2670 Ga0070695_100436886
2671 Ga0070695_101690757
2672 Ga0070696_100006757
2673 Ga0070696_100008352
2674 Ga0070696_100018750
2675 Ga0070696_100031693
2676 Ga0070696_100035629
2677 Ga0070696_100563106
2678 Ga0070696_100586763
2679 Ga0070696_100772219
2680 Ga0070693_100001128
2681 Ga0070693_100035072
2682 Ga0070693_100044381
2683 Ga0070693_100046721
2684 Ga0070693_100413948
2685 Ga0070693_100584035
2686 Ga0070693_101661734
2687 Ga0070665_100004533
2688 Ga0070665_100067776
2689 Ga0070665_100740544
2690 Ga0070704_100002157
2691 Ga0070704_100091407
2692 Ga0070704_100108830
2693 Ga0070704_100255028
2694 Ga0070704_100353296
2695 Ga0070704_100856915
2696 Ga0070704_101168360
2697 Ga0068855_100006293
2698 Ga0068855_100022593
2699 Ga0068855_101499089
2700 Ga0068855_102088925
2701 Ga0068855_102570993
2702 Ga0070664_100121232
2703 Ga0070664_100435723
2704 Ga0070664_101989115
2705 Ga0068857_100716138
2706 Ga0068857_101431922
2707 Ga0068854_100003089
2708 Ga0068854_100039233
2709 Ga0068854_100196663
2710 Ga0068854_101215624
2711 Ga0068854_101847736
2712 Ga0068856_100015760
2713 Ga0068856_100092377
2714 Ga0068856_100910117
2715 Ga0068856_101442387
2716 Ga0070702_100000173
2717 Ga0070702_100000786
2718 Ga0070702_100043672
2719 Ga0070702_100067317
2720 Ga0070702_100148943
2721 Ga0068852_100154774
2722 Ga0068852_100434550
2723 Ga0068852_100815903
2724 Ga0068852_100898805
2725 Ga0068859_100001101
2726 Ga0068859_100026412
2727 Ga0068859_101033390
2728 Ga0068859_102739600
2729 Ga0068864_100001698
2730 Ga0068864_100011774
2731 Ga0068864_100054311
2732 Ga0068866_10003479
2733 Ga0068866_10475879
2734 Ga0068861_100002373
2735 Ga0068861_100011414
2736 Ga0068861_100809863
2737 Ga0068861_100875968
2738 Ga0068851_10074453
2739 Ga0068851_10640704
2740 Ga0068870_10020158
2741 Ga0068870_10076877
2742 Ga0068870_10101667
2743 Ga0068870_10204282
2744 Ga0068870_10292158
2745 Ga0068870_10298042
2746 Ga0068863_100001850
2747 Ga0068863_100010828
2748 Ga0068863_100963914
2749 Ga0068858_100001448
2750 Ga0068858_100002333
2751 Ga0068858_100085925
2752 Ga0068858_100504148
2753 Ga0068858_100926275
2754 Ga0068860_100012728
2755 Ga0068860_100021165
2756 Ga0068860_100090825
2757 Ga0068860_100272407
2758 Ga0068860_100339252
2759 Ga0068860_101139523
2760 Ga0068862_100010175
2761 Ga0068862_100282036
2762 Ga0068862_100780673
2763 Ga0068862_101169866
2764 Ga0068862_101370799
2765 Ga0081455_10185826
2766 Ga0070717_10054394
2767 Ga0070717_11706388
2768 Ga0075368_10000736
2769 Ga0075368_10412859
2770 Ga0075363_100007656
2771 Ga0075364_10053044
2772 Ga0075364_10274581
2773 Ga0070715_10001565
2774 Ga0070715_10394870
2775 Ga0070715_10441151
2776 Ga0070716_100203858
2777 Ga0070716_100631682
2778 Ga0070716_100797665
2779 Ga0070712_100039099
2780 Ga0070712_100578365
2781 Ga0070712_100608067
2782 Ga0070712_101257228
2783 Ga0075362_10007883
2784 Ga0075362_10069337
2785 Ga0075362_10366639
2786 Ga0075367_10365613
2787 Ga0075367_10739734
2788 Ga0075367_10905519
2789 Ga0075369_10016462
2790 Ga0075369_10062872
2791 Ga0075366_10039997
2792 Ga0075366_10041485
2793 Ga0075366_10112375
2794 Ga0075366_10478935
2795 Ga0097621_100001873
2796 Ga0097621_100029495
2797 Ga0097621_100201076
2798 Ga0097621_100316444
2799 Ga0097621_100632032
2800 Ga0097621_100932336
2801 Ga0075370_10011662
2802 Ga0075370_10311672
2803 Ga0075370_10818962
2804 Ga0068871_100000683
2805 Ga0068871_100004579
2806 Ga0068871_100005465
2807 Ga0068871_100094806
2808 Ga0068871_100119439
2809 Ga0068871_100187842
2810 Ga0068871_100456051
2811 Ga0068871_100520904
2812 Ga0068871_100739142
2813 Ga0075428_100000739
2814 Ga0075428_100031700
2815 Ga0075428_101054364
2816 Ga0075430_100049871
2817 Ga0075430_100388341
2818 Ga0075431_100076505
2819 Ga0075431_100489816
2820 Ga0075433_10005869
2821 Ga0075433_10331567
2822 Ga0075434_100001032
2823 Ga0075434_100032843
2824 Ga0075434_100595219
2825 Ga0075434_101803666
2826 Ga0075429_100006847
2827 Ga0068865_100000525
2828 Ga0068865_100008874
2829 Ga0068865_100040838
2830 Ga0068865_100142185
2831 Ga0068865_100145376
2832 Ga0068865_100253997
2833 Ga0068865_101792555
2834 Ga0075436_100000593
2835 Ga0075436_100004032
2836 Ga0075436_100100551
2837 Ga0075436_100193939
2838 Ga0075436_100343477
2839 Ga0097620_100001101
2840 Ga0097620_100026411
2841 Ga0097620_101033401
2842 Ga0097620_102739579
2843 Ga0079104_1007537
2844 Ga0079104_1073049
2845 Ga0099826_10000002
2846 Ga0075435_100001154
2847 Ga0075435_100136269
2848 Ga0075435_100704185
2849 Ga0075435_100998947
2850 Ga0075435_101196417
2851 Ga0099794_10008812
2852 Ga0099794_10014278
2853 Ga0105244_10002910
2854 Ga0105244_10026470
2855 Ga0105244_10074139
2856 Ga0105244_10080953
2857 Ga0105250_10012744
2858 Ga0105250_10471920
2859 Ga0105240_10059642
2860 Ga0105240_10440776
2861 Ga0105240_10544914
2862 Ga0105240_10813815
2863 Ga0111539_10016757
2864 Ga0111539_10035731
2865 Ga0111539_10067447
2866 Ga0111539_10190070
2867 Ga0111539_10449066
2868 Ga0111539_10614705
2869 Ga0111539_11647413
2870 Ga0105245_10000207
2871 Ga0105245_10002185
2872 Ga0105245_10009972
2873 Ga0105245_10047291
2874 Ga0105245_10065006
2875 Ga0105245_10296783
2876 Ga0105245_10600671
2877 Ga0105245_11851361
2878 Ga0105247_10854581
2879 Ga0114129_10002453
2880 Ga0114129_12058377
2881 Ga0114129_13007808
2882 Ga0114129_13442050
2883 Ga0105243_10002103
2884 Ga0105243_10034302
2885 Ga0105243_10229178
2886 Ga0105243_10240291
2887 Ga0105243_10273712
2888 Ga0105243_10488771
2889 Ga0105243_10526241
2890 Ga0105241_10027264
2891 Ga0105241_10084895
2892 Ga0105241_10215242
2893 Ga0105241_10352599
2894 Ga0105241_10426444
2895 Ga0105241_11632607
2896 Ga0105242_10003926
2897 Ga0105242_10028574
2898 Ga0105242_10029121
2899 Ga0105242_10078387
2900 Ga0105242_10135719
2901 Ga0105242_10211028
2902 Ga0105242_10246046
2903 Ga0105242_10288371
2904 Ga0105242_10550654
2905 Ga0105242_10705721
2906 Ga0105242_10793245
2907 Ga0105242_10959647
2908 Ga0105248_10074665
2909 Ga0105248_10487409
2910 Ga0105237_10237724
2911 Ga0105237_10422571
2912 Ga0105237_11492344
2913 Ga0105237_11696217
2914 Ga0105237_11992775
2915 Ga0105238_10014457
2916 Ga0105238_10166660
2917 Ga0105238_10324128
2918 Ga0105238_10800005
2919 Ga0105238_11324159
2920 Ga0105249_10501152
2921 Ga0105249_10509420
2922 Ga0105249_10691656
2923 Ga0105249_11224652
2924 Ga0105249_11350139
2925 Ga0105249_12279995
2926 Ga0105239_10009227
2927 Ga0105239_10243567
2928 Ga0105239_10774454
2929 Ga0105239_12934718
2930 Ga0105246_10142109
2931 Ga0105246_10161956
2932 Ga0105246_10267141
2933 Ga0105246_11016956
2934 Ga0105246_11041241
2935 Ga0105246_11226184
2936 Ga0105246_11243297
2937 Ga0157341_1002745
2938 Ga0157347_1033888
2939 Ga0157327_1012740
2940 Ga0157373_10088518
2941 Ga0157373_10263286
2942 Ga0157373_10486590
2943 Ga0157373_10579918
2944 Ga0157373_10965097
2945 Ga0157373_11355520
2946 Ga0157371_10049583
2947 Ga0157371_10502672
2948 Ga0157371_10888147
2949 Ga0157371_11236536
2950 Ga0157370_10062393
2951 Ga0157370_10286291
2952 Ga0157369_10137815
2953 Ga0157369_10838119
2954 Ga0157374_10373902
2955 Ga0157374_10378539
2956 Ga0157374_10823628
2957 Ga0157378_10001175
2958 Ga0157378_10099224
2959 Ga0157378_10622956
2960 Ga0163162_10082727
2961 Ga0163162_10161956
2962 Ga0163162_10335810
2963 Ga0163162_10344066
2964 Ga0163162_10413738
2965 Ga0163162_10544677
2966 Ga0157372_10149662
2967 Ga0157372_10157848
2968 Ga0157372_11084170
2969 Ga0157372_11114294
2970 Ga0157372_11384010
2971 Ga0157375_10047744
2972 Ga0157375_10308546
2973 Ga0157375_10729740
2974 Ga0157375_11469622
2975 Ga0163163_10009593
2976 Ga0163163_10019560
2977 Ga0163163_10846802
2978 Ga0163163_12237882
2979 Ga0157380_10022168
2980 Ga0157380_10533822
2981 Ga0157380_10690874
2982 Ga0157380_10828368
2983 Ga0182008_10001210
2984 Ga0182008_10160810
2985 Ga0157377_10111584
2986 Ga0157377_10269917
2987 Ga0157377_10420019
2988 Ga0157379_10006994
2989 Ga0157379_10361025
2990 Ga0157379_10413899
2991 Ga0157379_10760102
2992 Ga0157379_10793644
2993 Ga0157379_11010040
2994 Ga0157376_10041180
2995 Ga0157376_10044345
2996 Ga0157376_10071273
2997 Ga0157376_10368791
2998 Ga0157376_10440993
2999 Ga0157376_10776137
3000 Ga0157376_12141178
3001 Ga0182006_1000002
3002 Ga0182006_1000026
3003 Ga0182006_1037733
3004 Ga0182006_1068722
3005 Ga0182006_1145629
3006 Ga0182006_1241352
3007 Ga0182007_10000159
3008 Ga0182007_10024981
3009 Ga0182007_10080783
3010 Ga0182007_10082433
3011 Ga0182005_1000002
3012 Ga0182005_1000007
3013 Ga0182005_1020747
3014 Ga0163161_10021691
3015 Ga0163161_10045173
3016 Ga0163161_10047644
3017 Ga0163161_10174521
3018 Ga0163161_11853290
3019 Ga0206351_10512431
3020 Ga0206350_10748337
3021 Ga0154015_1698159
3022 Ga0213872_10000028
3023 Ga0213872_10000921
3024 Ga0213872_10097561
3025 Ga0213872_10255684
3026 Ga0213876_10330753
3027 Ga0209435_100013
3028 Ga0209435_100862
3029 Ga0209436_100857
3030 Ga0209566_100521
3031 Ga0209674_109866
3032 Ga0209672_100033
3033 Ga0209672_100114
3034 Ga0209147_100030
3035 Ga0209147_100161
3036 Ga0209147_100390
3037 Ga0209147_110450
3038 Ga0209563_100007
3039 Ga0209258_100100
3040 Ga0209258_100205
3041 Ga0209258_100263
3042 Ga0207425_1000001
3043 Ga0207425_1000143
3044 Ga0209646_1000010
3045 Ga0209646_1000034
3046 Ga0209646_1000135
3047 Ga0209026_1000022
3048 Ga0209026_1004343
3049 Ga0209026_1007871
3050 Ga0209677_102467
3051 Ga0209148_1000432
3052 Ga0209148_1001082
3053 Ga0209148_1001416
3054 Ga0209148_1016550
3055 Ga0209148_1030510
3056 Ga0209759_1000018
3057 Ga0209759_1000133
3058 Ga0209759_1000890
3059 Ga0209129_1000001
3060 Ga0209233_1090303
3061 Ga0209565_1000057
3062 Ga0209565_1001088
3063 Ga0209565_1004368
3064 Ga0209565_1006127
3065 Ga0209455_1000037
3066 Ga0209455_1000192
3067 Ga0209673_1000051
3068 Ga0209673_1000332
3069 Ga0209673_1010506
3070 Ga0209130_1000268
3071 Ga0209130_1004305
3072 Ga0209675_1000027
3073 Ga0209675_1002448
3074 Ga0209675_1048852
3075 Ga0209025_1001845
3076 Ga0209564_1000009
3077 Ga0209564_1000033
3078 Ga0209564_1000094
3079 Ga0209564_1002669
3080 Ga0209564_1003700
3081 Ga0209758_1000073
3082 Ga0209758_1001766
3083 Ga0209050_1000046
3084 Ga0209256_1000044
3085 Ga0209256_1000139
3086 Ga0209256_1003060
3087 Ga0209256_1006799
3088 Ga0207426_1001318
3089 Ga0207426_1030983
3090 Ga0209051_1007011
3091 Ga0209257_1000728
3092 Ga0207697_10039612
3093 Ga0207697_10342404
3094 Ga0207656_10405524
3095 Ga0207696_1022174
3096 Ga0207655_1010587
3097 Ga0207655_1046953
3098 Ga0207655_1096525
3099 Ga0207655_1147135
3100 Ga0207653_10044471
3101 Ga0207653_10056955
3102 Ga0207653_10421718
3103 Ga0207682_10026427
3104 Ga0207682_10104475
3105 Ga0207692_10056492
3106 Ga0207692_10336212
3107 Ga0207642_10047120
3108 Ga0207642_10131008
3109 Ga0207710_10446685
3110 Ga0207688_10108080
3111 Ga0207688_10207192
3112 Ga0207680_10066788
3113 Ga0207680_10411094
3114 Ga0207647_10000981
3115 Ga0207647_10051255
3116 Ga0207647_10749190
3117 Ga0207699_10840643
3118 Ga0207699_11123785
3119 Ga0207645_10122932
3120 Ga0207643_10005920
3121 Ga0207643_10014328
3122 Ga0207643_10067012
3123 Ga0207643_10084057
3124 Ga0207643_10134663
3125 Ga0207643_10969372
3126 Ga0207705_10281000
3127 Ga0207705_10316254
3128 Ga0207684_10279875
3129 Ga0207684_10376536
3130 Ga0207684_10500548
3131 Ga0207654_10030723
3132 Ga0207654_10077230
3133 Ga0207654_10118379
3134 Ga0207654_10360049
3135 Ga0207654_11044637
3136 Ga0207707_10033786
3137 Ga0207707_10053572
3138 Ga0207707_10399872
3139 Ga0207707_10427013
3140 Ga0207695_10001528
3141 Ga0207695_10012279
3142 Ga0207695_10302505
3143 Ga0207695_10361267
3144 Ga0207695_11141749
3145 Ga0207671_10008283
3146 Ga0207693_10001263
3147 Ga0207693_10189721
3148 Ga0207693_10268559
3149 Ga0207693_10944929
3150 Ga0207663_10307781
3151 Ga0207663_10542816
3152 Ga0207660_10047276
3153 Ga0207660_10047629
3154 Ga0207660_10142159
3155 Ga0207660_10180225
3156 Ga0207662_10000577
3157 Ga0207662_10067141
3158 Ga0207662_10128095
3159 Ga0207657_10000068
3160 Ga0207657_10001348
3161 Ga0207657_10184294
3162 Ga0207657_10468472
3163 Ga0207649_10181300
3164 Ga0207649_10640928
3165 Ga0207652_10394896
3166 Ga0207652_11155970
3167 Ga0207646_10075873
3168 Ga0207646_10419930
3169 Ga0207681_10002320
3170 Ga0207681_10021046
3171 Ga0207681_11324076
3172 Ga0207694_10005697
3173 Ga0207694_10173702
3174 Ga0207694_10833845
3175 Ga0207650_10010546
3176 Ga0207650_10726181
3177 Ga0207650_11698397
3178 Ga0207659_10002190
3179 Ga0207659_10073385
3180 Ga0207659_10184790
3181 Ga0207659_10338378
3182 Ga0207659_11574010
3183 Ga0207687_10002891
3184 Ga0207687_10033850
3185 Ga0207687_10061275
3186 Ga0207687_10132207
3187 Ga0207687_10189604
3188 Ga0207700_10000099
3189 Ga0207700_10023848
3190 Ga0207700_10037033
3191 Ga0207664_10000454
3192 Ga0207644_10004698
3193 Ga0207644_10142857
3194 Ga0207644_10443426
3195 Ga0207690_10000027
3196 Ga0207690_10078703
3197 Ga0207706_10006695
3198 Ga0207706_10082422
3199 Ga0207706_10113429
3200 Ga0207706_10372542
3201 Ga0207706_10405415
3202 Ga0207706_10550041
3203 Ga0207686_10000488
3204 Ga0207686_10000586
3205 Ga0207686_10002850
3206 Ga0207686_10149169
3207 Ga0207686_10150170
3208 Ga0207686_10162748
3209 Ga0207686_10325907
3210 Ga0207686_10571203
3211 Ga0207686_10890787
3212 Ga0207686_11728651
3213 Ga0207709_10001240
3214 Ga0207709_10004162
3215 Ga0207709_10055857
3216 Ga0207709_10155586
3217 Ga0207709_10239248
3218 Ga0207709_10332762
3219 Ga0207709_10459528
3220 Ga0207709_10766363
3221 Ga0207709_10801541
3222 Ga0207670_10001102
3223 Ga0207670_10021580
3224 Ga0207670_10149171
3225 Ga0207670_10627845
3226 Ga0207670_10836371
3227 Ga0207669_10050794
3228 Ga0207669_10189862
3229 Ga0207669_10258572
3230 Ga0207669_10482318
3231 Ga0207704_10000475
3232 Ga0207704_10160498
3233 Ga0207704_10218818
3234 Ga0207704_11061273
3235 Ga0207665_10014048
3236 Ga0207665_10455767
3237 Ga0207691_10062473
3238 Ga0207691_10082111
3239 Ga0207691_10106456
3240 Ga0207691_10232780
3241 Ga0207691_10546899
3242 Ga0207711_10001033
3243 Ga0207711_10309689
3244 Ga0207711_11138565
3245 Ga0207711_11986836
3246 Ga0207689_10000384
3247 Ga0207689_10000808
3248 Ga0207689_10029109
3249 Ga0207689_10058383
3250 Ga0207689_10058570
3251 Ga0207689_10615687
3252 Ga0207689_10666864
3253 Ga0207661_10567734
3254 Ga0207661_10811040
3255 Ga0207679_10115933
3256 Ga0207679_10441804
3257 Ga0207679_11268919
3258 Ga0207667_10039769
3259 Ga0207667_10062976
3260 Ga0207667_10071588
3261 Ga0207667_11268120
3262 Ga0207667_11519163
3263 Ga0207651_10003957
3264 Ga0207651_10015772
3265 Ga0207651_10667491
3266 Ga0207712_10022912
3267 Ga0207712_10228310
3268 Ga0207712_10306446
3269 Ga0207712_10388700
3270 Ga0207712_10497804
3271 Ga0207668_10181985
3272 Ga0207668_10229957
3273 Ga0207668_10258472
3274 Ga0207668_10755003
3275 Ga0207640_10029906
3276 Ga0207640_10295906
3277 Ga0207640_10909140
3278 Ga0207658_10032488
3279 Ga0207658_10173117
3280 Ga0207658_10210850
3281 Ga0207677_10002051
3282 Ga0207677_10159068
3283 Ga0207677_10281942
3284 Ga0207677_10524577
3285 Ga0207677_11210109
3286 Ga0207703_10001476
3287 Ga0207703_10001709
3288 Ga0207703_11300927
3289 Ga0207639_10423545
3290 Ga0207639_10708266
3291 Ga0207639_11062049
3292 Ga0207639_11699868
3293 Ga0207678_10002813
3294 Ga0207678_10057117
3295 Ga0207678_10059618
3296 Ga0207678_10218891
3297 Ga0207678_10877631
3298 Ga0207678_11761218
3299 Ga0207708_10000156
3300 Ga0207708_10007769
3301 Ga0207708_10050862
3302 Ga0207708_10459646
3303 Ga0207708_10544887
3304 Ga0207708_10775684
3305 Ga0207702_10014860
3306 Ga0207702_10362633
3307 Ga0207702_10417239
3308 Ga0207702_10573009
3309 Ga0207702_10881170
3310 Ga0207702_11101363
3311 Ga0207702_11531296
3312 Ga0207702_12173321
3313 Ga0207641_10016890
3314 Ga0207641_10339069
3315 Ga0207641_10982728
3316 Ga0207648_10000128
3317 Ga0207648_10002472
3318 Ga0207648_10005495
3319 Ga0207648_10025971
3320 Ga0207648_10259915
3321 Ga0207648_10434447
3322 Ga0207648_10609220
3323 Ga0207648_11291970
3324 Ga0207648_11879985
3325 Ga0207676_10000174
3326 Ga0207676_10007775
3327 Ga0207676_11062734
3328 Ga0207674_10005547
3329 Ga0207674_10316922
3330 Ga0207674_10353792
3331 Ga0207675_100000215
3332 Ga0207675_100000408
3333 Ga0207675_100009821
3334 Ga0207675_100165026
3335 Ga0207675_100684500
3336 Ga0207675_101485820
3337 Ga0207683_10001993
3338 Ga0207683_10012879
3339 Ga0207683_10043918
3340 Ga0207683_10173906
3341 Ga0207683_10651065
3342 Ga0207683_10744807
3343 Ga0207698_10254086
3344 Ga0207698_10386136
3345 Ga0207698_10394735
3346 Ga0207698_10935404
3347 Ga0207698_11311021
3348 Ga0209281_1012000
3349 Ga0209371_1000448
3350 Ga0209969_1000391
3351 Ga0209967_1000346
3352 Ga0209981_1006208
3353 Ga0209981_1024360
3354 Ga0209996_1014353
3355 Ga0210000_1005995
3356 Ga0210000_1045302
3357 Ga0209995_1004306
3358 Ga0209968_1049772
3359 Ga0209999_1004967
3360 Ga0209999_1009591
3361 Ga0209999_1036179
3362 Ga0209970_1015173
3363 Ga0209983_1016239
3364 Ga0209282_1000001
3365 Ga0209588_1102153
3366 Ga0209588_1130375
3367 Ga0209588_1164561
3368 Ga0209971_1006394
3369 Ga0209971_1171336
3370 Ga0209966_1026619
3371 Ga0209966_1177484
3372 Ga0209998_10045879
3373 Ga0209813_10017820
3374 Ga0209974_10018316
3375 Ga0207428_10004612
3376 Ga0207428_10007629
3377 Ga0207428_10222717
3378 Ga0207428_10228212
3379 Ga0207428_10242943
3380 Ga0207428_10760392
3381 Ga0268266_10008065
3382 Ga0268266_10047065
3383 Ga0268265_10001364
3384 Ga0268265_10002399
3385 Ga0268265_10033020
3386 Ga0268265_10041740
3387 Ga0268265_10867311
3388 Ga0268264_10053808
3389 Ga0268264_10063078
3390 Ga0268264_10421553
3391 Ga0268264_11185149
3392 Ga0268264_12376970
3393 Ga0265324_10000006
3394 Ga0265324_10016237
3395 Ga0268256_1000823
3396 Ga0307511_10000248
3397 Ga0316177_1163550
3398 Ga0314311_1225052
3399 Ga0316179_1096458
3400 Ga0316178_1028413
3401 Ga0316178_1146804
3402 Ga0316178_1169113
3403 Ga0316180_1167461
3404 Ga0316183_1193877
3405 Ga0316182_1436475
3406 Ga0265332_10003769
3407 Ga0265328_10002778
3408 Ga0265328_10007837
3409 Ga0265328_10043022
3410 Ga0265320_10073544
3411 Ga0265325_10000110
3412 Ga0265339_10221934
3413 Ga0265331_10002297
3414 Ga0265331_10002426
3415 Ga0265331_10005458
3416 Ga0265331_10120852
3417 Ga0265327_10000588
3418 Ga0265327_10000809
3419 Ga0265327_10002222
3420 Ga0265327_10045923
3421 Ga0265327_10056979
3422 Ga0265316_10075296
3423 Ga0265316_10101868
3424 Ga0265316_10119684
3425 Ga0307513_11043829
3426 Ga0307509_10536082
3427 Ga0307408_100002707
3428 Ga0307408_100022174
3429 Ga0307408_100103451
3430 Ga0307408_100646686
3431 Ga0307408_100792260
3432 Ga0265313_10168109
3433 Ga0316575_10011355
3434 Ga0265314_10000245
3435 Ga0265314_10009646
3436 Ga0265314_10016544
3437 Ga0265314_10126042
3438 Ga0265342_10473914
3439 Ga0316576_10303711
3440 Ga0316576_10915028
3441 Ga0307516_10755847
3442 Ga0307405_10247730
3443 Ga0307405_10881972
3444 Ga0307518_10117882
3445 Ga0307406_10573976
3446 Ga0307406_10584348
3447 Ga0307406_11398175
3448 Ga0307406_12066410
3449 Ga0307407_11198047
3450 Ga0307412_10965583
3451 Ga0307412_11289824
3452 Ga0307416_100022459
3453 Ga0307416_100667029
3454 Ga0307416_101485459
3455 Ga0307416_102545616
3456 Ga0307414_10030059
3457 Ga0307411_10185351
3458 Ga0307411_11409969
3459 Ga0307411_11426161
3460 Ga0307415_101193524
3461 Ga0307415_101367772
3462 Ga0316583_10062422
3463 Ga0307507_10104184
3464 Ga0373950_0117658
3465 Ga0373929_0086328
3466 Ga0373934_0176786
3467 Ga0373940_0030517
3468 Ga0373944_0001197
3469 Ga0373944_0069188
3470 Ga0373949_0037050
3471 Ga0373949_0135114
3472 Ga0373951_0015446
3473 Ga0373952_0226126
3474 Ga0373952_0294254
3475 Ga0373923_0066800
3476 Ga0373932_0001629
3477 Ga0373932_0130555
3478 Ga0373936_0003926
3479 Ga0373936_0014734
3480 Ga0373936_0110541
3481 Ga0373936_0111839
3482 Ga0373936_0545757
3483 Ga0373939_0041526
3484 Ga0373939_0189054
3485 Ga0373939_0439442
3486 Ga0373941_0076465
3487 Ga0373941_0172249
3488 Ga0373941_0270086
3489 Ga0373945_0025125
3490 Ga0373945_0240091
3491 Ga0373953_0022608
3492 Ga0373953_0054507
3493 Ga0373953_0198630
3494 Ga0373954_0024099
3495 Ga0373954_0345868
3496 Ga0373956_0025761
3497 Ga0373956_0079120
3498 Ga0373956_0109451
3499 Ga0373957_0157691
3500 Ga0373960_0091904
3501 Ga0373943_0021046
3502 Ga0373943_0038187
3503 Ga0373943_0046400
3504 Ga0373943_0138726
3505 Ga0373943_0175304
3506 Ga0373943_0574636
3507 Ga0373946_0074089
3508 Ga0373946_0086439
3509 Ga0373946_0144620
3510 Ga0373946_0187562
3511 Ga0373946_0220506
3512 Ga0373955_0045169
3513 Ga0373955_0144808
3514 Ga0373955_0196502
3515 Ga0373955_0227939
3516 Ga0373955_0310073
3517 Ga0373955_0475990
3518 Ga0373942_0029303
3519 Ga0373942_0092566
3520 Ga0373942_0190317
3521 Ga0373962_0226282
3522 Ga0373962_0243852
3523 Ga0316574_0000854
3524 Ga0316574_0002988
3525 Ga0373924_0043068
3526 Ga0373924_0161259
3527 Ga0373924_0185598
3528 Ga0373924_0388207
3529 Ga0373931_0000424
3530 Ga0373931_0018892
3531 Ga0373931_0109568
3532 Ga0373931_0406430
3533 Ga0373935_0008550
3534 Ga0373935_0027021
3535 Ga0373935_0686211
3536 Ga0373935_0726761
3537 Ga0373935_0863263
3538 Ga0373927_0002911
3539 Ga0373927_0016489
3540 Ga0373927_0017456
3541 Ga0373927_0444198
3542 Ga0373927_0536273
3543 Ga0373933_0005103
3544 Ga0373933_0060834
3545 Ga0373933_0061327
3546 Ga0373933_0236829
3547 Ga0373933_0238831
3548 Ga0373933_0307873
3549 Ga0373933_0890428
3550 Ga0373947_0012180
3551 Ga0373947_0054393
3552 Ga0373947_0187151
3553 Ga0373947_0239003
3554 Ga0373947_0300938
3555 Ga0373947_0525852
3556 Ga0373937_0107343
3557 Ga0373937_0216611
3558 Ga0373937_0487814
3559 Ga0373937_0657684
3560 Ga0373937_0726714
3561 Ga0316582_0162139
3562 Ga0373925_0012636
3563 Ga0373925_0068651
3564 Ga0373925_0074773
3565 Ga0373925_0228787
3566 Ga0373925_0273745
3567 Ga0373925_0293246
3568 Ga0373925_0874968
3569 Ga0395899_0000505
3570 Ga0395899_0003409
3571 Ga0395899_0234206
3572 Ga0395900_0006268
3573 Ga0395900_0206565
3574 Ga0395900_1289413
3575 Ga0395898_0536946
3576 Ga0395898_0946296
3577 Ga0395898_1150299
3578 Ga0395905_0008791
3579 Ga0395905_0067029
3580 Ga0395905_0155785
3581 Ga0395905_0365479
3582 Ga0395905_0467096
3583 Ga0395901_0000182
3584 Ga0395901_0230027
3585 Ga0395901_0346653
3586 Ga0395901_0796187
3587 Ga0395901_0879150
3588 Ga0400490_47983
3589 Ga0242420_095243
3590 Ga0400483_225090
3591 Ga0436365_0581961
3592 Ga0436365_1017355
3593 Ga0436360_0570562
3594 Ga0436360_1263300
3595 Ga0436361_0009988
3596 Ga0436361_0200247
3597 Ga0436361_0514914
3598 Ga0436361_0521959
3599 Ga0436361_0687444
3600 Ga0436361_0928362
3601 Ga0436363_0091266
3602 Ga0436363_0620330
3603 Ga0439461_0012185
3604 Ga0439465_0232265
3605 Ga0451789_1216037
3606 Ga0451797_1582190
3607 Ga0451804_0575511
3608 Ga0451835_0475987
3609 Ga0451839_0318377
3610 Ga0451853_3182744
3611 Ga0439433_0023110
3612 Ga0439433_0099279
3613 Ga0439441_006635
3614 Ga0439441_176546
3615 Ga0439449_0024567
3616 Ga0439450_003397
3617 Ga0439450_212025
3618 Ga0439451_034850
3619 Ga0439454_074802
3620 Ga0450911_025560
3621 Ga0450917_019401
3622 Ga0450897_007065
3623 Ga0450898_018404
3624 Ga0450898_023425
3625 Ga0450904_000933
3626 Ga0439446_0004083
3627 Ga0439458_0010675
3628 Ga0439434_0000207
3629 Ga0439435_0000263
3630 Ga0439435_0002006
3631 Ga0439460_0005416
3632 Ga0439460_0006906
3633 Ga0450893_0007475
3634 Ga0451577_0009550
3635 Ga0451577_0341078
3636 Ga0451577_0387767
3637 Ga0451577_0826646
3638 Ga0466969_0432385
3639 Ga0466972_0000070
3640 Ga0466972_0246959
3641 Ga0466972_0390617
3642 Ga0466982_0359842
3643 Ga0453683_0258207
3644 Ga0453683_0401251
3645 Ga0466965_0006917
3646 Ga0466965_0057320
3647 Ga0466965_0113751
3648 Ga0466965_0282826
3649 Ga0466966_0195263
3650 Ga0466966_0385009
3651 Ga0466961_0157343
3652 Ga0466961_0338418
3653 Ga0466963_0298143
3654 Ga0466964_0019249
3655 Ga0466964_0242455
3656 Ga0453684_0000237
3657 Ga0453684_0796826
3658 Ga0453684_2306124
3659 Ga0466970_0022377
3660 Ga0466970_0114882
3661 Ga0466970_0276104
3662 Ga0466957_0091828
3663 Ga0466960_0180323
3664 Ga0466960_0228618
3665 Ga0466960_0299615
3666 Ga0451576_0000034
3667 Ga0451576_0000906
3668 Ga0451576_0001076
3669 Ga0451576_0002763
3670 Ga0451576_0005425
3671 Ga0451576_0031091
3672 Ga0451576_0038069
3673 Ga0451576_0284224
3674 Ga0451576_0568075
3675 Ga0466958_0138819
3676 Ga0466967_0119186
3677 Ga0495617_000037
3678 Ga0495617_000039
3679 Ga0495617_000940
3680 Ga0495617_029977
3681 Ga0495617_065190
3682 Ga0495617_149382
3683 Ga0495627_000008
3684 Ga0495627_015998
3685 Ga0495627_018004
3686 Ga0495627_020896
3687 Ga0495627_122687
3688 Ga0495592_0051886
3689 Ga0495592_0075221
3690 Ga0495603_0006152
3691 Ga0495603_0043579
3692 Ga0495603_0047463
3693 Ga0495603_0093673
3694 Ga0495603_0152350
3695 Ga0495590_0000089
3696 Ga0495590_0000256
3697 Ga0495590_0002299
3698 Ga0495590_0008133
3699 Ga0495590_0131777
3700 Ga0495629_0142860
3701 Ga0495629_0280428
3702 Ga0495629_0491197
3703 Ga0495629_0555635
3704 Ga0495629_0558981
3705 Ga0495638_0000329
3706 Ga0495638_0010359
3707 Ga0495638_0017274
3708 Ga0495638_0078869
3709 Ga0495638_0161272
3710 Ga0495638_0186403
3711 Ga0495638_0458401
3712 Ga0495641_0057113
3713 Ga0495641_0068108
3714 Ga0495651_0026064
3715 Ga0495651_0248309
3716 Ga0495651_0858063
3717 Ga0495653_0000038
3718 Ga0495653_0021439
3719 Ga0495653_0033733
3720 Ga0495653_0045738
3721 Ga0495653_0062116
3722 Ga0495653_0073237
3723 Ga0495653_0286533
3724 Ga0495653_0659477
3725 Ga0495650_0000048
3726 Ga0495650_0001026
3727 Ga0495650_0003518
3728 Ga0495650_0010456
3729 Ga0495650_0059767
3730 Ga0495650_0059820
3731 Ga0495650_0162181
3732 Ga0495650_0224807
3733 Ga0495580_0002487
3734 Ga0495580_0072315
3735 Ga0495580_0371054
3736 Ga0495580_0420938
3737 Ga0495580_0946361
3738 Ga0495582_0008768
3739 Ga0495582_0009830
3740 Ga0495582_0015683
3741 Ga0495582_0032967
3742 Ga0495582_0110455
3743 Ga0495582_0456930
3744 Ga0495605_0002030
3745 Ga0495605_0016179
3746 Ga0495605_0018129
3747 Ga0495605_0038869
3748 Ga0495605_0042704
3749 Ga0495605_0083768
3750 Ga0495605_0115435
3751 Ga0495639_0001363
3752 Ga0495639_0015247
3753 Ga0495639_0016761
3754 Ga0495639_0036360
3755 Ga0495639_0230513
3756 Ga0495662_0003932
3757 Ga0495662_0014304
3758 Ga0495662_0018247
3759 Ga0495662_0202882
3760 Ga0495664_0096519
3761 Ga0495664_0178081
3762 Ga0495664_0553842
3763 Ga0495584_0000006
3764 Ga0495584_0000679
3765 Ga0495584_0004790
3766 Ga0495584_0008034
3767 Ga0495584_0045789
3768 Ga0495584_0111483
3769 Ga0495584_0298359
3770 Ga0495584_0334524
3771 Ga0495585_0011506
3772 Ga0495585_0012995
3773 Ga0495585_0089092
3774 Ga0495585_0103811
3775 Ga0495585_0114472
3776 Ga0495585_0125801
3777 Ga0495585_0132197
3778 Ga0495585_0141740
3779 Ga0495585_0174688
3780 Ga0495585_0199213
3781 Ga0495585_0246622
3782 Ga0495585_0265905
3783 Ga0495594_0006812
3784 Ga0495594_0011294
3785 Ga0495594_0025057
3786 Ga0495594_0038079
3787 Ga0495594_0061269
3788 Ga0495594_0086172
3789 Ga0495594_0091226
3790 Ga0495594_0121769
3791 Ga0495594_0182800
3792 Ga0495596_0001262
3793 Ga0495596_0002979
3794 Ga0495596_0016589
3795 Ga0495596_0110255
3796 Ga0495607_0000146
3797 Ga0495607_0012687
3798 Ga0495607_0043832
3799 Ga0495607_0047575
3800 Ga0495607_0108759
3801 Ga0495607_0131367
3802 Ga0495607_0151172
3803 Ga0495607_0161243
3804 Ga0495607_0173846
3805 Ga0495607_0463128
3806 Ga0495583_0000035
3807 Ga0495583_0000464
3808 Ga0495583_0000515
3809 Ga0495583_0000941
3810 Ga0495583_0025532
3811 Ga0495583_0026085
3812 Ga0495583_0037110
3813 Ga0495606_0000011
3814 Ga0495606_0000064
3815 Ga0495606_0008212
3816 Ga0495606_0015425
3817 Ga0495606_0015437
3818 Ga0495606_0031884
3819 Ga0495606_0041980
3820 Ga0495606_0076629
3821 Ga0495606_0079664
3822 Ga0495606_0087399
3823 Ga0495606_0107100
3824 Ga0495606_0225456
3825 Ga0495606_0258014
3826 Ga0495606_0585633
3827 Ga0495608_0060034
3828 Ga0495608_0243247
3829 Ga0495608_0307552
3830 Ga0495610_0000003
3831 Ga0495610_0000147
3832 Ga0495610_0020763
3833 Ga0495610_0030292
3834 Ga0495610_0075901
3835 Ga0495610_0111465
3836 Ga0495610_0269380
3837 Ga0495616_0005111
3838 Ga0495616_0010998
3839 Ga0495616_0033526
3840 Ga0495616_0068125
3841 Ga0495616_0081978
3842 Ga0495616_0090764
3843 Ga0495616_0093850
3844 Ga0495616_0103929
3845 Ga0495616_0103962
3846 Ga0495616_0138043
3847 Ga0495618_0059440
3848 Ga0495620_0005610
3849 Ga0495628_0001929
3850 Ga0495628_1053217
3851 Ga0495630_0011239
3852 Ga0495630_0016385
3853 Ga0495630_0104553
3854 Ga0495630_0214172
3855 Ga0495630_0356463
3856 Ga0495630_0589118
3857 Ga0495631_0011492
3858 Ga0495631_0025302
3859 Ga0495631_0059603
3860 Ga0495631_0086696
3861 Ga0495631_0117343
3862 Ga0495631_0253159
3863 Ga0495631_0326922
3864 Ga0495632_0000250
3865 Ga0495632_0019797
3866 Ga0495632_0046632
3867 Ga0495632_0055038
3868 Ga0495632_0275491
3869 Ga0495637_0000004
3870 Ga0495637_0002614
3871 Ga0495637_0020216
3872 Ga0495643_0000933
3873 Ga0495643_0006906
3874 Ga0495643_0031051
3875 Ga0495643_0045226
3876 Ga0495643_0045455
3877 Ga0495643_0099955
3878 Ga0495643_0100936
3879 Ga0495643_0116765
3880 Ga0495643_0254848
3881 Ga0495644_0005823
3882 Ga0495644_0011056
3883 Ga0495644_0012807
3884 Ga0495644_0039079
3885 Ga0495644_0052182
3886 Ga0495644_0059009
3887 Ga0495644_0064010
3888 Ga0495644_0082189
3889 Ga0495644_0094584
3890 Ga0495644_0173745
3891 Ga0495644_0350380
3892 Ga0495644_0445199
3893 Ga0495648_0000001
3894 Ga0495648_0002588
3895 Ga0495648_0007597
3896 Ga0495648_0026333
3897 Ga0495648_0035961
3898 Ga0495648_0041230
3899 Ga0495648_0058058
3900 Ga0495648_0065957
3901 Ga0495648_0072601
3902 Ga0495648_0077815
3903 Ga0495648_0093764
3904 Ga0495648_0096077
3905 Ga0495648_0381431
3906 Ga0495663_0018551
3907 Ga0495663_0058761
3908 Ga0495663_0095728
3909 Ga0495666_0002752
3910 Ga0495666_0006205
3911 Ga0495666_0011231
3912 Ga0495666_0012973
3913 Ga0495666_0060314
3914 Ga0495666_0157285
3915 Ga0495666_0186219
3916 Ga0495666_0205407
3917 Ga0495666_0447872
3918 Ga0495642_0000366
3919 Ga0495642_0037261
3920 Ga0495642_0043210
3921 Ga0495642_0051391
3922 Ga0495642_0113555
3923 Ga0495642_0121583
3924 Ga0495642_0136233
3925 Ga0495642_0197240
3926 Ga0495642_0268587
3927 Ga0495652_0029810
3928 Ga0495652_0456531
3929 Ga0495652_0681737
3930 Ga0495654_0000028
3931 Ga0495654_0038980
3932 Ga0495654_0052592
3933 Ga0495654_0066092
3934 Ga0495654_0068091
3935 Ga0495654_0079581
3936 Ga0495654_0094274
3937 Ga0495654_0112433
3938 Ga0495654_0338477
3939 Ga0495665_0005600
3940 Ga0495665_0031234
3941 Ga0495665_0037697
3942 Ga0495665_0050815
3943 Ga0495665_0070023
3944 Ga0495665_0311788
3945 Ga0495665_0571292
3946 Ga0495640_0000332
3947 Ga0495640_0040721
3948 Ga0495640_0042765
3949 Ga0495640_0054180
3950 Ga0495640_0263223
3951 Ga0495640_0316478
3952 Ga0495586_0001612
3953 Ga0495586_0002680
3954 Ga0495586_0047882
3955 Ga0495586_0057896
3956 Ga0495586_0126869
3957 Ga0495586_0133520
3958 Ga0495587_0013600
3959 Ga0495587_0054498
3960 Ga0495587_0120716
3961 Ga0495587_0162193
3962 Ga0495587_0519753
3963 Ga0495587_0633605
3964 Ga0495598_0039369
3965 Ga0495598_0051470
3966 Ga0495598_0235033
3967 Ga0495609_0000202
3968 Ga0495609_0000632
3969 Ga0495609_0000731
3970 Ga0495609_0005004
3971 Ga0495609_0011146
3972 Ga0495609_0019147
3973 Ga0495609_0050578
3974 Ga0495609_0093344
3975 Ga0495609_0148567
3976 Ga0495609_0199620
3977 Ga0495621_0010474
3978 Ga0495621_0011182
3979 Ga0495621_0013172
3980 Ga0495621_0107235
3981 Ga0495621_0164068
3982 Ga0495597_0010170
3983 Ga0495597_0022198
3984 Ga0495597_0043912
3985 Ga0495597_0049650
3986 Ga0495597_0054930
3987 Ga0495597_0069719
3988 Ga0495597_0081127
3989 Ga0495597_0081891
3990 Ga0495597_0151049
3991 Ga0495597_0205414
3992 Ga0495597_0235955
3993 Ga0495597_0345635
3994 Ga0495645_0196737
3995 Ga0495645_0280617
3996 Ga0495622_0000068
3997 Ga0495622_0006132
3998 Ga0495622_0029717
3999 Ga0495622_0061892
4000 Ga0495622_0104183
4001 Ga0495622_0105294
4002 Ga0495622_0122940
4003 Ga0495622_0167628
4004 Ga0495622_0184950
4005 Ga0495633_0006613
4006 Ga0495633_0007375
4007 Ga0495633_0008653
4008 Ga0495633_0034176
4009 Ga0495633_0034661
4010 Ga0495633_0093371
4011 Ga0495633_0100650
4012 Ga0495633_0121004
4013 Ga0495633_0135146
4014 Ga0495633_0147848
4015 Ga0495633_0153652
4016 Ga0495633_0168545
4017 Ga0495633_0196114
4018 Ga0495633_0243807
4019 Ga0495633_0480125
4020 Ga0495667_0008831
4021 Ga0495667_0025952
4022 Ga0495667_0339598
4023 Ga0495656_0153543
4024 Ga0495656_0160500
4025 Ga0495656_0191516
4026 Ga0495656_0203451
4027 Ga0495656_0295141
4028 Ga0495656_0691904
4029 Ga0495656_0791185
4030 Ga0495668_0000048
4031 Ga0495668_0001049
4032 Ga0495668_0001239
4033 Ga0495668_0012767
4034 Ga0495668_0015049
4035 Ga0495668_0024042
4036 Ga0495668_0074781
4037 Ga0495668_0103640
4038 Ga0495668_0133401
4039 Ga0495668_0135939
4040 Ga0495668_0408171
4041 Ga0495634_0019021
4042 Ga0495634_0141276
4043 Ga0495634_0225284
4044 Ga0495634_0343268
4045 Ga0495611_0001880
4046 Ga0495611_0010338
4047 Ga0495611_0024049
4048 Ga0495611_0039658
4049 Ga0495611_0088858
4050 Ga0495611_0220431
4051 Ga0495625_0005736
4052 Ga0495625_0008141
4053 Ga0495625_0013178
4054 Ga0495625_0019706
4055 Ga0495625_0033686
4056 Ga0495625_0080087
4057 Ga0495625_0154224
4058 Ga0495625_0186460
4059 Ga0495625_0212373
4060 Ga0495625_0384700
4061 Ga0495625_0624382
4062 Ga0495635_0013701
4063 Ga0495635_0019832
4064 Ga0495635_0030213
4065 Ga0495635_0061139
4066 Ga0495635_0526042
4067 Ga0495635_0584544
4068 Ga0495659_0001303
4069 Ga0495659_0003422
4070 Ga0495659_0023879
4071 Ga0495659_0025638
4072 Ga0495661_0000894
4073 Ga0495661_0027661
4074 Ga0495661_0037675
4075 Ga0495661_0040131
4076 Ga0495661_0047776
4077 Ga0495661_0066666
4078 Ga0495661_0092034
4079 Ga0495661_0110406
4080 Ga0495661_0144680
4081 Ga0495661_0182630
4082 Ga0495661_0274760
4083 Ga0495661_0307386
4084 Ga0495588_0000174
4085 Ga0495588_0013191
4086 Ga0495588_0017660
4087 Ga0495588_0028280
4088 Ga0495588_0028920
4089 Ga0495588_0036538
4090 Ga0495588_0085138
4091 Ga0495588_0094769
4092 Ga0495588_0113679
4093 Ga0495588_0145496
4094 Ga0495588_0248952
4095 Ga0495588_0452445
4096 Ga0495588_0544026
4097 Ga0495657_0061543
4098 Ga0495599_0070371
4099 Ga0495599_0212083
4100 Ga0495623_0062383
4101 Ga0495623_0088447
4102 Ga0495623_0126919
4103 Ga0495646_0117109
4104 Ga0495646_0171456
4105 Ga0495646_0256228
4106 Ga0495647_0018160
4107 Ga0495647_0019605
4108 Ga0495647_0032169
4109 Ga0495647_0441362
4110 Ga0495658_0013899
4111 Ga0495658_0023459
4112 Ga0495658_0059219
4113 Ga0495658_0277342
4114 Ga0495658_0318448
4115 Ga0495669_0007067
4116 Ga0495669_0030462
4117 Ga0495669_0032428
4118 Ga0495669_0102634
4119 Ga0495669_0122337
4120 Ga0495669_0312111
4121 Ga0495613_0006401
4122 Ga0495613_0012801
4123 Ga0495613_0206651
4124 Ga0495624_0098156
4125 Ga0495624_0113806
4126 Ga0495624_0200579
4127 Ga0495624_0574798
4128 Ga0495670_0007032
4129 Ga0495670_0009786
4130 Ga0495670_0011696
4131 Ga0495670_0106314
4132 Ga0495670_0227423
4133 Ga0495670_0244567
4134 Ga0495670_0262056
4135 Ga0495670_0392516
4136 Ga0495670_0815647
4137 Ga0495671_0000001
4138 Ga0495671_0019237
4139 Ga0495671_0043851
4140 Ga0495671_0057396
4141 Ga0495671_0068086
4142 Ga0495671_0128812
4143 Ga0495649_0086174
4144 Ga0495649_0089196
4145 Ga0495649_0111267
4146 Ga0495649_0136693
4147 Ga0495649_0164836
4148 Ga0495649_0196964
4149 Ga0495649_0407926
4150 Ga0495589_0005458
4151 Ga0495589_0016939
4152 Ga0495589_0038017
4153 Ga0495589_0074369
4154 Ga0495589_0075171
4155 Ga0495589_0106592
4156 Ga0495589_0189849
4157 Ga0495589_0275352
4158 Ga0495589_0448607
4159 Ga0495589_0526539
4160 Ga0495600_0001395
4161 Ga0495600_0003020
4162 Ga0495600_0009571
4163 Ga0495660_0000157
4164 Ga0495660_0008377
4165 Ga0495660_0011707
4166 Ga0495660_0019417
4167 Ga0495660_0021276
4168 Ga0495660_0034095
4169 Ga0495660_0041115
4170 Ga0495660_0144672
4171 Ga0495660_0184876
4172 Ga0495660_0203368
4173 Ga0495581_0029270
4174 Ga0495581_0061774
4175 Ga0495581_0077497
4176 Ga0495581_0089854
4177 Ga0495581_0399830
4178 Ga0495604_0013374
4179 Ga0495604_0025790
4180 Ga0495604_0070450
4181 Ga0495604_0215863
4182 Ga0495636_0013522
4183 Ga0495636_0028161
4184 Ga0495636_0030003
4185 Ga0495636_0030241
4186 Ga0495636_0190048
4187 Ga0495636_0318890
4188 Ga0495636_0328059
4189 Ga0495636_0334901
4190 Ga0495636_0581236
4191 Ga0495674_0047498
4192 Ga0495674_0085356
4193 Ga0495674_0940357
4194 Ga0495672_0000097
4195 Ga0495672_0000126
4196 Ga0495672_0000259
4197 Ga0495672_0000302
4198 Ga0495672_0014901
4199 Ga0495672_0016317
4200 Ga0495672_0054303
4201 Ga0495672_0064756
4202 Ga0495672_0127119
4203 Ga0495676_0024464
4204 Ga0495676_0040241
4205 Ga0495676_0061436
4206 Ga0495676_0116285
4207 Ga0495676_0320558
4208 Ga0495680_0001868
4209 Ga0495680_0021668
4210 Ga0495680_0192327
4211 Ga0495680_0235599
4212 Ga0495680_0248495
4213 Ga0495683_0004993
4214 Ga0495683_0008550
4215 Ga0495683_0050632
4216 Ga0495683_0094864
4217 Ga0495683_0164529
4218 Ga0495683_0324519
4219 Ga0495687_000002
4220 Ga0495687_000457
4221 Ga0495687_000702
4222 Ga0495687_000994
4223 Ga0495687_006365
4224 Ga0495687_008955
4225 Ga0495687_010475
4226 Ga0495687_014535
4227 Ga0495687_066666
4228 Ga0495675_0007368
4229 Ga0495675_0106251
4230 Ga0495675_0184835
4231 Ga0495675_0236560
4232 Ga0495675_0408643
4233 Ga0495675_0436126
4234 Ga0495677_0001656
4235 Ga0495677_0004036
4236 Ga0495677_0056792
4237 Ga0495677_0093616
4238 Ga0495677_0096683
4239 Ga0495677_0116460
4240 Ga0495677_0116588
4241 Ga0495677_0133294
4242 Ga0495677_0163324
4243 Ga0495677_0171047
4244 Ga0495677_0260767
4245 Ga0495677_0280720
4246 Ga0495679_001915
4247 Ga0495679_002551
4248 Ga0495679_009967
4249 Ga0495679_015702
4250 Ga0495679_205866
4251 Ga0495685_000019
4252 Ga0495685_004108
4253 Ga0495685_027283
4254 Ga0495685_030523
4255 Ga0495685_051327
4256 Ga0495685_059272
4257 Ga0495673_0000097
4258 Ga0495673_0000100
4259 Ga0495673_0017896
4260 Ga0495673_0135162
4261 Ga0495673_0224214
4262 Ga0495681_0040152
4263 Ga0495681_0044744
4264 Ga0495681_0049709
4265 Ga0495681_0073885
4266 Ga0495681_0126294
4267 Ga0495681_0137367
4268 Ga0495681_0199071
4269 Ga0495681_0336725
4270 Ga0495684_0098504
4271 Ga0495686_0005033
4272 Ga0495686_0018140
4273 Ga0495686_0018201
4274 Ga0495686_0064771
4275 Ga0495686_0140863
4276 Ga0495686_0213745
4277 Ga0495686_0220372
4278 Ga0495593_0026048
4279 Ga0495593_0030667
4280 Ga0495593_0063593
4281 Ga0495593_0083801
4282 Ga0495593_0087694
4283 Ga0495593_0313336
4284 Ga0495593_0400699
4285 Ga0495602_0034817
4286 Ga0495602_0146972
4287 Ga0495602_0216990
4288 Ga0495602_0254281
4289 Ga0495602_0527923
4290 Ga0495614_0133794
4291 Ga0495614_0157033
4292 Ga0495614_0158387
4293 Ga0495614_0603571
4294 Ga0495615_0008199
4295 Ga0495615_0039914
4296 Ga0495615_0090517
4297 Ga0495615_0101707
4298 Ga0495626_0000016
4299 Ga0495626_0000026
4300 Ga0495626_0002931
4301 Ga0495626_0007918
4302 Ga0495626_0009392
4303 Ga0495626_0039663
4304 Ga0495626_0059472
4305 Ga0495626_0063508
4306 Ga0495626_0328037
4307 Ga0496100_0007351
4308 Ga0496100_0505931
4309 Ga0496100_0512356
4310 Ga0496101_0021065
4311 Ga0496101_0663724
4312 Ga0496101_0721375
4313 Ga0496101_1011655
4314 Ga0496101_1264700
4315 Ga0496101_1544142
4316 Ga0496102_0001202
4317 Ga0496102_0229748
4318 Ga0496102_0273261
4319 Ga0496102_0436832
4320 Ga0496102_0596621
4321 Ga0496102_0850748
4322 Ga0496102_1406222
4323 Ga0496103_0011633
4324 Ga0496103_0033010
4325 Ga0496103_0052491
4326 Ga0496103_0223449
4327 Ga0496103_0436650
4328 Ga0496103_0643335
4329 Ga0496104_0338190
4330 Ga0496104_0470315
4331 Ga0496104_0490806
4332 Ga0496105_0214483
4333 Ga0496105_0262170
4334 Ga0496105_0424723
4335 Ga0496105_0790792
4336 Ga0496106_0283638
4337 Ga0496106_0325348
4338 Ga0496106_0663760
4339 Ga0496107_0023356
4340 Ga0496107_0114465
4341 Ga0496107_0358940
4342 Ga0496107_0424302
4343 Ga0496107_0462972
4344 Ga0496107_1170906
4345 Ga0496108_0024232
4346 Ga0496108_0448377
4347 Ga0496108_0664557
4348 Ga0496108_0992952
4349 Ga0496109_0133179
4350 Ga0496109_0984215
4351 Ga0496110_0137215
4352 Ga0496110_0711128
4353 Ga0496111_0198780
4354 Ga0496111_0373526
4355 Ga0496111_0413525
4356 Ga0496111_1218834
4357 Ga0496112_0005841
4358 Ga0496112_0164242
4359 Ga0496112_0346973
4360 Ga0496112_1111606
4361 Ga0496113_0147492
4362 Ga0496114_0106830
4363 Ga0496114_0113531
4364 Ga0496114_0273592
4365 Ga0496114_0288596
4366 Ga0496114_1053278
4367 Ga0496115_0001055
4368 Ga0496115_0276137
4369 Ga0496115_0663026
4370 Ga0496115_0665170
4371 Ga0496115_0856686
4372 Ga0496116_0069056
4373 Ga0496116_0088689
4374 Ga0496116_0121005
4375 Ga0496116_0170227
4376 Ga0496117_0000001
4377 Ga0496117_0001602
4378 Ga0496117_0030143
4379 Ga0496118_0000002
4380 Ga0496118_0004742
4381 Ga0496118_0030437
4382 Ga0496118_0485019
4383 Ga0496119_0124513
4384 Ga0496119_0332915
4385 Ga0496120_0087336
4386 Ga0496121_0000001
4387 Ga0496121_0015019
4388 Ga0496121_0030639
4389 Ga0496121_0099689
4390 Ga0496121_0186736
4391 Ga0496121_0267654
4392 Ga0496122_0138190
4393 Ga0496122_0158809
4394 Ga0496122_0202223
4395 Ga0496122_0301213
4396 Ga0496123_0013346
4397 Ga0496123_0018581
4398 Ga0496123_0264373
4399 Ga0496124_0009480
4400 Ga0496124_0028304
4401 Ga0496124_0034796
4402 Ga0496124_0127088
4403 Ga0496124_0161584
4404 Ga0496124_0179046
4405 Ga0496124_0208501
4406 Ga0496124_0311278
4407 Ga0496124_0680300
4408 Ga0496124_0767445
4409 Ga0496125_0000001
4410 Ga0496125_0014630
4411 Ga0496126_0000034
4412 Ga0496126_0014001
4413 Ga0496126_0452947
4414 Ga0496126_0510864
4415 Ga0496126_0555819
4416 Ga0496126_0625220
4417 Ga0496126_0691004
4418 Ga0466983_0814339
4419 Ga0501306_023443
4420 Ga0501306_094074
4421 Ga0501308_000043
4422 Ga0501308_004623
4423 Ga0501309_002926
4424 Ga0501309_010747
4425 Ga0501310_000314
4426 Ga0501310_023165
4427 Ga0501304_000103
4428 Ga0501304_010860
4429 Ga0501307_004362
4430 Ga0501307_009157
4431 Ga0501307_013604
4432 Ga0495678_000128
4433 Ga0495678_004908
4434 Ga0495678_009158
4435 Ga0495678_017087
4436 Ga0495678_022689
4437 Ga0495678_025494
4438 Ga0495678_067621
4439 Ga0495682_0007646
4440 Ga0495682_0046808
4441 Ga0495682_0059187
4442 Ga0495682_0315331
4443 Ga0501291_052603
4444 Ga0501298_097590
4445 Ga0501299_014456
4446 Ga0501303_009692
4447 Ga0501311_001467
4448 Ga0501311_005169
4449 Ga0501311_104620
4450 Ga0501312_015087
4451 Ga0501312_107741
4452 Ga0501313_006566
4453 Ga0501314_013894
4454 Ga0501315_003168
4455 Ga0501315_008242
4456 Ga0501315_018201
4457 Ga0501315_058801
4458 Ga0501316_002918
4459 Ga0501316_003463
4460 Ga0501318_007306
4461 Ga0501319_021994
4462 Ga0501320_010242
4463 Ga0501320_019732
4464 Ga0501320_021934
4465 Ga0501321_007332
4466 Ga0501322_001671
4467 Ga0501322_017103
4468 Ga0501323_002866
4469 Ga0501323_013157
4470 Ga0501323_043258
4471 Ga0501324_004785
4472 Ga0501325_017223
4473 Ga0501326_02490
4474 Ga0501326_09563
4475 Ga0501335_006342
4476 Ga0501031_0047354
4477 Ga0501032_0088596
4478 Ga0501033_0002051
4479 Ga0501034_0005225
4480 Ga0501036_0003558
4481 Ga0501036_0371290
4482 Ga0501036_0714024
4483 Ga0501036_1385522
4484 Ga0501037_0019590
4485 Ga0501037_0292291
4486 Ga0501038_0000564
4487 Ga0501038_0758494
4488 Ga0501039_0000137
4489 Ga0501039_0024770
4490 Ga0501039_0396181
4491 Ga0501039_0861283
4492 Ga0501040_0000301
4493 Ga0501040_0152623
4494 Ga0501040_0613662
4495 Ga0501040_0638417
4496 Ga0501041_0000043
4497 Ga0501041_0047018
4498 Ga0501041_0241653
4499 Ga0501042_0000604
4500 Ga0501042_0263106
4501 Ga0501042_0525467
4502 Ga0501042_1052716
4503 Ga0501043_0425944
4504 Ga0501043_1263034
4505 Ga0501046_0000328
4506 Ga0501046_0707038
4507 Ga0501048_0001946
4508 Ga0501048_0069740
4509 Ga0501048_0212479
4510 Ga0501048_0333054
4511 Ga0501068_0008756
4512 Ga0501068_0321198
4513 Ga0501069_0673430
4514 Ga0501069_0914522
4515 Ga0501069_1004263
4516 Ga0501070_0191012
4517 Ga0501070_0312293
4518 Ga0501070_0895039
4519 Ga0501070_1360618
4520 Ga0501071_0017983
4521 Ga0501071_1201881
4522 Ga0501072_0000555
4523 Ga0501072_0002944
4524 Ga0501072_0204103
4525 Ga0501072_0451307
4526 Ga0501073_0000117
4527 Ga0501073_0630446
4528 Ga0501073_0994509
4529 Ga0501074_0011250
4530 Ga0501074_0315689
4531 Ga0501074_0493033
4532 Ga0501075_0003437
4533 Ga0501075_0062124
4534 Ga0501076_0000284
4535 Ga0501076_0218443
4536 Ga0501076_1698990
4537 Ga0501077_0000236
4538 Ga0501077_0715745
4539 Ga0501202_170050
4540 Ga0501227_003010
4541 Ga0501238_000630
4542 Ga0501249_020941
4543 Ga0501253_051963
4544 Ga0501257_037433
4545 Ga0501079_0005362
4546 Ga0501079_0014496
4547 Ga0501079_0495653
4548 Ga0501080_0000743
4549 Ga0501080_0267888
4550 Ga0501080_0663173
4551 Ga0501080_0678475
4552 Ga0501080_1080765
4553 Ga0501081_0000621
4554 Ga0501083_0522610
4555 Ga0501083_0523133
4556 Ga0501241_038231
4557 Ga0501269_000234
4558 Ga0501279_012469
4559 Ga0501279_021347
4560 Ga0501280_000570
4561 Ga0501035_0147039
4562 Ga0501035_0216993
4563 Ga0501035_0306964
4564 Ga0501035_0873524
4565 Ga0501035_1040808
4566 Ga0501045_0018761
4567 nmdc:mga03683_3602_c1
4568 nmdc:mga03683_44815_c1
4569 nmdc:mga03n38_46902_c1
4570 nmdc:mga00v17_242948_c1
4571 nmdc:mga00v17_55062_c1
4572 nmdc:mga00v17_68635_c1
4573 nmdc:mga0yw44_187786_c1
4574 nmdc:mga0k408_1337_c1
4575 nmdc:mga0k408_234616_c1
4576 nmdc:mga0k408_44254_c1
4577 nmdc:mga0k408_729910_c1
4578 nmdc:mga06z11_27247_c1
4579 nmdc:mga06z11_790959_c1
4580 nmdc:mga04h51_49073_c1
4581 nmdc:mga07m45_8520_c1
4582 nmdc:mga05p37_114_c1
4583 nmdc:mga05p37_1353913_c1
4584 nmdc:mga05p37_411155_c1
4585 nmdc:mga05p37_733178_c1
4586 nmdc:mga09592_273648_c1
4587 nmdc:mga09592_3662_c1
4588 nmdc:mga0qj67_1051544_c1
4589 nmdc:mga0qj67_210782_c1
4590 nmdc:mga0qj67_726061_c1
4591 nmdc:mga06r32_391648_c1
4592 nmdc:mga06r32_97009_c1
4593 nmdc:mga08y16_150766_c1
4594 nmdc:mga08y16_15466_c1
4595 nmdc:mga08y16_54698_c1
4596 nmdc:mga08y16_54862_c1
4597 nmdc:mga08y16_563594_c1
4598 nmdc:mga08y16_67290_c1
4599 nmdc:mga0n895_1305518_c1
4600 nmdc:mga0n895_632826_c1
4601 nmdc:mga0n895_9031_c1
4602 nmdc:mga0n895_96963_c1
4603 nmdc:mga0rr50_2846_c1
4604 nmdc:mga0rr50_376197_c1
4605 nmdc:mga0rr50_414384_c1
4606 nmdc:mga0rr50_688253_c1
4607 nmdc:mga08x19_19018_c1
4608 nmdc:mga08x19_190761_c1
4609 nmdc:mga08x19_2760_c1
4610 nmdc:mga08x19_299758_c1
4611 nmdc:mga0a205_1305498_c1
4612 nmdc:mga0a205_1465299_c1
4613 nmdc:mga0a205_215246_c1
4614 nmdc:mga0a205_5446_c3
4615 nmdc:mga0sz30_22870_c1
4616 nmdc:mga0sz30_68027_c1
4617 Ga0495601_0015794
4618 Ga0495601_0235787
4619 Ga0495601_0237000
4620 Ga0495612_0148845
4621 Ga0495595_0005218
4622 Ga0495619_0010461
4623 Ga0495619_0098728
4624 Ga0500646_0027739
4625 Ga0500583_0139275
4626 Ga0500566_0348121
4627 Ga0500566_0463779
4628 Ga0500650_0126388
4629 Ga0500594_0170832
4630 Ga0500618_001153
4631 Ga0500618_014656
4632 Ga0500618_026153
4633 Ga0500559_0240280
4634 Ga0500559_0296255
4635 Ga0500568_0173286
4636 Ga0500586_051917
4637 Ga0500586_104605
4638 Ga0500604_0067134
4639 Ga0500637_0279950
4640 Ga0500637_0551044
4641 Ga0500552_019037
4642 Ga0501084_0013751
4643 Ga0501084_0206426
4644 Ga0501084_0373441
4645 Ga0501084_1135141
4646 Ga0590071_012073
4647 Ga0590074_022298
4648 Ga0590075_053262
4649 Ga0587066_003481
4650 Ga0587066_041096
4651 Ga0587070_006668
4652 Ga0587077_007430
4653 Ga0587077_011691
4654 Ga0587077_119379
4655 Ga0587080_003759
4656 Ga0587080_093142
4657 Ga0587083_0025865
4658 Ga0587083_0117552
4659 Ga0587090_019409
4660 Ga0587091_049512
4661 Ga0587098_010079
4662 Ga0587106_033341
4663 Ga0587125_050587
4664 Ga0587109_123270
4665 Ga0587067_006206
4666 Ga0587068_000149
4667 Ga0587068_069828
4668 Ga0587072_038719
4669 Ga0587075_054888
4670 Ga0587076_002189
4671 Ga0587079_001531
4672 Ga0587102_000546
4673 Ga0587105_000829
4674 Ga0587107_053588
4675 Ga0587124_036669
4676 Ga0587071_012908
4677 Ga0587111_0052221
4678 Ga0587111_0154241
4679 Ga0501082_0001199
4680 Ga0501082_1852334
4681 Ga0466962_0059050
4682 Ga0466962_0069487
4683 Ga0530510_0000177
4684 Ga0530510_1152037
4685 2511250887
4686 2513953027
4687 2514043870
4688 2526211213
4689 2550692653
4690 2599738353
4691 2599746475
4692 2600208381
4693 2601667525
4694 2643787150
4695 2643802178
4696 2644215763
4697 2644254240
4698 2644358095
4699 2644475687
4700 2676745341
4701 2723877067
4702 2738741059
4703 2738845518
4704 2739276573
4705 2739345617
4706 2808971981
4707 2808981618
4708 2809006810
4709 2809013948
4710 2809129201
4711 2809145243
4712 2809148821
4713 2819591584
4714 2819633520
4715 2842714226
4716 2852621359
4717 2857551753
4718 2857554307
4719 2857559916
4720 2857578614
4721 2863425695
4722 2870070704
4723 2884812849
4724 2884837394
4725 2884853685
4726 2885085589
4727 2896155198
4728 2904426204
4729 2904483438
4730 2904569900
4731 2904577080
4732 2919478573
4733 2928161639
4734 2928168467
4735 2928174806
4736 2928542470
4737 2932411136
4738 2932419297
4739 2981993627
4740 642415144
4741 644747359
4742 8018850889
4743 8020940982
4744 8020952343
4745 8020958404
4746 8021125189
4747 8039103490
4748 8047673970

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

19

114

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e73-assembly1.cif.gz_4L vigna radiata supercomplex i+iii2 (full bridge) 0.8784 4 96
7a24-assembly1.cif.gz_K assembly intermediate of the plant mitochondrial complex i 0.8781 4 86
7zmh-assembly1.cif.gz_L cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) - membrane arm 0.8777 10 94
6x89-assembly1.cif.gz_4L vigna radiata mitochondrial complex i* 0.8701 4 86
7ar7-assembly1.cif.gz_K cryo-em structure of arabidopsis thaliana complex-i (open conformation) 0.8609 4 88
ID Description Score Start End Superfamily
af_A0A3B6U9Q8_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9087 7 94 1.10.287.3510
af_A0A2P2CLH7_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8991 7 94 1.10.287.3510
af_Q6R9N1_4_99_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8825 7 96 1.10.287.3510
af_P18934_2_96_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8579 4 97 1.10.287.3510
af_P34651_608_792_1.20.120.1900 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Gamma-tubulin complex, C-terminal domain 0.8491 35 80 1.20.120.1900
ID Description Score Start End GO Terms
AF-A0A368F7W0-F1-model_v4 NADH-ubiquinone oxidoreductase chain 4L (NADH dehydrogenase subunit 4L) (NADH dehydrogenase subunit 5) (NADH-ubiquinone oxidoreductase chain 5) 0.9476 9 89 GO:0003954
GO:0008137
GO:0015990
GO:0016020
GO:0042773
AF-A0A349TCF6-F1-model_v4 NADH-quinone oxidoreductase subunit NuoK 0.9402 1 62 GO:0016651
GO:0030964
GO:0042773
AF-A0A367IZW3-F1-model_v4 NADH dehydrogenase subunit 4 0.939 4 93 GO:0003954
GO:0008137
GO:0015990
GO:0016020
GO:0042773
GO:0048039
AF-A0A2E2YBK6-F1-model_v4 NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) 0.931 1 87 GO:0005886
GO:0030964
GO:0042773
GO:0048038
GO:0050136
AF-Q6U7Y2-F1-model_v4 NADH-ubiquinone oxidoreductase chain 4L (EC 7.1.1.2) (NADH dehydrogenase subunit 4L) 0.9279 10 86 GO:0005743
GO:0008137
GO:0030964
GO:0042773

Map