F496752
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2374 | 762 | 4748 | 101 |
Family's Representative Sequence
| Representative Sequence | 3300049585|Ga0501069_0190746|Ga0501069_0190746_509_853 |
| Length | 114 |
| Sequence | MRRHPPYQGGEGMTLDLSHYLTLAAILFAISVVGIFLNRRNLIVLLMAIELMLLAVNLNFIAFSHYLGNAAGQVFVFFILTVAAAESAIGLAILVVLFRNINTIDVEDLDSLRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 7 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 8 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 9 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 10 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 11 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 12 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 13 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 14 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 15 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 16 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 18 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 19 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 20 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 21 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 23 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 24 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 25 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 26 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 36 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 37 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 39 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 40 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 42 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 45 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 46 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 47 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 54 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 58 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 71 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 88 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 89 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 95 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 96 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 97 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 98 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 100 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 106 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 108 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 109 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 110 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 112 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 113 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 114 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 115 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 116 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 117 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 118 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 119 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 120 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 121 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 122 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 123 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 125 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 126 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 127 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 128 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 129 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 130 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 131 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 132 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 133 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 134 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 136 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 137 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 138 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 139 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 140 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 141 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 142 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 143 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 144 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 145 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 147 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 148 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 149 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 150 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 167 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 168 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 169 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 181 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 185 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 186 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 187 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 189 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 190 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 192 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 193 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 194 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 202 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 203 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 204 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 207 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 208 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 210 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 212 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 214 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 215 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 216 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 218 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 219 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 292 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 304 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 309 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 311 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 315 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 316 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 317 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 318 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 319 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 320 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 321 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 322 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 323 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 324 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 325 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 326 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 327 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 328 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 329 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 330 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 331 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 332 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 333 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 334 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 335 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 336 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 337 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 338 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 339 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 340 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 341 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 342 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 343 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 344 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 345 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 346 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 347 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 348 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 349 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 350 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 351 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 352 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 353 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 354 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 355 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 356 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 357 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 358 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 359 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 360 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 361 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 362 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 363 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 364 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 365 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 366 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 367 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 368 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 369 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 370 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 371 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 372 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 373 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 374 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 375 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 376 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 377 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 378 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 379 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 380 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 381 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 382 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 383 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 384 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 385 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 386 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 387 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 388 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 389 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 390 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 391 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 392 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 393 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 394 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 395 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 396 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 397 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 398 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 399 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 400 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 401 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 402 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 403 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 404 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 405 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 406 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 407 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 408 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 409 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 410 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 411 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 412 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 413 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 414 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 415 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 416 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 417 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 418 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 419 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 420 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 421 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 422 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 423 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 424 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 425 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 426 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 427 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 428 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 429 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 430 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 431 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 432 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 433 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 434 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 435 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 436 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 437 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 438 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 439 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 440 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 541 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 542 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 543 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 544 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 545 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 546 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 547 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 548 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 549 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 550 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 551 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 552 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 553 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 554 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 555 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 556 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 557 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 558 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 559 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 560 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 561 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 562 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 563 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 564 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 565 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 566 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 567 | 3300048986 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E | Metagenome | Unclassified |
| 568 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 569 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 570 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 571 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 572 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 573 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 574 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 577 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 578 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 579 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 580 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 581 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 582 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 583 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 584 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 585 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 586 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 587 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 588 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 589 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 590 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 591 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 592 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 593 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 594 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 595 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 596 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 597 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 598 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 599 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 600 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 601 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 602 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 603 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 604 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 605 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 606 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 607 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 608 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 609 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 610 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 611 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 612 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 613 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 614 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 615 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 616 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 617 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 618 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 619 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 620 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 621 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 622 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 623 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 624 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 625 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 626 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 627 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 628 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 629 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 630 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 631 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 632 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 633 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 634 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 635 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 636 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 637 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 638 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 639 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 640 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 641 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 642 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 643 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 644 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 645 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 646 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 647 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 648 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 649 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 650 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 651 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 652 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 653 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 654 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 655 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 656 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 657 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 658 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 659 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 660 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 661 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 662 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 663 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 664 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 665 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 666 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 667 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 668 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 669 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 670 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 671 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 672 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 673 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 674 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 675 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 676 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 677 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 678 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 679 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 680 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 681 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 682 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 683 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 684 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 685 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 686 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 687 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 688 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 689 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 690 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 691 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 692 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 693 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 694 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 695 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 696 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 697 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 698 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 699 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 700 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 701 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 702 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 703 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 704 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 705 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 706 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 707 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 708 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 709 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 710 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 711 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 712 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 713 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 714 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 715 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 716 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 717 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 718 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 719 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 720 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 721 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 722 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 723 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 724 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 725 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 726 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 727 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 728 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 729 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 730 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 731 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 732 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 733 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 734 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 735 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 736 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 737 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 738 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 739 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 740 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 741 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 742 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 743 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 744 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 745 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 746 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 747 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 748 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 749 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 750 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 751 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 752 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 753 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 754 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 755 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 756 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 757 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 758 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 759 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 760 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 761 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 762 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.85 |
| Metatranscriptomes | 3.45 |
| Isolates | 2.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.4 |
| Nodule | 0.42 |
| Rhizoplane | 3.07 |
| Rhizosphere | 85.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501069_0190746 | 3300049585 | Bacteria | 1186 |
| 2 | JGI24736J21556_1005532 | 3300001904 | Bacteria | 2132 |
| 3 | JGI24736J21556_1030490 | 3300001904 | Bacteria | 833 |
| 4 | JGI24739J22299_10075201 | 3300001989 | Bacteria | 1045 |
| 5 | JGI24739J22299_10090660 | 3300001989 | Bacteria | 931 |
| 6 | JGI24739J22299_10093162 | 3300001989 | Bacteria | 915 |
| 7 | JGI24739J22299_10150065 | 3300001989 | Bacteria | 689 |
| 8 | JGI24737J22298_10021955 | 3300001990 | Bacteria | 2030 |
| 9 | JGI24735J21928_10004761 | 3300002067 | Bacteria | 4529 |
| 10 | JGI24735J21928_10045752 | 3300002067 | Bacteria | 1270 |
| 11 | JGI24742J22300_10040961 | 3300002244 | Bacteria | 825 |
| 12 | JGI25155J39150_1000720 | 3300002704 | Bacteria | 5784 |
| 13 | JGI25155J39150_1000725 | 3300002704 | Bacteria | 5727 |
| 14 | JGI25156J39149_1000539 | 3300002705 | Bacteria | 21759 |
| 15 | JGI25156J39149_1003832 | 3300002705 | Bacteria | 4785 |
| 16 | JGI25162J39368_1003949 | 3300002737 | Bacteria | 3795 |
| 17 | JGI25154J39366_1000471 | 3300002738 | Bacteria | 21074 |
| 18 | JGI25154J39366_1001331 | 3300002738 | Bacteria | 9086 |
| 19 | JGI25154J39366_1001346 | 3300002738 | Bacteria | 9004 |
| 20 | JGI25158J39367_1000859 | 3300002739 | Bacteria | 5792 |
| 21 | JGI25157J39369_1000359 | 3300002741 | Bacteria | 31770 |
| 22 | JGI25152J39213_1038240 | 3300002773 | Bacteria | 690 |
| 23 | JGI25150J39212_1002919 | 3300002774 | Bacteria | 4131 |
| 24 | JGI25159J45721_1001302 | 3300002987 | Bacteria | 10528 |
| 25 | Ga0006759J45824_1073084 | 3300003163 | Bacteria | 2615 |
| 26 | JGI25151J46595_10015102 | 3300003187 | Bacteria | 3420 |
| 27 | JGI25153J46596_10039306 | 3300003215 | Bacteria | 1479 |
| 28 | JGI25153J46596_10041657 | 3300003215 | Bacteria | 1410 |
| 29 | rootL2_10035855 | 3300003322 | Bacteria | 1198 |
| 30 | JGI25160J50197_1010821 | 3300003354 | Bacteria | 3273 |
| 31 | Ga0007417J51691_1052140 | 3300003544 | Bacteria | 618 |
| 32 | Ga0007410J51695_1037975 | 3300003574 | Bacteria | 4043 |
| 33 | Ga0007409J51694_1013012 | 3300003575 | Bacteria | 10513 |
| 34 | Ga0007409J51694_1026750 | 3300003575 | Bacteria | 5092 |
| 35 | Ga0007416J51690_1021228 | 3300003577 | Bacteria | 10458 |
| 36 | Ga0032354_1056868 | 3300003693 | Bacteria | 5896 |
| 37 | Ga0055532_1000023 | 3300003758 | Bacteria | 248212 |
| 38 | Ga0055532_1013264 | 3300003758 | Bacteria | 941 |
| 39 | Ga0055525_1000001 | 3300003759 | Bacteria | 1016948 |
| 40 | Ga0055527_1006290 | 3300003760 | Bacteria | 1492 |
| 41 | Ga0055527_1011250 | 3300003760 | Bacteria | 1025 |
| 42 | Ga0055535_1010124 | 3300003761 | Bacteria | 1570 |
| 43 | Ga0055535_1016202 | 3300003761 | Bacteria | 1025 |
| 44 | Ga0055535_1016203 | 3300003761 | Bacteria | 1025 |
| 45 | Ga0055542_1003930 | 3300003762 | Bacteria | 3808 |
| 46 | Ga0055542_1004189 | 3300003762 | Bacteria | 3603 |
| 47 | Ga0055542_1013692 | 3300003762 | Bacteria | 1356 |
| 48 | Ga0055529_1000080 | 3300003763 | Bacteria | 148614 |
| 49 | Ga0055529_1006072 | 3300003763 | Bacteria | 1709 |
| 50 | Ga0055529_1014636 | 3300003763 | Bacteria | 993 |
| 51 | Ga0055526_1001704 | 3300003771 | Bacteria | 15350 |
| 52 | Ga0055526_1002909 | 3300003771 | Bacteria | 11254 |
| 53 | Ga0055526_1002911 | 3300003771 | Bacteria | 11252 |
| 54 | Ga0055526_1022939 | 3300003771 | Bacteria | 2101 |
| 55 | Ga0055537_1000012 | 3300003773 | Bacteria | 133761 |
| 56 | Ga0055537_1004026 | 3300003773 | Bacteria | 4324 |
| 57 | Ga0055524_1000021 | 3300003775 | Bacteria | 227578 |
| 58 | Ga0055524_1010983 | 3300003775 | Bacteria | 3566 |
| 59 | Ga0055524_1030369 | 3300003775 | Bacteria | 1577 |
| 60 | Ga0055534_1000529 | 3300003784 | Bacteria | 20625 |
| 61 | Ga0055528_1000073 | 3300003790 | Bacteria | 77054 |
| 62 | Ga0055528_1006103 | 3300003790 | Bacteria | 5505 |
| 63 | Ga0055528_1008801 | 3300003790 | Bacteria | 4277 |
| 64 | Ga0055528_1011504 | 3300003790 | Bacteria | 3506 |
| 65 | Ga0055531_10048281 | 3300003794 | Bacteria | 1149 |
| 66 | Ga0055541_1009639 | 3300003841 | Bacteria | 1483 |
| 67 | Ga0058692_1005164 | 3300003856 | Bacteria | 3755 |
| 68 | Ga0055543_1033000 | 3300004625 | Bacteria | 897 |
| 69 | Ga0065165_1000156 | 3300005262 | Bacteria | 119261 |
| 70 | Ga0065165_1034885 | 3300005262 | Bacteria | 1550 |
| 71 | Ga0065714_10104740 | 3300005288 | Bacteria | 1567 |
| 72 | Ga0065704_10162523 | 3300005289 | Bacteria | 1344 |
| 73 | Ga0065704_10492334 | 3300005289 | Bacteria | 673 |
| 74 | Ga0065712_10081344 | 3300005290 | Bacteria | 3015 |
| 75 | Ga0065712_10086540 | 3300005290 | Bacteria | 2630 |
| 76 | Ga0065715_10126937 | 3300005293 | Bacteria | 2098 |
| 77 | Ga0065715_10201625 | 3300005293 | Bacteria | 1335 |
| 78 | Ga0065715_10397033 | 3300005293 | Bacteria | 866 |
| 79 | Ga0065707_10105719 | 3300005295 | Bacteria | 2626 |
| 80 | Ga0065707_10625010 | 3300005295 | Bacteria | 677 |
| 81 | Ga0070658_10171325 | 3300005327 | Bacteria | 1823 |
| 82 | Ga0070658_10514554 | 3300005327 | Bacteria | 1034 |
| 83 | Ga0070676_10210673 | 3300005328 | Bacteria | 1279 |
| 84 | Ga0070676_10429392 | 3300005328 | Bacteria | 925 |
| 85 | Ga0070676_10945398 | 3300005328 | Bacteria | 644 |
| 86 | Ga0070683_100018665 | 3300005329 | Bacteria | 6147 |
| 87 | Ga0070683_100487012 | 3300005329 | Bacteria | 1178 |
| 88 | Ga0070690_100001009 | 3300005330 | Bacteria | 14387 |
| 89 | Ga0070690_100002775 | 3300005330 | Bacteria | 9465 |
| 90 | Ga0070690_100002867 | 3300005330 | Bacteria | 9296 |
| 91 | Ga0070690_100377503 | 3300005330 | Bacteria | 1035 |
| 92 | Ga0070690_100704220 | 3300005330 | Bacteria | 776 |
| 93 | Ga0070670_100008912 | 3300005331 | Bacteria | 8565 |
| 94 | Ga0070670_100806807 | 3300005331 | Bacteria | 848 |
| 95 | Ga0070670_100925450 | 3300005331 | Bacteria | 791 |
| 96 | Ga0070670_101182415 | 3300005331 | Bacteria | 699 |
| 97 | Ga0070677_10085884 | 3300005333 | Bacteria | 1358 |
| 98 | Ga0068869_100001595 | 3300005334 | Bacteria | 13483 |
| 99 | Ga0068869_100063014 | 3300005334 | Bacteria | 2722 |
| 100 | Ga0068869_100094726 | 3300005334 | Bacteria | 2252 |
| 101 | Ga0068869_100245546 | 3300005334 | Bacteria | 1428 |
| 102 | Ga0068869_100666502 | 3300005334 | Bacteria | 884 |
| 103 | Ga0068869_101319928 | 3300005334 | Bacteria | 637 |
| 104 | Ga0068869_102066678 | 3300005334 | Bacteria | 512 |
| 105 | Ga0070666_10253033 | 3300005335 | Bacteria | 1247 |
| 106 | Ga0070666_10426392 | 3300005335 | Bacteria | 956 |
| 107 | Ga0070680_100013746 | 3300005336 | Bacteria | 6313 |
| 108 | Ga0070680_100058208 | 3300005336 | Bacteria | 3160 |
| 109 | Ga0070680_100202711 | 3300005336 | Bacteria | 1673 |
| 110 | Ga0070680_100222721 | 3300005336 | Bacteria | 1592 |
| 111 | Ga0070682_100090946 | 3300005337 | Bacteria | 1997 |
| 112 | Ga0070682_100216980 | 3300005337 | Bacteria | 1359 |
| 113 | Ga0070682_100242388 | 3300005337 | Bacteria | 1295 |
| 114 | Ga0070682_100522181 | 3300005337 | Bacteria | 924 |
| 115 | Ga0070682_100791080 | 3300005337 | Bacteria | 770 |
| 116 | Ga0068868_100005336 | 3300005338 | Bacteria | 9021 |
| 117 | Ga0068868_100007038 | 3300005338 | Bacteria | 7995 |
| 118 | Ga0068868_100238554 | 3300005338 | Bacteria | 1527 |
| 119 | Ga0068868_100367190 | 3300005338 | Bacteria | 1236 |
| 120 | Ga0068868_100529446 | 3300005338 | Bacteria | 1036 |
| 121 | Ga0068868_101477755 | 3300005338 | Bacteria | 636 |
| 122 | Ga0068868_102102863 | 3300005338 | Bacteria | 537 |
| 123 | Ga0070660_100002701 | 3300005339 | Bacteria | 12178 |
| 124 | Ga0070660_100149159 | 3300005339 | Bacteria | 1879 |
| 125 | Ga0070660_101599813 | 3300005339 | Bacteria | 554 |
| 126 | Ga0070689_100003115 | 3300005340 | Bacteria | 10952 |
| 127 | Ga0070689_100005312 | 3300005340 | Bacteria | 8780 |
| 128 | Ga0070689_100120991 | 3300005340 | Bacteria | 2091 |
| 129 | Ga0070689_100395249 | 3300005340 | Bacteria | 1167 |
| 130 | Ga0070689_100835885 | 3300005340 | Bacteria | 812 |
| 131 | Ga0070691_10000927 | 3300005341 | Bacteria | 11893 |
| 132 | Ga0070691_10010007 | 3300005341 | Bacteria | 4321 |
| 133 | Ga0070691_10489895 | 3300005341 | Bacteria | 709 |
| 134 | Ga0070687_100000367 | 3300005343 | Bacteria | 15417 |
| 135 | Ga0070687_100074624 | 3300005343 | Bacteria | 1832 |
| 136 | Ga0070687_100175900 | 3300005343 | Bacteria | 1278 |
| 137 | Ga0070687_100411817 | 3300005343 | Bacteria | 889 |
| 138 | Ga0070687_100522856 | 3300005343 | Bacteria | 803 |
| 139 | Ga0070687_100765048 | 3300005343 | Bacteria | 681 |
| 140 | Ga0070661_100007249 | 3300005344 | Bacteria | 7647 |
| 141 | Ga0070661_100207600 | 3300005344 | Bacteria | 1498 |
| 142 | Ga0070692_10000993 | 3300005345 | Bacteria | 9719 |
| 143 | Ga0070692_10069478 | 3300005345 | Bacteria | 1874 |
| 144 | Ga0070692_10075084 | 3300005345 | Bacteria | 1809 |
| 145 | Ga0070692_10095036 | 3300005345 | Bacteria | 1626 |
| 146 | Ga0070692_10413409 | 3300005345 | Bacteria | 854 |
| 147 | Ga0070692_10918085 | 3300005345 | Bacteria | 606 |
| 148 | Ga0070692_11249156 | 3300005345 | Bacteria | 531 |
| 149 | Ga0070668_100253113 | 3300005347 | Bacteria | 1463 |
| 150 | Ga0070668_101844152 | 3300005347 | Bacteria | 556 |
| 151 | Ga0070669_100034552 | 3300005353 | Bacteria | 3660 |
| 152 | Ga0070669_100049156 | 3300005353 | Bacteria | 3079 |
| 153 | Ga0070669_100293599 | 3300005353 | Bacteria | 1305 |
| 154 | Ga0070675_100039670 | 3300005354 | Bacteria | 3843 |
| 155 | Ga0070675_100044347 | 3300005354 | Bacteria | 3637 |
| 156 | Ga0070675_100402268 | 3300005354 | Bacteria | 1222 |
| 157 | Ga0070675_101066640 | 3300005354 | Bacteria | 742 |
| 158 | Ga0070671_100038050 | 3300005355 | Bacteria | 3993 |
| 159 | Ga0070671_100558018 | 3300005355 | Bacteria | 988 |
| 160 | Ga0070671_102096695 | 3300005355 | Bacteria | 504 |
| 161 | Ga0070674_100066570 | 3300005356 | Bacteria | 2532 |
| 162 | Ga0070674_100127966 | 3300005356 | Bacteria | 1889 |
| 163 | Ga0070674_100164801 | 3300005356 | Bacteria | 1685 |
| 164 | Ga0070674_100504462 | 3300005356 | Bacteria | 1008 |
| 165 | Ga0070674_101202538 | 3300005356 | Bacteria | 673 |
| 166 | Ga0070674_101901993 | 3300005356 | Bacteria | 541 |
| 167 | Ga0070673_100024655 | 3300005364 | Bacteria | 4415 |
| 168 | Ga0070673_100051130 | 3300005364 | Bacteria | 3234 |
| 169 | Ga0070673_101339269 | 3300005364 | Bacteria | 673 |
| 170 | Ga0070688_100075036 | 3300005365 | Bacteria | 2173 |
| 171 | Ga0070688_100289505 | 3300005365 | Bacteria | 1180 |
| 172 | Ga0070688_100432243 | 3300005365 | Bacteria | 981 |
| 173 | Ga0070688_100746052 | 3300005365 | Bacteria | 762 |
| 174 | Ga0070688_101018476 | 3300005365 | Bacteria | 659 |
| 175 | Ga0070659_100000069 | 3300005366 | Bacteria | 81078 |
| 176 | Ga0070659_100149269 | 3300005366 | Bacteria | 1906 |
| 177 | Ga0070659_100183772 | 3300005366 | Bacteria | 1716 |
| 178 | Ga0070667_100051694 | 3300005367 | Bacteria | 3465 |
| 179 | Ga0070667_100171074 | 3300005367 | Bacteria | 1918 |
| 180 | Ga0070667_100171495 | 3300005367 | Bacteria | 1915 |
| 181 | Ga0070703_10040538 | 3300005406 | Bacteria | 1448 |
| 182 | Ga0070703_10125036 | 3300005406 | Bacteria | 938 |
| 183 | Ga0070709_10836217 | 3300005434 | Bacteria | 724 |
| 184 | Ga0070709_11208089 | 3300005434 | Bacteria | 608 |
| 185 | Ga0070709_11448720 | 3300005434 | Bacteria | 557 |
| 186 | Ga0070714_100009259 | 3300005435 | Bacteria | 7738 |
| 187 | Ga0070713_100000033 | 3300005436 | Bacteria | 86758 |
| 188 | Ga0070713_100205825 | 3300005436 | Bacteria | 1779 |
| 189 | Ga0070710_10126218 | 3300005437 | Bacteria | 1555 |
| 190 | Ga0070701_10010798 | 3300005438 | Bacteria | 4054 |
| 191 | Ga0070701_10012435 | 3300005438 | Bacteria | 3840 |
| 192 | Ga0070701_10068602 | 3300005438 | Bacteria | 1889 |
| 193 | Ga0070701_10101896 | 3300005438 | Bacteria | 1592 |
| 194 | Ga0070701_10128394 | 3300005438 | Bacteria | 1438 |
| 195 | Ga0070711_100116707 | 3300005439 | Bacteria | 1967 |
| 196 | Ga0070711_100143083 | 3300005439 | Bacteria | 1795 |
| 197 | Ga0070705_100000337 | 3300005440 | Bacteria | 27585 |
| 198 | Ga0070705_100017946 | 3300005440 | Bacteria | 3700 |
| 199 | Ga0070705_100019507 | 3300005440 | Bacteria | 3569 |
| 200 | Ga0070705_100275503 | 3300005440 | Bacteria | 1193 |
| 201 | Ga0070705_100770436 | 3300005440 | Bacteria | 763 |
| 202 | Ga0070705_101185526 | 3300005440 | Bacteria | 628 |
| 203 | Ga0070705_101213804 | 3300005440 | Bacteria | 622 |
| 204 | Ga0070700_100001013 | 3300005441 | Bacteria | 13883 |
| 205 | Ga0070700_100003020 | 3300005441 | Bacteria | 8628 |
| 206 | Ga0070700_100239557 | 3300005441 | Bacteria | 1296 |
| 207 | Ga0070700_100335549 | 3300005441 | Bacteria | 1116 |
| 208 | Ga0070700_100598458 | 3300005441 | Bacteria | 863 |
| 209 | Ga0070700_100606317 | 3300005441 | Bacteria | 858 |
| 210 | Ga0070700_101451055 | 3300005441 | Bacteria | 582 |
| 211 | Ga0070694_100001944 | 3300005444 | Bacteria | 12250 |
| 212 | Ga0070694_100015443 | 3300005444 | Bacteria | 4798 |
| 213 | Ga0070694_100018554 | 3300005444 | Bacteria | 4415 |
| 214 | Ga0070694_100182528 | 3300005444 | Bacteria | 1553 |
| 215 | Ga0070694_100608694 | 3300005444 | Bacteria | 880 |
| 216 | Ga0070694_101204988 | 3300005444 | Bacteria | 634 |
| 217 | Ga0070708_100038088 | 3300005445 | Bacteria | 4199 |
| 218 | Ga0070708_100139816 | 3300005445 | Bacteria | 2245 |
| 219 | Ga0070708_101353564 | 3300005445 | Bacteria | 664 |
| 220 | Ga0070663_100000948 | 3300005455 | Bacteria | 15775 |
| 221 | Ga0070663_100165072 | 3300005455 | Bacteria | 1707 |
| 222 | Ga0070663_100806931 | 3300005455 | Bacteria | 805 |
| 223 | Ga0070663_101234909 | 3300005455 | Bacteria | 658 |
| 224 | Ga0070678_100006957 | 3300005456 | Bacteria | 6677 |
| 225 | Ga0070678_100037773 | 3300005456 | Bacteria | 3394 |
| 226 | Ga0070678_100093579 | 3300005456 | Bacteria | 2311 |
| 227 | Ga0070678_100565762 | 3300005456 | Bacteria | 1011 |
| 228 | Ga0070678_100587316 | 3300005456 | Bacteria | 993 |
| 229 | Ga0070678_100771209 | 3300005456 | Bacteria | 871 |
| 230 | Ga0070678_101221283 | 3300005456 | Bacteria | 698 |
| 231 | Ga0070662_100008477 | 3300005457 | Bacteria | 6706 |
| 232 | Ga0070662_100599011 | 3300005457 | Bacteria | 927 |
| 233 | Ga0070662_101342092 | 3300005457 | Bacteria | 616 |
| 234 | Ga0070662_101783977 | 3300005457 | Bacteria | 531 |
| 235 | Ga0070662_101834102 | 3300005457 | Bacteria | 524 |
| 236 | Ga0070681_10014534 | 3300005458 | Bacteria | 7834 |
| 237 | Ga0070681_10247182 | 3300005458 | Bacteria | 1697 |
| 238 | Ga0070681_10337430 | 3300005458 | Bacteria | 1417 |
| 239 | Ga0070681_10734325 | 3300005458 | Bacteria | 904 |
| 240 | Ga0070681_11315233 | 3300005458 | Bacteria | 646 |
| 241 | Ga0070681_11441575 | 3300005458 | Bacteria | 613 |
| 242 | Ga0068867_100001711 | 3300005459 | Bacteria | 15285 |
| 243 | Ga0068867_100103377 | 3300005459 | Bacteria | 2179 |
| 244 | Ga0068867_100103681 | 3300005459 | Bacteria | 2176 |
| 245 | Ga0068867_100197805 | 3300005459 | Bacteria | 1607 |
| 246 | Ga0068867_100255209 | 3300005459 | Bacteria | 1427 |
| 247 | Ga0068867_100277743 | 3300005459 | Bacteria | 1372 |
| 248 | Ga0068867_100458482 | 3300005459 | Bacteria | 1088 |
| 249 | Ga0068867_100489189 | 3300005459 | Bacteria | 1055 |
| 250 | Ga0068867_100585877 | 3300005459 | Bacteria | 971 |
| 251 | Ga0068867_100634421 | 3300005459 | Bacteria | 935 |
| 252 | Ga0068867_101525580 | 3300005459 | Bacteria | 623 |
| 253 | Ga0070685_10002374 | 3300005466 | Bacteria | 9687 |
| 254 | Ga0070685_11369508 | 3300005466 | Bacteria | 542 |
| 255 | Ga0070685_11562588 | 3300005466 | Bacteria | 510 |
| 256 | Ga0070706_100039082 | 3300005467 | Bacteria | 4381 |
| 257 | Ga0070706_100491786 | 3300005467 | Bacteria | 1141 |
| 258 | Ga0070706_100527406 | 3300005467 | Bacteria | 1099 |
| 259 | Ga0070707_100082853 | 3300005468 | Bacteria | 3098 |
| 260 | Ga0070707_100123962 | 3300005468 | Bacteria | 2509 |
| 261 | Ga0070698_100362862 | 3300005471 | Bacteria | 1381 |
| 262 | Ga0070698_101359718 | 3300005471 | Bacteria | 661 |
| 263 | Ga0070699_100009169 | 3300005518 | Bacteria | 8578 |
| 264 | Ga0070699_100017481 | 3300005518 | Bacteria | 6155 |
| 265 | Ga0070699_100357307 | 3300005518 | Bacteria | 1317 |
| 266 | Ga0070699_100617587 | 3300005518 | Bacteria | 989 |
| 267 | Ga0070699_100698645 | 3300005518 | Bacteria | 927 |
| 268 | Ga0070699_102212258 | 3300005518 | Bacteria | 502 |
| 269 | Ga0070679_100057970 | 3300005530 | Bacteria | 3859 |
| 270 | Ga0070679_100073581 | 3300005530 | Bacteria | 3408 |
| 271 | Ga0070679_100477043 | 3300005530 | Bacteria | 1192 |
| 272 | Ga0070679_101926360 | 3300005530 | Bacteria | 540 |
| 273 | Ga0070684_100111325 | 3300005535 | Bacteria | 2455 |
| 274 | Ga0070684_100504493 | 3300005535 | Bacteria | 1121 |
| 275 | Ga0070684_101482983 | 3300005535 | Bacteria | 639 |
| 276 | Ga0070697_100002415 | 3300005536 | Bacteria | 14379 |
| 277 | Ga0070697_100109125 | 3300005536 | Bacteria | 2304 |
| 278 | Ga0070697_100492962 | 3300005536 | Bacteria | 1071 |
| 279 | Ga0070697_100994230 | 3300005536 | Bacteria | 746 |
| 280 | Ga0070697_101204996 | 3300005536 | Bacteria | 675 |
| 281 | Ga0068853_100431783 | 3300005539 | Bacteria | 1237 |
| 282 | Ga0070672_100096087 | 3300005543 | Bacteria | 2397 |
| 283 | Ga0070672_100454426 | 3300005543 | Bacteria | 1104 |
| 284 | Ga0070672_100550151 | 3300005543 | Bacteria | 1002 |
| 285 | Ga0070672_100670308 | 3300005543 | Bacteria | 907 |
| 286 | Ga0070672_100686925 | 3300005543 | Bacteria | 896 |
| 287 | Ga0070686_100005023 | 3300005544 | Bacteria | 7305 |
| 288 | Ga0070686_100025094 | 3300005544 | Bacteria | 3581 |
| 289 | Ga0070686_100058485 | 3300005544 | Bacteria | 2480 |
| 290 | Ga0070686_100060262 | 3300005544 | Bacteria | 2448 |
| 291 | Ga0070686_101335319 | 3300005544 | Bacteria | 600 |
| 292 | Ga0070686_101508217 | 3300005544 | Bacteria | 567 |
| 293 | Ga0070695_100020705 | 3300005545 | Bacteria | 4017 |
| 294 | Ga0070695_100031232 | 3300005545 | Bacteria | 3320 |
| 295 | Ga0070695_100277680 | 3300005545 | Bacteria | 1230 |
| 296 | Ga0070695_100436886 | 3300005545 | Bacteria | 1000 |
| 297 | Ga0070695_101690757 | 3300005545 | Bacteria | 530 |
| 298 | Ga0070696_100006757 | 3300005546 | Bacteria | 7660 |
| 299 | Ga0070696_100008352 | 3300005546 | Bacteria | 6927 |
| 300 | Ga0070696_100018750 | 3300005546 | Bacteria | 4680 |
| 301 | Ga0070696_100031693 | 3300005546 | Bacteria | 3624 |
| 302 | Ga0070696_100035629 | 3300005546 | Bacteria | 3428 |
| 303 | Ga0070696_100563106 | 3300005546 | Bacteria | 914 |
| 304 | Ga0070696_100586763 | 3300005546 | Bacteria | 897 |
| 305 | Ga0070696_100772219 | 3300005546 | Bacteria | 789 |
| 306 | Ga0070693_100001128 | 3300005547 | Bacteria | 11961 |
| 307 | Ga0070693_100035072 | 3300005547 | Bacteria | 2780 |
| 308 | Ga0070693_100044381 | 3300005547 | Bacteria | 2515 |
| 309 | Ga0070693_100046721 | 3300005547 | Bacteria | 2460 |
| 310 | Ga0070693_100413948 | 3300005547 | Bacteria | 938 |
| 311 | Ga0070693_100584035 | 3300005547 | Bacteria | 804 |
| 312 | Ga0070693_101661734 | 3300005547 | Bacteria | 503 |
| 313 | Ga0070665_100004533 | 3300005548 | Bacteria | 14554 |
| 314 | Ga0070665_100067776 | 3300005548 | Bacteria | 3578 |
| 315 | Ga0070665_100740544 | 3300005548 | Bacteria | 996 |
| 316 | Ga0070704_100002157 | 3300005549 | Bacteria | 10959 |
| 317 | Ga0070704_100091407 | 3300005549 | Bacteria | 2269 |
| 318 | Ga0070704_100108830 | 3300005549 | Bacteria | 2105 |
| 319 | Ga0070704_100255028 | 3300005549 | Bacteria | 1442 |
| 320 | Ga0070704_100353296 | 3300005549 | Bacteria | 1241 |
| 321 | Ga0070704_100856915 | 3300005549 | Bacteria | 815 |
| 322 | Ga0070704_101168360 | 3300005549 | Bacteria | 701 |
| 323 | Ga0068855_100006293 | 3300005563 | Bacteria | 14471 |
| 324 | Ga0068855_100022593 | 3300005563 | Bacteria | 7537 |
| 325 | Ga0068855_101499089 | 3300005563 | Bacteria | 692 |
| 326 | Ga0068855_102088925 | 3300005563 | Bacteria | 571 |
| 327 | Ga0068855_102570993 | 3300005563 | Bacteria | 505 |
| 328 | Ga0070664_100121232 | 3300005564 | Bacteria | 2290 |
| 329 | Ga0070664_100435723 | 3300005564 | Bacteria | 1202 |
| 330 | Ga0070664_101989115 | 3300005564 | Bacteria | 551 |
| 331 | Ga0068857_100716138 | 3300005577 | Bacteria | 952 |
| 332 | Ga0068857_101431922 | 3300005577 | Bacteria | 672 |
| 333 | Ga0068854_100003089 | 3300005578 | Bacteria | 10367 |
| 334 | Ga0068854_100039233 | 3300005578 | Bacteria | 3335 |
| 335 | Ga0068854_100196663 | 3300005578 | Bacteria | 1582 |
| 336 | Ga0068854_101215624 | 3300005578 | Bacteria | 676 |
| 337 | Ga0068854_101847736 | 3300005578 | Bacteria | 554 |
| 338 | Ga0068856_100015760 | 3300005614 | Bacteria | 7308 |
| 339 | Ga0068856_100092377 | 3300005614 | Bacteria | 3011 |
| 340 | Ga0068856_100910117 | 3300005614 | Bacteria | 898 |
| 341 | Ga0068856_101442387 | 3300005614 | Bacteria | 702 |
| 342 | Ga0070702_100000173 | 3300005615 | Bacteria | 20607 |
| 343 | Ga0070702_100000786 | 3300005615 | Bacteria | 12069 |
| 344 | Ga0070702_100043672 | 3300005615 | Bacteria | 2526 |
| 345 | Ga0070702_100067317 | 3300005615 | Bacteria | 2103 |
| 346 | Ga0070702_100148943 | 3300005615 | Bacteria | 1500 |
| 347 | Ga0068852_100154774 | 3300005616 | Bacteria | 2135 |
| 348 | Ga0068852_100434550 | 3300005616 | Bacteria | 1297 |
| 349 | Ga0068852_100815903 | 3300005616 | Bacteria | 947 |
| 350 | Ga0068852_100898805 | 3300005616 | Bacteria | 902 |
| 351 | Ga0068859_100001101 | 3300005617 | Bacteria | 27548 |
| 352 | Ga0068859_100026412 | 3300005617 | Bacteria | 5822 |
| 353 | Ga0068859_101033390 | 3300005617 | Bacteria | 903 |
| 354 | Ga0068859_102739600 | 3300005617 | Bacteria | 542 |
| 355 | Ga0068864_100001698 | 3300005618 | Bacteria | 18102 |
| 356 | Ga0068864_100011774 | 3300005618 | Bacteria | 7225 |
| 357 | Ga0068864_100054311 | 3300005618 | Bacteria | 3457 |
| 358 | Ga0068866_10003479 | 3300005718 | Bacteria | 6451 |
| 359 | Ga0068866_10475879 | 3300005718 | Bacteria | 822 |
| 360 | Ga0068861_100002373 | 3300005719 | Bacteria | 12263 |
| 361 | Ga0068861_100011414 | 3300005719 | Bacteria | 6175 |
| 362 | Ga0068861_100809863 | 3300005719 | Bacteria | 880 |
| 363 | Ga0068861_100875968 | 3300005719 | Bacteria | 848 |
| 364 | Ga0068851_10074453 | 3300005834 | Bacteria | 1763 |
| 365 | Ga0068851_10640704 | 3300005834 | Bacteria | 650 |
| 366 | Ga0068870_10020158 | 3300005840 | Bacteria | 3243 |
| 367 | Ga0068870_10076877 | 3300005840 | Bacteria | 1835 |
| 368 | Ga0068870_10101667 | 3300005840 | Bacteria | 1626 |
| 369 | Ga0068870_10204282 | 3300005840 | Bacteria | 1200 |
| 370 | Ga0068870_10292158 | 3300005840 | Bacteria | 1026 |
| 371 | Ga0068870_10298042 | 3300005840 | Bacteria | 1017 |
| 372 | Ga0068863_100001850 | 3300005841 | Bacteria | 21037 |
| 373 | Ga0068863_100010828 | 3300005841 | Bacteria | 8842 |
| 374 | Ga0068863_100963914 | 3300005841 | Bacteria | 855 |
| 375 | Ga0068858_100001448 | 3300005842 | Bacteria | 24421 |
| 376 | Ga0068858_100002333 | 3300005842 | Bacteria | 19189 |
| 377 | Ga0068858_100085925 | 3300005842 | Bacteria | 2927 |
| 378 | Ga0068858_100504148 | 3300005842 | Bacteria | 1169 |
| 379 | Ga0068858_100926275 | 3300005842 | Bacteria | 853 |
| 380 | Ga0068860_100012728 | 3300005843 | Bacteria | 8275 |
| 381 | Ga0068860_100021165 | 3300005843 | Bacteria | 6299 |
| 382 | Ga0068860_100090825 | 3300005843 | Bacteria | 2909 |
| 383 | Ga0068860_100272407 | 3300005843 | Bacteria | 1652 |
| 384 | Ga0068860_100339252 | 3300005843 | Bacteria | 1477 |
| 385 | Ga0068860_101139523 | 3300005843 | Bacteria | 800 |
| 386 | Ga0068862_100010175 | 3300005844 | Bacteria | 7763 |
| 387 | Ga0068862_100282036 | 3300005844 | Bacteria | 1523 |
| 388 | Ga0068862_100780673 | 3300005844 | Bacteria | 931 |
| 389 | Ga0068862_101169866 | 3300005844 | Bacteria | 767 |
| 390 | Ga0068862_101370799 | 3300005844 | Bacteria | 710 |
| 391 | Ga0081455_10185826 | 3300005937 | Bacteria | 1570 |
| 392 | Ga0070717_10054394 | 3300006028 | Bacteria | 3301 |
| 393 | Ga0070717_11706388 | 3300006028 | Bacteria | 570 |
| 394 | Ga0075368_10000736 | 3300006042 | Bacteria | 10040 |
| 395 | Ga0075368_10412859 | 3300006042 | Bacteria | 594 |
| 396 | Ga0075363_100007656 | 3300006048 | Bacteria | 4981 |
| 397 | Ga0075364_10053044 | 3300006051 | Bacteria | 2650 |
| 398 | Ga0075364_10274581 | 3300006051 | Bacteria | 1146 |
| 399 | Ga0070715_10001565 | 3300006163 | Bacteria | 6711 |
| 400 | Ga0070715_10394870 | 3300006163 | Bacteria | 767 |
| 401 | Ga0070715_10441151 | 3300006163 | Bacteria | 733 |
| 402 | Ga0070716_100203858 | 3300006173 | Bacteria | 1317 |
| 403 | Ga0070716_100631682 | 3300006173 | Bacteria | 809 |
| 404 | Ga0070716_100797665 | 3300006173 | Bacteria | 731 |
| 405 | Ga0070712_100039099 | 3300006175 | Bacteria | 3245 |
| 406 | Ga0070712_100578365 | 3300006175 | Bacteria | 949 |
| 407 | Ga0070712_100608067 | 3300006175 | Bacteria | 926 |
| 408 | Ga0070712_101257228 | 3300006175 | Bacteria | 644 |
| 409 | Ga0075362_10007883 | 3300006177 | Bacteria | 4050 |
| 410 | Ga0075362_10069337 | 3300006177 | Bacteria | 1607 |
| 411 | Ga0075362_10366639 | 3300006177 | Bacteria | 723 |
| 412 | Ga0075367_10365613 | 3300006178 | Bacteria | 911 |
| 413 | Ga0075367_10739734 | 3300006178 | Bacteria | 626 |
| 414 | Ga0075367_10905519 | 3300006178 | Bacteria | 562 |
| 415 | Ga0075369_10016462 | 3300006186 | Bacteria | 2984 |
| 416 | Ga0075369_10062872 | 3300006186 | Bacteria | 1623 |
| 417 | Ga0075366_10039997 | 3300006195 | Bacteria | 2772 |
| 418 | Ga0075366_10041485 | 3300006195 | Bacteria | 2725 |
| 419 | Ga0075366_10112375 | 3300006195 | Bacteria | 1639 |
| 420 | Ga0075366_10478935 | 3300006195 | Bacteria | 769 |
| 421 | Ga0097621_100001873 | 3300006237 | Bacteria | 14405 |
| 422 | Ga0097621_100029495 | 3300006237 | Bacteria | 4333 |
| 423 | Ga0097621_100201076 | 3300006237 | Bacteria | 1730 |
| 424 | Ga0097621_100316444 | 3300006237 | Bacteria | 1381 |
| 425 | Ga0097621_100632032 | 3300006237 | Bacteria | 981 |
| 426 | Ga0097621_100932336 | 3300006237 | Bacteria | 810 |
| 427 | Ga0075370_10011662 | 3300006353 | Bacteria | 4625 |
| 428 | Ga0075370_10311672 | 3300006353 | Bacteria | 937 |
| 429 | Ga0075370_10818962 | 3300006353 | Bacteria | 568 |
| 430 | Ga0068871_100000683 | 3300006358 | Bacteria | 23106 |
| 431 | Ga0068871_100004579 | 3300006358 | Bacteria | 9643 |
| 432 | Ga0068871_100005465 | 3300006358 | Bacteria | 8914 |
| 433 | Ga0068871_100094806 | 3300006358 | Bacteria | 2491 |
| 434 | Ga0068871_100119439 | 3300006358 | Bacteria | 2225 |
| 435 | Ga0068871_100187842 | 3300006358 | Bacteria | 1778 |
| 436 | Ga0068871_100456051 | 3300006358 | Bacteria | 1147 |
| 437 | Ga0068871_100520904 | 3300006358 | Bacteria | 1074 |
| 438 | Ga0068871_100739142 | 3300006358 | Bacteria | 904 |
| 439 | Ga0075428_100000739 | 3300006844 | Bacteria | 33928 |
| 440 | Ga0075428_100031700 | 3300006844 | Bacteria | 5839 |
| 441 | Ga0075428_101054364 | 3300006844 | Bacteria | 859 |
| 442 | Ga0075430_100049871 | 3300006846 | Bacteria | 3532 |
| 443 | Ga0075430_100388341 | 3300006846 | Bacteria | 1152 |
| 444 | Ga0075431_100076505 | 3300006847 | Bacteria | 3454 |
| 445 | Ga0075431_100489816 | 3300006847 | Bacteria | 1221 |
| 446 | Ga0075433_10005869 | 3300006852 | Bacteria | 9673 |
| 447 | Ga0075433_10331567 | 3300006852 | Bacteria | 1345 |
| 448 | Ga0075434_100001032 | 3300006871 | Bacteria | 22671 |
| 449 | Ga0075434_100032843 | 3300006871 | Bacteria | 5119 |
| 450 | Ga0075434_100595219 | 3300006871 | Bacteria | 1125 |
| 451 | Ga0075434_101803666 | 3300006871 | Bacteria | 618 |
| 452 | Ga0075429_100006847 | 3300006880 | Bacteria | 9892 |
| 453 | Ga0068865_100000525 | 3300006881 | Bacteria | 21434 |
| 454 | Ga0068865_100008874 | 3300006881 | Bacteria | 6219 |
| 455 | Ga0068865_100040838 | 3300006881 | Bacteria | 3154 |
| 456 | Ga0068865_100142185 | 3300006881 | Bacteria | 1810 |
| 457 | Ga0068865_100145376 | 3300006881 | Bacteria | 1793 |
| 458 | Ga0068865_100253997 | 3300006881 | Bacteria | 1389 |
| 459 | Ga0068865_101792555 | 3300006881 | Bacteria | 554 |
| 460 | Ga0075436_100000593 | 3300006914 | Bacteria | 23748 |
| 461 | Ga0075436_100004032 | 3300006914 | Bacteria | 10071 |
| 462 | Ga0075436_100100551 | 3300006914 | Bacteria | 2014 |
| 463 | Ga0075436_100193939 | 3300006914 | Bacteria | 1438 |
| 464 | Ga0075436_100343477 | 3300006914 | Bacteria | 1075 |
| 465 | Ga0097620_100001101 | 3300006931 | Bacteria | 27548 |
| 466 | Ga0097620_100026411 | 3300006931 | Bacteria | 5822 |
| 467 | Ga0097620_101033401 | 3300006931 | Bacteria | 903 |
| 468 | Ga0097620_102739579 | 3300006931 | Bacteria | 542 |
| 469 | Ga0079104_1007537 | 3300006946 | Bacteria | 3922 |
| 470 | Ga0079104_1073049 | 3300006946 | Bacteria | 717 |
| 471 | Ga0099826_10000002 | 3300006948 | Bacteria | 1125830 |
| 472 | Ga0075435_100001154 | 3300007076 | Bacteria | 16862 |
| 473 | Ga0075435_100136269 | 3300007076 | Bacteria | 2057 |
| 474 | Ga0075435_100704185 | 3300007076 | Bacteria | 878 |
| 475 | Ga0075435_100998947 | 3300007076 | Bacteria | 731 |
| 476 | Ga0075435_101196417 | 3300007076 | Bacteria | 665 |
| 477 | Ga0099794_10008812 | 3300007265 | Bacteria | 4204 |
| 478 | Ga0099794_10014278 | 3300007265 | Bacteria | 3476 |
| 479 | Ga0105244_10002910 | 3300009036 | Bacteria | 12645 |
| 480 | Ga0105244_10026470 | 3300009036 | Bacteria | 3138 |
| 481 | Ga0105244_10074139 | 3300009036 | Bacteria | 1693 |
| 482 | Ga0105244_10080953 | 3300009036 | Bacteria | 1608 |
| 483 | Ga0105250_10012744 | 3300009092 | Bacteria | 3463 |
| 484 | Ga0105250_10471920 | 3300009092 | Bacteria | 566 |
| 485 | Ga0105240_10059642 | 3300009093 | Bacteria | 4761 |
| 486 | Ga0105240_10440776 | 3300009093 | Bacteria | 1459 |
| 487 | Ga0105240_10544914 | 3300009093 | Bacteria | 1284 |
| 488 | Ga0105240_10813815 | 3300009093 | Bacteria | 1011 |
| 489 | Ga0111539_10016757 | 3300009094 | Bacteria | 9082 |
| 490 | Ga0111539_10035731 | 3300009094 | Bacteria | 6014 |
| 491 | Ga0111539_10067447 | 3300009094 | Bacteria | 4225 |
| 492 | Ga0111539_10190070 | 3300009094 | Bacteria | 2396 |
| 493 | Ga0111539_10449066 | 3300009094 | Bacteria | 1501 |
| 494 | Ga0111539_10614705 | 3300009094 | Bacteria | 1266 |
| 495 | Ga0111539_11647413 | 3300009094 | Bacteria | 744 |
| 496 | Ga0105245_10000207 | 3300009098 | Bacteria | 55562 |
| 497 | Ga0105245_10002185 | 3300009098 | Bacteria | 17735 |
| 498 | Ga0105245_10009972 | 3300009098 | Bacteria | 8274 |
| 499 | Ga0105245_10047291 | 3300009098 | Bacteria | 3846 |
| 500 | Ga0105245_10065006 | 3300009098 | Bacteria | 3298 |
| 501 | Ga0105245_10296783 | 3300009098 | Bacteria | 1584 |
| 502 | Ga0105245_10600671 | 3300009098 | Bacteria | 1127 |
| 503 | Ga0105245_11851361 | 3300009098 | Bacteria | 656 |
| 504 | Ga0105247_10854581 | 3300009101 | Bacteria | 699 |
| 505 | Ga0114129_10002453 | 3300009147 | Bacteria | 25761 |
| 506 | Ga0114129_12058377 | 3300009147 | Bacteria | 689 |
| 507 | Ga0114129_13007808 | 3300009147 | Bacteria | 554 |
| 508 | Ga0114129_13442050 | 3300009147 | Bacteria | 508 |
| 509 | Ga0105243_10002103 | 3300009148 | Bacteria | 16844 |
| 510 | Ga0105243_10034302 | 3300009148 | Bacteria | 3927 |
| 511 | Ga0105243_10229178 | 3300009148 | Bacteria | 1647 |
| 512 | Ga0105243_10240291 | 3300009148 | Bacteria | 1611 |
| 513 | Ga0105243_10273712 | 3300009148 | Bacteria | 1517 |
| 514 | Ga0105243_10488771 | 3300009148 | Bacteria | 1163 |
| 515 | Ga0105243_10526241 | 3300009148 | Bacteria | 1125 |
| 516 | Ga0105241_10027264 | 3300009174 | Bacteria | 4254 |
| 517 | Ga0105241_10084895 | 3300009174 | Bacteria | 2487 |
| 518 | Ga0105241_10215242 | 3300009174 | Bacteria | 1612 |
| 519 | Ga0105241_10352599 | 3300009174 | Bacteria | 1278 |
| 520 | Ga0105241_10426444 | 3300009174 | Bacteria | 1168 |
| 521 | Ga0105241_11632607 | 3300009174 | Bacteria | 624 |
| 522 | Ga0105242_10003926 | 3300009176 | Bacteria | 11556 |
| 523 | Ga0105242_10028574 | 3300009176 | Bacteria | 4442 |
| 524 | Ga0105242_10029121 | 3300009176 | Bacteria | 4402 |
| 525 | Ga0105242_10078387 | 3300009176 | Bacteria | 2758 |
| 526 | Ga0105242_10135719 | 3300009176 | Bacteria | 2129 |
| 527 | Ga0105242_10211028 | 3300009176 | Bacteria | 1730 |
| 528 | Ga0105242_10246046 | 3300009176 | Bacteria | 1610 |
| 529 | Ga0105242_10288371 | 3300009176 | Bacteria | 1494 |
| 530 | Ga0105242_10550654 | 3300009176 | Bacteria | 1106 |
| 531 | Ga0105242_10705721 | 3300009176 | Bacteria | 987 |
| 532 | Ga0105242_10793245 | 3300009176 | Bacteria | 937 |
| 533 | Ga0105242_10959647 | 3300009176 | Bacteria | 860 |
| 534 | Ga0105248_10074665 | 3300009177 | Bacteria | 3811 |
| 535 | Ga0105248_10487409 | 3300009177 | Bacteria | 1390 |
| 536 | Ga0105237_10237724 | 3300009545 | Bacteria | 1823 |
| 537 | Ga0105237_10422571 | 3300009545 | Bacteria | 1338 |
| 538 | Ga0105237_11492344 | 3300009545 | Bacteria | 683 |
| 539 | Ga0105237_11696217 | 3300009545 | Bacteria | 639 |
| 540 | Ga0105237_11992775 | 3300009545 | Bacteria | 589 |
| 541 | Ga0105238_10014457 | 3300009551 | Bacteria | 7982 |
| 542 | Ga0105238_10166660 | 3300009551 | Bacteria | 2179 |
| 543 | Ga0105238_10324128 | 3300009551 | Bacteria | 1527 |
| 544 | Ga0105238_10800005 | 3300009551 | Bacteria | 958 |
| 545 | Ga0105238_11324159 | 3300009551 | Bacteria | 746 |
| 546 | Ga0105249_10501152 | 3300009553 | Bacteria | 1259 |
| 547 | Ga0105249_10509420 | 3300009553 | Bacteria | 1250 |
| 548 | Ga0105249_10691656 | 3300009553 | Bacteria | 1079 |
| 549 | Ga0105249_11224652 | 3300009553 | Bacteria | 822 |
| 550 | Ga0105249_11350139 | 3300009553 | Bacteria | 785 |
| 551 | Ga0105249_12279995 | 3300009553 | Bacteria | 614 |
| 552 | Ga0105239_10009227 | 3300010375 | Bacteria | 11158 |
| 553 | Ga0105239_10243567 | 3300010375 | Bacteria | 2018 |
| 554 | Ga0105239_10774454 | 3300010375 | Bacteria | 1099 |
| 555 | Ga0105239_12934718 | 3300010375 | Bacteria | 556 |
| 556 | Ga0105246_10142109 | 3300011119 | Bacteria | 1806 |
| 557 | Ga0105246_10161956 | 3300011119 | Bacteria | 1705 |
| 558 | Ga0105246_10267141 | 3300011119 | Bacteria | 1366 |
| 559 | Ga0105246_11016956 | 3300011119 | Bacteria | 751 |
| 560 | Ga0105246_11041241 | 3300011119 | Bacteria | 743 |
| 561 | Ga0105246_11226184 | 3300011119 | Bacteria | 692 |
| 562 | Ga0105246_11243297 | 3300011119 | Bacteria | 687 |
| 563 | Ga0157341_1002745 | 3300012494 | Bacteria | 1185 |
| 564 | Ga0157347_1033888 | 3300012502 | Bacteria | 651 |
| 565 | Ga0157327_1012740 | 3300012512 | Bacteria | 834 |
| 566 | Ga0157373_10088518 | 3300013100 | Bacteria | 2181 |
| 567 | Ga0157373_10263286 | 3300013100 | Bacteria | 1220 |
| 568 | Ga0157373_10486590 | 3300013100 | Bacteria | 890 |
| 569 | Ga0157373_10579918 | 3300013100 | Bacteria | 815 |
| 570 | Ga0157373_10965097 | 3300013100 | Bacteria | 635 |
| 571 | Ga0157373_11355520 | 3300013100 | Bacteria | 540 |
| 572 | Ga0157371_10049583 | 3300013102 | Bacteria | 2982 |
| 573 | Ga0157371_10502672 | 3300013102 | Bacteria | 895 |
| 574 | Ga0157371_10888147 | 3300013102 | Bacteria | 675 |
| 575 | Ga0157371_11236536 | 3300013102 | Bacteria | 576 |
| 576 | Ga0157370_10062393 | 3300013104 | Bacteria | 3535 |
| 577 | Ga0157370_10286291 | 3300013104 | Bacteria | 1522 |
| 578 | Ga0157369_10137815 | 3300013105 | Bacteria | 2583 |
| 579 | Ga0157369_10838119 | 3300013105 | Bacteria | 944 |
| 580 | Ga0157374_10373902 | 3300013296 | Bacteria | 1419 |
| 581 | Ga0157374_10378539 | 3300013296 | Bacteria | 1410 |
| 582 | Ga0157374_10823628 | 3300013296 | Bacteria | 944 |
| 583 | Ga0157378_10001175 | 3300013297 | Bacteria | 23842 |
| 584 | Ga0157378_10099224 | 3300013297 | Bacteria | 2657 |
| 585 | Ga0157378_10622956 | 3300013297 | Bacteria | 1092 |
| 586 | Ga0163162_10082727 | 3300013306 | Bacteria | 3282 |
| 587 | Ga0163162_10161956 | 3300013306 | Bacteria | 2359 |
| 588 | Ga0163162_10335810 | 3300013306 | Bacteria | 1644 |
| 589 | Ga0163162_10344066 | 3300013306 | Bacteria | 1624 |
| 590 | Ga0163162_10413738 | 3300013306 | Bacteria | 1481 |
| 591 | Ga0163162_10544677 | 3300013306 | Bacteria | 1289 |
| 592 | Ga0157372_10149662 | 3300013307 | Bacteria | 2693 |
| 593 | Ga0157372_10157848 | 3300013307 | Bacteria | 2620 |
| 594 | Ga0157372_11084170 | 3300013307 | Bacteria | 927 |
| 595 | Ga0157372_11114294 | 3300013307 | Bacteria | 913 |
| 596 | Ga0157372_11384010 | 3300013307 | Bacteria | 811 |
| 597 | Ga0157375_10047744 | 3300013308 | Bacteria | 4183 |
| 598 | Ga0157375_10308546 | 3300013308 | Bacteria | 1746 |
| 599 | Ga0157375_10729740 | 3300013308 | Bacteria | 1143 |
| 600 | Ga0157375_11469622 | 3300013308 | Bacteria | 804 |
| 601 | Ga0163163_10009593 | 3300014325 | Bacteria | 8649 |
| 602 | Ga0163163_10019560 | 3300014325 | Bacteria | 6361 |
| 603 | Ga0163163_10846802 | 3300014325 | Bacteria | 978 |
| 604 | Ga0163163_12237882 | 3300014325 | Bacteria | 606 |
| 605 | Ga0157380_10022168 | 3300014326 | Bacteria | 4776 |
| 606 | Ga0157380_10533822 | 3300014326 | Bacteria | 1147 |
| 607 | Ga0157380_10690874 | 3300014326 | Bacteria | 1024 |
| 608 | Ga0157380_10828368 | 3300014326 | Bacteria | 945 |
| 609 | Ga0182008_10001210 | 3300014497 | Bacteria | 17771 |
| 610 | Ga0182008_10160810 | 3300014497 | Bacteria | 1130 |
| 611 | Ga0157377_10111584 | 3300014745 | Bacteria | 1644 |
| 612 | Ga0157377_10269917 | 3300014745 | Bacteria | 1110 |
| 613 | Ga0157377_10420019 | 3300014745 | Bacteria | 915 |
| 614 | Ga0157379_10006994 | 3300014968 | Bacteria | 9753 |
| 615 | Ga0157379_10361025 | 3300014968 | Bacteria | 1331 |
| 616 | Ga0157379_10413899 | 3300014968 | Bacteria | 1241 |
| 617 | Ga0157379_10760102 | 3300014968 | Bacteria | 913 |
| 618 | Ga0157379_10793644 | 3300014968 | Bacteria | 893 |
| 619 | Ga0157379_11010040 | 3300014968 | Bacteria | 793 |
| 620 | Ga0157376_10041180 | 3300014969 | Bacteria | 3781 |
| 621 | Ga0157376_10044345 | 3300014969 | Bacteria | 3655 |
| 622 | Ga0157376_10071273 | 3300014969 | Bacteria | 2953 |
| 623 | Ga0157376_10368791 | 3300014969 | Bacteria | 1379 |
| 624 | Ga0157376_10440993 | 3300014969 | Bacteria | 1268 |
| 625 | Ga0157376_10776137 | 3300014969 | Bacteria | 969 |
| 626 | Ga0157376_12141178 | 3300014969 | Bacteria | 598 |
| 627 | Ga0182006_1000002 | 3300015261 | Bacteria | 887990 |
| 628 | Ga0182006_1000026 | 3300015261 | Bacteria | 253543 |
| 629 | Ga0182006_1037733 | 3300015261 | Bacteria | 1914 |
| 630 | Ga0182006_1068722 | 3300015261 | Bacteria | 1318 |
| 631 | Ga0182006_1145629 | 3300015261 | Bacteria | 806 |
| 632 | Ga0182006_1241352 | 3300015261 | Bacteria | 594 |
| 633 | Ga0182007_10000159 | 3300015262 | Bacteria | 46374 |
| 634 | Ga0182007_10024981 | 3300015262 | Bacteria | 2085 |
| 635 | Ga0182007_10080783 | 3300015262 | Bacteria | 1066 |
| 636 | Ga0182007_10082433 | 3300015262 | Bacteria | 1055 |
| 637 | Ga0182005_1000002 | 3300015265 | Bacteria | 908499 |
| 638 | Ga0182005_1000007 | 3300015265 | Bacteria | 490994 |
| 639 | Ga0182005_1020747 | 3300015265 | Bacteria | 1805 |
| 640 | Ga0163161_10021691 | 3300017792 | Bacteria | 4514 |
| 641 | Ga0163161_10045173 | 3300017792 | Bacteria | 3176 |
| 642 | Ga0163161_10047644 | 3300017792 | Bacteria | 3094 |
| 643 | Ga0163161_10174521 | 3300017792 | Bacteria | 1645 |
| 644 | Ga0163161_11853290 | 3300017792 | Bacteria | 537 |
| 645 | Ga0206351_10512431 | 3300020077 | Bacteria | 625 |
| 646 | Ga0206350_10748337 | 3300020080 | Bacteria | 664 |
| 647 | Ga0154015_1698159 | 3300020610 | Bacteria | 564 |
| 648 | Ga0213872_10000028 | 3300021361 | Bacteria | 148766 |
| 649 | Ga0213872_10000921 | 3300021361 | Bacteria | 20878 |
| 650 | Ga0213872_10097561 | 3300021361 | Bacteria | 1312 |
| 651 | Ga0213872_10255684 | 3300021361 | Bacteria | 737 |
| 652 | Ga0213876_10330753 | 3300021384 | Bacteria | 810 |
| 653 | Ga0209435_100013 | 3300025206 | Bacteria | 366789 |
| 654 | Ga0209435_100862 | 3300025206 | Bacteria | 4685 |
| 655 | Ga0209436_100857 | 3300025208 | Bacteria | 12209 |
| 656 | Ga0209566_100521 | 3300025225 | Bacteria | 26331 |
| 657 | Ga0209674_109866 | 3300025226 | Bacteria | 1046 |
| 658 | Ga0209672_100033 | 3300025228 | Bacteria | 315326 |
| 659 | Ga0209672_100114 | 3300025228 | Bacteria | 90538 |
| 660 | Ga0209147_100030 | 3300025229 | Bacteria | 366789 |
| 661 | Ga0209147_100161 | 3300025229 | Bacteria | 90627 |
| 662 | Ga0209147_100390 | 3300025229 | Bacteria | 30099 |
| 663 | Ga0209147_110450 | 3300025229 | Bacteria | 1062 |
| 664 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 665 | Ga0209258_100100 | 3300025242 | Bacteria | 214027 |
| 666 | Ga0209258_100205 | 3300025242 | Bacteria | 119727 |
| 667 | Ga0209258_100263 | 3300025242 | Bacteria | 90453 |
| 668 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 669 | Ga0207425_1000143 | 3300025245 | Bacteria | 62334 |
| 670 | Ga0209646_1000010 | 3300025246 | Bacteria | 573803 |
| 671 | Ga0209646_1000034 | 3300025246 | Bacteria | 366789 |
| 672 | Ga0209646_1000135 | 3300025246 | Bacteria | 124235 |
| 673 | Ga0209026_1000022 | 3300025250 | Bacteria | 366789 |
| 674 | Ga0209026_1004343 | 3300025250 | Bacteria | 4245 |
| 675 | Ga0209026_1007871 | 3300025250 | Bacteria | 2313 |
| 676 | Ga0209677_102467 | 3300025253 | Bacteria | 6934 |
| 677 | Ga0209148_1000432 | 3300025254 | Bacteria | 46257 |
| 678 | Ga0209148_1001082 | 3300025254 | Bacteria | 16579 |
| 679 | Ga0209148_1001416 | 3300025254 | Bacteria | 12285 |
| 680 | Ga0209148_1016550 | 3300025254 | Bacteria | 1267 |
| 681 | Ga0209148_1030510 | 3300025254 | Bacteria | 807 |
| 682 | Ga0209759_1000018 | 3300025256 | Bacteria | 366789 |
| 683 | Ga0209759_1000133 | 3300025256 | Bacteria | 126928 |
| 684 | Ga0209759_1000890 | 3300025256 | Bacteria | 22545 |
| 685 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 686 | Ga0209233_1090303 | 3300025261 | Bacteria | 526 |
| 687 | Ga0209565_1000057 | 3300025263 | Bacteria | 196908 |
| 688 | Ga0209565_1001088 | 3300025263 | Bacteria | 13531 |
| 689 | Ga0209565_1004368 | 3300025263 | Bacteria | 4313 |
| 690 | Ga0209565_1006127 | 3300025263 | Bacteria | 3413 |
| 691 | Ga0209455_1000037 | 3300025272 | Bacteria | 464097 |
| 692 | Ga0209455_1000192 | 3300025272 | Bacteria | 90553 |
| 693 | Ga0209673_1000051 | 3300025273 | Bacteria | 282161 |
| 694 | Ga0209673_1000332 | 3300025273 | Bacteria | 86973 |
| 695 | Ga0209673_1010506 | 3300025273 | Bacteria | 3898 |
| 696 | Ga0209130_1000268 | 3300025284 | Bacteria | 65115 |
| 697 | Ga0209130_1004305 | 3300025284 | Bacteria | 5493 |
| 698 | Ga0209675_1000027 | 3300025291 | Bacteria | 282175 |
| 699 | Ga0209675_1002448 | 3300025291 | Bacteria | 9538 |
| 700 | Ga0209675_1048852 | 3300025291 | Bacteria | 883 |
| 701 | Ga0209025_1001845 | 3300025294 | Bacteria | 24883 |
| 702 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 703 | Ga0209564_1000033 | 3300025295 | Bacteria | 446200 |
| 704 | Ga0209564_1000094 | 3300025295 | Bacteria | 243176 |
| 705 | Ga0209564_1002669 | 3300025295 | Bacteria | 13536 |
| 706 | Ga0209564_1003700 | 3300025295 | Bacteria | 10066 |
| 707 | Ga0209758_1000073 | 3300025297 | Bacteria | 276262 |
| 708 | Ga0209758_1001766 | 3300025297 | Bacteria | 23985 |
| 709 | Ga0209050_1000046 | 3300025298 | Bacteria | 386466 |
| 710 | Ga0209256_1000044 | 3300025299 | Bacteria | 337264 |
| 711 | Ga0209256_1000139 | 3300025299 | Bacteria | 155515 |
| 712 | Ga0209256_1003060 | 3300025299 | Bacteria | 12314 |
| 713 | Ga0209256_1006799 | 3300025299 | Bacteria | 5903 |
| 714 | Ga0207426_1001318 | 3300025302 | Bacteria | 21153 |
| 715 | Ga0207426_1030983 | 3300025302 | Bacteria | 1749 |
| 716 | Ga0209051_1007011 | 3300025303 | Bacteria | 6243 |
| 717 | Ga0209257_1000728 | 3300025304 | Bacteria | 49918 |
| 718 | Ga0207697_10039612 | 3300025315 | Bacteria | 1933 |
| 719 | Ga0207697_10342404 | 3300025315 | Bacteria | 664 |
| 720 | Ga0207656_10405524 | 3300025321 | Bacteria | 685 |
| 721 | Ga0207696_1022174 | 3300025711 | Bacteria | 2022 |
| 722 | Ga0207655_1010587 | 3300025728 | Bacteria | 5578 |
| 723 | Ga0207655_1046953 | 3300025728 | Bacteria | 1787 |
| 724 | Ga0207655_1096525 | 3300025728 | Bacteria | 1028 |
| 725 | Ga0207655_1147135 | 3300025728 | Bacteria | 749 |
| 726 | Ga0207653_10044471 | 3300025885 | Bacteria | 1464 |
| 727 | Ga0207653_10056955 | 3300025885 | Bacteria | 1311 |
| 728 | Ga0207653_10421718 | 3300025885 | Bacteria | 523 |
| 729 | Ga0207682_10026427 | 3300025893 | Bacteria | 2308 |
| 730 | Ga0207682_10104475 | 3300025893 | Bacteria | 1241 |
| 731 | Ga0207692_10056492 | 3300025898 | Bacteria | 2014 |
| 732 | Ga0207692_10336212 | 3300025898 | Bacteria | 928 |
| 733 | Ga0207642_10047120 | 3300025899 | Bacteria | 1925 |
| 734 | Ga0207642_10131008 | 3300025899 | Bacteria | 1309 |
| 735 | Ga0207710_10446685 | 3300025900 | Bacteria | 667 |
| 736 | Ga0207688_10108080 | 3300025901 | Bacteria | 1612 |
| 737 | Ga0207688_10207192 | 3300025901 | Bacteria | 1177 |
| 738 | Ga0207680_10066788 | 3300025903 | Bacteria | 2213 |
| 739 | Ga0207680_10411094 | 3300025903 | Bacteria | 957 |
| 740 | Ga0207647_10000981 | 3300025904 | Bacteria | 22111 |
| 741 | Ga0207647_10051255 | 3300025904 | Bacteria | 2552 |
| 742 | Ga0207647_10749190 | 3300025904 | Bacteria | 529 |
| 743 | Ga0207699_10840643 | 3300025906 | Bacteria | 676 |
| 744 | Ga0207699_11123785 | 3300025906 | Bacteria | 582 |
| 745 | Ga0207645_10122932 | 3300025907 | Bacteria | 1686 |
| 746 | Ga0207643_10005920 | 3300025908 | Bacteria | 6530 |
| 747 | Ga0207643_10014328 | 3300025908 | Bacteria | 4305 |
| 748 | Ga0207643_10067012 | 3300025908 | Bacteria | 2060 |
| 749 | Ga0207643_10084057 | 3300025908 | Bacteria | 1847 |
| 750 | Ga0207643_10134663 | 3300025908 | Bacteria | 1472 |
| 751 | Ga0207643_10969372 | 3300025908 | Bacteria | 550 |
| 752 | Ga0207705_10281000 | 3300025909 | Bacteria | 1274 |
| 753 | Ga0207705_10316254 | 3300025909 | Bacteria | 1199 |
| 754 | Ga0207684_10279875 | 3300025910 | Bacteria | 1439 |
| 755 | Ga0207684_10376536 | 3300025910 | Bacteria | 1221 |
| 756 | Ga0207684_10500548 | 3300025910 | Bacteria | 1041 |
| 757 | Ga0207654_10030723 | 3300025911 | Bacteria | 2952 |
| 758 | Ga0207654_10077230 | 3300025911 | Bacteria | 1996 |
| 759 | Ga0207654_10118379 | 3300025911 | Bacteria | 1659 |
| 760 | Ga0207654_10360049 | 3300025911 | Bacteria | 1003 |
| 761 | Ga0207654_11044637 | 3300025911 | Bacteria | 595 |
| 762 | Ga0207707_10033786 | 3300025912 | Bacteria | 4476 |
| 763 | Ga0207707_10053572 | 3300025912 | Bacteria | 3512 |
| 764 | Ga0207707_10399872 | 3300025912 | Bacteria | 1179 |
| 765 | Ga0207707_10427013 | 3300025912 | Bacteria | 1136 |
| 766 | Ga0207695_10001528 | 3300025913 | Bacteria | 38261 |
| 767 | Ga0207695_10012279 | 3300025913 | Bacteria | 10287 |
| 768 | Ga0207695_10302505 | 3300025913 | Bacteria | 1491 |
| 769 | Ga0207695_10361267 | 3300025913 | Bacteria | 1339 |
| 770 | Ga0207695_11141749 | 3300025913 | Bacteria | 659 |
| 771 | Ga0207671_10008283 | 3300025914 | Bacteria | 8841 |
| 772 | Ga0207693_10001263 | 3300025915 | Bacteria | 22541 |
| 773 | Ga0207693_10189721 | 3300025915 | Bacteria | 1618 |
| 774 | Ga0207693_10268559 | 3300025915 | Bacteria | 1337 |
| 775 | Ga0207693_10944929 | 3300025915 | Bacteria | 660 |
| 776 | Ga0207663_10307781 | 3300025916 | Bacteria | 1186 |
| 777 | Ga0207663_10542816 | 3300025916 | Bacteria | 908 |
| 778 | Ga0207660_10047276 | 3300025917 | Bacteria | 3041 |
| 779 | Ga0207660_10047629 | 3300025917 | Bacteria | 3032 |
| 780 | Ga0207660_10142159 | 3300025917 | Bacteria | 1835 |
| 781 | Ga0207660_10180225 | 3300025917 | Bacteria | 1640 |
| 782 | Ga0207662_10000577 | 3300025918 | Bacteria | 16347 |
| 783 | Ga0207662_10067141 | 3300025918 | Bacteria | 2162 |
| 784 | Ga0207662_10128095 | 3300025918 | Bacteria | 1598 |
| 785 | Ga0207657_10000068 | 3300025919 | Bacteria | 96575 |
| 786 | Ga0207657_10001348 | 3300025919 | Bacteria | 26123 |
| 787 | Ga0207657_10184294 | 3300025919 | Bacteria | 1686 |
| 788 | Ga0207657_10468472 | 3300025919 | Bacteria | 988 |
| 789 | Ga0207649_10181300 | 3300025920 | Bacteria | 1474 |
| 790 | Ga0207649_10640928 | 3300025920 | Bacteria | 820 |
| 791 | Ga0207652_10394896 | 3300025921 | Bacteria | 1248 |
| 792 | Ga0207652_11155970 | 3300025921 | Bacteria | 675 |
| 793 | Ga0207646_10075873 | 3300025922 | Bacteria | 3004 |
| 794 | Ga0207646_10419930 | 3300025922 | Bacteria | 1207 |
| 795 | Ga0207681_10002320 | 3300025923 | Bacteria | 12099 |
| 796 | Ga0207681_10021046 | 3300025923 | Bacteria | 4140 |
| 797 | Ga0207681_11324076 | 3300025923 | Bacteria | 605 |
| 798 | Ga0207694_10005697 | 3300025924 | Bacteria | 9550 |
| 799 | Ga0207694_10173702 | 3300025924 | Bacteria | 1745 |
| 800 | Ga0207694_10833845 | 3300025924 | Bacteria | 779 |
| 801 | Ga0207650_10010546 | 3300025925 | Bacteria | 6343 |
| 802 | Ga0207650_10726181 | 3300025925 | Bacteria | 840 |
| 803 | Ga0207650_11698397 | 3300025925 | Bacteria | 535 |
| 804 | Ga0207659_10002190 | 3300025926 | Bacteria | 11611 |
| 805 | Ga0207659_10073385 | 3300025926 | Bacteria | 2505 |
| 806 | Ga0207659_10184790 | 3300025926 | Bacteria | 1654 |
| 807 | Ga0207659_10338378 | 3300025926 | Bacteria | 1246 |
| 808 | Ga0207659_11574010 | 3300025926 | Bacteria | 561 |
| 809 | Ga0207687_10002891 | 3300025927 | Bacteria | 11663 |
| 810 | Ga0207687_10033850 | 3300025927 | Bacteria | 3467 |
| 811 | Ga0207687_10061275 | 3300025927 | Bacteria | 2657 |
| 812 | Ga0207687_10132207 | 3300025927 | Bacteria | 1883 |
| 813 | Ga0207687_10189604 | 3300025927 | Bacteria | 1599 |
| 814 | Ga0207700_10000099 | 3300025928 | Bacteria | 53179 |
| 815 | Ga0207700_10023848 | 3300025928 | Bacteria | 4227 |
| 816 | Ga0207700_10037033 | 3300025928 | Bacteria | 3529 |
| 817 | Ga0207664_10000454 | 3300025929 | Bacteria | 29097 |
| 818 | Ga0207644_10004698 | 3300025931 | Bacteria | 8874 |
| 819 | Ga0207644_10142857 | 3300025931 | Bacteria | 1845 |
| 820 | Ga0207644_10443426 | 3300025931 | Bacteria | 1066 |
| 821 | Ga0207690_10000027 | 3300025932 | Bacteria | 162225 |
| 822 | Ga0207690_10078703 | 3300025932 | Bacteria | 2295 |
| 823 | Ga0207706_10006695 | 3300025933 | Bacteria | 10654 |
| 824 | Ga0207706_10082422 | 3300025933 | Bacteria | 2827 |
| 825 | Ga0207706_10113429 | 3300025933 | Bacteria | 2384 |
| 826 | Ga0207706_10372542 | 3300025933 | Bacteria | 1240 |
| 827 | Ga0207706_10405415 | 3300025933 | Bacteria | 1182 |
| 828 | Ga0207706_10550041 | 3300025933 | Bacteria | 994 |
| 829 | Ga0207686_10000488 | 3300025934 | Bacteria | 26043 |
| 830 | Ga0207686_10000586 | 3300025934 | Bacteria | 22804 |
| 831 | Ga0207686_10002850 | 3300025934 | Bacteria | 9326 |
| 832 | Ga0207686_10149169 | 3300025934 | Bacteria | 1626 |
| 833 | Ga0207686_10150170 | 3300025934 | Bacteria | 1621 |
| 834 | Ga0207686_10162748 | 3300025934 | Bacteria | 1566 |
| 835 | Ga0207686_10325907 | 3300025934 | Bacteria | 1149 |
| 836 | Ga0207686_10571203 | 3300025934 | Bacteria | 886 |
| 837 | Ga0207686_10890787 | 3300025934 | Bacteria | 717 |
| 838 | Ga0207686_11728651 | 3300025934 | Bacteria | 517 |
| 839 | Ga0207709_10001240 | 3300025935 | Bacteria | 18327 |
| 840 | Ga0207709_10004162 | 3300025935 | Bacteria | 8418 |
| 841 | Ga0207709_10055857 | 3300025935 | Bacteria | 2441 |
| 842 | Ga0207709_10155586 | 3300025935 | Bacteria | 1588 |
| 843 | Ga0207709_10239248 | 3300025935 | Bacteria | 1320 |
| 844 | Ga0207709_10332762 | 3300025935 | Bacteria | 1140 |
| 845 | Ga0207709_10459528 | 3300025935 | Bacteria | 986 |
| 846 | Ga0207709_10766363 | 3300025935 | Bacteria | 777 |
| 847 | Ga0207709_10801541 | 3300025935 | Bacteria | 760 |
| 848 | Ga0207670_10001102 | 3300025936 | Bacteria | 14210 |
| 849 | Ga0207670_10021580 | 3300025936 | Bacteria | 3976 |
| 850 | Ga0207670_10149171 | 3300025936 | Bacteria | 1733 |
| 851 | Ga0207670_10627845 | 3300025936 | Bacteria | 884 |
| 852 | Ga0207670_10836371 | 3300025936 | Bacteria | 768 |
| 853 | Ga0207669_10050794 | 3300025937 | Bacteria | 2481 |
| 854 | Ga0207669_10189862 | 3300025937 | Bacteria | 1481 |
| 855 | Ga0207669_10258572 | 3300025937 | Bacteria | 1301 |
| 856 | Ga0207669_10482318 | 3300025937 | Bacteria | 989 |
| 857 | Ga0207704_10000475 | 3300025938 | Bacteria | 17855 |
| 858 | Ga0207704_10160498 | 3300025938 | Bacteria | 1599 |
| 859 | Ga0207704_10218818 | 3300025938 | Bacteria | 1407 |
| 860 | Ga0207704_11061273 | 3300025938 | Bacteria | 687 |
| 861 | Ga0207665_10014048 | 3300025939 | Bacteria | 5268 |
| 862 | Ga0207665_10455767 | 3300025939 | Bacteria | 982 |
| 863 | Ga0207691_10062473 | 3300025940 | Bacteria | 3379 |
| 864 | Ga0207691_10082111 | 3300025940 | Bacteria | 2896 |
| 865 | Ga0207691_10106456 | 3300025940 | Bacteria | 2498 |
| 866 | Ga0207691_10232780 | 3300025940 | Bacteria | 1595 |
| 867 | Ga0207691_10546899 | 3300025940 | Bacteria | 982 |
| 868 | Ga0207711_10001033 | 3300025941 | Bacteria | 26678 |
| 869 | Ga0207711_10309689 | 3300025941 | Bacteria | 1458 |
| 870 | Ga0207711_11138565 | 3300025941 | Bacteria | 721 |
| 871 | Ga0207711_11986836 | 3300025941 | Bacteria | 524 |
| 872 | Ga0207689_10000384 | 3300025942 | Bacteria | 41557 |
| 873 | Ga0207689_10000808 | 3300025942 | Bacteria | 30211 |
| 874 | Ga0207689_10029109 | 3300025942 | Bacteria | 4616 |
| 875 | Ga0207689_10058383 | 3300025942 | Bacteria | 3174 |
| 876 | Ga0207689_10058570 | 3300025942 | Bacteria | 3168 |
| 877 | Ga0207689_10615687 | 3300025942 | Bacteria | 914 |
| 878 | Ga0207689_10666864 | 3300025942 | Bacteria | 877 |
| 879 | Ga0207661_10567734 | 3300025944 | Bacteria | 1040 |
| 880 | Ga0207661_10811040 | 3300025944 | Bacteria | 862 |
| 881 | Ga0207679_10115933 | 3300025945 | Bacteria | 2123 |
| 882 | Ga0207679_10441804 | 3300025945 | Bacteria | 1152 |
| 883 | Ga0207679_11268919 | 3300025945 | Bacteria | 676 |
| 884 | Ga0207667_10039769 | 3300025949 | Bacteria | 5009 |
| 885 | Ga0207667_10062976 | 3300025949 | Bacteria | 3877 |
| 886 | Ga0207667_10071588 | 3300025949 | Bacteria | 3604 |
| 887 | Ga0207667_11268120 | 3300025949 | Bacteria | 714 |
| 888 | Ga0207667_11519163 | 3300025949 | Bacteria | 640 |
| 889 | Ga0207651_10003957 | 3300025960 | Bacteria | 7358 |
| 890 | Ga0207651_10015772 | 3300025960 | Bacteria | 4402 |
| 891 | Ga0207651_10667491 | 3300025960 | Bacteria | 914 |
| 892 | Ga0207712_10022912 | 3300025961 | Bacteria | 4117 |
| 893 | Ga0207712_10228310 | 3300025961 | Bacteria | 1493 |
| 894 | Ga0207712_10306446 | 3300025961 | Bacteria | 1305 |
| 895 | Ga0207712_10388700 | 3300025961 | Bacteria | 1170 |
| 896 | Ga0207712_10497804 | 3300025961 | Bacteria | 1041 |
| 897 | Ga0207668_10181985 | 3300025972 | Bacteria | 1659 |
| 898 | Ga0207668_10229957 | 3300025972 | Bacteria | 1494 |
| 899 | Ga0207668_10258472 | 3300025972 | Bacteria | 1418 |
| 900 | Ga0207668_10755003 | 3300025972 | Bacteria | 858 |
| 901 | Ga0207640_10029906 | 3300025981 | Bacteria | 3350 |
| 902 | Ga0207640_10295906 | 3300025981 | Bacteria | 1278 |
| 903 | Ga0207640_10909140 | 3300025981 | Bacteria | 769 |
| 904 | Ga0207658_10032488 | 3300025986 | Bacteria | 3715 |
| 905 | Ga0207658_10173117 | 3300025986 | Bacteria | 1780 |
| 906 | Ga0207658_10210850 | 3300025986 | Bacteria | 1628 |
| 907 | Ga0207677_10002051 | 3300026023 | Bacteria | 10615 |
| 908 | Ga0207677_10159068 | 3300026023 | Bacteria | 1753 |
| 909 | Ga0207677_10281942 | 3300026023 | Bacteria | 1364 |
| 910 | Ga0207677_10524577 | 3300026023 | Bacteria | 1028 |
| 911 | Ga0207677_11210109 | 3300026023 | Bacteria | 692 |
| 912 | Ga0207703_10001476 | 3300026035 | Bacteria | 21438 |
| 913 | Ga0207703_10001709 | 3300026035 | Bacteria | 19718 |
| 914 | Ga0207703_11300927 | 3300026035 | Bacteria | 699 |
| 915 | Ga0207639_10423545 | 3300026041 | Bacteria | 1204 |
| 916 | Ga0207639_10708266 | 3300026041 | Bacteria | 934 |
| 917 | Ga0207639_11062049 | 3300026041 | Bacteria | 759 |
| 918 | Ga0207639_11699868 | 3300026041 | Bacteria | 591 |
| 919 | Ga0207678_10002813 | 3300026067 | Bacteria | 15784 |
| 920 | Ga0207678_10057117 | 3300026067 | Bacteria | 3359 |
| 921 | Ga0207678_10059618 | 3300026067 | Bacteria | 3284 |
| 922 | Ga0207678_10218891 | 3300026067 | Bacteria | 1630 |
| 923 | Ga0207678_10877631 | 3300026067 | Bacteria | 793 |
| 924 | Ga0207678_11761218 | 3300026067 | Bacteria | 543 |
| 925 | Ga0207708_10000156 | 3300026075 | Bacteria | 54425 |
| 926 | Ga0207708_10007769 | 3300026075 | Bacteria | 7941 |
| 927 | Ga0207708_10050862 | 3300026075 | Bacteria | 3154 |
| 928 | Ga0207708_10459646 | 3300026075 | Bacteria | 1061 |
| 929 | Ga0207708_10544887 | 3300026075 | Bacteria | 978 |
| 930 | Ga0207708_10775684 | 3300026075 | Bacteria | 824 |
| 931 | Ga0207702_10014860 | 3300026078 | Bacteria | 6458 |
| 932 | Ga0207702_10362633 | 3300026078 | Bacteria | 1389 |
| 933 | Ga0207702_10417239 | 3300026078 | Bacteria | 1297 |
| 934 | Ga0207702_10573009 | 3300026078 | Bacteria | 1106 |
| 935 | Ga0207702_10881170 | 3300026078 | Bacteria | 887 |
| 936 | Ga0207702_11101363 | 3300026078 | Bacteria | 788 |
| 937 | Ga0207702_11531296 | 3300026078 | Bacteria | 660 |
| 938 | Ga0207702_12173321 | 3300026078 | Bacteria | 544 |
| 939 | Ga0207641_10016890 | 3300026088 | Bacteria | 5976 |
| 940 | Ga0207641_10339069 | 3300026088 | Bacteria | 1430 |
| 941 | Ga0207641_10982728 | 3300026088 | Bacteria | 840 |
| 942 | Ga0207648_10000128 | 3300026089 | Bacteria | 75279 |
| 943 | Ga0207648_10002472 | 3300026089 | Bacteria | 19861 |
| 944 | Ga0207648_10005495 | 3300026089 | Bacteria | 12773 |
| 945 | Ga0207648_10025971 | 3300026089 | Bacteria | 5209 |
| 946 | Ga0207648_10259915 | 3300026089 | Bacteria | 1549 |
| 947 | Ga0207648_10434447 | 3300026089 | Bacteria | 1193 |
| 948 | Ga0207648_10609220 | 3300026089 | Bacteria | 1007 |
| 949 | Ga0207648_11291970 | 3300026089 | Bacteria | 686 |
| 950 | Ga0207648_11879985 | 3300026089 | Bacteria | 560 |
| 951 | Ga0207676_10000174 | 3300026095 | Bacteria | 56439 |
| 952 | Ga0207676_10007775 | 3300026095 | Bacteria | 7623 |
| 953 | Ga0207676_11062734 | 3300026095 | Bacteria | 799 |
| 954 | Ga0207674_10005547 | 3300026116 | Bacteria | 14978 |
| 955 | Ga0207674_10316922 | 3300026116 | Bacteria | 1509 |
| 956 | Ga0207674_10353792 | 3300026116 | Bacteria | 1420 |
| 957 | Ga0207675_100000215 | 3300026118 | Bacteria | 54261 |
| 958 | Ga0207675_100000408 | 3300026118 | Bacteria | 41228 |
| 959 | Ga0207675_100009821 | 3300026118 | Bacteria | 8959 |
| 960 | Ga0207675_100165026 | 3300026118 | Bacteria | 2115 |
| 961 | Ga0207675_100684500 | 3300026118 | Bacteria | 1033 |
| 962 | Ga0207675_101485820 | 3300026118 | Bacteria | 698 |
| 963 | Ga0207683_10001993 | 3300026121 | Bacteria | 18067 |
| 964 | Ga0207683_10012879 | 3300026121 | Bacteria | 7138 |
| 965 | Ga0207683_10043918 | 3300026121 | Bacteria | 3906 |
| 966 | Ga0207683_10173906 | 3300026121 | Bacteria | 1951 |
| 967 | Ga0207683_10651065 | 3300026121 | Bacteria | 976 |
| 968 | Ga0207683_10744807 | 3300026121 | Bacteria | 909 |
| 969 | Ga0207698_10254086 | 3300026142 | Bacteria | 1610 |
| 970 | Ga0207698_10386136 | 3300026142 | Bacteria | 1334 |
| 971 | Ga0207698_10394735 | 3300026142 | Bacteria | 1320 |
| 972 | Ga0207698_10935404 | 3300026142 | Bacteria | 875 |
| 973 | Ga0207698_11311021 | 3300026142 | Bacteria | 739 |
| 974 | Ga0209281_1012000 | 3300027111 | Bacteria | 1920 |
| 975 | Ga0209371_1000448 | 3300027312 | Bacteria | 41139 |
| 976 | Ga0209969_1000391 | 3300027360 | Bacteria | 5844 |
| 977 | Ga0209967_1000346 | 3300027364 | Bacteria | 6174 |
| 978 | Ga0209981_1006208 | 3300027378 | Bacteria | 1596 |
| 979 | Ga0209981_1024360 | 3300027378 | Bacteria | 873 |
| 980 | Ga0209996_1014353 | 3300027395 | Bacteria | 1076 |
| 981 | Ga0210000_1005995 | 3300027462 | Bacteria | 1769 |
| 982 | Ga0210000_1045302 | 3300027462 | Bacteria | 702 |
| 983 | Ga0209995_1004306 | 3300027471 | Bacteria | 2275 |
| 984 | Ga0209968_1049772 | 3300027526 | Bacteria | 726 |
| 985 | Ga0209999_1004967 | 3300027543 | Bacteria | 2394 |
| 986 | Ga0209999_1009591 | 3300027543 | Bacteria | 1748 |
| 987 | Ga0209999_1036179 | 3300027543 | Bacteria | 922 |
| 988 | Ga0209970_1015173 | 3300027614 | Bacteria | 1281 |
| 989 | Ga0209983_1016239 | 3300027665 | Bacteria | 1537 |
| 990 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 991 | Ga0209588_1102153 | 3300027671 | Bacteria | 922 |
| 992 | Ga0209588_1130375 | 3300027671 | Bacteria | 802 |
| 993 | Ga0209588_1164561 | 3300027671 | Bacteria | 700 |
| 994 | Ga0209971_1006394 | 3300027682 | Bacteria | 2787 |
| 995 | Ga0209971_1171336 | 3300027682 | Bacteria | 535 |
| 996 | Ga0209966_1026619 | 3300027695 | Bacteria | 1153 |
| 997 | Ga0209966_1177484 | 3300027695 | Bacteria | 500 |
| 998 | Ga0209998_10045879 | 3300027717 | Bacteria | 1002 |
| 999 | Ga0209813_10017820 | 3300027866 | Bacteria | 1954 |
| 1000 | Ga0209974_10018316 | 3300027876 | Bacteria | 2323 |
| 1001 | Ga0207428_10004612 | 3300027907 | Bacteria | 13060 |
| 1002 | Ga0207428_10007629 | 3300027907 | Bacteria | 9851 |
| 1003 | Ga0207428_10222717 | 3300027907 | Bacteria | 1413 |
| 1004 | Ga0207428_10228212 | 3300027907 | Bacteria | 1394 |
| 1005 | Ga0207428_10242943 | 3300027907 | Bacteria | 1345 |
| 1006 | Ga0207428_10760392 | 3300027907 | Bacteria | 690 |
| 1007 | Ga0268266_10008065 | 3300028379 | Bacteria | 9410 |
| 1008 | Ga0268266_10047065 | 3300028379 | Bacteria | 3693 |
| 1009 | Ga0268265_10001364 | 3300028380 | Bacteria | 20788 |
| 1010 | Ga0268265_10002399 | 3300028380 | Bacteria | 14163 |
| 1011 | Ga0268265_10033020 | 3300028380 | Bacteria | 3758 |
| 1012 | Ga0268265_10041740 | 3300028380 | Bacteria | 3398 |
| 1013 | Ga0268265_10867311 | 3300028380 | Bacteria | 884 |
| 1014 | Ga0268264_10053808 | 3300028381 | Bacteria | 3359 |
| 1015 | Ga0268264_10063078 | 3300028381 | Bacteria | 3114 |
| 1016 | Ga0268264_10421553 | 3300028381 | Bacteria | 1287 |
| 1017 | Ga0268264_11185149 | 3300028381 | Bacteria | 773 |
| 1018 | Ga0268264_12376970 | 3300028381 | Bacteria | 536 |
| 1019 | Ga0265324_10000006 | 3300029957 | Bacteria | 267048 |
| 1020 | Ga0265324_10016237 | 3300029957 | Bacteria | 2723 |
| 1021 | Ga0268256_1000823 | 3300030500 | Bacteria | 22186 |
| 1022 | Ga0307511_10000248 | 3300030521 | Bacteria | 55337 |
| 1023 | Ga0316177_1163550 | 3300030731 | Bacteria | 2582 |
| 1024 | Ga0314311_1225052 | 3300030733 | Bacteria | 1072 |
| 1025 | Ga0316179_1096458 | 3300030734 | Bacteria | 1039 |
| 1026 | Ga0316178_1028413 | 3300030735 | Bacteria | 1529 |
| 1027 | Ga0316178_1146804 | 3300030735 | Bacteria | 528 |
| 1028 | Ga0316178_1169113 | 3300030735 | Bacteria | 533 |
| 1029 | Ga0316180_1167461 | 3300030736 | Bacteria | 1716 |
| 1030 | Ga0316183_1193877 | 3300030742 | Bacteria | 1134 |
| 1031 | Ga0316182_1436475 | 3300030745 | Bacteria | 1301 |
| 1032 | Ga0265332_10003769 | 3300031238 | Bacteria | 7247 |
| 1033 | Ga0265328_10002778 | 3300031239 | Bacteria | 7837 |
| 1034 | Ga0265328_10007837 | 3300031239 | Bacteria | 4437 |
| 1035 | Ga0265328_10043022 | 3300031239 | Bacteria | 1662 |
| 1036 | Ga0265320_10073544 | 3300031240 | Bacteria | 1606 |
| 1037 | Ga0265325_10000110 | 3300031241 | Bacteria | 56687 |
| 1038 | Ga0265339_10221934 | 3300031249 | Bacteria | 924 |
| 1039 | Ga0265331_10002297 | 3300031250 | Bacteria | 13027 |
| 1040 | Ga0265331_10002426 | 3300031250 | Bacteria | 12637 |
| 1041 | Ga0265331_10005458 | 3300031250 | Bacteria | 7674 |
| 1042 | Ga0265331_10120852 | 3300031250 | Bacteria | 1198 |
| 1043 | Ga0265327_10000588 | 3300031251 | Bacteria | 61029 |
| 1044 | Ga0265327_10000809 | 3300031251 | Bacteria | 47572 |
| 1045 | Ga0265327_10002222 | 3300031251 | Bacteria | 21132 |
| 1046 | Ga0265327_10045923 | 3300031251 | Bacteria | 2317 |
| 1047 | Ga0265327_10056979 | 3300031251 | Bacteria | 2012 |
| 1048 | Ga0265316_10075296 | 3300031344 | Bacteria | 2596 |
| 1049 | Ga0265316_10101868 | 3300031344 | Bacteria | 2181 |
| 1050 | Ga0265316_10119684 | 3300031344 | Bacteria | 1989 |
| 1051 | Ga0307513_11043829 | 3300031456 | Bacteria | 528 |
| 1052 | Ga0307509_10536082 | 3300031507 | Bacteria | 850 |
| 1053 | Ga0307408_100002707 | 3300031548 | Bacteria | 12301 |
| 1054 | Ga0307408_100022174 | 3300031548 | Bacteria | 4310 |
| 1055 | Ga0307408_100103451 | 3300031548 | Bacteria | 2174 |
| 1056 | Ga0307408_100646686 | 3300031548 | Bacteria | 945 |
| 1057 | Ga0307408_100792260 | 3300031548 | Bacteria | 859 |
| 1058 | Ga0265313_10168109 | 3300031595 | Bacteria | 928 |
| 1059 | Ga0316575_10011355 | 3300031665 | Bacteria | 3295 |
| 1060 | Ga0265314_10000245 | 3300031711 | Bacteria | 79757 |
| 1061 | Ga0265314_10009646 | 3300031711 | Bacteria | 8130 |
| 1062 | Ga0265314_10016544 | 3300031711 | Bacteria | 5819 |
| 1063 | Ga0265314_10126042 | 3300031711 | Bacteria | 1604 |
| 1064 | Ga0265342_10473914 | 3300031712 | Bacteria | 641 |
| 1065 | Ga0316576_10303711 | 3300031727 | Bacteria | 1192 |
| 1066 | Ga0316576_10915028 | 3300031727 | Bacteria | 628 |
| 1067 | Ga0307516_10755847 | 3300031730 | Bacteria | 632 |
| 1068 | Ga0307405_10247730 | 3300031731 | Bacteria | 1324 |
| 1069 | Ga0307405_10881972 | 3300031731 | Bacteria | 755 |
| 1070 | Ga0307518_10117882 | 3300031838 | Bacteria | 1883 |
| 1071 | Ga0307406_10573976 | 3300031901 | Bacteria | 926 |
| 1072 | Ga0307406_10584348 | 3300031901 | Bacteria | 919 |
| 1073 | Ga0307406_11398175 | 3300031901 | Bacteria | 613 |
| 1074 | Ga0307406_12066410 | 3300031901 | Bacteria | 510 |
| 1075 | Ga0307407_11198047 | 3300031903 | Bacteria | 593 |
| 1076 | Ga0307412_10965583 | 3300031911 | Bacteria | 751 |
| 1077 | Ga0307412_11289824 | 3300031911 | Bacteria | 657 |
| 1078 | Ga0307416_100022459 | 3300032002 | Bacteria | 4555 |
| 1079 | Ga0307416_100667029 | 3300032002 | Bacteria | 1126 |
| 1080 | Ga0307416_101485459 | 3300032002 | Bacteria | 783 |
| 1081 | Ga0307416_102545616 | 3300032002 | Bacteria | 610 |
| 1082 | Ga0307414_10030059 | 3300032004 | Bacteria | 3544 |
| 1083 | Ga0307411_10185351 | 3300032005 | Bacteria | 1584 |
| 1084 | Ga0307411_11409969 | 3300032005 | Bacteria | 638 |
| 1085 | Ga0307411_11426161 | 3300032005 | Bacteria | 634 |
| 1086 | Ga0307415_101193524 | 3300032126 | Bacteria | 717 |
| 1087 | Ga0307415_101367772 | 3300032126 | Bacteria | 673 |
| 1088 | Ga0316583_10062422 | 3300032133 | Bacteria | 1305 |
| 1089 | Ga0307507_10104184 | 3300033179 | Bacteria | 2356 |
| 1090 | Ga0373950_0117658 | 3300034818 | Bacteria | 585 |
| 1091 | Ga0373929_0086328 | 3300035085 | Bacteria | 772 |
| 1092 | Ga0373934_0176786 | 3300035086 | Bacteria | 877 |
| 1093 | Ga0373940_0030517 | 3300035088 | Bacteria | 1434 |
| 1094 | Ga0373944_0001197 | 3300035089 | Bacteria | 6490 |
| 1095 | Ga0373944_0069188 | 3300035089 | Bacteria | 1147 |
| 1096 | Ga0373949_0037050 | 3300035090 | Bacteria | 1185 |
| 1097 | Ga0373949_0135114 | 3300035090 | Bacteria | 703 |
| 1098 | Ga0373951_0015446 | 3300035091 | Bacteria | 1720 |
| 1099 | Ga0373952_0226126 | 3300035092 | Bacteria | 558 |
| 1100 | Ga0373952_0294254 | 3300035092 | Bacteria | 504 |
| 1101 | Ga0373923_0066800 | 3300035111 | Bacteria | 1537 |
| 1102 | Ga0373932_0001629 | 3300035112 | Bacteria | 6164 |
| 1103 | Ga0373932_0130555 | 3300035112 | Bacteria | 846 |
| 1104 | Ga0373936_0003926 | 3300035113 | Bacteria | 5600 |
| 1105 | Ga0373936_0014734 | 3300035113 | Bacteria | 2992 |
| 1106 | Ga0373936_0110541 | 3300035113 | Bacteria | 1167 |
| 1107 | Ga0373936_0111839 | 3300035113 | Bacteria | 1160 |
| 1108 | Ga0373936_0545757 | 3300035113 | Bacteria | 541 |
| 1109 | Ga0373939_0041526 | 3300035114 | Bacteria | 1387 |
| 1110 | Ga0373939_0189054 | 3300035114 | Bacteria | 772 |
| 1111 | Ga0373939_0439442 | 3300035114 | Bacteria | 547 |
| 1112 | Ga0373941_0076465 | 3300035115 | Bacteria | 1122 |
| 1113 | Ga0373941_0172249 | 3300035115 | Bacteria | 807 |
| 1114 | Ga0373941_0270086 | 3300035115 | Bacteria | 670 |
| 1115 | Ga0373945_0025125 | 3300035116 | Bacteria | 2068 |
| 1116 | Ga0373945_0240091 | 3300035116 | Bacteria | 763 |
| 1117 | Ga0373953_0022608 | 3300035117 | Bacteria | 2372 |
| 1118 | Ga0373953_0054507 | 3300035117 | Bacteria | 1622 |
| 1119 | Ga0373953_0198630 | 3300035117 | Bacteria | 867 |
| 1120 | Ga0373954_0024099 | 3300035118 | Bacteria | 2773 |
| 1121 | Ga0373954_0345868 | 3300035118 | Bacteria | 734 |
| 1122 | Ga0373956_0025761 | 3300035119 | Bacteria | 2544 |
| 1123 | Ga0373956_0079120 | 3300035119 | Bacteria | 1506 |
| 1124 | Ga0373956_0109451 | 3300035119 | Bacteria | 1285 |
| 1125 | Ga0373957_0157691 | 3300035120 | Bacteria | 934 |
| 1126 | Ga0373960_0091904 | 3300035121 | Bacteria | 971 |
| 1127 | Ga0373943_0021046 | 3300035170 | Bacteria | 3011 |
| 1128 | Ga0373943_0038187 | 3300035170 | Bacteria | 2307 |
| 1129 | Ga0373943_0046400 | 3300035170 | Bacteria | 2120 |
| 1130 | Ga0373943_0138726 | 3300035170 | Bacteria | 1308 |
| 1131 | Ga0373943_0175304 | 3300035170 | Bacteria | 1175 |
| 1132 | Ga0373943_0574636 | 3300035170 | Bacteria | 662 |
| 1133 | Ga0373946_0074089 | 3300035171 | Bacteria | 1477 |
| 1134 | Ga0373946_0086439 | 3300035171 | Bacteria | 1382 |
| 1135 | Ga0373946_0144620 | 3300035171 | Bacteria | 1105 |
| 1136 | Ga0373946_0187562 | 3300035171 | Bacteria | 984 |
| 1137 | Ga0373946_0220506 | 3300035171 | Bacteria | 915 |
| 1138 | Ga0373955_0045169 | 3300035172 | Bacteria | 2376 |
| 1139 | Ga0373955_0144808 | 3300035172 | Bacteria | 1395 |
| 1140 | Ga0373955_0196502 | 3300035172 | Bacteria | 1200 |
| 1141 | Ga0373955_0227939 | 3300035172 | Bacteria | 1114 |
| 1142 | Ga0373955_0310073 | 3300035172 | Bacteria | 952 |
| 1143 | Ga0373955_0475990 | 3300035172 | Bacteria | 762 |
| 1144 | Ga0373942_0029303 | 3300035207 | Bacteria | 1443 |
| 1145 | Ga0373942_0092566 | 3300035207 | Bacteria | 913 |
| 1146 | Ga0373942_0190317 | 3300035207 | Bacteria | 676 |
| 1147 | Ga0373962_0226282 | 3300035242 | Bacteria | 642 |
| 1148 | Ga0373962_0243852 | 3300035242 | Bacteria | 622 |
| 1149 | Ga0316574_0000854 | 3300035398 | Bacteria | 13382 |
| 1150 | Ga0316574_0002988 | 3300035398 | Bacteria | 8620 |
| 1151 | Ga0373924_0043068 | 3300035410 | Bacteria | 1853 |
| 1152 | Ga0373924_0161259 | 3300035410 | Bacteria | 983 |
| 1153 | Ga0373924_0185598 | 3300035410 | Bacteria | 915 |
| 1154 | Ga0373924_0388207 | 3300035410 | Bacteria | 623 |
| 1155 | Ga0373931_0000424 | 3300035691 | Bacteria | 17213 |
| 1156 | Ga0373931_0018892 | 3300035691 | Bacteria | 3433 |
| 1157 | Ga0373931_0109568 | 3300035691 | Bacteria | 1565 |
| 1158 | Ga0373931_0406430 | 3300035691 | Bacteria | 863 |
| 1159 | Ga0373935_0008550 | 3300035692 | Bacteria | 6127 |
| 1160 | Ga0373935_0027021 | 3300035692 | Bacteria | 3547 |
| 1161 | Ga0373935_0686211 | 3300035692 | Bacteria | 753 |
| 1162 | Ga0373935_0726761 | 3300035692 | Bacteria | 731 |
| 1163 | Ga0373935_0863263 | 3300035692 | Bacteria | 669 |
| 1164 | Ga0373927_0002911 | 3300035695 | Bacteria | 12449 |
| 1165 | Ga0373927_0016489 | 3300035695 | Bacteria | 4871 |
| 1166 | Ga0373927_0017456 | 3300035695 | Bacteria | 4721 |
| 1167 | Ga0373927_0444198 | 3300035695 | Bacteria | 856 |
| 1168 | Ga0373927_0536273 | 3300035695 | Bacteria | 773 |
| 1169 | Ga0373933_0005103 | 3300035724 | Bacteria | 7163 |
| 1170 | Ga0373933_0060834 | 3300035724 | Bacteria | 2277 |
| 1171 | Ga0373933_0061327 | 3300035724 | Bacteria | 2269 |
| 1172 | Ga0373933_0236829 | 3300035724 | Bacteria | 1173 |
| 1173 | Ga0373933_0238831 | 3300035724 | Bacteria | 1168 |
| 1174 | Ga0373933_0307873 | 3300035724 | Bacteria | 1026 |
| 1175 | Ga0373933_0890428 | 3300035724 | Bacteria | 586 |
| 1176 | Ga0373947_0012180 | 3300035725 | Bacteria | 4924 |
| 1177 | Ga0373947_0054393 | 3300035725 | Bacteria | 2415 |
| 1178 | Ga0373947_0187151 | 3300035725 | Bacteria | 1350 |
| 1179 | Ga0373947_0239003 | 3300035725 | Bacteria | 1198 |
| 1180 | Ga0373947_0300938 | 3300035725 | Bacteria | 1069 |
| 1181 | Ga0373947_0525852 | 3300035725 | Bacteria | 804 |
| 1182 | Ga0373937_0107343 | 3300036401 | Bacteria | 2596 |
| 1183 | Ga0373937_0216611 | 3300036401 | Bacteria | 1802 |
| 1184 | Ga0373937_0487814 | 3300036401 | Bacteria | 1170 |
| 1185 | Ga0373937_0657684 | 3300036401 | Bacteria | 993 |
| 1186 | Ga0373937_0726714 | 3300036401 | Bacteria | 940 |
| 1187 | Ga0316582_0162139 | 3300036647 | Bacteria | 1515 |
| 1188 | Ga0373925_0012636 | 3300037068 | Bacteria | 6116 |
| 1189 | Ga0373925_0068651 | 3300037068 | Bacteria | 2676 |
| 1190 | Ga0373925_0074773 | 3300037068 | Bacteria | 2566 |
| 1191 | Ga0373925_0228787 | 3300037068 | Bacteria | 1486 |
| 1192 | Ga0373925_0273745 | 3300037068 | Bacteria | 1358 |
| 1193 | Ga0373925_0293246 | 3300037068 | Bacteria | 1312 |
| 1194 | Ga0373925_0874968 | 3300037068 | Bacteria | 740 |
| 1195 | Ga0395899_0000505 | 3300037312 | Bacteria | 43367 |
| 1196 | Ga0395899_0003409 | 3300037312 | Bacteria | 12614 |
| 1197 | Ga0395899_0234206 | 3300037312 | Bacteria | 1266 |
| 1198 | Ga0395900_0006268 | 3300037418 | Bacteria | 12412 |
| 1199 | Ga0395900_0206565 | 3300037418 | Bacteria | 1985 |
| 1200 | Ga0395900_1289413 | 3300037418 | Bacteria | 644 |
| 1201 | Ga0395898_0536946 | 3300037466 | Bacteria | 1111 |
| 1202 | Ga0395898_0946296 | 3300037466 | Bacteria | 798 |
| 1203 | Ga0395898_1150299 | 3300037466 | Bacteria | 708 |
| 1204 | Ga0395905_0008791 | 3300037471 | Bacteria | 9928 |
| 1205 | Ga0395905_0067029 | 3300037471 | Bacteria | 3361 |
| 1206 | Ga0395905_0155785 | 3300037471 | Bacteria | 2149 |
| 1207 | Ga0395905_0365479 | 3300037471 | Bacteria | 1336 |
| 1208 | Ga0395905_0467096 | 3300037471 | Bacteria | 1160 |
| 1209 | Ga0395901_0000182 | 3300038443 | Bacteria | 81583 |
| 1210 | Ga0395901_0230027 | 3300038443 | Bacteria | 1936 |
| 1211 | Ga0395901_0346653 | 3300038443 | Bacteria | 1533 |
| 1212 | Ga0395901_0796187 | 3300038443 | Bacteria | 934 |
| 1213 | Ga0395901_0879150 | 3300038443 | Bacteria | 879 |
| 1214 | Ga0400490_47983 | 3300038726 | Bacteria | 10023 |
| 1215 | Ga0242420_095243 | 3300038996 | Bacteria | 629 |
| 1216 | Ga0400483_225090 | 3300039062 | Bacteria | 1314 |
| 1217 | Ga0436365_0581961 | 3300039437 | Bacteria | 3143 |
| 1218 | Ga0436365_1017355 | 3300039437 | Bacteria | 2303 |
| 1219 | Ga0436360_0570562 | 3300039438 | Bacteria | 1087 |
| 1220 | Ga0436360_1263300 | 3300039438 | Bacteria | 633 |
| 1221 | Ga0436361_0009988 | 3300039447 | Bacteria | 9004 |
| 1222 | Ga0436361_0200247 | 3300039447 | Bacteria | 777 |
| 1223 | Ga0436361_0514914 | 3300039447 | Bacteria | 1093 |
| 1224 | Ga0436361_0521959 | 3300039447 | Bacteria | 968 |
| 1225 | Ga0436361_0687444 | 3300039447 | Bacteria | 109830 |
| 1226 | Ga0436361_0928362 | 3300039447 | Bacteria | 955 |
| 1227 | Ga0436363_0091266 | 3300039450 | Bacteria | 595 |
| 1228 | Ga0436363_0620330 | 3300039450 | Bacteria | 564 |
| 1229 | Ga0439461_0012185 | 3300041410 | Bacteria | 1605 |
| 1230 | Ga0439465_0232265 | 3300041413 | Bacteria | 679 |
| 1231 | Ga0451789_1216037 | 3300041443 | Bacteria | 621 |
| 1232 | Ga0451797_1582190 | 3300041453 | Bacteria | 531 |
| 1233 | Ga0451804_0575511 | 3300041463 | Bacteria | 644 |
| 1234 | Ga0451835_0475987 | 3300041492 | Bacteria | 749 |
| 1235 | Ga0451839_0318377 | 3300041496 | Bacteria | 718 |
| 1236 | Ga0451853_3182744 | 3300041512 | Bacteria | 1124 |
| 1237 | Ga0439433_0023110 | 3300041999 | Bacteria | 1398 |
| 1238 | Ga0439433_0099279 | 3300041999 | Bacteria | 721 |
| 1239 | Ga0439441_006635 | 3300042001 | Bacteria | 1842 |
| 1240 | Ga0439441_176546 | 3300042001 | Bacteria | 512 |
| 1241 | Ga0439449_0024567 | 3300042007 | Bacteria | 2252 |
| 1242 | Ga0439450_003397 | 3300042008 | Bacteria | 2628 |
| 1243 | Ga0439450_212025 | 3300042008 | Bacteria | 520 |
| 1244 | Ga0439451_034850 | 3300042009 | Bacteria | 1012 |
| 1245 | Ga0439454_074802 | 3300042011 | Bacteria | 606 |
| 1246 | Ga0450911_025560 | 3300042115 | Bacteria | 766 |
| 1247 | Ga0450917_019401 | 3300042120 | Bacteria | 598 |
| 1248 | Ga0450897_007065 | 3300042128 | Bacteria | 1017 |
| 1249 | Ga0450898_018404 | 3300042134 | Bacteria | 1210 |
| 1250 | Ga0450898_023425 | 3300042134 | Bacteria | 1098 |
| 1251 | Ga0450904_000933 | 3300042139 | Bacteria | 4637 |
| 1252 | Ga0439446_0004083 | 3300042156 | Bacteria | 3679 |
| 1253 | Ga0439458_0010675 | 3300042157 | Bacteria | 2049 |
| 1254 | Ga0439434_0000207 | 3300042435 | Bacteria | 16234 |
| 1255 | Ga0439435_0000263 | 3300042436 | Bacteria | 7702 |
| 1256 | Ga0439435_0002006 | 3300042436 | Bacteria | 3932 |
| 1257 | Ga0439460_0005416 | 3300042461 | Bacteria | 3129 |
| 1258 | Ga0439460_0006906 | 3300042461 | Bacteria | 2827 |
| 1259 | Ga0450893_0007475 | 3300042532 | Bacteria | 1776 |
| 1260 | Ga0451577_0009550 | 3300042876 | Bacteria | 9330 |
| 1261 | Ga0451577_0341078 | 3300042876 | Bacteria | 1359 |
| 1262 | Ga0451577_0387767 | 3300042876 | Bacteria | 1268 |
| 1263 | Ga0451577_0826646 | 3300042876 | Bacteria | 836 |
| 1264 | Ga0466969_0432385 | 3300044656 | Bacteria | 598 |
| 1265 | Ga0466972_0000070 | 3300044658 | Bacteria | 100242 |
| 1266 | Ga0466972_0246959 | 3300044658 | Bacteria | 834 |
| 1267 | Ga0466972_0390617 | 3300044658 | Bacteria | 652 |
| 1268 | Ga0466982_0359842 | 3300044672 | Bacteria | 804 |
| 1269 | Ga0453683_0258207 | 3300044673 | Bacteria | 1111 |
| 1270 | Ga0453683_0401251 | 3300044673 | Bacteria | 884 |
| 1271 | Ga0466965_0006917 | 3300044683 | Bacteria | 5189 |
| 1272 | Ga0466965_0057320 | 3300044683 | Bacteria | 1941 |
| 1273 | Ga0466965_0113751 | 3300044683 | Bacteria | 1393 |
| 1274 | Ga0466965_0282826 | 3300044683 | Bacteria | 896 |
| 1275 | Ga0466966_0195263 | 3300044684 | Bacteria | 1225 |
| 1276 | Ga0466966_0385009 | 3300044684 | Bacteria | 842 |
| 1277 | Ga0466961_0157343 | 3300044693 | Bacteria | 1417 |
| 1278 | Ga0466961_0338418 | 3300044693 | Bacteria | 916 |
| 1279 | Ga0466963_0298143 | 3300044694 | Bacteria | 1133 |
| 1280 | Ga0466964_0019249 | 3300044706 | Bacteria | 2622 |
| 1281 | Ga0466964_0242455 | 3300044706 | Bacteria | 885 |
| 1282 | Ga0453684_0000237 | 3300044712 | Bacteria | 236999 |
| 1283 | Ga0453684_0796826 | 3300044712 | Bacteria | 1019 |
| 1284 | Ga0453684_2306124 | 3300044712 | Bacteria | 535 |
| 1285 | Ga0466970_0022377 | 3300044765 | Bacteria | 3299 |
| 1286 | Ga0466970_0114882 | 3300044765 | Bacteria | 1471 |
| 1287 | Ga0466970_0276104 | 3300044765 | Bacteria | 944 |
| 1288 | Ga0466957_0091828 | 3300044842 | Bacteria | 1903 |
| 1289 | Ga0466960_0180323 | 3300044901 | Bacteria | 1144 |
| 1290 | Ga0466960_0228618 | 3300044901 | Bacteria | 1026 |
| 1291 | Ga0466960_0299615 | 3300044901 | Bacteria | 905 |
| 1292 | Ga0451576_0000034 | 3300045051 | Bacteria | 390778 |
| 1293 | Ga0451576_0000906 | 3300045051 | Bacteria | 56126 |
| 1294 | Ga0451576_0001076 | 3300045051 | Bacteria | 50068 |
| 1295 | Ga0451576_0002763 | 3300045051 | Bacteria | 25371 |
| 1296 | Ga0451576_0005425 | 3300045051 | Bacteria | 16007 |
| 1297 | Ga0451576_0031091 | 3300045051 | Bacteria | 5695 |
| 1298 | Ga0451576_0038069 | 3300045051 | Bacteria | 5091 |
| 1299 | Ga0451576_0284224 | 3300045051 | Bacteria | 1730 |
| 1300 | Ga0451576_0568075 | 3300045051 | Bacteria | 1192 |
| 1301 | Ga0466958_0138819 | 3300045836 | Bacteria | 1529 |
| 1302 | Ga0466967_0119186 | 3300045976 | Bacteria | 2435 |
| 1303 | Ga0495617_000037 | 3300046452 | Bacteria | 134553 |
| 1304 | Ga0495617_000039 | 3300046452 | Bacteria | 128069 |
| 1305 | Ga0495617_000940 | 3300046452 | Bacteria | 13541 |
| 1306 | Ga0495617_029977 | 3300046452 | Bacteria | 1829 |
| 1307 | Ga0495617_065190 | 3300046452 | Bacteria | 1201 |
| 1308 | Ga0495617_149382 | 3300046452 | Bacteria | 743 |
| 1309 | Ga0495627_000008 | 3300046453 | Bacteria | 572150 |
| 1310 | Ga0495627_015998 | 3300046453 | Bacteria | 2578 |
| 1311 | Ga0495627_018004 | 3300046453 | Bacteria | 2391 |
| 1312 | Ga0495627_020896 | 3300046453 | Bacteria | 2175 |
| 1313 | Ga0495627_122687 | 3300046453 | Bacteria | 733 |
| 1314 | Ga0495592_0051886 | 3300046454 | Bacteria | 3046 |
| 1315 | Ga0495592_0075221 | 3300046454 | Bacteria | 2452 |
| 1316 | Ga0495603_0006152 | 3300046455 | Bacteria | 7175 |
| 1317 | Ga0495603_0043579 | 3300046455 | Bacteria | 2679 |
| 1318 | Ga0495603_0047463 | 3300046455 | Bacteria | 2557 |
| 1319 | Ga0495603_0093673 | 3300046455 | Bacteria | 1755 |
| 1320 | Ga0495603_0152350 | 3300046455 | Bacteria | 1342 |
| 1321 | Ga0495590_0000089 | 3300046457 | Bacteria | 57394 |
| 1322 | Ga0495590_0000256 | 3300046457 | Bacteria | 28990 |
| 1323 | Ga0495590_0002299 | 3300046457 | Bacteria | 7959 |
| 1324 | Ga0495590_0008133 | 3300046457 | Bacteria | 4017 |
| 1325 | Ga0495590_0131777 | 3300046457 | Bacteria | 899 |
| 1326 | Ga0495629_0142860 | 3300046459 | Bacteria | 1665 |
| 1327 | Ga0495629_0280428 | 3300046459 | Bacteria | 1143 |
| 1328 | Ga0495629_0491197 | 3300046459 | Bacteria | 828 |
| 1329 | Ga0495629_0555635 | 3300046459 | Bacteria | 770 |
| 1330 | Ga0495629_0558981 | 3300046459 | Bacteria | 767 |
| 1331 | Ga0495638_0000329 | 3300046460 | Bacteria | 60063 |
| 1332 | Ga0495638_0010359 | 3300046460 | Bacteria | 6483 |
| 1333 | Ga0495638_0017274 | 3300046460 | Bacteria | 4815 |
| 1334 | Ga0495638_0078869 | 3300046460 | Bacteria | 2003 |
| 1335 | Ga0495638_0161272 | 3300046460 | Bacteria | 1293 |
| 1336 | Ga0495638_0186403 | 3300046460 | Bacteria | 1180 |
| 1337 | Ga0495638_0458401 | 3300046460 | Bacteria | 649 |
| 1338 | Ga0495641_0057113 | 3300046461 | Bacteria | 1768 |
| 1339 | Ga0495641_0068108 | 3300046461 | Bacteria | 1600 |
| 1340 | Ga0495651_0026064 | 3300046462 | Bacteria | 4552 |
| 1341 | Ga0495651_0248309 | 3300046462 | Bacteria | 1217 |
| 1342 | Ga0495651_0858063 | 3300046462 | Bacteria | 557 |
| 1343 | Ga0495653_0000038 | 3300046463 | Bacteria | 120385 |
| 1344 | Ga0495653_0021439 | 3300046463 | Bacteria | 5234 |
| 1345 | Ga0495653_0033733 | 3300046463 | Bacteria | 4052 |
| 1346 | Ga0495653_0045738 | 3300046463 | Bacteria | 3392 |
| 1347 | Ga0495653_0062116 | 3300046463 | Bacteria | 2824 |
| 1348 | Ga0495653_0073237 | 3300046463 | Bacteria | 2556 |
| 1349 | Ga0495653_0286533 | 3300046463 | Bacteria | 1079 |
| 1350 | Ga0495653_0659477 | 3300046463 | Bacteria | 638 |
| 1351 | Ga0495650_0000048 | 3300046471 | Bacteria | 334427 |
| 1352 | Ga0495650_0001026 | 3300046471 | Bacteria | 31382 |
| 1353 | Ga0495650_0003518 | 3300046471 | Bacteria | 11346 |
| 1354 | Ga0495650_0010456 | 3300046471 | Bacteria | 5176 |
| 1355 | Ga0495650_0059767 | 3300046471 | Bacteria | 1533 |
| 1356 | Ga0495650_0059820 | 3300046471 | Bacteria | 1532 |
| 1357 | Ga0495650_0162181 | 3300046471 | Bacteria | 796 |
| 1358 | Ga0495650_0224807 | 3300046471 | Bacteria | 645 |
| 1359 | Ga0495580_0002487 | 3300046472 | Bacteria | 16090 |
| 1360 | Ga0495580_0072315 | 3300046472 | Bacteria | 2408 |
| 1361 | Ga0495580_0371054 | 3300046472 | Bacteria | 967 |
| 1362 | Ga0495580_0420938 | 3300046472 | Bacteria | 898 |
| 1363 | Ga0495580_0946361 | 3300046472 | Bacteria | 551 |
| 1364 | Ga0495582_0008768 | 3300046473 | Bacteria | 5579 |
| 1365 | Ga0495582_0009830 | 3300046473 | Bacteria | 5267 |
| 1366 | Ga0495582_0015683 | 3300046473 | Bacteria | 4159 |
| 1367 | Ga0495582_0032967 | 3300046473 | Bacteria | 2846 |
| 1368 | Ga0495582_0110455 | 3300046473 | Bacteria | 1544 |
| 1369 | Ga0495582_0456930 | 3300046473 | Bacteria | 737 |
| 1370 | Ga0495605_0002030 | 3300046474 | Bacteria | 12766 |
| 1371 | Ga0495605_0016179 | 3300046474 | Bacteria | 4040 |
| 1372 | Ga0495605_0018129 | 3300046474 | Bacteria | 3779 |
| 1373 | Ga0495605_0038869 | 3300046474 | Bacteria | 2385 |
| 1374 | Ga0495605_0042704 | 3300046474 | Bacteria | 2251 |
| 1375 | Ga0495605_0083768 | 3300046474 | Bacteria | 1488 |
| 1376 | Ga0495605_0115435 | 3300046474 | Bacteria | 1221 |
| 1377 | Ga0495639_0001363 | 3300046475 | Bacteria | 10968 |
| 1378 | Ga0495639_0015247 | 3300046475 | Bacteria | 3331 |
| 1379 | Ga0495639_0016761 | 3300046475 | Bacteria | 3181 |
| 1380 | Ga0495639_0036360 | 3300046475 | Bacteria | 2205 |
| 1381 | Ga0495639_0230513 | 3300046475 | Bacteria | 912 |
| 1382 | Ga0495662_0003932 | 3300046476 | Bacteria | 7498 |
| 1383 | Ga0495662_0014304 | 3300046476 | Bacteria | 3860 |
| 1384 | Ga0495662_0018247 | 3300046476 | Bacteria | 3394 |
| 1385 | Ga0495662_0202882 | 3300046476 | Bacteria | 977 |
| 1386 | Ga0495664_0096519 | 3300046477 | Bacteria | 1779 |
| 1387 | Ga0495664_0178081 | 3300046477 | Bacteria | 1289 |
| 1388 | Ga0495664_0553842 | 3300046477 | Bacteria | 685 |
| 1389 | Ga0495584_0000006 | 3300046491 | Bacteria | 301775 |
| 1390 | Ga0495584_0000679 | 3300046491 | Bacteria | 22629 |
| 1391 | Ga0495584_0004790 | 3300046491 | Bacteria | 7232 |
| 1392 | Ga0495584_0008034 | 3300046491 | Bacteria | 5484 |
| 1393 | Ga0495584_0045789 | 3300046491 | Bacteria | 2206 |
| 1394 | Ga0495584_0111483 | 3300046491 | Bacteria | 1384 |
| 1395 | Ga0495584_0298359 | 3300046491 | Bacteria | 818 |
| 1396 | Ga0495584_0334524 | 3300046491 | Bacteria | 769 |
| 1397 | Ga0495585_0011506 | 3300046492 | Bacteria | 5235 |
| 1398 | Ga0495585_0012995 | 3300046492 | Bacteria | 4887 |
| 1399 | Ga0495585_0089092 | 3300046492 | Bacteria | 1663 |
| 1400 | Ga0495585_0103811 | 3300046492 | Bacteria | 1517 |
| 1401 | Ga0495585_0114472 | 3300046492 | Bacteria | 1431 |
| 1402 | Ga0495585_0125801 | 3300046492 | Bacteria | 1352 |
| 1403 | Ga0495585_0132197 | 3300046492 | Bacteria | 1312 |
| 1404 | Ga0495585_0141740 | 3300046492 | Bacteria | 1258 |
| 1405 | Ga0495585_0174688 | 3300046492 | Bacteria | 1107 |
| 1406 | Ga0495585_0199213 | 3300046492 | Bacteria | 1020 |
| 1407 | Ga0495585_0246622 | 3300046492 | Bacteria | 892 |
| 1408 | Ga0495585_0265905 | 3300046492 | Bacteria | 851 |
| 1409 | Ga0495594_0006812 | 3300046499 | Bacteria | 5870 |
| 1410 | Ga0495594_0011294 | 3300046499 | Bacteria | 4640 |
| 1411 | Ga0495594_0025057 | 3300046499 | Bacteria | 3205 |
| 1412 | Ga0495594_0038079 | 3300046499 | Bacteria | 2624 |
| 1413 | Ga0495594_0061269 | 3300046499 | Bacteria | 2082 |
| 1414 | Ga0495594_0086172 | 3300046499 | Bacteria | 1757 |
| 1415 | Ga0495594_0091226 | 3300046499 | Bacteria | 1707 |
| 1416 | Ga0495594_0121769 | 3300046499 | Bacteria | 1475 |
| 1417 | Ga0495594_0182800 | 3300046499 | Bacteria | 1193 |
| 1418 | Ga0495596_0001262 | 3300046500 | Bacteria | 14661 |
| 1419 | Ga0495596_0002979 | 3300046500 | Bacteria | 8785 |
| 1420 | Ga0495596_0016589 | 3300046500 | Bacteria | 3056 |
| 1421 | Ga0495596_0110255 | 3300046500 | Bacteria | 1068 |
| 1422 | Ga0495607_0000146 | 3300046501 | Bacteria | 74540 |
| 1423 | Ga0495607_0012687 | 3300046501 | Bacteria | 5550 |
| 1424 | Ga0495607_0043832 | 3300046501 | Bacteria | 2642 |
| 1425 | Ga0495607_0047575 | 3300046501 | Bacteria | 2512 |
| 1426 | Ga0495607_0108759 | 3300046501 | Bacteria | 1472 |
| 1427 | Ga0495607_0131367 | 3300046501 | Bacteria | 1302 |
| 1428 | Ga0495607_0151172 | 3300046501 | Bacteria | 1188 |
| 1429 | Ga0495607_0161243 | 3300046501 | Bacteria | 1139 |
| 1430 | Ga0495607_0173846 | 3300046501 | Bacteria | 1085 |
| 1431 | Ga0495607_0463128 | 3300046501 | Bacteria | 567 |
| 1432 | Ga0495583_0000035 | 3300046506 | Bacteria | 246849 |
| 1433 | Ga0495583_0000464 | 3300046506 | Bacteria | 59972 |
| 1434 | Ga0495583_0000515 | 3300046506 | Bacteria | 55250 |
| 1435 | Ga0495583_0000941 | 3300046506 | Bacteria | 33886 |
| 1436 | Ga0495583_0025532 | 3300046506 | Bacteria | 2949 |
| 1437 | Ga0495583_0026085 | 3300046506 | Bacteria | 2905 |
| 1438 | Ga0495583_0037110 | 3300046506 | Bacteria | 2312 |
| 1439 | Ga0495606_0000011 | 3300046507 | Bacteria | 296816 |
| 1440 | Ga0495606_0000064 | 3300046507 | Bacteria | 183631 |
| 1441 | Ga0495606_0008212 | 3300046507 | Bacteria | 9127 |
| 1442 | Ga0495606_0015425 | 3300046507 | Bacteria | 5885 |
| 1443 | Ga0495606_0015437 | 3300046507 | Bacteria | 5883 |
| 1444 | Ga0495606_0031884 | 3300046507 | Bacteria | 3658 |
| 1445 | Ga0495606_0041980 | 3300046507 | Bacteria | 3063 |
| 1446 | Ga0495606_0076629 | 3300046507 | Bacteria | 2089 |
| 1447 | Ga0495606_0079664 | 3300046507 | Bacteria | 2039 |
| 1448 | Ga0495606_0087399 | 3300046507 | Bacteria | 1924 |
| 1449 | Ga0495606_0107100 | 3300046507 | Bacteria | 1691 |
| 1450 | Ga0495606_0225456 | 3300046507 | Bacteria | 1053 |
| 1451 | Ga0495606_0258014 | 3300046507 | Bacteria | 963 |
| 1452 | Ga0495606_0585633 | 3300046507 | Bacteria | 549 |
| 1453 | Ga0495608_0060034 | 3300046511 | Bacteria | 2503 |
| 1454 | Ga0495608_0243247 | 3300046511 | Bacteria | 1123 |
| 1455 | Ga0495608_0307552 | 3300046511 | Bacteria | 981 |
| 1456 | Ga0495610_0000003 | 3300046512 | Bacteria | 1203910 |
| 1457 | Ga0495610_0000147 | 3300046512 | Bacteria | 77304 |
| 1458 | Ga0495610_0020763 | 3300046512 | Bacteria | 3636 |
| 1459 | Ga0495610_0030292 | 3300046512 | Bacteria | 2837 |
| 1460 | Ga0495610_0075901 | 3300046512 | Bacteria | 1555 |
| 1461 | Ga0495610_0111465 | 3300046512 | Bacteria | 1211 |
| 1462 | Ga0495610_0269380 | 3300046512 | Bacteria | 667 |
| 1463 | Ga0495616_0005111 | 3300046513 | Bacteria | 8150 |
| 1464 | Ga0495616_0010998 | 3300046513 | Bacteria | 5206 |
| 1465 | Ga0495616_0033526 | 3300046513 | Bacteria | 2674 |
| 1466 | Ga0495616_0068125 | 3300046513 | Bacteria | 1728 |
| 1467 | Ga0495616_0081978 | 3300046513 | Bacteria | 1541 |
| 1468 | Ga0495616_0090764 | 3300046513 | Bacteria | 1446 |
| 1469 | Ga0495616_0093850 | 3300046513 | Bacteria | 1416 |
| 1470 | Ga0495616_0103929 | 3300046513 | Bacteria | 1328 |
| 1471 | Ga0495616_0103962 | 3300046513 | Bacteria | 1328 |
| 1472 | Ga0495616_0138043 | 3300046513 | Bacteria | 1112 |
| 1473 | Ga0495618_0059440 | 3300046514 | Bacteria | 2422 |
| 1474 | Ga0495620_0005610 | 3300046515 | Bacteria | 6987 |
| 1475 | Ga0495628_0001929 | 3300046516 | Bacteria | 18824 |
| 1476 | Ga0495628_1053217 | 3300046516 | Bacteria | 557 |
| 1477 | Ga0495630_0011239 | 3300046517 | Bacteria | 6476 |
| 1478 | Ga0495630_0016385 | 3300046517 | Bacteria | 5414 |
| 1479 | Ga0495630_0104553 | 3300046517 | Bacteria | 2143 |
| 1480 | Ga0495630_0214172 | 3300046517 | Bacteria | 1470 |
| 1481 | Ga0495630_0356463 | 3300046517 | Bacteria | 1119 |
| 1482 | Ga0495630_0589118 | 3300046517 | Bacteria | 853 |
| 1483 | Ga0495631_0011492 | 3300046518 | Bacteria | 4352 |
| 1484 | Ga0495631_0025302 | 3300046518 | Bacteria | 2734 |
| 1485 | Ga0495631_0059603 | 3300046518 | Bacteria | 1658 |
| 1486 | Ga0495631_0086696 | 3300046518 | Bacteria | 1348 |
| 1487 | Ga0495631_0117343 | 3300046518 | Bacteria | 1144 |
| 1488 | Ga0495631_0253159 | 3300046518 | Bacteria | 750 |
| 1489 | Ga0495631_0326922 | 3300046518 | Bacteria | 652 |
| 1490 | Ga0495632_0000250 | 3300046519 | Bacteria | 53467 |
| 1491 | Ga0495632_0019797 | 3300046519 | Bacteria | 3658 |
| 1492 | Ga0495632_0046632 | 3300046519 | Bacteria | 2152 |
| 1493 | Ga0495632_0055038 | 3300046519 | Bacteria | 1948 |
| 1494 | Ga0495632_0275491 | 3300046519 | Bacteria | 750 |
| 1495 | Ga0495637_0000004 | 3300046520 | Bacteria | 589740 |
| 1496 | Ga0495637_0002614 | 3300046520 | Bacteria | 9881 |
| 1497 | Ga0495637_0020216 | 3300046520 | Bacteria | 3066 |
| 1498 | Ga0495643_0000933 | 3300046522 | Bacteria | 30408 |
| 1499 | Ga0495643_0006906 | 3300046522 | Bacteria | 7391 |
| 1500 | Ga0495643_0031051 | 3300046522 | Bacteria | 2977 |
| 1501 | Ga0495643_0045226 | 3300046522 | Bacteria | 2390 |
| 1502 | Ga0495643_0045455 | 3300046522 | Bacteria | 2383 |
| 1503 | Ga0495643_0099955 | 3300046522 | Bacteria | 1487 |
| 1504 | Ga0495643_0100936 | 3300046522 | Bacteria | 1479 |
| 1505 | Ga0495643_0116765 | 3300046522 | Bacteria | 1351 |
| 1506 | Ga0495643_0254848 | 3300046522 | Bacteria | 817 |
| 1507 | Ga0495644_0005823 | 3300046523 | Bacteria | 4813 |
| 1508 | Ga0495644_0011056 | 3300046523 | Bacteria | 3479 |
| 1509 | Ga0495644_0012807 | 3300046523 | Bacteria | 3224 |
| 1510 | Ga0495644_0039079 | 3300046523 | Bacteria | 1789 |
| 1511 | Ga0495644_0052182 | 3300046523 | Bacteria | 1535 |
| 1512 | Ga0495644_0059009 | 3300046523 | Bacteria | 1442 |
| 1513 | Ga0495644_0064010 | 3300046523 | Bacteria | 1382 |
| 1514 | Ga0495644_0082189 | 3300046523 | Bacteria | 1214 |
| 1515 | Ga0495644_0094584 | 3300046523 | Bacteria | 1128 |
| 1516 | Ga0495644_0173745 | 3300046523 | Bacteria | 827 |
| 1517 | Ga0495644_0350380 | 3300046523 | Bacteria | 581 |
| 1518 | Ga0495644_0445199 | 3300046523 | Bacteria | 515 |
| 1519 | Ga0495648_0000001 | 3300046524 | Bacteria | 696872 |
| 1520 | Ga0495648_0002588 | 3300046524 | Bacteria | 16566 |
| 1521 | Ga0495648_0007597 | 3300046524 | Bacteria | 8656 |
| 1522 | Ga0495648_0026333 | 3300046524 | Bacteria | 3917 |
| 1523 | Ga0495648_0035961 | 3300046524 | Bacteria | 3203 |
| 1524 | Ga0495648_0041230 | 3300046524 | Bacteria | 2918 |
| 1525 | Ga0495648_0058058 | 3300046524 | Bacteria | 2316 |
| 1526 | Ga0495648_0065957 | 3300046524 | Bacteria | 2124 |
| 1527 | Ga0495648_0072601 | 3300046524 | Bacteria | 1991 |
| 1528 | Ga0495648_0077815 | 3300046524 | Bacteria | 1899 |
| 1529 | Ga0495648_0093764 | 3300046524 | Bacteria | 1673 |
| 1530 | Ga0495648_0096077 | 3300046524 | Bacteria | 1647 |
| 1531 | Ga0495648_0381431 | 3300046524 | Bacteria | 635 |
| 1532 | Ga0495663_0018551 | 3300046525 | Bacteria | 1981 |
| 1533 | Ga0495663_0058761 | 3300046525 | Bacteria | 1205 |
| 1534 | Ga0495663_0095728 | 3300046525 | Bacteria | 972 |
| 1535 | Ga0495666_0002752 | 3300046526 | Bacteria | 8787 |
| 1536 | Ga0495666_0006205 | 3300046526 | Bacteria | 6017 |
| 1537 | Ga0495666_0011231 | 3300046526 | Bacteria | 4467 |
| 1538 | Ga0495666_0012973 | 3300046526 | Bacteria | 4153 |
| 1539 | Ga0495666_0060314 | 3300046526 | Bacteria | 1813 |
| 1540 | Ga0495666_0157285 | 3300046526 | Bacteria | 1055 |
| 1541 | Ga0495666_0186219 | 3300046526 | Bacteria | 957 |
| 1542 | Ga0495666_0205407 | 3300046526 | Bacteria | 905 |
| 1543 | Ga0495666_0447872 | 3300046526 | Bacteria | 578 |
| 1544 | Ga0495642_0000366 | 3300046528 | Bacteria | 24393 |
| 1545 | Ga0495642_0037261 | 3300046528 | Bacteria | 1967 |
| 1546 | Ga0495642_0043210 | 3300046528 | Bacteria | 1837 |
| 1547 | Ga0495642_0051391 | 3300046528 | Bacteria | 1695 |
| 1548 | Ga0495642_0113555 | 3300046528 | Bacteria | 1159 |
| 1549 | Ga0495642_0121583 | 3300046528 | Bacteria | 1120 |
| 1550 | Ga0495642_0136233 | 3300046528 | Bacteria | 1058 |
| 1551 | Ga0495642_0197240 | 3300046528 | Bacteria | 877 |
| 1552 | Ga0495642_0268587 | 3300046528 | Bacteria | 746 |
| 1553 | Ga0495652_0029810 | 3300046529 | Bacteria | 4790 |
| 1554 | Ga0495652_0456531 | 3300046529 | Bacteria | 893 |
| 1555 | Ga0495652_0681737 | 3300046529 | Bacteria | 693 |
| 1556 | Ga0495654_0000028 | 3300046530 | Bacteria | 223384 |
| 1557 | Ga0495654_0038980 | 3300046530 | Bacteria | 2373 |
| 1558 | Ga0495654_0052592 | 3300046530 | Bacteria | 1982 |
| 1559 | Ga0495654_0066092 | 3300046530 | Bacteria | 1725 |
| 1560 | Ga0495654_0068091 | 3300046530 | Bacteria | 1692 |
| 1561 | Ga0495654_0079581 | 3300046530 | Bacteria | 1539 |
| 1562 | Ga0495654_0094274 | 3300046530 | Bacteria | 1385 |
| 1563 | Ga0495654_0112433 | 3300046530 | Bacteria | 1241 |
| 1564 | Ga0495654_0338477 | 3300046530 | Bacteria | 607 |
| 1565 | Ga0495665_0005600 | 3300046531 | Bacteria | 6766 |
| 1566 | Ga0495665_0031234 | 3300046531 | Bacteria | 2850 |
| 1567 | Ga0495665_0037697 | 3300046531 | Bacteria | 2579 |
| 1568 | Ga0495665_0050815 | 3300046531 | Bacteria | 2197 |
| 1569 | Ga0495665_0070023 | 3300046531 | Bacteria | 1848 |
| 1570 | Ga0495665_0311788 | 3300046531 | Bacteria | 804 |
| 1571 | Ga0495665_0571292 | 3300046531 | Bacteria | 566 |
| 1572 | Ga0495640_0000332 | 3300046533 | Bacteria | 32858 |
| 1573 | Ga0495640_0040721 | 3300046533 | Bacteria | 3251 |
| 1574 | Ga0495640_0042765 | 3300046533 | Bacteria | 3159 |
| 1575 | Ga0495640_0054180 | 3300046533 | Bacteria | 2749 |
| 1576 | Ga0495640_0263223 | 3300046533 | Bacteria | 1077 |
| 1577 | Ga0495640_0316478 | 3300046533 | Bacteria | 967 |
| 1578 | Ga0495586_0001612 | 3300046535 | Bacteria | 12371 |
| 1579 | Ga0495586_0002680 | 3300046535 | Bacteria | 9632 |
| 1580 | Ga0495586_0047882 | 3300046535 | Bacteria | 2308 |
| 1581 | Ga0495586_0057896 | 3300046535 | Bacteria | 2103 |
| 1582 | Ga0495586_0126869 | 3300046535 | Bacteria | 1427 |
| 1583 | Ga0495586_0133520 | 3300046535 | Bacteria | 1390 |
| 1584 | Ga0495587_0013600 | 3300046536 | Bacteria | 5113 |
| 1585 | Ga0495587_0054498 | 3300046536 | Bacteria | 2356 |
| 1586 | Ga0495587_0120716 | 3300046536 | Bacteria | 1501 |
| 1587 | Ga0495587_0162193 | 3300046536 | Bacteria | 1272 |
| 1588 | Ga0495587_0519753 | 3300046536 | Bacteria | 657 |
| 1589 | Ga0495587_0633605 | 3300046536 | Bacteria | 588 |
| 1590 | Ga0495598_0039369 | 3300046537 | Bacteria | 1374 |
| 1591 | Ga0495598_0051470 | 3300046537 | Bacteria | 1241 |
| 1592 | Ga0495598_0235033 | 3300046537 | Bacteria | 674 |
| 1593 | Ga0495609_0000202 | 3300046538 | Bacteria | 59327 |
| 1594 | Ga0495609_0000632 | 3300046538 | Bacteria | 27358 |
| 1595 | Ga0495609_0000731 | 3300046538 | Bacteria | 24981 |
| 1596 | Ga0495609_0005004 | 3300046538 | Bacteria | 7088 |
| 1597 | Ga0495609_0011146 | 3300046538 | Bacteria | 4291 |
| 1598 | Ga0495609_0019147 | 3300046538 | Bacteria | 3169 |
| 1599 | Ga0495609_0050578 | 3300046538 | Bacteria | 1852 |
| 1600 | Ga0495609_0093344 | 3300046538 | Bacteria | 1308 |
| 1601 | Ga0495609_0148567 | 3300046538 | Bacteria | 997 |
| 1602 | Ga0495609_0199620 | 3300046538 | Bacteria | 836 |
| 1603 | Ga0495621_0010474 | 3300046539 | Bacteria | 2838 |
| 1604 | Ga0495621_0011182 | 3300046539 | Bacteria | 2769 |
| 1605 | Ga0495621_0013172 | 3300046539 | Bacteria | 2594 |
| 1606 | Ga0495621_0107235 | 3300046539 | Bacteria | 1068 |
| 1607 | Ga0495621_0164068 | 3300046539 | Bacteria | 880 |
| 1608 | Ga0495597_0010170 | 3300046542 | Bacteria | 4609 |
| 1609 | Ga0495597_0022198 | 3300046542 | Bacteria | 2945 |
| 1610 | Ga0495597_0043912 | 3300046542 | Bacteria | 1988 |
| 1611 | Ga0495597_0049650 | 3300046542 | Bacteria | 1853 |
| 1612 | Ga0495597_0054930 | 3300046542 | Bacteria | 1747 |
| 1613 | Ga0495597_0069719 | 3300046542 | Bacteria | 1516 |
| 1614 | Ga0495597_0081127 | 3300046542 | Bacteria | 1387 |
| 1615 | Ga0495597_0081891 | 3300046542 | Bacteria | 1379 |
| 1616 | Ga0495597_0151049 | 3300046542 | Bacteria | 953 |
| 1617 | Ga0495597_0205414 | 3300046542 | Bacteria | 787 |
| 1618 | Ga0495597_0235955 | 3300046542 | Bacteria | 722 |
| 1619 | Ga0495597_0345635 | 3300046542 | Bacteria | 571 |
| 1620 | Ga0495645_0196737 | 3300046543 | Bacteria | 1370 |
| 1621 | Ga0495645_0280617 | 3300046543 | Bacteria | 1095 |
| 1622 | Ga0495622_0000068 | 3300046557 | Bacteria | 90633 |
| 1623 | Ga0495622_0006132 | 3300046557 | Bacteria | 5585 |
| 1624 | Ga0495622_0029717 | 3300046557 | Bacteria | 2553 |
| 1625 | Ga0495622_0061892 | 3300046557 | Bacteria | 1732 |
| 1626 | Ga0495622_0104183 | 3300046557 | Bacteria | 1299 |
| 1627 | Ga0495622_0105294 | 3300046557 | Bacteria | 1292 |
| 1628 | Ga0495622_0122940 | 3300046557 | Bacteria | 1184 |
| 1629 | Ga0495622_0167628 | 3300046557 | Bacteria | 988 |
| 1630 | Ga0495622_0184950 | 3300046557 | Bacteria | 933 |
| 1631 | Ga0495633_0006613 | 3300046558 | Bacteria | 6842 |
| 1632 | Ga0495633_0007375 | 3300046558 | Bacteria | 6335 |
| 1633 | Ga0495633_0008653 | 3300046558 | Bacteria | 5714 |
| 1634 | Ga0495633_0034176 | 3300046558 | Bacteria | 2446 |
| 1635 | Ga0495633_0034661 | 3300046558 | Bacteria | 2426 |
| 1636 | Ga0495633_0093371 | 3300046558 | Bacteria | 1398 |
| 1637 | Ga0495633_0100650 | 3300046558 | Bacteria | 1341 |
| 1638 | Ga0495633_0121004 | 3300046558 | Bacteria | 1212 |
| 1639 | Ga0495633_0135146 | 3300046558 | Bacteria | 1140 |
| 1640 | Ga0495633_0147848 | 3300046558 | Bacteria | 1085 |
| 1641 | Ga0495633_0153652 | 3300046558 | Bacteria | 1062 |
| 1642 | Ga0495633_0168545 | 3300046558 | Bacteria | 1009 |
| 1643 | Ga0495633_0196114 | 3300046558 | Bacteria | 927 |
| 1644 | Ga0495633_0243807 | 3300046558 | Bacteria | 820 |
| 1645 | Ga0495633_0480125 | 3300046558 | Bacteria | 561 |
| 1646 | Ga0495667_0008831 | 3300046559 | Bacteria | 6853 |
| 1647 | Ga0495667_0025952 | 3300046559 | Bacteria | 3946 |
| 1648 | Ga0495667_0339598 | 3300046559 | Bacteria | 950 |
| 1649 | Ga0495656_0153543 | 3300046615 | Bacteria | 1113 |
| 1650 | Ga0495656_0160500 | 3300046615 | Bacteria | 1092 |
| 1651 | Ga0495656_0191516 | 3300046615 | Bacteria | 1010 |
| 1652 | Ga0495656_0203451 | 3300046615 | Bacteria | 983 |
| 1653 | Ga0495656_0295141 | 3300046615 | Bacteria | 829 |
| 1654 | Ga0495656_0691904 | 3300046615 | Bacteria | 548 |
| 1655 | Ga0495656_0791185 | 3300046615 | Bacteria | 512 |
| 1656 | Ga0495668_0000048 | 3300046616 | Bacteria | 217867 |
| 1657 | Ga0495668_0001049 | 3300046616 | Bacteria | 29314 |
| 1658 | Ga0495668_0001239 | 3300046616 | Bacteria | 25630 |
| 1659 | Ga0495668_0012767 | 3300046616 | Bacteria | 4974 |
| 1660 | Ga0495668_0015049 | 3300046616 | Bacteria | 4526 |
| 1661 | Ga0495668_0024042 | 3300046616 | Bacteria | 3467 |
| 1662 | Ga0495668_0074781 | 3300046616 | Bacteria | 1860 |
| 1663 | Ga0495668_0103640 | 3300046616 | Bacteria | 1556 |
| 1664 | Ga0495668_0133401 | 3300046616 | Bacteria | 1359 |
| 1665 | Ga0495668_0135939 | 3300046616 | Bacteria | 1345 |
| 1666 | Ga0495668_0408171 | 3300046616 | Bacteria | 746 |
| 1667 | Ga0495634_0019021 | 3300046642 | Bacteria | 4883 |
| 1668 | Ga0495634_0141276 | 3300046642 | Bacteria | 1528 |
| 1669 | Ga0495634_0225284 | 3300046642 | Bacteria | 1155 |
| 1670 | Ga0495634_0343268 | 3300046642 | Bacteria | 895 |
| 1671 | Ga0495611_0001880 | 3300046648 | Bacteria | 10002 |
| 1672 | Ga0495611_0010338 | 3300046648 | Bacteria | 3948 |
| 1673 | Ga0495611_0024049 | 3300046648 | Bacteria | 2647 |
| 1674 | Ga0495611_0039658 | 3300046648 | Bacteria | 2097 |
| 1675 | Ga0495611_0088858 | 3300046648 | Bacteria | 1426 |
| 1676 | Ga0495611_0220431 | 3300046648 | Bacteria | 882 |
| 1677 | Ga0495625_0005736 | 3300046660 | Bacteria | 11222 |
| 1678 | Ga0495625_0008141 | 3300046660 | Bacteria | 8981 |
| 1679 | Ga0495625_0013178 | 3300046660 | Bacteria | 6659 |
| 1680 | Ga0495625_0019706 | 3300046660 | Bacteria | 5223 |
| 1681 | Ga0495625_0033686 | 3300046660 | Bacteria | 3784 |
| 1682 | Ga0495625_0080087 | 3300046660 | Bacteria | 2275 |
| 1683 | Ga0495625_0154224 | 3300046660 | Bacteria | 1542 |
| 1684 | Ga0495625_0186460 | 3300046660 | Bacteria | 1376 |
| 1685 | Ga0495625_0212373 | 3300046660 | Bacteria | 1271 |
| 1686 | Ga0495625_0384700 | 3300046660 | Bacteria | 879 |
| 1687 | Ga0495625_0624382 | 3300046660 | Bacteria | 644 |
| 1688 | Ga0495635_0013701 | 3300046663 | Bacteria | 5673 |
| 1689 | Ga0495635_0019832 | 3300046663 | Bacteria | 4684 |
| 1690 | Ga0495635_0030213 | 3300046663 | Bacteria | 3765 |
| 1691 | Ga0495635_0061139 | 3300046663 | Bacteria | 2587 |
| 1692 | Ga0495635_0526042 | 3300046663 | Bacteria | 777 |
| 1693 | Ga0495635_0584544 | 3300046663 | Bacteria | 730 |
| 1694 | Ga0495659_0001303 | 3300046664 | Bacteria | 8570 |
| 1695 | Ga0495659_0003422 | 3300046664 | Bacteria | 5070 |
| 1696 | Ga0495659_0023879 | 3300046664 | Bacteria | 2080 |
| 1697 | Ga0495659_0025638 | 3300046664 | Bacteria | 2019 |
| 1698 | Ga0495661_0000894 | 3300046665 | Bacteria | 27503 |
| 1699 | Ga0495661_0027661 | 3300046665 | Bacteria | 3637 |
| 1700 | Ga0495661_0037675 | 3300046665 | Bacteria | 3017 |
| 1701 | Ga0495661_0040131 | 3300046665 | Bacteria | 2905 |
| 1702 | Ga0495661_0047776 | 3300046665 | Bacteria | 2604 |
| 1703 | Ga0495661_0066666 | 3300046665 | Bacteria | 2117 |
| 1704 | Ga0495661_0092034 | 3300046665 | Bacteria | 1723 |
| 1705 | Ga0495661_0110406 | 3300046665 | Bacteria | 1533 |
| 1706 | Ga0495661_0144680 | 3300046665 | Bacteria | 1289 |
| 1707 | Ga0495661_0182630 | 3300046665 | Bacteria | 1110 |
| 1708 | Ga0495661_0274760 | 3300046665 | Bacteria | 851 |
| 1709 | Ga0495661_0307386 | 3300046665 | Bacteria | 791 |
| 1710 | Ga0495588_0000174 | 3300046674 | Bacteria | 81329 |
| 1711 | Ga0495588_0013191 | 3300046674 | Bacteria | 3931 |
| 1712 | Ga0495588_0017660 | 3300046674 | Bacteria | 3469 |
| 1713 | Ga0495588_0028280 | 3300046674 | Bacteria | 2804 |
| 1714 | Ga0495588_0028920 | 3300046674 | Bacteria | 2777 |
| 1715 | Ga0495588_0036538 | 3300046674 | Bacteria | 2492 |
| 1716 | Ga0495588_0085138 | 3300046674 | Bacteria | 1652 |
| 1717 | Ga0495588_0094769 | 3300046674 | Bacteria | 1565 |
| 1718 | Ga0495588_0113679 | 3300046674 | Bacteria | 1426 |
| 1719 | Ga0495588_0145496 | 3300046674 | Bacteria | 1252 |
| 1720 | Ga0495588_0248952 | 3300046674 | Bacteria | 937 |
| 1721 | Ga0495588_0452445 | 3300046674 | Bacteria | 673 |
| 1722 | Ga0495588_0544026 | 3300046674 | Bacteria | 608 |
| 1723 | Ga0495657_0061543 | 3300046675 | Bacteria | 2482 |
| 1724 | Ga0495599_0070371 | 3300046678 | Bacteria | 2184 |
| 1725 | Ga0495599_0212083 | 3300046678 | Bacteria | 1187 |
| 1726 | Ga0495623_0062383 | 3300046679 | Bacteria | 2336 |
| 1727 | Ga0495623_0088447 | 3300046679 | Bacteria | 1906 |
| 1728 | Ga0495623_0126919 | 3300046679 | Bacteria | 1531 |
| 1729 | Ga0495646_0117109 | 3300046680 | Bacteria | 1511 |
| 1730 | Ga0495646_0171456 | 3300046680 | Bacteria | 1195 |
| 1731 | Ga0495646_0256228 | 3300046680 | Bacteria | 936 |
| 1732 | Ga0495647_0018160 | 3300046681 | Bacteria | 2499 |
| 1733 | Ga0495647_0019605 | 3300046681 | Bacteria | 2419 |
| 1734 | Ga0495647_0032169 | 3300046681 | Bacteria | 1954 |
| 1735 | Ga0495647_0441362 | 3300046681 | Bacteria | 601 |
| 1736 | Ga0495658_0013899 | 3300046683 | Bacteria | 4103 |
| 1737 | Ga0495658_0023459 | 3300046683 | Bacteria | 3275 |
| 1738 | Ga0495658_0059219 | 3300046683 | Bacteria | 2192 |
| 1739 | Ga0495658_0277342 | 3300046683 | Bacteria | 1057 |
| 1740 | Ga0495658_0318448 | 3300046683 | Bacteria | 985 |
| 1741 | Ga0495669_0007067 | 3300046684 | Bacteria | 4700 |
| 1742 | Ga0495669_0030462 | 3300046684 | Bacteria | 2368 |
| 1743 | Ga0495669_0032428 | 3300046684 | Bacteria | 2296 |
| 1744 | Ga0495669_0102634 | 3300046684 | Bacteria | 1329 |
| 1745 | Ga0495669_0122337 | 3300046684 | Bacteria | 1220 |
| 1746 | Ga0495669_0312111 | 3300046684 | Bacteria | 758 |
| 1747 | Ga0495613_0006401 | 3300046689 | Bacteria | 8799 |
| 1748 | Ga0495613_0012801 | 3300046689 | Bacteria | 6237 |
| 1749 | Ga0495613_0206651 | 3300046689 | Bacteria | 1382 |
| 1750 | Ga0495624_0098156 | 3300046690 | Bacteria | 1804 |
| 1751 | Ga0495624_0113806 | 3300046690 | Bacteria | 1663 |
| 1752 | Ga0495624_0200579 | 3300046690 | Bacteria | 1212 |
| 1753 | Ga0495624_0574798 | 3300046690 | Bacteria | 672 |
| 1754 | Ga0495670_0007032 | 3300046691 | Bacteria | 5539 |
| 1755 | Ga0495670_0009786 | 3300046691 | Bacteria | 4712 |
| 1756 | Ga0495670_0011696 | 3300046691 | Bacteria | 4320 |
| 1757 | Ga0495670_0106314 | 3300046691 | Bacteria | 1449 |
| 1758 | Ga0495670_0227423 | 3300046691 | Bacteria | 991 |
| 1759 | Ga0495670_0244567 | 3300046691 | Bacteria | 955 |
| 1760 | Ga0495670_0262056 | 3300046691 | Bacteria | 922 |
| 1761 | Ga0495670_0392516 | 3300046691 | Bacteria | 749 |
| 1762 | Ga0495670_0815647 | 3300046691 | Bacteria | 509 |
| 1763 | Ga0495671_0000001 | 3300046692 | Bacteria | 1169494 |
| 1764 | Ga0495671_0019237 | 3300046692 | Bacteria | 3613 |
| 1765 | Ga0495671_0043851 | 3300046692 | Bacteria | 2244 |
| 1766 | Ga0495671_0057396 | 3300046692 | Bacteria | 1926 |
| 1767 | Ga0495671_0068086 | 3300046692 | Bacteria | 1750 |
| 1768 | Ga0495671_0128812 | 3300046692 | Bacteria | 1234 |
| 1769 | Ga0495649_0086174 | 3300046694 | Bacteria | 1676 |
| 1770 | Ga0495649_0089196 | 3300046694 | Bacteria | 1644 |
| 1771 | Ga0495649_0111267 | 3300046694 | Bacteria | 1452 |
| 1772 | Ga0495649_0136693 | 3300046694 | Bacteria | 1291 |
| 1773 | Ga0495649_0164836 | 3300046694 | Bacteria | 1161 |
| 1774 | Ga0495649_0196964 | 3300046694 | Bacteria | 1047 |
| 1775 | Ga0495649_0407926 | 3300046694 | Bacteria | 681 |
| 1776 | Ga0495589_0005458 | 3300046794 | Bacteria | 6709 |
| 1777 | Ga0495589_0016939 | 3300046794 | Bacteria | 3741 |
| 1778 | Ga0495589_0038017 | 3300046794 | Bacteria | 2410 |
| 1779 | Ga0495589_0074369 | 3300046794 | Bacteria | 1658 |
| 1780 | Ga0495589_0075171 | 3300046794 | Bacteria | 1647 |
| 1781 | Ga0495589_0106592 | 3300046794 | Bacteria | 1354 |
| 1782 | Ga0495589_0189849 | 3300046794 | Bacteria | 972 |
| 1783 | Ga0495589_0275352 | 3300046794 | Bacteria | 783 |
| 1784 | Ga0495589_0448607 | 3300046794 | Bacteria | 590 |
| 1785 | Ga0495589_0526539 | 3300046794 | Bacteria | 539 |
| 1786 | Ga0495600_0001395 | 3300046809 | Bacteria | 13324 |
| 1787 | Ga0495600_0003020 | 3300046809 | Bacteria | 9822 |
| 1788 | Ga0495600_0009571 | 3300046809 | Bacteria | 5991 |
| 1789 | Ga0495660_0000157 | 3300046810 | Bacteria | 73772 |
| 1790 | Ga0495660_0008377 | 3300046810 | Bacteria | 6046 |
| 1791 | Ga0495660_0011707 | 3300046810 | Bacteria | 5089 |
| 1792 | Ga0495660_0019417 | 3300046810 | Bacteria | 3902 |
| 1793 | Ga0495660_0021276 | 3300046810 | Bacteria | 3714 |
| 1794 | Ga0495660_0034095 | 3300046810 | Bacteria | 2850 |
| 1795 | Ga0495660_0041115 | 3300046810 | Bacteria | 2561 |
| 1796 | Ga0495660_0144672 | 3300046810 | Bacteria | 1179 |
| 1797 | Ga0495660_0184876 | 3300046810 | Bacteria | 1005 |
| 1798 | Ga0495660_0203368 | 3300046810 | Bacteria | 944 |
| 1799 | Ga0495581_0029270 | 3300047315 | Bacteria | 3192 |
| 1800 | Ga0495581_0061774 | 3300047315 | Bacteria | 2165 |
| 1801 | Ga0495581_0077497 | 3300047315 | Bacteria | 1923 |
| 1802 | Ga0495581_0089854 | 3300047315 | Bacteria | 1781 |
| 1803 | Ga0495581_0399830 | 3300047315 | Bacteria | 801 |
| 1804 | Ga0495604_0013374 | 3300047317 | Bacteria | 6535 |
| 1805 | Ga0495604_0025790 | 3300047317 | Bacteria | 4681 |
| 1806 | Ga0495604_0070450 | 3300047317 | Bacteria | 2647 |
| 1807 | Ga0495604_0215863 | 3300047317 | Bacteria | 1323 |
| 1808 | Ga0495636_0013522 | 3300047318 | Bacteria | 3240 |
| 1809 | Ga0495636_0028161 | 3300047318 | Bacteria | 2289 |
| 1810 | Ga0495636_0030003 | 3300047318 | Bacteria | 2221 |
| 1811 | Ga0495636_0030241 | 3300047318 | Bacteria | 2213 |
| 1812 | Ga0495636_0190048 | 3300047318 | Bacteria | 934 |
| 1813 | Ga0495636_0318890 | 3300047318 | Bacteria | 729 |
| 1814 | Ga0495636_0328059 | 3300047318 | Bacteria | 719 |
| 1815 | Ga0495636_0334901 | 3300047318 | Bacteria | 712 |
| 1816 | Ga0495636_0581236 | 3300047318 | Bacteria | 546 |
| 1817 | Ga0495674_0047498 | 3300047319 | Bacteria | 3806 |
| 1818 | Ga0495674_0085356 | 3300047319 | Bacteria | 2704 |
| 1819 | Ga0495674_0940357 | 3300047319 | Bacteria | 665 |
| 1820 | Ga0495672_0000097 | 3300047320 | Bacteria | 141608 |
| 1821 | Ga0495672_0000126 | 3300047320 | Bacteria | 117782 |
| 1822 | Ga0495672_0000259 | 3300047320 | Bacteria | 73356 |
| 1823 | Ga0495672_0000302 | 3300047320 | Bacteria | 66589 |
| 1824 | Ga0495672_0014901 | 3300047320 | Bacteria | 5301 |
| 1825 | Ga0495672_0016317 | 3300047320 | Bacteria | 5009 |
| 1826 | Ga0495672_0054303 | 3300047320 | Bacteria | 2342 |
| 1827 | Ga0495672_0064756 | 3300047320 | Bacteria | 2091 |
| 1828 | Ga0495672_0127119 | 3300047320 | Bacteria | 1346 |
| 1829 | Ga0495676_0024464 | 3300047321 | Bacteria | 5228 |
| 1830 | Ga0495676_0040241 | 3300047321 | Bacteria | 3860 |
| 1831 | Ga0495676_0061436 | 3300047321 | Bacteria | 2939 |
| 1832 | Ga0495676_0116285 | 3300047321 | Bacteria | 1953 |
| 1833 | Ga0495676_0320558 | 3300047321 | Bacteria | 1041 |
| 1834 | Ga0495680_0001868 | 3300047322 | Bacteria | 22155 |
| 1835 | Ga0495680_0021668 | 3300047322 | Bacteria | 5374 |
| 1836 | Ga0495680_0192327 | 3300047322 | Bacteria | 1467 |
| 1837 | Ga0495680_0235599 | 3300047322 | Bacteria | 1302 |
| 1838 | Ga0495680_0248495 | 3300047322 | Bacteria | 1261 |
| 1839 | Ga0495683_0004993 | 3300047323 | Bacteria | 7431 |
| 1840 | Ga0495683_0008550 | 3300047323 | Bacteria | 5474 |
| 1841 | Ga0495683_0050632 | 3300047323 | Bacteria | 2078 |
| 1842 | Ga0495683_0094864 | 3300047323 | Bacteria | 1441 |
| 1843 | Ga0495683_0164529 | 3300047323 | Bacteria | 1023 |
| 1844 | Ga0495683_0324519 | 3300047323 | Bacteria | 655 |
| 1845 | Ga0495687_000002 | 3300047443 | Bacteria | 1085770 |
| 1846 | Ga0495687_000457 | 3300047443 | Bacteria | 49882 |
| 1847 | Ga0495687_000702 | 3300047443 | Bacteria | 37364 |
| 1848 | Ga0495687_000994 | 3300047443 | Bacteria | 28433 |
| 1849 | Ga0495687_006365 | 3300047443 | Bacteria | 7254 |
| 1850 | Ga0495687_008955 | 3300047443 | Bacteria | 5661 |
| 1851 | Ga0495687_010475 | 3300047443 | Bacteria | 5082 |
| 1852 | Ga0495687_014535 | 3300047443 | Bacteria | 4046 |
| 1853 | Ga0495687_066666 | 3300047443 | Bacteria | 1460 |
| 1854 | Ga0495675_0007368 | 3300047444 | Bacteria | 6778 |
| 1855 | Ga0495675_0106251 | 3300047444 | Bacteria | 1754 |
| 1856 | Ga0495675_0184835 | 3300047444 | Bacteria | 1274 |
| 1857 | Ga0495675_0236560 | 3300047444 | Bacteria | 1100 |
| 1858 | Ga0495675_0408643 | 3300047444 | Bacteria | 790 |
| 1859 | Ga0495675_0436126 | 3300047444 | Bacteria | 759 |
| 1860 | Ga0495677_0001656 | 3300047445 | Bacteria | 8951 |
| 1861 | Ga0495677_0004036 | 3300047445 | Bacteria | 5667 |
| 1862 | Ga0495677_0056792 | 3300047445 | Bacteria | 1446 |
| 1863 | Ga0495677_0093616 | 3300047445 | Bacteria | 1133 |
| 1864 | Ga0495677_0096683 | 3300047445 | Bacteria | 1115 |
| 1865 | Ga0495677_0116460 | 3300047445 | Bacteria | 1018 |
| 1866 | Ga0495677_0116588 | 3300047445 | Bacteria | 1017 |
| 1867 | Ga0495677_0133294 | 3300047445 | Bacteria | 951 |
| 1868 | Ga0495677_0163324 | 3300047445 | Bacteria | 860 |
| 1869 | Ga0495677_0171047 | 3300047445 | Bacteria | 840 |
| 1870 | Ga0495677_0260767 | 3300047445 | Bacteria | 678 |
| 1871 | Ga0495677_0280720 | 3300047445 | Bacteria | 653 |
| 1872 | Ga0495679_001915 | 3300047446 | Bacteria | 11141 |
| 1873 | Ga0495679_002551 | 3300047446 | Bacteria | 9192 |
| 1874 | Ga0495679_009967 | 3300047446 | Bacteria | 3763 |
| 1875 | Ga0495679_015702 | 3300047446 | Bacteria | 2761 |
| 1876 | Ga0495679_205866 | 3300047446 | Bacteria | 516 |
| 1877 | Ga0495685_000019 | 3300047447 | Bacteria | 73831 |
| 1878 | Ga0495685_004108 | 3300047447 | Bacteria | 4681 |
| 1879 | Ga0495685_027283 | 3300047447 | Bacteria | 1964 |
| 1880 | Ga0495685_030523 | 3300047447 | Bacteria | 1853 |
| 1881 | Ga0495685_051327 | 3300047447 | Bacteria | 1398 |
| 1882 | Ga0495685_059272 | 3300047447 | Bacteria | 1291 |
| 1883 | Ga0495673_0000097 | 3300047469 | Bacteria | 182247 |
| 1884 | Ga0495673_0000100 | 3300047469 | Bacteria | 173962 |
| 1885 | Ga0495673_0017896 | 3300047469 | Bacteria | 3585 |
| 1886 | Ga0495673_0135162 | 3300047469 | Bacteria | 966 |
| 1887 | Ga0495673_0224214 | 3300047469 | Bacteria | 694 |
| 1888 | Ga0495681_0040152 | 3300047470 | Bacteria | 2280 |
| 1889 | Ga0495681_0044744 | 3300047470 | Bacteria | 2124 |
| 1890 | Ga0495681_0049709 | 3300047470 | Bacteria | 1980 |
| 1891 | Ga0495681_0073885 | 3300047470 | Bacteria | 1538 |
| 1892 | Ga0495681_0126294 | 3300047470 | Bacteria | 1093 |
| 1893 | Ga0495681_0137367 | 3300047470 | Bacteria | 1035 |
| 1894 | Ga0495681_0199071 | 3300047470 | Bacteria | 813 |
| 1895 | Ga0495681_0336725 | 3300047470 | Bacteria | 576 |
| 1896 | Ga0495684_0098504 | 3300047471 | Bacteria | 2210 |
| 1897 | Ga0495686_0005033 | 3300047472 | Bacteria | 10612 |
| 1898 | Ga0495686_0018140 | 3300047472 | Bacteria | 4728 |
| 1899 | Ga0495686_0018201 | 3300047472 | Bacteria | 4719 |
| 1900 | Ga0495686_0064771 | 3300047472 | Bacteria | 2261 |
| 1901 | Ga0495686_0140863 | 3300047472 | Bacteria | 1423 |
| 1902 | Ga0495686_0213745 | 3300047472 | Bacteria | 1100 |
| 1903 | Ga0495686_0220372 | 3300047472 | Bacteria | 1079 |
| 1904 | Ga0495593_0026048 | 3300047673 | Bacteria | 3232 |
| 1905 | Ga0495593_0030667 | 3300047673 | Bacteria | 2941 |
| 1906 | Ga0495593_0063593 | 3300047673 | Bacteria | 1927 |
| 1907 | Ga0495593_0083801 | 3300047673 | Bacteria | 1646 |
| 1908 | Ga0495593_0087694 | 3300047673 | Bacteria | 1604 |
| 1909 | Ga0495593_0313336 | 3300047673 | Bacteria | 784 |
| 1910 | Ga0495593_0400699 | 3300047673 | Bacteria | 686 |
| 1911 | Ga0495602_0034817 | 3300048088 | Bacteria | 4704 |
| 1912 | Ga0495602_0146972 | 3300048088 | Bacteria | 1858 |
| 1913 | Ga0495602_0216990 | 3300048088 | Bacteria | 1447 |
| 1914 | Ga0495602_0254281 | 3300048088 | Bacteria | 1307 |
| 1915 | Ga0495602_0527923 | 3300048088 | Bacteria | 821 |
| 1916 | Ga0495614_0133794 | 3300048089 | Bacteria | 1098 |
| 1917 | Ga0495614_0157033 | 3300048089 | Bacteria | 1016 |
| 1918 | Ga0495614_0158387 | 3300048089 | Bacteria | 1012 |
| 1919 | Ga0495614_0603571 | 3300048089 | Bacteria | 527 |
| 1920 | Ga0495615_0008199 | 3300048090 | Bacteria | 2011 |
| 1921 | Ga0495615_0039914 | 3300048090 | Bacteria | 1166 |
| 1922 | Ga0495615_0090517 | 3300048090 | Bacteria | 852 |
| 1923 | Ga0495615_0101707 | 3300048090 | Bacteria | 813 |
| 1924 | Ga0495626_0000016 | 3300048091 | Bacteria | 232214 |
| 1925 | Ga0495626_0000026 | 3300048091 | Bacteria | 207698 |
| 1926 | Ga0495626_0002931 | 3300048091 | Bacteria | 11353 |
| 1927 | Ga0495626_0007918 | 3300048091 | Bacteria | 5881 |
| 1928 | Ga0495626_0009392 | 3300048091 | Bacteria | 5287 |
| 1929 | Ga0495626_0039663 | 3300048091 | Bacteria | 2227 |
| 1930 | Ga0495626_0059472 | 3300048091 | Bacteria | 1743 |
| 1931 | Ga0495626_0063508 | 3300048091 | Bacteria | 1674 |
| 1932 | Ga0495626_0328037 | 3300048091 | Bacteria | 600 |
| 1933 | Ga0496100_0007351 | 3300048903 | Bacteria | 6069 |
| 1934 | Ga0496100_0505931 | 3300048903 | Bacteria | 931 |
| 1935 | Ga0496100_0512356 | 3300048903 | Bacteria | 925 |
| 1936 | Ga0496101_0021065 | 3300048904 | Bacteria | 4474 |
| 1937 | Ga0496101_0663724 | 3300048904 | Bacteria | 824 |
| 1938 | Ga0496101_0721375 | 3300048904 | Bacteria | 787 |
| 1939 | Ga0496101_1011655 | 3300048904 | Bacteria | 653 |
| 1940 | Ga0496101_1264700 | 3300048904 | Bacteria | 577 |
| 1941 | Ga0496101_1544142 | 3300048904 | Bacteria | 516 |
| 1942 | Ga0496102_0001202 | 3300048905 | Bacteria | 23500 |
| 1943 | Ga0496102_0229748 | 3300048905 | Bacteria | 1749 |
| 1944 | Ga0496102_0273261 | 3300048905 | Bacteria | 1593 |
| 1945 | Ga0496102_0436832 | 3300048905 | Bacteria | 1228 |
| 1946 | Ga0496102_0596621 | 3300048905 | Bacteria | 1027 |
| 1947 | Ga0496102_0850748 | 3300048905 | Bacteria | 834 |
| 1948 | Ga0496102_1406222 | 3300048905 | Bacteria | 617 |
| 1949 | Ga0496103_0011633 | 3300048906 | Bacteria | 5218 |
| 1950 | Ga0496103_0033010 | 3300048906 | Bacteria | 3161 |
| 1951 | Ga0496103_0052491 | 3300048906 | Bacteria | 2525 |
| 1952 | Ga0496103_0223449 | 3300048906 | Bacteria | 1211 |
| 1953 | Ga0496103_0436650 | 3300048906 | Bacteria | 840 |
| 1954 | Ga0496103_0643335 | 3300048906 | Bacteria | 674 |
| 1955 | Ga0496104_0338190 | 3300048907 | Bacteria | 1418 |
| 1956 | Ga0496104_0470315 | 3300048907 | Bacteria | 1168 |
| 1957 | Ga0496104_0490806 | 3300048907 | Bacteria | 1139 |
| 1958 | Ga0496105_0214483 | 3300048908 | Bacteria | 1568 |
| 1959 | Ga0496105_0262170 | 3300048908 | Bacteria | 1397 |
| 1960 | Ga0496105_0424723 | 3300048908 | Bacteria | 1052 |
| 1961 | Ga0496105_0790792 | 3300048908 | Bacteria | 722 |
| 1962 | Ga0496106_0283638 | 3300048909 | Bacteria | 1327 |
| 1963 | Ga0496106_0325348 | 3300048909 | Bacteria | 1234 |
| 1964 | Ga0496106_0663760 | 3300048909 | Bacteria | 832 |
| 1965 | Ga0496107_0023356 | 3300048910 | Bacteria | 4373 |
| 1966 | Ga0496107_0114465 | 3300048910 | Bacteria | 1984 |
| 1967 | Ga0496107_0358940 | 3300048910 | Bacteria | 1084 |
| 1968 | Ga0496107_0424302 | 3300048910 | Bacteria | 989 |
| 1969 | Ga0496107_0462972 | 3300048910 | Bacteria | 941 |
| 1970 | Ga0496107_1170906 | 3300048910 | Bacteria | 553 |
| 1971 | Ga0496108_0024232 | 3300048911 | Bacteria | 4997 |
| 1972 | Ga0496108_0448377 | 3300048911 | Bacteria | 1127 |
| 1973 | Ga0496108_0664557 | 3300048911 | Bacteria | 905 |
| 1974 | Ga0496108_0992952 | 3300048911 | Bacteria | 717 |
| 1975 | Ga0496109_0133179 | 3300048912 | Bacteria | 2321 |
| 1976 | Ga0496109_0984215 | 3300048912 | Bacteria | 781 |
| 1977 | Ga0496110_0137215 | 3300048913 | Bacteria | 2211 |
| 1978 | Ga0496110_0711128 | 3300048913 | Bacteria | 906 |
| 1979 | Ga0496111_0198780 | 3300048914 | Bacteria | 1490 |
| 1980 | Ga0496111_0373526 | 3300048914 | Bacteria | 1055 |
| 1981 | Ga0496111_0413525 | 3300048914 | Bacteria | 996 |
| 1982 | Ga0496111_1218834 | 3300048914 | Bacteria | 533 |
| 1983 | Ga0496112_0005841 | 3300048915 | Bacteria | 10715 |
| 1984 | Ga0496112_0164242 | 3300048915 | Bacteria | 2186 |
| 1985 | Ga0496112_0346973 | 3300048915 | Bacteria | 1427 |
| 1986 | Ga0496112_1111606 | 3300048915 | Bacteria | 708 |
| 1987 | Ga0496113_0147492 | 3300048916 | Bacteria | 1854 |
| 1988 | Ga0496114_0106830 | 3300048917 | Bacteria | 2395 |
| 1989 | Ga0496114_0113531 | 3300048917 | Bacteria | 2322 |
| 1990 | Ga0496114_0273592 | 3300048917 | Bacteria | 1488 |
| 1991 | Ga0496114_0288596 | 3300048917 | Bacteria | 1447 |
| 1992 | Ga0496114_1053278 | 3300048917 | Bacteria | 697 |
| 1993 | Ga0496115_0001055 | 3300048918 | Bacteria | 19985 |
| 1994 | Ga0496115_0276137 | 3300048918 | Bacteria | 1380 |
| 1995 | Ga0496115_0663026 | 3300048918 | Bacteria | 823 |
| 1996 | Ga0496115_0665170 | 3300048918 | Bacteria | 822 |
| 1997 | Ga0496115_0856686 | 3300048918 | Bacteria | 703 |
| 1998 | Ga0496116_0069056 | 3300048919 | Bacteria | 2249 |
| 1999 | Ga0496116_0088689 | 3300048919 | Bacteria | 1889 |
| 2000 | Ga0496116_0121005 | 3300048919 | Bacteria | 1515 |
| 2001 | Ga0496116_0170227 | 3300048919 | Bacteria | 1181 |
| 2002 | Ga0496117_0000001 | 3300048920 | Bacteria | 2526244 |
| 2003 | Ga0496117_0001602 | 3300048920 | Bacteria | 32006 |
| 2004 | Ga0496117_0030143 | 3300048920 | Bacteria | 4168 |
| 2005 | Ga0496118_0000002 | 3300048921 | Bacteria | 1690764 |
| 2006 | Ga0496118_0004742 | 3300048921 | Bacteria | 15913 |
| 2007 | Ga0496118_0030437 | 3300048921 | Bacteria | 4504 |
| 2008 | Ga0496118_0485019 | 3300048921 | Bacteria | 619 |
| 2009 | Ga0496119_0124513 | 3300048922 | Bacteria | 1412 |
| 2010 | Ga0496119_0332915 | 3300048922 | Bacteria | 740 |
| 2011 | Ga0496120_0087336 | 3300048923 | Bacteria | 1674 |
| 2012 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 2013 | Ga0496121_0015019 | 3300048924 | Bacteria | 8151 |
| 2014 | Ga0496121_0030639 | 3300048924 | Bacteria | 4936 |
| 2015 | Ga0496121_0099689 | 3300048924 | Bacteria | 2244 |
| 2016 | Ga0496121_0186736 | 3300048924 | Bacteria | 1490 |
| 2017 | Ga0496121_0267654 | 3300048924 | Bacteria | 1176 |
| 2018 | Ga0496122_0138190 | 3300048925 | Bacteria | 1530 |
| 2019 | Ga0496122_0158809 | 3300048925 | Bacteria | 1382 |
| 2020 | Ga0496122_0202223 | 3300048925 | Bacteria | 1160 |
| 2021 | Ga0496122_0301213 | 3300048925 | Bacteria | 864 |
| 2022 | Ga0496123_0013346 | 3300048926 | Bacteria | 6906 |
| 2023 | Ga0496123_0018581 | 3300048926 | Bacteria | 5520 |
| 2024 | Ga0496123_0264373 | 3300048926 | Bacteria | 841 |
| 2025 | Ga0496124_0009480 | 3300048927 | Bacteria | 10025 |
| 2026 | Ga0496124_0028304 | 3300048927 | Bacteria | 5015 |
| 2027 | Ga0496124_0034796 | 3300048927 | Bacteria | 4414 |
| 2028 | Ga0496124_0127088 | 3300048927 | Bacteria | 2029 |
| 2029 | Ga0496124_0161584 | 3300048927 | Bacteria | 1745 |
| 2030 | Ga0496124_0179046 | 3300048927 | Bacteria | 1633 |
| 2031 | Ga0496124_0208501 | 3300048927 | Bacteria | 1480 |
| 2032 | Ga0496124_0311278 | 3300048927 | Bacteria | 1132 |
| 2033 | Ga0496124_0680300 | 3300048927 | Bacteria | 655 |
| 2034 | Ga0496124_0767445 | 3300048927 | Bacteria | 602 |
| 2035 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 2036 | Ga0496125_0014630 | 3300048928 | Bacteria | 7628 |
| 2037 | Ga0496126_0000034 | 3300048929 | Bacteria | 362440 |
| 2038 | Ga0496126_0014001 | 3300048929 | Bacteria | 8128 |
| 2039 | Ga0496126_0452947 | 3300048929 | Bacteria | 1032 |
| 2040 | Ga0496126_0510864 | 3300048929 | Bacteria | 959 |
| 2041 | Ga0496126_0555819 | 3300048929 | Bacteria | 910 |
| 2042 | Ga0496126_0625220 | 3300048929 | Bacteria | 846 |
| 2043 | Ga0496126_0691004 | 3300048929 | Bacteria | 794 |
| 2044 | Ga0466983_0814339 | 3300048986 | Bacteria | 564 |
| 2045 | Ga0501306_023443 | 3300049127 | Bacteria | 876 |
| 2046 | Ga0501306_094074 | 3300049127 | Bacteria | 530 |
| 2047 | Ga0501308_000043 | 3300049128 | Bacteria | 5019 |
| 2048 | Ga0501308_004623 | 3300049128 | Bacteria | 1336 |
| 2049 | Ga0501309_002926 | 3300049129 | Bacteria | 1894 |
| 2050 | Ga0501309_010747 | 3300049129 | Bacteria | 1184 |
| 2051 | Ga0501310_000314 | 3300049130 | Bacteria | 4465 |
| 2052 | Ga0501310_023165 | 3300049130 | Bacteria | 788 |
| 2053 | Ga0501304_000103 | 3300049160 | Bacteria | 3162 |
| 2054 | Ga0501304_010860 | 3300049160 | Bacteria | 801 |
| 2055 | Ga0501307_004362 | 3300049162 | Bacteria | 1439 |
| 2056 | Ga0501307_009157 | 3300049162 | Bacteria | 1128 |
| 2057 | Ga0501307_013604 | 3300049162 | Bacteria | 984 |
| 2058 | Ga0495678_000128 | 3300049459 | Bacteria | 89099 |
| 2059 | Ga0495678_004908 | 3300049459 | Bacteria | 7558 |
| 2060 | Ga0495678_009158 | 3300049459 | Bacteria | 4928 |
| 2061 | Ga0495678_017087 | 3300049459 | Bacteria | 3297 |
| 2062 | Ga0495678_022689 | 3300049459 | Bacteria | 2740 |
| 2063 | Ga0495678_025494 | 3300049459 | Bacteria | 2537 |
| 2064 | Ga0495678_067621 | 3300049459 | Bacteria | 1319 |
| 2065 | Ga0495682_0007646 | 3300049460 | Bacteria | 4288 |
| 2066 | Ga0495682_0046808 | 3300049460 | Bacteria | 1578 |
| 2067 | Ga0495682_0059187 | 3300049460 | Bacteria | 1384 |
| 2068 | Ga0495682_0315331 | 3300049460 | Bacteria | 551 |
| 2069 | Ga0501291_052603 | 3300049514 | Bacteria | 746 |
| 2070 | Ga0501298_097590 | 3300049521 | Bacteria | 666 |
| 2071 | Ga0501299_014456 | 3300049522 | Bacteria | 1374 |
| 2072 | Ga0501303_009692 | 3300049526 | Bacteria | 893 |
| 2073 | Ga0501311_001467 | 3300049527 | Bacteria | 2058 |
| 2074 | Ga0501311_005169 | 3300049527 | Bacteria | 1420 |
| 2075 | Ga0501311_104620 | 3300049527 | Bacteria | 504 |
| 2076 | Ga0501312_015087 | 3300049528 | Bacteria | 1093 |
| 2077 | Ga0501312_107741 | 3300049528 | Bacteria | 529 |
| 2078 | Ga0501313_006566 | 3300049529 | Bacteria | 1263 |
| 2079 | Ga0501314_013894 | 3300049530 | Bacteria | 784 |
| 2080 | Ga0501315_003168 | 3300049531 | Bacteria | 1624 |
| 2081 | Ga0501315_008242 | 3300049531 | Bacteria | 1207 |
| 2082 | Ga0501315_018201 | 3300049531 | Bacteria | 925 |
| 2083 | Ga0501315_058801 | 3300049531 | Bacteria | 618 |
| 2084 | Ga0501316_002918 | 3300049532 | Bacteria | 1624 |
| 2085 | Ga0501316_003463 | 3300049532 | Bacteria | 1535 |
| 2086 | Ga0501318_007306 | 3300049534 | Bacteria | 1151 |
| 2087 | Ga0501319_021994 | 3300049535 | Bacteria | 577 |
| 2088 | Ga0501320_010242 | 3300049536 | Bacteria | 952 |
| 2089 | Ga0501320_019732 | 3300049536 | Bacteria | 771 |
| 2090 | Ga0501320_021934 | 3300049536 | Bacteria | 745 |
| 2091 | Ga0501321_007332 | 3300049537 | Bacteria | 1143 |
| 2092 | Ga0501322_001671 | 3300049538 | Bacteria | 1281 |
| 2093 | Ga0501322_017103 | 3300049538 | Bacteria | 612 |
| 2094 | Ga0501323_002866 | 3300049539 | Bacteria | 1715 |
| 2095 | Ga0501323_013157 | 3300049539 | Bacteria | 1020 |
| 2096 | Ga0501323_043258 | 3300049539 | Bacteria | 666 |
| 2097 | Ga0501324_004785 | 3300049540 | Bacteria | 1090 |
| 2098 | Ga0501325_017223 | 3300049541 | Bacteria | 730 |
| 2099 | Ga0501326_02490 | 3300049542 | Bacteria | 909 |
| 2100 | Ga0501326_09563 | 3300049542 | Bacteria | 574 |
| 2101 | Ga0501335_006342 | 3300049551 | Bacteria | 1076 |
| 2102 | Ga0501031_0047354 | 3300049568 | Bacteria | 2803 |
| 2103 | Ga0501032_0088596 | 3300049569 | Bacteria | 2055 |
| 2104 | Ga0501033_0002051 | 3300049570 | Bacteria | 17522 |
| 2105 | Ga0501034_0005225 | 3300049571 | Bacteria | 14241 |
| 2106 | Ga0501036_0003558 | 3300049572 | Bacteria | 12457 |
| 2107 | Ga0501036_0371290 | 3300049572 | Bacteria | 1194 |
| 2108 | Ga0501036_0714024 | 3300049572 | Bacteria | 828 |
| 2109 | Ga0501036_1385522 | 3300049572 | Bacteria | 570 |
| 2110 | Ga0501037_0019590 | 3300049573 | Bacteria | 4993 |
| 2111 | Ga0501037_0292291 | 3300049573 | Bacteria | 1133 |
| 2112 | Ga0501038_0000564 | 3300049574 | Bacteria | 32743 |
| 2113 | Ga0501038_0758494 | 3300049574 | Bacteria | 723 |
| 2114 | Ga0501039_0000137 | 3300049575 | Bacteria | 50348 |
| 2115 | Ga0501039_0024770 | 3300049575 | Bacteria | 4610 |
| 2116 | Ga0501039_0396181 | 3300049575 | Bacteria | 1084 |
| 2117 | Ga0501039_0861283 | 3300049575 | Bacteria | 706 |
| 2118 | Ga0501040_0000301 | 3300049576 | Bacteria | 28846 |
| 2119 | Ga0501040_0152623 | 3300049576 | Bacteria | 1630 |
| 2120 | Ga0501040_0613662 | 3300049576 | Bacteria | 786 |
| 2121 | Ga0501040_0638417 | 3300049576 | Bacteria | 769 |
| 2122 | Ga0501041_0000043 | 3300049577 | Bacteria | 43612 |
| 2123 | Ga0501041_0047018 | 3300049577 | Bacteria | 2626 |
| 2124 | Ga0501041_0241653 | 3300049577 | Bacteria | 1135 |
| 2125 | Ga0501042_0000604 | 3300049578 | Bacteria | 19154 |
| 2126 | Ga0501042_0263106 | 3300049578 | Bacteria | 1245 |
| 2127 | Ga0501042_0525467 | 3300049578 | Bacteria | 860 |
| 2128 | Ga0501042_1052716 | 3300049578 | Bacteria | 593 |
| 2129 | Ga0501043_0425944 | 3300049579 | Bacteria | 1000 |
| 2130 | Ga0501043_1263034 | 3300049579 | Bacteria | 516 |
| 2131 | Ga0501046_0000328 | 3300049580 | Bacteria | 47729 |
| 2132 | Ga0501046_0707038 | 3300049580 | Bacteria | 710 |
| 2133 | Ga0501048_0001946 | 3300049582 | Bacteria | 15680 |
| 2134 | Ga0501048_0069740 | 3300049582 | Bacteria | 2483 |
| 2135 | Ga0501048_0212479 | 3300049582 | Bacteria | 1372 |
| 2136 | Ga0501048_0333054 | 3300049582 | Bacteria | 1082 |
| 2137 | Ga0501068_0008756 | 3300049584 | Bacteria | 5647 |
| 2138 | Ga0501068_0321198 | 3300049584 | Bacteria | 992 |
| 2139 | Ga0501069_0673430 | 3300049585 | Bacteria | 623 |
| 2140 | Ga0501069_0914522 | 3300049585 | Bacteria | 534 |
| 2141 | Ga0501069_1004263 | 3300049585 | Bacteria | 510 |
| 2142 | Ga0501070_0191012 | 3300049586 | Bacteria | 1683 |
| 2143 | Ga0501070_0312293 | 3300049586 | Bacteria | 1279 |
| 2144 | Ga0501070_0895039 | 3300049586 | Bacteria | 693 |
| 2145 | Ga0501070_1360618 | 3300049586 | Bacteria | 540 |
| 2146 | Ga0501071_0017983 | 3300049587 | Bacteria | 4888 |
| 2147 | Ga0501071_1201881 | 3300049587 | Bacteria | 586 |
| 2148 | Ga0501072_0000555 | 3300049588 | Bacteria | 26861 |
| 2149 | Ga0501072_0002944 | 3300049588 | Bacteria | 12813 |
| 2150 | Ga0501072_0204103 | 3300049588 | Bacteria | 1576 |
| 2151 | Ga0501072_0451307 | 3300049588 | Bacteria | 1018 |
| 2152 | Ga0501073_0000117 | 3300049589 | Bacteria | 50986 |
| 2153 | Ga0501073_0630446 | 3300049589 | Bacteria | 740 |
| 2154 | Ga0501073_0994509 | 3300049589 | Bacteria | 577 |
| 2155 | Ga0501074_0011250 | 3300049590 | Bacteria | 6504 |
| 2156 | Ga0501074_0315689 | 3300049590 | Bacteria | 1110 |
| 2157 | Ga0501074_0493033 | 3300049590 | Bacteria | 868 |
| 2158 | Ga0501075_0003437 | 3300049591 | Bacteria | 10600 |
| 2159 | Ga0501075_0062124 | 3300049591 | Bacteria | 2816 |
| 2160 | Ga0501076_0000284 | 3300049592 | Bacteria | 31537 |
| 2161 | Ga0501076_0218443 | 3300049592 | Bacteria | 1558 |
| 2162 | Ga0501076_1698990 | 3300049592 | Bacteria | 518 |
| 2163 | Ga0501077_0000236 | 3300049593 | Bacteria | 32672 |
| 2164 | Ga0501077_0715745 | 3300049593 | Bacteria | 643 |
| 2165 | Ga0501202_170050 | 3300049652 | Bacteria | 582 |
| 2166 | Ga0501227_003010 | 3300049665 | Bacteria | 3681 |
| 2167 | Ga0501238_000630 | 3300049671 | Bacteria | 4007 |
| 2168 | Ga0501249_020941 | 3300049679 | Bacteria | 1425 |
| 2169 | Ga0501253_051963 | 3300049683 | Bacteria | 861 |
| 2170 | Ga0501257_037433 | 3300049686 | Bacteria | 1183 |
| 2171 | Ga0501079_0005362 | 3300049741 | Bacteria | 9549 |
| 2172 | Ga0501079_0014496 | 3300049741 | Bacteria | 6011 |
| 2173 | Ga0501079_0495653 | 3300049741 | Bacteria | 960 |
| 2174 | Ga0501080_0000743 | 3300049742 | Bacteria | 26380 |
| 2175 | Ga0501080_0267888 | 3300049742 | Bacteria | 1555 |
| 2176 | Ga0501080_0663173 | 3300049742 | Bacteria | 922 |
| 2177 | Ga0501080_0678475 | 3300049742 | Bacteria | 910 |
| 2178 | Ga0501080_1080765 | 3300049742 | Bacteria | 693 |
| 2179 | Ga0501081_0000621 | 3300049743 | Bacteria | 20225 |
| 2180 | Ga0501083_0522610 | 3300049744 | Bacteria | 772 |
| 2181 | Ga0501083_0523133 | 3300049744 | Bacteria | 772 |
| 2182 | Ga0501241_038231 | 3300049758 | Bacteria | 924 |
| 2183 | Ga0501269_000234 | 3300049766 | Bacteria | 16178 |
| 2184 | Ga0501279_012469 | 3300049775 | Bacteria | 1156 |
| 2185 | Ga0501279_021347 | 3300049775 | Bacteria | 924 |
| 2186 | Ga0501280_000570 | 3300049776 | Bacteria | 8565 |
| 2187 | Ga0501035_0147039 | 3300049822 | Bacteria | 2046 |
| 2188 | Ga0501035_0216993 | 3300049822 | Bacteria | 1635 |
| 2189 | Ga0501035_0306964 | 3300049822 | Bacteria | 1336 |
| 2190 | Ga0501035_0873524 | 3300049822 | Bacteria | 714 |
| 2191 | Ga0501035_1040808 | 3300049822 | Bacteria | 642 |
| 2192 | Ga0501045_0018761 | 3300049824 | Bacteria | 4923 |
| 2193 | nmdc:mga03683_3602_c1 | 3300050489 | Bacteria | 5025 |
| 2194 | nmdc:mga03683_44815_c1 | 3300050489 | Bacteria | 1829 |
| 2195 | nmdc:mga03n38_46902_c1 | 3300050490 | Bacteria | 1910 |
| 2196 | nmdc:mga00v17_242948_c1 | 3300050491 | Bacteria | 1168 |
| 2197 | nmdc:mga00v17_55062_c1 | 3300050491 | Bacteria | 2428 |
| 2198 | nmdc:mga00v17_68635_c1 | 3300050491 | Bacteria | 2192 |
| 2199 | nmdc:mga0yw44_187786_c1 | 3300050492 | Bacteria | 1362 |
| 2200 | nmdc:mga0k408_1337_c1 | 3300050493 | Bacteria | 13338 |
| 2201 | nmdc:mga0k408_234616_c1 | 3300050493 | Bacteria | 1095 |
| 2202 | nmdc:mga0k408_44254_c1 | 3300050493 | Bacteria | 2566 |
| 2203 | nmdc:mga0k408_729910_c1 | 3300050493 | Bacteria | 579 |
| 2204 | nmdc:mga06z11_27247_c1 | 3300050494 | Bacteria | 2731 |
| 2205 | nmdc:mga06z11_790959_c1 | 3300050494 | Bacteria | 578 |
| 2206 | nmdc:mga04h51_49073_c1 | 3300050495 | Bacteria | 1409 |
| 2207 | nmdc:mga07m45_8520_c1 | 3300050496 | Bacteria | 5276 |
| 2208 | nmdc:mga05p37_114_c1 | 3300050507 | Bacteria | 73016 |
| 2209 | nmdc:mga05p37_1353913_c1 | 3300050507 | Bacteria | 721 |
| 2210 | nmdc:mga05p37_411155_c1 | 3300050507 | Bacteria | 1577 |
| 2211 | nmdc:mga05p37_733178_c1 | 3300050507 | Bacteria | 1092 |
| 2212 | nmdc:mga09592_273648_c1 | 3300050508 | Bacteria | 1465 |
| 2213 | nmdc:mga09592_3662_c1 | 3300050508 | Bacteria | 11248 |
| 2214 | nmdc:mga0qj67_1051544_c1 | 3300050509 | Bacteria | 637 |
| 2215 | nmdc:mga0qj67_210782_c1 | 3300050509 | Bacteria | 1578 |
| 2216 | nmdc:mga0qj67_726061_c1 | 3300050509 | Bacteria | 789 |
| 2217 | nmdc:mga06r32_391648_c1 | 3300050510 | Bacteria | 1372 |
| 2218 | nmdc:mga06r32_97009_c1 | 3300050510 | Bacteria | 2888 |
| 2219 | nmdc:mga08y16_150766_c1 | 3300050511 | Bacteria | 2417 |
| 2220 | nmdc:mga08y16_15466_c1 | 3300050511 | Bacteria | 8025 |
| 2221 | nmdc:mga08y16_54698_c1 | 3300050511 | Bacteria | 4171 |
| 2222 | nmdc:mga08y16_54862_c1 | 3300050511 | Bacteria | 4165 |
| 2223 | nmdc:mga08y16_563594_c1 | 3300050511 | Bacteria | 1152 |
| 2224 | nmdc:mga08y16_67290_c1 | 3300050511 | Bacteria | 3737 |
| 2225 | nmdc:mga0n895_1305518_c1 | 3300050512 | Bacteria | 696 |
| 2226 | nmdc:mga0n895_632826_c1 | 3300050512 | Bacteria | 1070 |
| 2227 | nmdc:mga0n895_9031_c1 | 3300050512 | Bacteria | 8694 |
| 2228 | nmdc:mga0n895_96963_c1 | 3300050512 | Bacteria | 2954 |
| 2229 | nmdc:mga0rr50_2846_c1 | 3300050513 | Bacteria | 9838 |
| 2230 | nmdc:mga0rr50_376197_c1 | 3300050513 | Bacteria | 1197 |
| 2231 | nmdc:mga0rr50_414384_c1 | 3300050513 | Bacteria | 1139 |
| 2232 | nmdc:mga0rr50_688253_c1 | 3300050513 | Bacteria | 873 |
| 2233 | nmdc:mga08x19_19018_c1 | 3300050514 | Bacteria | 4212 |
| 2234 | nmdc:mga08x19_190761_c1 | 3300050514 | Bacteria | 1402 |
| 2235 | nmdc:mga08x19_2760_c1 | 3300050514 | Bacteria | 10597 |
| 2236 | nmdc:mga08x19_299758_c1 | 3300050514 | Bacteria | 1116 |
| 2237 | nmdc:mga0a205_1305498_c1 | 3300050515 | Bacteria | 573 |
| 2238 | nmdc:mga0a205_1465299_c1 | 3300050515 | Bacteria | 531 |
| 2239 | nmdc:mga0a205_215246_c1 | 3300050515 | Bacteria | 1808 |
| 2240 | nmdc:mga0a205_5446_c3 | 3300050515 | Bacteria | 4904 |
| 2241 | nmdc:mga0sz30_22870_c1 | 3300050516 | Bacteria | 2539 |
| 2242 | nmdc:mga0sz30_68027_c1 | 3300050516 | Bacteria | 1530 |
| 2243 | Ga0495601_0015794 | 3300053077 | Bacteria | 4569 |
| 2244 | Ga0495601_0235787 | 3300053077 | Bacteria | 1195 |
| 2245 | Ga0495601_0237000 | 3300053077 | Bacteria | 1191 |
| 2246 | Ga0495612_0148845 | 3300053078 | Bacteria | 1018 |
| 2247 | Ga0495595_0005218 | 3300053084 | Bacteria | 5247 |
| 2248 | Ga0495619_0010461 | 3300053085 | Bacteria | 5834 |
| 2249 | Ga0495619_0098728 | 3300053085 | Bacteria | 1985 |
| 2250 | Ga0500646_0027739 | 3300053090 | Bacteria | 1542 |
| 2251 | Ga0500583_0139275 | 3300053092 | Bacteria | 1205 |
| 2252 | Ga0500566_0348121 | 3300053094 | Bacteria | 680 |
| 2253 | Ga0500566_0463779 | 3300053094 | Bacteria | 552 |
| 2254 | Ga0500650_0126388 | 3300053098 | Bacteria | 1190 |
| 2255 | Ga0500594_0170832 | 3300053118 | Bacteria | 706 |
| 2256 | Ga0500618_001153 | 3300053125 | Bacteria | 12820 |
| 2257 | Ga0500618_014656 | 3300053125 | Bacteria | 1997 |
| 2258 | Ga0500618_026153 | 3300053125 | Bacteria | 1394 |
| 2259 | Ga0500559_0240280 | 3300053136 | Bacteria | 854 |
| 2260 | Ga0500559_0296255 | 3300053136 | Bacteria | 760 |
| 2261 | Ga0500568_0173286 | 3300053139 | Bacteria | 794 |
| 2262 | Ga0500586_051917 | 3300053145 | Bacteria | 1415 |
| 2263 | Ga0500586_104605 | 3300053145 | Bacteria | 990 |
| 2264 | Ga0500604_0067134 | 3300053151 | Bacteria | 1137 |
| 2265 | Ga0500637_0279950 | 3300053178 | Bacteria | 919 |
| 2266 | Ga0500637_0551044 | 3300053178 | Bacteria | 558 |
| 2267 | Ga0500552_019037 | 3300053733 | Bacteria | 958 |
| 2268 | Ga0501084_0013751 | 3300054114 | Bacteria | 6698 |
| 2269 | Ga0501084_0206426 | 3300054114 | Bacteria | 1658 |
| 2270 | Ga0501084_0373441 | 3300054114 | Bacteria | 1205 |
| 2271 | Ga0501084_1135141 | 3300054114 | Bacteria | 656 |
| 2272 | Ga0590071_012073 | 3300059421 | Bacteria | 2025 |
| 2273 | Ga0590074_022298 | 3300059423 | Bacteria | 1094 |
| 2274 | Ga0590075_053262 | 3300059424 | Bacteria | 1039 |
| 2275 | Ga0587066_003481 | 3300059490 | Bacteria | 1854 |
| 2276 | Ga0587066_041096 | 3300059490 | Bacteria | 872 |
| 2277 | Ga0587070_006668 | 3300059491 | Bacteria | 1568 |
| 2278 | Ga0587077_007430 | 3300059493 | Bacteria | 1595 |
| 2279 | Ga0587077_011691 | 3300059493 | Bacteria | 1387 |
| 2280 | Ga0587077_119379 | 3300059493 | Bacteria | 656 |
| 2281 | Ga0587080_003759 | 3300059503 | Bacteria | 1918 |
| 2282 | Ga0587080_093142 | 3300059503 | Bacteria | 635 |
| 2283 | Ga0587083_0025865 | 3300059505 | Bacteria | 1129 |
| 2284 | Ga0587083_0117552 | 3300059505 | Bacteria | 683 |
| 2285 | Ga0587090_019409 | 3300059510 | Bacteria | 1048 |
| 2286 | Ga0587091_049512 | 3300059511 | Bacteria | 858 |
| 2287 | Ga0587098_010079 | 3300059604 | Bacteria | 1039 |
| 2288 | Ga0587106_033341 | 3300059605 | Bacteria | 838 |
| 2289 | Ga0587125_050587 | 3300059607 | Bacteria | 585 |
| 2290 | Ga0587109_123270 | 3300059624 | Bacteria | 617 |
| 2291 | Ga0587067_006206 | 3300059640 | Bacteria | 1656 |
| 2292 | Ga0587068_000149 | 3300059641 | Bacteria | 5013 |
| 2293 | Ga0587068_069828 | 3300059641 | Bacteria | 691 |
| 2294 | Ga0587072_038719 | 3300059643 | Bacteria | 919 |
| 2295 | Ga0587075_054888 | 3300059644 | Bacteria | 705 |
| 2296 | Ga0587076_002189 | 3300059645 | Bacteria | 2157 |
| 2297 | Ga0587079_001531 | 3300059647 | Bacteria | 2620 |
| 2298 | Ga0587102_000546 | 3300059649 | Bacteria | 2209 |
| 2299 | Ga0587105_000829 | 3300059651 | Bacteria | 1436 |
| 2300 | Ga0587107_053588 | 3300059652 | Bacteria | 691 |
| 2301 | Ga0587124_036669 | 3300059660 | Bacteria | 560 |
| 2302 | Ga0587071_012908 | 3300060344 | Bacteria | 1432 |
| 2303 | Ga0587111_0052221 | 3300060346 | Bacteria | 906 |
| 2304 | Ga0587111_0154241 | 3300060346 | Bacteria | 619 |
| 2305 | Ga0501082_0001199 | 3300060353 | Bacteria | 22801 |
| 2306 | Ga0501082_1852334 | 3300060353 | Bacteria | 526 |
| 2307 | Ga0466962_0059050 | 3300061719 | Bacteria | 1830 |
| 2308 | Ga0466962_0069487 | 3300061719 | Bacteria | 1682 |
| 2309 | Ga0530510_0000177 | 3300061734 | Bacteria | 38962 |
| 2310 | Ga0530510_1152037 | 3300061734 | Bacteria | 594 |
| 2311 | 2511250887 | 2511231003 | Bacteria | 5606035 |
| 2312 | 2513953027 | 2513237150 | Bacteria | 6553639 |
| 2313 | 2514043870 | 2513237165 | Bacteria | 6771773 |
| 2314 | 2526211213 | 2526164512 | Bacteria | 4025691 |
| 2315 | 2550692653 | 2548876994 | Bacteria | 4904866 |
| 2316 | 2599738353 | 2599185239 | Bacteria | 8686614 |
| 2317 | 2599746475 | 2599185240 | Bacteria | 7968121 |
| 2318 | 2600208381 | 2599185355 | Bacteria | 7968906 |
| 2319 | 2601667525 | 2600255292 | Bacteria | 6300551 |
| 2320 | 2643787150 | 2643221554 | Bacteria | 6603920 |
| 2321 | 2643802178 | 2643221556 | Bacteria | 7251154 |
| 2322 | 2644215763 | 2643221638 | Bacteria | 6579467 |
| 2323 | 2644254240 | 2643221645 | Bacteria | 7207331 |
| 2324 | 2644358095 | 2643221664 | Bacteria | 7272945 |
| 2325 | 2644475687 | 2643221684 | Bacteria | 7145183 |
| 2326 | 2676745341 | 2675903129 | Bacteria | 7964495 |
| 2327 | 2723877067 | 2721755763 | Bacteria | 4464185 |
| 2328 | 2738741059 | 2738541280 | Bacteria | 6630198 |
| 2329 | 2738845518 | 2738541300 | Bacteria | 6675882 |
| 2330 | 2739276573 | 2738543018 | Bacteria | 6718814 |
| 2331 | 2739345617 | 2738543030 | Bacteria | 6719714 |
| 2332 | 2808971981 | 2808606384 | Bacteria | 8474373 |
| 2333 | 2808981618 | 2808606386 | Bacteria | 4471946 |
| 2334 | 2809006810 | 2808606390 | Bacteria | 8476311 |
| 2335 | 2809013948 | 2808606391 | Bacteria | 8308166 |
| 2336 | 2809129201 | 2808606415 | Bacteria | 4576710 |
| 2337 | 2809145243 | 2808606418 | Bacteria | 6724496 |
| 2338 | 2809148821 | 2808606419 | Bacteria | 4576925 |
| 2339 | 2819591584 | 2818991445 | Bacteria | 4955017 |
| 2340 | 2819633520 | 2818991452 | Bacteria | 8442785 |
| 2341 | 2842714226 | 2842711865 | Bacteria | 7155354 |
| 2342 | 2852621359 | 2852618963 | Bacteria | 4577824 |
| 2343 | 2857551753 | 2857547612 | Bacteria | 6179999 |
| 2344 | 2857554307 | 2857553236 | Bacteria | 6166726 |
| 2345 | 2857559916 | 2857558681 | Bacteria | 6617694 |
| 2346 | 2857578614 | 2857576091 | Bacteria | 5465855 |
| 2347 | 2863425695 | 2863421361 | Bacteria | 7300805 |
| 2348 | 2870070704 | 2870068957 | Bacteria | 8925310 |
| 2349 | 2884812849 | 2884811622 | Bacteria | 5552861 |
| 2350 | 2884837394 | 2884836552 | Bacteria | 5219991 |
| 2351 | 2884853685 | 2884852848 | Bacteria | 5221161 |
| 2352 | 2885085589 | 2885080285 | Bacteria | 6355622 |
| 2353 | 2896155198 | 2896154374 | Bacteria | 5221518 |
| 2354 | 2904426204 | 2904424332 | Bacteria | 7633521 |
| 2355 | 2904483438 | 2904479285 | Bacteria | 5073931 |
| 2356 | 2904569900 | 2904564687 | Bacteria | 7609577 |
| 2357 | 2904577080 | 2904571731 | Bacteria | 7608790 |
| 2358 | 2919478573 | 2919476304 | Bacteria | 5888696 |
| 2359 | 2928161639 | 2928157003 | Bacteria | 7522202 |
| 2360 | 2928168467 | 2928163908 | Bacteria | 7561269 |
| 2361 | 2928174806 | 2928170801 | Bacteria | 8785406 |
| 2362 | 2928542470 | 2928536128 | Bacteria | 7657547 |
| 2363 | 2932411136 | 2932410948 | Bacteria | 6312192 |
| 2364 | 2932419297 | 2932416698 | Bacteria | 6315112 |
| 2365 | 2981993627 | 2981990288 | Bacteria | 7590678 |
| 2366 | 642415144 | 641736154 | Bacteria | 7689995 |
| 2367 | 644747359 | 644736347 | Bacteria | 6476522 |
| 2368 | 8018850889 | 8018845410 | Bacteria | 8933938 |
| 2369 | 8020940982 | 8020938398 | Bacteria | 7472757 |
| 2370 | 8020952343 | 8020945358 | Bacteria | 8467355 |
| 2371 | 8020958404 | 8020953355 | Bacteria | 7439080 |
| 2372 | 8021125189 | 8021120328 | Bacteria | 8782274 |
| 2373 | 8039103490 | 8039098773 | Bacteria | 6602928 |
| 2374 | 8047673970 | 8047673197 | Bacteria | 7395230 |
| 2375 | Ga0501069_0190746 | |||
| 2376 | JGI24736J21556_1005532 | |||
| 2377 | JGI24736J21556_1030490 | |||
| 2378 | JGI24739J22299_10075201 | |||
| 2379 | JGI24739J22299_10090660 | |||
| 2380 | JGI24739J22299_10093162 | |||
| 2381 | JGI24739J22299_10150065 | |||
| 2382 | JGI24737J22298_10021955 | |||
| 2383 | JGI24735J21928_10004761 | |||
| 2384 | JGI24735J21928_10045752 | |||
| 2385 | JGI24742J22300_10040961 | |||
| 2386 | JGI25155J39150_1000720 | |||
| 2387 | JGI25155J39150_1000725 | |||
| 2388 | JGI25156J39149_1000539 | |||
| 2389 | JGI25156J39149_1003832 | |||
| 2390 | JGI25162J39368_1003949 | |||
| 2391 | JGI25154J39366_1000471 | |||
| 2392 | JGI25154J39366_1001331 | |||
| 2393 | JGI25154J39366_1001346 | |||
| 2394 | JGI25158J39367_1000859 | |||
| 2395 | JGI25157J39369_1000359 | |||
| 2396 | JGI25152J39213_1038240 | |||
| 2397 | JGI25150J39212_1002919 | |||
| 2398 | JGI25159J45721_1001302 | |||
| 2399 | Ga0006759J45824_1073084 | |||
| 2400 | JGI25151J46595_10015102 | |||
| 2401 | JGI25153J46596_10039306 | |||
| 2402 | JGI25153J46596_10041657 | |||
| 2403 | rootL2_10035855 | |||
| 2404 | JGI25160J50197_1010821 | |||
| 2405 | Ga0007417J51691_1052140 | |||
| 2406 | Ga0007410J51695_1037975 | |||
| 2407 | Ga0007409J51694_1013012 | |||
| 2408 | Ga0007409J51694_1026750 | |||
| 2409 | Ga0007416J51690_1021228 | |||
| 2410 | Ga0032354_1056868 | |||
| 2411 | Ga0055532_1000023 | |||
| 2412 | Ga0055532_1013264 | |||
| 2413 | Ga0055525_1000001 | |||
| 2414 | Ga0055527_1006290 | |||
| 2415 | Ga0055527_1011250 | |||
| 2416 | Ga0055535_1010124 | |||
| 2417 | Ga0055535_1016202 | |||
| 2418 | Ga0055535_1016203 | |||
| 2419 | Ga0055542_1003930 | |||
| 2420 | Ga0055542_1004189 | |||
| 2421 | Ga0055542_1013692 | |||
| 2422 | Ga0055529_1000080 | |||
| 2423 | Ga0055529_1006072 | |||
| 2424 | Ga0055529_1014636 | |||
| 2425 | Ga0055526_1001704 | |||
| 2426 | Ga0055526_1002909 | |||
| 2427 | Ga0055526_1002911 | |||
| 2428 | Ga0055526_1022939 | |||
| 2429 | Ga0055537_1000012 | |||
| 2430 | Ga0055537_1004026 | |||
| 2431 | Ga0055524_1000021 | |||
| 2432 | Ga0055524_1010983 | |||
| 2433 | Ga0055524_1030369 | |||
| 2434 | Ga0055534_1000529 | |||
| 2435 | Ga0055528_1000073 | |||
| 2436 | Ga0055528_1006103 | |||
| 2437 | Ga0055528_1008801 | |||
| 2438 | Ga0055528_1011504 | |||
| 2439 | Ga0055531_10048281 | |||
| 2440 | Ga0055541_1009639 | |||
| 2441 | Ga0058692_1005164 | |||
| 2442 | Ga0055543_1033000 | |||
| 2443 | Ga0065165_1000156 | |||
| 2444 | Ga0065165_1034885 | |||
| 2445 | Ga0065714_10104740 | |||
| 2446 | Ga0065704_10162523 | |||
| 2447 | Ga0065704_10492334 | |||
| 2448 | Ga0065712_10081344 | |||
| 2449 | Ga0065712_10086540 | |||
| 2450 | Ga0065715_10126937 | |||
| 2451 | Ga0065715_10201625 | |||
| 2452 | Ga0065715_10397033 | |||
| 2453 | Ga0065707_10105719 | |||
| 2454 | Ga0065707_10625010 | |||
| 2455 | Ga0070658_10171325 | |||
| 2456 | Ga0070658_10514554 | |||
| 2457 | Ga0070676_10210673 | |||
| 2458 | Ga0070676_10429392 | |||
| 2459 | Ga0070676_10945398 | |||
| 2460 | Ga0070683_100018665 | |||
| 2461 | Ga0070683_100487012 | |||
| 2462 | Ga0070690_100001009 | |||
| 2463 | Ga0070690_100002775 | |||
| 2464 | Ga0070690_100002867 | |||
| 2465 | Ga0070690_100377503 | |||
| 2466 | Ga0070690_100704220 | |||
| 2467 | Ga0070670_100008912 | |||
| 2468 | Ga0070670_100806807 | |||
| 2469 | Ga0070670_100925450 | |||
| 2470 | Ga0070670_101182415 | |||
| 2471 | Ga0070677_10085884 | |||
| 2472 | Ga0068869_100001595 | |||
| 2473 | Ga0068869_100063014 | |||
| 2474 | Ga0068869_100094726 | |||
| 2475 | Ga0068869_100245546 | |||
| 2476 | Ga0068869_100666502 | |||
| 2477 | Ga0068869_101319928 | |||
| 2478 | Ga0068869_102066678 | |||
| 2479 | Ga0070666_10253033 | |||
| 2480 | Ga0070666_10426392 | |||
| 2481 | Ga0070680_100013746 | |||
| 2482 | Ga0070680_100058208 | |||
| 2483 | Ga0070680_100202711 | |||
| 2484 | Ga0070680_100222721 | |||
| 2485 | Ga0070682_100090946 | |||
| 2486 | Ga0070682_100216980 | |||
| 2487 | Ga0070682_100242388 | |||
| 2488 | Ga0070682_100522181 | |||
| 2489 | Ga0070682_100791080 | |||
| 2490 | Ga0068868_100005336 | |||
| 2491 | Ga0068868_100007038 | |||
| 2492 | Ga0068868_100238554 | |||
| 2493 | Ga0068868_100367190 | |||
| 2494 | Ga0068868_100529446 | |||
| 2495 | Ga0068868_101477755 | |||
| 2496 | Ga0068868_102102863 | |||
| 2497 | Ga0070660_100002701 | |||
| 2498 | Ga0070660_100149159 | |||
| 2499 | Ga0070660_101599813 | |||
| 2500 | Ga0070689_100003115 | |||
| 2501 | Ga0070689_100005312 | |||
| 2502 | Ga0070689_100120991 | |||
| 2503 | Ga0070689_100395249 | |||
| 2504 | Ga0070689_100835885 | |||
| 2505 | Ga0070691_10000927 | |||
| 2506 | Ga0070691_10010007 | |||
| 2507 | Ga0070691_10489895 | |||
| 2508 | Ga0070687_100000367 | |||
| 2509 | Ga0070687_100074624 | |||
| 2510 | Ga0070687_100175900 | |||
| 2511 | Ga0070687_100411817 | |||
| 2512 | Ga0070687_100522856 | |||
| 2513 | Ga0070687_100765048 | |||
| 2514 | Ga0070661_100007249 | |||
| 2515 | Ga0070661_100207600 | |||
| 2516 | Ga0070692_10000993 | |||
| 2517 | Ga0070692_10069478 | |||
| 2518 | Ga0070692_10075084 | |||
| 2519 | Ga0070692_10095036 | |||
| 2520 | Ga0070692_10413409 | |||
| 2521 | Ga0070692_10918085 | |||
| 2522 | Ga0070692_11249156 | |||
| 2523 | Ga0070668_100253113 | |||
| 2524 | Ga0070668_101844152 | |||
| 2525 | Ga0070669_100034552 | |||
| 2526 | Ga0070669_100049156 | |||
| 2527 | Ga0070669_100293599 | |||
| 2528 | Ga0070675_100039670 | |||
| 2529 | Ga0070675_100044347 | |||
| 2530 | Ga0070675_100402268 | |||
| 2531 | Ga0070675_101066640 | |||
| 2532 | Ga0070671_100038050 | |||
| 2533 | Ga0070671_100558018 | |||
| 2534 | Ga0070671_102096695 | |||
| 2535 | Ga0070674_100066570 | |||
| 2536 | Ga0070674_100127966 | |||
| 2537 | Ga0070674_100164801 | |||
| 2538 | Ga0070674_100504462 | |||
| 2539 | Ga0070674_101202538 | |||
| 2540 | Ga0070674_101901993 | |||
| 2541 | Ga0070673_100024655 | |||
| 2542 | Ga0070673_100051130 | |||
| 2543 | Ga0070673_101339269 | |||
| 2544 | Ga0070688_100075036 | |||
| 2545 | Ga0070688_100289505 | |||
| 2546 | Ga0070688_100432243 | |||
| 2547 | Ga0070688_100746052 | |||
| 2548 | Ga0070688_101018476 | |||
| 2549 | Ga0070659_100000069 | |||
| 2550 | Ga0070659_100149269 | |||
| 2551 | Ga0070659_100183772 | |||
| 2552 | Ga0070667_100051694 | |||
| 2553 | Ga0070667_100171074 | |||
| 2554 | Ga0070667_100171495 | |||
| 2555 | Ga0070703_10040538 | |||
| 2556 | Ga0070703_10125036 | |||
| 2557 | Ga0070709_10836217 | |||
| 2558 | Ga0070709_11208089 | |||
| 2559 | Ga0070709_11448720 | |||
| 2560 | Ga0070714_100009259 | |||
| 2561 | Ga0070713_100000033 | |||
| 2562 | Ga0070713_100205825 | |||
| 2563 | Ga0070710_10126218 | |||
| 2564 | Ga0070701_10010798 | |||
| 2565 | Ga0070701_10012435 | |||
| 2566 | Ga0070701_10068602 | |||
| 2567 | Ga0070701_10101896 | |||
| 2568 | Ga0070701_10128394 | |||
| 2569 | Ga0070711_100116707 | |||
| 2570 | Ga0070711_100143083 | |||
| 2571 | Ga0070705_100000337 | |||
| 2572 | Ga0070705_100017946 | |||
| 2573 | Ga0070705_100019507 | |||
| 2574 | Ga0070705_100275503 | |||
| 2575 | Ga0070705_100770436 | |||
| 2576 | Ga0070705_101185526 | |||
| 2577 | Ga0070705_101213804 | |||
| 2578 | Ga0070700_100001013 | |||
| 2579 | Ga0070700_100003020 | |||
| 2580 | Ga0070700_100239557 | |||
| 2581 | Ga0070700_100335549 | |||
| 2582 | Ga0070700_100598458 | |||
| 2583 | Ga0070700_100606317 | |||
| 2584 | Ga0070700_101451055 | |||
| 2585 | Ga0070694_100001944 | |||
| 2586 | Ga0070694_100015443 | |||
| 2587 | Ga0070694_100018554 | |||
| 2588 | Ga0070694_100182528 | |||
| 2589 | Ga0070694_100608694 | |||
| 2590 | Ga0070694_101204988 | |||
| 2591 | Ga0070708_100038088 | |||
| 2592 | Ga0070708_100139816 | |||
| 2593 | Ga0070708_101353564 | |||
| 2594 | Ga0070663_100000948 | |||
| 2595 | Ga0070663_100165072 | |||
| 2596 | Ga0070663_100806931 | |||
| 2597 | Ga0070663_101234909 | |||
| 2598 | Ga0070678_100006957 | |||
| 2599 | Ga0070678_100037773 | |||
| 2600 | Ga0070678_100093579 | |||
| 2601 | Ga0070678_100565762 | |||
| 2602 | Ga0070678_100587316 | |||
| 2603 | Ga0070678_100771209 | |||
| 2604 | Ga0070678_101221283 | |||
| 2605 | Ga0070662_100008477 | |||
| 2606 | Ga0070662_100599011 | |||
| 2607 | Ga0070662_101342092 | |||
| 2608 | Ga0070662_101783977 | |||
| 2609 | Ga0070662_101834102 | |||
| 2610 | Ga0070681_10014534 | |||
| 2611 | Ga0070681_10247182 | |||
| 2612 | Ga0070681_10337430 | |||
| 2613 | Ga0070681_10734325 | |||
| 2614 | Ga0070681_11315233 | |||
| 2615 | Ga0070681_11441575 | |||
| 2616 | Ga0068867_100001711 | |||
| 2617 | Ga0068867_100103377 | |||
| 2618 | Ga0068867_100103681 | |||
| 2619 | Ga0068867_100197805 | |||
| 2620 | Ga0068867_100255209 | |||
| 2621 | Ga0068867_100277743 | |||
| 2622 | Ga0068867_100458482 | |||
| 2623 | Ga0068867_100489189 | |||
| 2624 | Ga0068867_100585877 | |||
| 2625 | Ga0068867_100634421 | |||
| 2626 | Ga0068867_101525580 | |||
| 2627 | Ga0070685_10002374 | |||
| 2628 | Ga0070685_11369508 | |||
| 2629 | Ga0070685_11562588 | |||
| 2630 | Ga0070706_100039082 | |||
| 2631 | Ga0070706_100491786 | |||
| 2632 | Ga0070706_100527406 | |||
| 2633 | Ga0070707_100082853 | |||
| 2634 | Ga0070707_100123962 | |||
| 2635 | Ga0070698_100362862 | |||
| 2636 | Ga0070698_101359718 | |||
| 2637 | Ga0070699_100009169 | |||
| 2638 | Ga0070699_100017481 | |||
| 2639 | Ga0070699_100357307 | |||
| 2640 | Ga0070699_100617587 | |||
| 2641 | Ga0070699_100698645 | |||
| 2642 | Ga0070699_102212258 | |||
| 2643 | Ga0070679_100057970 | |||
| 2644 | Ga0070679_100073581 | |||
| 2645 | Ga0070679_100477043 | |||
| 2646 | Ga0070679_101926360 | |||
| 2647 | Ga0070684_100111325 | |||
| 2648 | Ga0070684_100504493 | |||
| 2649 | Ga0070684_101482983 | |||
| 2650 | Ga0070697_100002415 | |||
| 2651 | Ga0070697_100109125 | |||
| 2652 | Ga0070697_100492962 | |||
| 2653 | Ga0070697_100994230 | |||
| 2654 | Ga0070697_101204996 | |||
| 2655 | Ga0068853_100431783 | |||
| 2656 | Ga0070672_100096087 | |||
| 2657 | Ga0070672_100454426 | |||
| 2658 | Ga0070672_100550151 | |||
| 2659 | Ga0070672_100670308 | |||
| 2660 | Ga0070672_100686925 | |||
| 2661 | Ga0070686_100005023 | |||
| 2662 | Ga0070686_100025094 | |||
| 2663 | Ga0070686_100058485 | |||
| 2664 | Ga0070686_100060262 | |||
| 2665 | Ga0070686_101335319 | |||
| 2666 | Ga0070686_101508217 | |||
| 2667 | Ga0070695_100020705 | |||
| 2668 | Ga0070695_100031232 | |||
| 2669 | Ga0070695_100277680 | |||
| 2670 | Ga0070695_100436886 | |||
| 2671 | Ga0070695_101690757 | |||
| 2672 | Ga0070696_100006757 | |||
| 2673 | Ga0070696_100008352 | |||
| 2674 | Ga0070696_100018750 | |||
| 2675 | Ga0070696_100031693 | |||
| 2676 | Ga0070696_100035629 | |||
| 2677 | Ga0070696_100563106 | |||
| 2678 | Ga0070696_100586763 | |||
| 2679 | Ga0070696_100772219 | |||
| 2680 | Ga0070693_100001128 | |||
| 2681 | Ga0070693_100035072 | |||
| 2682 | Ga0070693_100044381 | |||
| 2683 | Ga0070693_100046721 | |||
| 2684 | Ga0070693_100413948 | |||
| 2685 | Ga0070693_100584035 | |||
| 2686 | Ga0070693_101661734 | |||
| 2687 | Ga0070665_100004533 | |||
| 2688 | Ga0070665_100067776 | |||
| 2689 | Ga0070665_100740544 | |||
| 2690 | Ga0070704_100002157 | |||
| 2691 | Ga0070704_100091407 | |||
| 2692 | Ga0070704_100108830 | |||
| 2693 | Ga0070704_100255028 | |||
| 2694 | Ga0070704_100353296 | |||
| 2695 | Ga0070704_100856915 | |||
| 2696 | Ga0070704_101168360 | |||
| 2697 | Ga0068855_100006293 | |||
| 2698 | Ga0068855_100022593 | |||
| 2699 | Ga0068855_101499089 | |||
| 2700 | Ga0068855_102088925 | |||
| 2701 | Ga0068855_102570993 | |||
| 2702 | Ga0070664_100121232 | |||
| 2703 | Ga0070664_100435723 | |||
| 2704 | Ga0070664_101989115 | |||
| 2705 | Ga0068857_100716138 | |||
| 2706 | Ga0068857_101431922 | |||
| 2707 | Ga0068854_100003089 | |||
| 2708 | Ga0068854_100039233 | |||
| 2709 | Ga0068854_100196663 | |||
| 2710 | Ga0068854_101215624 | |||
| 2711 | Ga0068854_101847736 | |||
| 2712 | Ga0068856_100015760 | |||
| 2713 | Ga0068856_100092377 | |||
| 2714 | Ga0068856_100910117 | |||
| 2715 | Ga0068856_101442387 | |||
| 2716 | Ga0070702_100000173 | |||
| 2717 | Ga0070702_100000786 | |||
| 2718 | Ga0070702_100043672 | |||
| 2719 | Ga0070702_100067317 | |||
| 2720 | Ga0070702_100148943 | |||
| 2721 | Ga0068852_100154774 | |||
| 2722 | Ga0068852_100434550 | |||
| 2723 | Ga0068852_100815903 | |||
| 2724 | Ga0068852_100898805 | |||
| 2725 | Ga0068859_100001101 | |||
| 2726 | Ga0068859_100026412 | |||
| 2727 | Ga0068859_101033390 | |||
| 2728 | Ga0068859_102739600 | |||
| 2729 | Ga0068864_100001698 | |||
| 2730 | Ga0068864_100011774 | |||
| 2731 | Ga0068864_100054311 | |||
| 2732 | Ga0068866_10003479 | |||
| 2733 | Ga0068866_10475879 | |||
| 2734 | Ga0068861_100002373 | |||
| 2735 | Ga0068861_100011414 | |||
| 2736 | Ga0068861_100809863 | |||
| 2737 | Ga0068861_100875968 | |||
| 2738 | Ga0068851_10074453 | |||
| 2739 | Ga0068851_10640704 | |||
| 2740 | Ga0068870_10020158 | |||
| 2741 | Ga0068870_10076877 | |||
| 2742 | Ga0068870_10101667 | |||
| 2743 | Ga0068870_10204282 | |||
| 2744 | Ga0068870_10292158 | |||
| 2745 | Ga0068870_10298042 | |||
| 2746 | Ga0068863_100001850 | |||
| 2747 | Ga0068863_100010828 | |||
| 2748 | Ga0068863_100963914 | |||
| 2749 | Ga0068858_100001448 | |||
| 2750 | Ga0068858_100002333 | |||
| 2751 | Ga0068858_100085925 | |||
| 2752 | Ga0068858_100504148 | |||
| 2753 | Ga0068858_100926275 | |||
| 2754 | Ga0068860_100012728 | |||
| 2755 | Ga0068860_100021165 | |||
| 2756 | Ga0068860_100090825 | |||
| 2757 | Ga0068860_100272407 | |||
| 2758 | Ga0068860_100339252 | |||
| 2759 | Ga0068860_101139523 | |||
| 2760 | Ga0068862_100010175 | |||
| 2761 | Ga0068862_100282036 | |||
| 2762 | Ga0068862_100780673 | |||
| 2763 | Ga0068862_101169866 | |||
| 2764 | Ga0068862_101370799 | |||
| 2765 | Ga0081455_10185826 | |||
| 2766 | Ga0070717_10054394 | |||
| 2767 | Ga0070717_11706388 | |||
| 2768 | Ga0075368_10000736 | |||
| 2769 | Ga0075368_10412859 | |||
| 2770 | Ga0075363_100007656 | |||
| 2771 | Ga0075364_10053044 | |||
| 2772 | Ga0075364_10274581 | |||
| 2773 | Ga0070715_10001565 | |||
| 2774 | Ga0070715_10394870 | |||
| 2775 | Ga0070715_10441151 | |||
| 2776 | Ga0070716_100203858 | |||
| 2777 | Ga0070716_100631682 | |||
| 2778 | Ga0070716_100797665 | |||
| 2779 | Ga0070712_100039099 | |||
| 2780 | Ga0070712_100578365 | |||
| 2781 | Ga0070712_100608067 | |||
| 2782 | Ga0070712_101257228 | |||
| 2783 | Ga0075362_10007883 | |||
| 2784 | Ga0075362_10069337 | |||
| 2785 | Ga0075362_10366639 | |||
| 2786 | Ga0075367_10365613 | |||
| 2787 | Ga0075367_10739734 | |||
| 2788 | Ga0075367_10905519 | |||
| 2789 | Ga0075369_10016462 | |||
| 2790 | Ga0075369_10062872 | |||
| 2791 | Ga0075366_10039997 | |||
| 2792 | Ga0075366_10041485 | |||
| 2793 | Ga0075366_10112375 | |||
| 2794 | Ga0075366_10478935 | |||
| 2795 | Ga0097621_100001873 | |||
| 2796 | Ga0097621_100029495 | |||
| 2797 | Ga0097621_100201076 | |||
| 2798 | Ga0097621_100316444 | |||
| 2799 | Ga0097621_100632032 | |||
| 2800 | Ga0097621_100932336 | |||
| 2801 | Ga0075370_10011662 | |||
| 2802 | Ga0075370_10311672 | |||
| 2803 | Ga0075370_10818962 | |||
| 2804 | Ga0068871_100000683 | |||
| 2805 | Ga0068871_100004579 | |||
| 2806 | Ga0068871_100005465 | |||
| 2807 | Ga0068871_100094806 | |||
| 2808 | Ga0068871_100119439 | |||
| 2809 | Ga0068871_100187842 | |||
| 2810 | Ga0068871_100456051 | |||
| 2811 | Ga0068871_100520904 | |||
| 2812 | Ga0068871_100739142 | |||
| 2813 | Ga0075428_100000739 | |||
| 2814 | Ga0075428_100031700 | |||
| 2815 | Ga0075428_101054364 | |||
| 2816 | Ga0075430_100049871 | |||
| 2817 | Ga0075430_100388341 | |||
| 2818 | Ga0075431_100076505 | |||
| 2819 | Ga0075431_100489816 | |||
| 2820 | Ga0075433_10005869 | |||
| 2821 | Ga0075433_10331567 | |||
| 2822 | Ga0075434_100001032 | |||
| 2823 | Ga0075434_100032843 | |||
| 2824 | Ga0075434_100595219 | |||
| 2825 | Ga0075434_101803666 | |||
| 2826 | Ga0075429_100006847 | |||
| 2827 | Ga0068865_100000525 | |||
| 2828 | Ga0068865_100008874 | |||
| 2829 | Ga0068865_100040838 | |||
| 2830 | Ga0068865_100142185 | |||
| 2831 | Ga0068865_100145376 | |||
| 2832 | Ga0068865_100253997 | |||
| 2833 | Ga0068865_101792555 | |||
| 2834 | Ga0075436_100000593 | |||
| 2835 | Ga0075436_100004032 | |||
| 2836 | Ga0075436_100100551 | |||
| 2837 | Ga0075436_100193939 | |||
| 2838 | Ga0075436_100343477 | |||
| 2839 | Ga0097620_100001101 | |||
| 2840 | Ga0097620_100026411 | |||
| 2841 | Ga0097620_101033401 | |||
| 2842 | Ga0097620_102739579 | |||
| 2843 | Ga0079104_1007537 | |||
| 2844 | Ga0079104_1073049 | |||
| 2845 | Ga0099826_10000002 | |||
| 2846 | Ga0075435_100001154 | |||
| 2847 | Ga0075435_100136269 | |||
| 2848 | Ga0075435_100704185 | |||
| 2849 | Ga0075435_100998947 | |||
| 2850 | Ga0075435_101196417 | |||
| 2851 | Ga0099794_10008812 | |||
| 2852 | Ga0099794_10014278 | |||
| 2853 | Ga0105244_10002910 | |||
| 2854 | Ga0105244_10026470 | |||
| 2855 | Ga0105244_10074139 | |||
| 2856 | Ga0105244_10080953 | |||
| 2857 | Ga0105250_10012744 | |||
| 2858 | Ga0105250_10471920 | |||
| 2859 | Ga0105240_10059642 | |||
| 2860 | Ga0105240_10440776 | |||
| 2861 | Ga0105240_10544914 | |||
| 2862 | Ga0105240_10813815 | |||
| 2863 | Ga0111539_10016757 | |||
| 2864 | Ga0111539_10035731 | |||
| 2865 | Ga0111539_10067447 | |||
| 2866 | Ga0111539_10190070 | |||
| 2867 | Ga0111539_10449066 | |||
| 2868 | Ga0111539_10614705 | |||
| 2869 | Ga0111539_11647413 | |||
| 2870 | Ga0105245_10000207 | |||
| 2871 | Ga0105245_10002185 | |||
| 2872 | Ga0105245_10009972 | |||
| 2873 | Ga0105245_10047291 | |||
| 2874 | Ga0105245_10065006 | |||
| 2875 | Ga0105245_10296783 | |||
| 2876 | Ga0105245_10600671 | |||
| 2877 | Ga0105245_11851361 | |||
| 2878 | Ga0105247_10854581 | |||
| 2879 | Ga0114129_10002453 | |||
| 2880 | Ga0114129_12058377 | |||
| 2881 | Ga0114129_13007808 | |||
| 2882 | Ga0114129_13442050 | |||
| 2883 | Ga0105243_10002103 | |||
| 2884 | Ga0105243_10034302 | |||
| 2885 | Ga0105243_10229178 | |||
| 2886 | Ga0105243_10240291 | |||
| 2887 | Ga0105243_10273712 | |||
| 2888 | Ga0105243_10488771 | |||
| 2889 | Ga0105243_10526241 | |||
| 2890 | Ga0105241_10027264 | |||
| 2891 | Ga0105241_10084895 | |||
| 2892 | Ga0105241_10215242 | |||
| 2893 | Ga0105241_10352599 | |||
| 2894 | Ga0105241_10426444 | |||
| 2895 | Ga0105241_11632607 | |||
| 2896 | Ga0105242_10003926 | |||
| 2897 | Ga0105242_10028574 | |||
| 2898 | Ga0105242_10029121 | |||
| 2899 | Ga0105242_10078387 | |||
| 2900 | Ga0105242_10135719 | |||
| 2901 | Ga0105242_10211028 | |||
| 2902 | Ga0105242_10246046 | |||
| 2903 | Ga0105242_10288371 | |||
| 2904 | Ga0105242_10550654 | |||
| 2905 | Ga0105242_10705721 | |||
| 2906 | Ga0105242_10793245 | |||
| 2907 | Ga0105242_10959647 | |||
| 2908 | Ga0105248_10074665 | |||
| 2909 | Ga0105248_10487409 | |||
| 2910 | Ga0105237_10237724 | |||
| 2911 | Ga0105237_10422571 | |||
| 2912 | Ga0105237_11492344 | |||
| 2913 | Ga0105237_11696217 | |||
| 2914 | Ga0105237_11992775 | |||
| 2915 | Ga0105238_10014457 | |||
| 2916 | Ga0105238_10166660 | |||
| 2917 | Ga0105238_10324128 | |||
| 2918 | Ga0105238_10800005 | |||
| 2919 | Ga0105238_11324159 | |||
| 2920 | Ga0105249_10501152 | |||
| 2921 | Ga0105249_10509420 | |||
| 2922 | Ga0105249_10691656 | |||
| 2923 | Ga0105249_11224652 | |||
| 2924 | Ga0105249_11350139 | |||
| 2925 | Ga0105249_12279995 | |||
| 2926 | Ga0105239_10009227 | |||
| 2927 | Ga0105239_10243567 | |||
| 2928 | Ga0105239_10774454 | |||
| 2929 | Ga0105239_12934718 | |||
| 2930 | Ga0105246_10142109 | |||
| 2931 | Ga0105246_10161956 | |||
| 2932 | Ga0105246_10267141 | |||
| 2933 | Ga0105246_11016956 | |||
| 2934 | Ga0105246_11041241 | |||
| 2935 | Ga0105246_11226184 | |||
| 2936 | Ga0105246_11243297 | |||
| 2937 | Ga0157341_1002745 | |||
| 2938 | Ga0157347_1033888 | |||
| 2939 | Ga0157327_1012740 | |||
| 2940 | Ga0157373_10088518 | |||
| 2941 | Ga0157373_10263286 | |||
| 2942 | Ga0157373_10486590 | |||
| 2943 | Ga0157373_10579918 | |||
| 2944 | Ga0157373_10965097 | |||
| 2945 | Ga0157373_11355520 | |||
| 2946 | Ga0157371_10049583 | |||
| 2947 | Ga0157371_10502672 | |||
| 2948 | Ga0157371_10888147 | |||
| 2949 | Ga0157371_11236536 | |||
| 2950 | Ga0157370_10062393 | |||
| 2951 | Ga0157370_10286291 | |||
| 2952 | Ga0157369_10137815 | |||
| 2953 | Ga0157369_10838119 | |||
| 2954 | Ga0157374_10373902 | |||
| 2955 | Ga0157374_10378539 | |||
| 2956 | Ga0157374_10823628 | |||
| 2957 | Ga0157378_10001175 | |||
| 2958 | Ga0157378_10099224 | |||
| 2959 | Ga0157378_10622956 | |||
| 2960 | Ga0163162_10082727 | |||
| 2961 | Ga0163162_10161956 | |||
| 2962 | Ga0163162_10335810 | |||
| 2963 | Ga0163162_10344066 | |||
| 2964 | Ga0163162_10413738 | |||
| 2965 | Ga0163162_10544677 | |||
| 2966 | Ga0157372_10149662 | |||
| 2967 | Ga0157372_10157848 | |||
| 2968 | Ga0157372_11084170 | |||
| 2969 | Ga0157372_11114294 | |||
| 2970 | Ga0157372_11384010 | |||
| 2971 | Ga0157375_10047744 | |||
| 2972 | Ga0157375_10308546 | |||
| 2973 | Ga0157375_10729740 | |||
| 2974 | Ga0157375_11469622 | |||
| 2975 | Ga0163163_10009593 | |||
| 2976 | Ga0163163_10019560 | |||
| 2977 | Ga0163163_10846802 | |||
| 2978 | Ga0163163_12237882 | |||
| 2979 | Ga0157380_10022168 | |||
| 2980 | Ga0157380_10533822 | |||
| 2981 | Ga0157380_10690874 | |||
| 2982 | Ga0157380_10828368 | |||
| 2983 | Ga0182008_10001210 | |||
| 2984 | Ga0182008_10160810 | |||
| 2985 | Ga0157377_10111584 | |||
| 2986 | Ga0157377_10269917 | |||
| 2987 | Ga0157377_10420019 | |||
| 2988 | Ga0157379_10006994 | |||
| 2989 | Ga0157379_10361025 | |||
| 2990 | Ga0157379_10413899 | |||
| 2991 | Ga0157379_10760102 | |||
| 2992 | Ga0157379_10793644 | |||
| 2993 | Ga0157379_11010040 | |||
| 2994 | Ga0157376_10041180 | |||
| 2995 | Ga0157376_10044345 | |||
| 2996 | Ga0157376_10071273 | |||
| 2997 | Ga0157376_10368791 | |||
| 2998 | Ga0157376_10440993 | |||
| 2999 | Ga0157376_10776137 | |||
| 3000 | Ga0157376_12141178 | |||
| 3001 | Ga0182006_1000002 | |||
| 3002 | Ga0182006_1000026 | |||
| 3003 | Ga0182006_1037733 | |||
| 3004 | Ga0182006_1068722 | |||
| 3005 | Ga0182006_1145629 | |||
| 3006 | Ga0182006_1241352 | |||
| 3007 | Ga0182007_10000159 | |||
| 3008 | Ga0182007_10024981 | |||
| 3009 | Ga0182007_10080783 | |||
| 3010 | Ga0182007_10082433 | |||
| 3011 | Ga0182005_1000002 | |||
| 3012 | Ga0182005_1000007 | |||
| 3013 | Ga0182005_1020747 | |||
| 3014 | Ga0163161_10021691 | |||
| 3015 | Ga0163161_10045173 | |||
| 3016 | Ga0163161_10047644 | |||
| 3017 | Ga0163161_10174521 | |||
| 3018 | Ga0163161_11853290 | |||
| 3019 | Ga0206351_10512431 | |||
| 3020 | Ga0206350_10748337 | |||
| 3021 | Ga0154015_1698159 | |||
| 3022 | Ga0213872_10000028 | |||
| 3023 | Ga0213872_10000921 | |||
| 3024 | Ga0213872_10097561 | |||
| 3025 | Ga0213872_10255684 | |||
| 3026 | Ga0213876_10330753 | |||
| 3027 | Ga0209435_100013 | |||
| 3028 | Ga0209435_100862 | |||
| 3029 | Ga0209436_100857 | |||
| 3030 | Ga0209566_100521 | |||
| 3031 | Ga0209674_109866 | |||
| 3032 | Ga0209672_100033 | |||
| 3033 | Ga0209672_100114 | |||
| 3034 | Ga0209147_100030 | |||
| 3035 | Ga0209147_100161 | |||
| 3036 | Ga0209147_100390 | |||
| 3037 | Ga0209147_110450 | |||
| 3038 | Ga0209563_100007 | |||
| 3039 | Ga0209258_100100 | |||
| 3040 | Ga0209258_100205 | |||
| 3041 | Ga0209258_100263 | |||
| 3042 | Ga0207425_1000001 | |||
| 3043 | Ga0207425_1000143 | |||
| 3044 | Ga0209646_1000010 | |||
| 3045 | Ga0209646_1000034 | |||
| 3046 | Ga0209646_1000135 | |||
| 3047 | Ga0209026_1000022 | |||
| 3048 | Ga0209026_1004343 | |||
| 3049 | Ga0209026_1007871 | |||
| 3050 | Ga0209677_102467 | |||
| 3051 | Ga0209148_1000432 | |||
| 3052 | Ga0209148_1001082 | |||
| 3053 | Ga0209148_1001416 | |||
| 3054 | Ga0209148_1016550 | |||
| 3055 | Ga0209148_1030510 | |||
| 3056 | Ga0209759_1000018 | |||
| 3057 | Ga0209759_1000133 | |||
| 3058 | Ga0209759_1000890 | |||
| 3059 | Ga0209129_1000001 | |||
| 3060 | Ga0209233_1090303 | |||
| 3061 | Ga0209565_1000057 | |||
| 3062 | Ga0209565_1001088 | |||
| 3063 | Ga0209565_1004368 | |||
| 3064 | Ga0209565_1006127 | |||
| 3065 | Ga0209455_1000037 | |||
| 3066 | Ga0209455_1000192 | |||
| 3067 | Ga0209673_1000051 | |||
| 3068 | Ga0209673_1000332 | |||
| 3069 | Ga0209673_1010506 | |||
| 3070 | Ga0209130_1000268 | |||
| 3071 | Ga0209130_1004305 | |||
| 3072 | Ga0209675_1000027 | |||
| 3073 | Ga0209675_1002448 | |||
| 3074 | Ga0209675_1048852 | |||
| 3075 | Ga0209025_1001845 | |||
| 3076 | Ga0209564_1000009 | |||
| 3077 | Ga0209564_1000033 | |||
| 3078 | Ga0209564_1000094 | |||
| 3079 | Ga0209564_1002669 | |||
| 3080 | Ga0209564_1003700 | |||
| 3081 | Ga0209758_1000073 | |||
| 3082 | Ga0209758_1001766 | |||
| 3083 | Ga0209050_1000046 | |||
| 3084 | Ga0209256_1000044 | |||
| 3085 | Ga0209256_1000139 | |||
| 3086 | Ga0209256_1003060 | |||
| 3087 | Ga0209256_1006799 | |||
| 3088 | Ga0207426_1001318 | |||
| 3089 | Ga0207426_1030983 | |||
| 3090 | Ga0209051_1007011 | |||
| 3091 | Ga0209257_1000728 | |||
| 3092 | Ga0207697_10039612 | |||
| 3093 | Ga0207697_10342404 | |||
| 3094 | Ga0207656_10405524 | |||
| 3095 | Ga0207696_1022174 | |||
| 3096 | Ga0207655_1010587 | |||
| 3097 | Ga0207655_1046953 | |||
| 3098 | Ga0207655_1096525 | |||
| 3099 | Ga0207655_1147135 | |||
| 3100 | Ga0207653_10044471 | |||
| 3101 | Ga0207653_10056955 | |||
| 3102 | Ga0207653_10421718 | |||
| 3103 | Ga0207682_10026427 | |||
| 3104 | Ga0207682_10104475 | |||
| 3105 | Ga0207692_10056492 | |||
| 3106 | Ga0207692_10336212 | |||
| 3107 | Ga0207642_10047120 | |||
| 3108 | Ga0207642_10131008 | |||
| 3109 | Ga0207710_10446685 | |||
| 3110 | Ga0207688_10108080 | |||
| 3111 | Ga0207688_10207192 | |||
| 3112 | Ga0207680_10066788 | |||
| 3113 | Ga0207680_10411094 | |||
| 3114 | Ga0207647_10000981 | |||
| 3115 | Ga0207647_10051255 | |||
| 3116 | Ga0207647_10749190 | |||
| 3117 | Ga0207699_10840643 | |||
| 3118 | Ga0207699_11123785 | |||
| 3119 | Ga0207645_10122932 | |||
| 3120 | Ga0207643_10005920 | |||
| 3121 | Ga0207643_10014328 | |||
| 3122 | Ga0207643_10067012 | |||
| 3123 | Ga0207643_10084057 | |||
| 3124 | Ga0207643_10134663 | |||
| 3125 | Ga0207643_10969372 | |||
| 3126 | Ga0207705_10281000 | |||
| 3127 | Ga0207705_10316254 | |||
| 3128 | Ga0207684_10279875 | |||
| 3129 | Ga0207684_10376536 | |||
| 3130 | Ga0207684_10500548 | |||
| 3131 | Ga0207654_10030723 | |||
| 3132 | Ga0207654_10077230 | |||
| 3133 | Ga0207654_10118379 | |||
| 3134 | Ga0207654_10360049 | |||
| 3135 | Ga0207654_11044637 | |||
| 3136 | Ga0207707_10033786 | |||
| 3137 | Ga0207707_10053572 | |||
| 3138 | Ga0207707_10399872 | |||
| 3139 | Ga0207707_10427013 | |||
| 3140 | Ga0207695_10001528 | |||
| 3141 | Ga0207695_10012279 | |||
| 3142 | Ga0207695_10302505 | |||
| 3143 | Ga0207695_10361267 | |||
| 3144 | Ga0207695_11141749 | |||
| 3145 | Ga0207671_10008283 | |||
| 3146 | Ga0207693_10001263 | |||
| 3147 | Ga0207693_10189721 | |||
| 3148 | Ga0207693_10268559 | |||
| 3149 | Ga0207693_10944929 | |||
| 3150 | Ga0207663_10307781 | |||
| 3151 | Ga0207663_10542816 | |||
| 3152 | Ga0207660_10047276 | |||
| 3153 | Ga0207660_10047629 | |||
| 3154 | Ga0207660_10142159 | |||
| 3155 | Ga0207660_10180225 | |||
| 3156 | Ga0207662_10000577 | |||
| 3157 | Ga0207662_10067141 | |||
| 3158 | Ga0207662_10128095 | |||
| 3159 | Ga0207657_10000068 | |||
| 3160 | Ga0207657_10001348 | |||
| 3161 | Ga0207657_10184294 | |||
| 3162 | Ga0207657_10468472 | |||
| 3163 | Ga0207649_10181300 | |||
| 3164 | Ga0207649_10640928 | |||
| 3165 | Ga0207652_10394896 | |||
| 3166 | Ga0207652_11155970 | |||
| 3167 | Ga0207646_10075873 | |||
| 3168 | Ga0207646_10419930 | |||
| 3169 | Ga0207681_10002320 | |||
| 3170 | Ga0207681_10021046 | |||
| 3171 | Ga0207681_11324076 | |||
| 3172 | Ga0207694_10005697 | |||
| 3173 | Ga0207694_10173702 | |||
| 3174 | Ga0207694_10833845 | |||
| 3175 | Ga0207650_10010546 | |||
| 3176 | Ga0207650_10726181 | |||
| 3177 | Ga0207650_11698397 | |||
| 3178 | Ga0207659_10002190 | |||
| 3179 | Ga0207659_10073385 | |||
| 3180 | Ga0207659_10184790 | |||
| 3181 | Ga0207659_10338378 | |||
| 3182 | Ga0207659_11574010 | |||
| 3183 | Ga0207687_10002891 | |||
| 3184 | Ga0207687_10033850 | |||
| 3185 | Ga0207687_10061275 | |||
| 3186 | Ga0207687_10132207 | |||
| 3187 | Ga0207687_10189604 | |||
| 3188 | Ga0207700_10000099 | |||
| 3189 | Ga0207700_10023848 | |||
| 3190 | Ga0207700_10037033 | |||
| 3191 | Ga0207664_10000454 | |||
| 3192 | Ga0207644_10004698 | |||
| 3193 | Ga0207644_10142857 | |||
| 3194 | Ga0207644_10443426 | |||
| 3195 | Ga0207690_10000027 | |||
| 3196 | Ga0207690_10078703 | |||
| 3197 | Ga0207706_10006695 | |||
| 3198 | Ga0207706_10082422 | |||
| 3199 | Ga0207706_10113429 | |||
| 3200 | Ga0207706_10372542 | |||
| 3201 | Ga0207706_10405415 | |||
| 3202 | Ga0207706_10550041 | |||
| 3203 | Ga0207686_10000488 | |||
| 3204 | Ga0207686_10000586 | |||
| 3205 | Ga0207686_10002850 | |||
| 3206 | Ga0207686_10149169 | |||
| 3207 | Ga0207686_10150170 | |||
| 3208 | Ga0207686_10162748 | |||
| 3209 | Ga0207686_10325907 | |||
| 3210 | Ga0207686_10571203 | |||
| 3211 | Ga0207686_10890787 | |||
| 3212 | Ga0207686_11728651 | |||
| 3213 | Ga0207709_10001240 | |||
| 3214 | Ga0207709_10004162 | |||
| 3215 | Ga0207709_10055857 | |||
| 3216 | Ga0207709_10155586 | |||
| 3217 | Ga0207709_10239248 | |||
| 3218 | Ga0207709_10332762 | |||
| 3219 | Ga0207709_10459528 | |||
| 3220 | Ga0207709_10766363 | |||
| 3221 | Ga0207709_10801541 | |||
| 3222 | Ga0207670_10001102 | |||
| 3223 | Ga0207670_10021580 | |||
| 3224 | Ga0207670_10149171 | |||
| 3225 | Ga0207670_10627845 | |||
| 3226 | Ga0207670_10836371 | |||
| 3227 | Ga0207669_10050794 | |||
| 3228 | Ga0207669_10189862 | |||
| 3229 | Ga0207669_10258572 | |||
| 3230 | Ga0207669_10482318 | |||
| 3231 | Ga0207704_10000475 | |||
| 3232 | Ga0207704_10160498 | |||
| 3233 | Ga0207704_10218818 | |||
| 3234 | Ga0207704_11061273 | |||
| 3235 | Ga0207665_10014048 | |||
| 3236 | Ga0207665_10455767 | |||
| 3237 | Ga0207691_10062473 | |||
| 3238 | Ga0207691_10082111 | |||
| 3239 | Ga0207691_10106456 | |||
| 3240 | Ga0207691_10232780 | |||
| 3241 | Ga0207691_10546899 | |||
| 3242 | Ga0207711_10001033 | |||
| 3243 | Ga0207711_10309689 | |||
| 3244 | Ga0207711_11138565 | |||
| 3245 | Ga0207711_11986836 | |||
| 3246 | Ga0207689_10000384 | |||
| 3247 | Ga0207689_10000808 | |||
| 3248 | Ga0207689_10029109 | |||
| 3249 | Ga0207689_10058383 | |||
| 3250 | Ga0207689_10058570 | |||
| 3251 | Ga0207689_10615687 | |||
| 3252 | Ga0207689_10666864 | |||
| 3253 | Ga0207661_10567734 | |||
| 3254 | Ga0207661_10811040 | |||
| 3255 | Ga0207679_10115933 | |||
| 3256 | Ga0207679_10441804 | |||
| 3257 | Ga0207679_11268919 | |||
| 3258 | Ga0207667_10039769 | |||
| 3259 | Ga0207667_10062976 | |||
| 3260 | Ga0207667_10071588 | |||
| 3261 | Ga0207667_11268120 | |||
| 3262 | Ga0207667_11519163 | |||
| 3263 | Ga0207651_10003957 | |||
| 3264 | Ga0207651_10015772 | |||
| 3265 | Ga0207651_10667491 | |||
| 3266 | Ga0207712_10022912 | |||
| 3267 | Ga0207712_10228310 | |||
| 3268 | Ga0207712_10306446 | |||
| 3269 | Ga0207712_10388700 | |||
| 3270 | Ga0207712_10497804 | |||
| 3271 | Ga0207668_10181985 | |||
| 3272 | Ga0207668_10229957 | |||
| 3273 | Ga0207668_10258472 | |||
| 3274 | Ga0207668_10755003 | |||
| 3275 | Ga0207640_10029906 | |||
| 3276 | Ga0207640_10295906 | |||
| 3277 | Ga0207640_10909140 | |||
| 3278 | Ga0207658_10032488 | |||
| 3279 | Ga0207658_10173117 | |||
| 3280 | Ga0207658_10210850 | |||
| 3281 | Ga0207677_10002051 | |||
| 3282 | Ga0207677_10159068 | |||
| 3283 | Ga0207677_10281942 | |||
| 3284 | Ga0207677_10524577 | |||
| 3285 | Ga0207677_11210109 | |||
| 3286 | Ga0207703_10001476 | |||
| 3287 | Ga0207703_10001709 | |||
| 3288 | Ga0207703_11300927 | |||
| 3289 | Ga0207639_10423545 | |||
| 3290 | Ga0207639_10708266 | |||
| 3291 | Ga0207639_11062049 | |||
| 3292 | Ga0207639_11699868 | |||
| 3293 | Ga0207678_10002813 | |||
| 3294 | Ga0207678_10057117 | |||
| 3295 | Ga0207678_10059618 | |||
| 3296 | Ga0207678_10218891 | |||
| 3297 | Ga0207678_10877631 | |||
| 3298 | Ga0207678_11761218 | |||
| 3299 | Ga0207708_10000156 | |||
| 3300 | Ga0207708_10007769 | |||
| 3301 | Ga0207708_10050862 | |||
| 3302 | Ga0207708_10459646 | |||
| 3303 | Ga0207708_10544887 | |||
| 3304 | Ga0207708_10775684 | |||
| 3305 | Ga0207702_10014860 | |||
| 3306 | Ga0207702_10362633 | |||
| 3307 | Ga0207702_10417239 | |||
| 3308 | Ga0207702_10573009 | |||
| 3309 | Ga0207702_10881170 | |||
| 3310 | Ga0207702_11101363 | |||
| 3311 | Ga0207702_11531296 | |||
| 3312 | Ga0207702_12173321 | |||
| 3313 | Ga0207641_10016890 | |||
| 3314 | Ga0207641_10339069 | |||
| 3315 | Ga0207641_10982728 | |||
| 3316 | Ga0207648_10000128 | |||
| 3317 | Ga0207648_10002472 | |||
| 3318 | Ga0207648_10005495 | |||
| 3319 | Ga0207648_10025971 | |||
| 3320 | Ga0207648_10259915 | |||
| 3321 | Ga0207648_10434447 | |||
| 3322 | Ga0207648_10609220 | |||
| 3323 | Ga0207648_11291970 | |||
| 3324 | Ga0207648_11879985 | |||
| 3325 | Ga0207676_10000174 | |||
| 3326 | Ga0207676_10007775 | |||
| 3327 | Ga0207676_11062734 | |||
| 3328 | Ga0207674_10005547 | |||
| 3329 | Ga0207674_10316922 | |||
| 3330 | Ga0207674_10353792 | |||
| 3331 | Ga0207675_100000215 | |||
| 3332 | Ga0207675_100000408 | |||
| 3333 | Ga0207675_100009821 | |||
| 3334 | Ga0207675_100165026 | |||
| 3335 | Ga0207675_100684500 | |||
| 3336 | Ga0207675_101485820 | |||
| 3337 | Ga0207683_10001993 | |||
| 3338 | Ga0207683_10012879 | |||
| 3339 | Ga0207683_10043918 | |||
| 3340 | Ga0207683_10173906 | |||
| 3341 | Ga0207683_10651065 | |||
| 3342 | Ga0207683_10744807 | |||
| 3343 | Ga0207698_10254086 | |||
| 3344 | Ga0207698_10386136 | |||
| 3345 | Ga0207698_10394735 | |||
| 3346 | Ga0207698_10935404 | |||
| 3347 | Ga0207698_11311021 | |||
| 3348 | Ga0209281_1012000 | |||
| 3349 | Ga0209371_1000448 | |||
| 3350 | Ga0209969_1000391 | |||
| 3351 | Ga0209967_1000346 | |||
| 3352 | Ga0209981_1006208 | |||
| 3353 | Ga0209981_1024360 | |||
| 3354 | Ga0209996_1014353 | |||
| 3355 | Ga0210000_1005995 | |||
| 3356 | Ga0210000_1045302 | |||
| 3357 | Ga0209995_1004306 | |||
| 3358 | Ga0209968_1049772 | |||
| 3359 | Ga0209999_1004967 | |||
| 3360 | Ga0209999_1009591 | |||
| 3361 | Ga0209999_1036179 | |||
| 3362 | Ga0209970_1015173 | |||
| 3363 | Ga0209983_1016239 | |||
| 3364 | Ga0209282_1000001 | |||
| 3365 | Ga0209588_1102153 | |||
| 3366 | Ga0209588_1130375 | |||
| 3367 | Ga0209588_1164561 | |||
| 3368 | Ga0209971_1006394 | |||
| 3369 | Ga0209971_1171336 | |||
| 3370 | Ga0209966_1026619 | |||
| 3371 | Ga0209966_1177484 | |||
| 3372 | Ga0209998_10045879 | |||
| 3373 | Ga0209813_10017820 | |||
| 3374 | Ga0209974_10018316 | |||
| 3375 | Ga0207428_10004612 | |||
| 3376 | Ga0207428_10007629 | |||
| 3377 | Ga0207428_10222717 | |||
| 3378 | Ga0207428_10228212 | |||
| 3379 | Ga0207428_10242943 | |||
| 3380 | Ga0207428_10760392 | |||
| 3381 | Ga0268266_10008065 | |||
| 3382 | Ga0268266_10047065 | |||
| 3383 | Ga0268265_10001364 | |||
| 3384 | Ga0268265_10002399 | |||
| 3385 | Ga0268265_10033020 | |||
| 3386 | Ga0268265_10041740 | |||
| 3387 | Ga0268265_10867311 | |||
| 3388 | Ga0268264_10053808 | |||
| 3389 | Ga0268264_10063078 | |||
| 3390 | Ga0268264_10421553 | |||
| 3391 | Ga0268264_11185149 | |||
| 3392 | Ga0268264_12376970 | |||
| 3393 | Ga0265324_10000006 | |||
| 3394 | Ga0265324_10016237 | |||
| 3395 | Ga0268256_1000823 | |||
| 3396 | Ga0307511_10000248 | |||
| 3397 | Ga0316177_1163550 | |||
| 3398 | Ga0314311_1225052 | |||
| 3399 | Ga0316179_1096458 | |||
| 3400 | Ga0316178_1028413 | |||
| 3401 | Ga0316178_1146804 | |||
| 3402 | Ga0316178_1169113 | |||
| 3403 | Ga0316180_1167461 | |||
| 3404 | Ga0316183_1193877 | |||
| 3405 | Ga0316182_1436475 | |||
| 3406 | Ga0265332_10003769 | |||
| 3407 | Ga0265328_10002778 | |||
| 3408 | Ga0265328_10007837 | |||
| 3409 | Ga0265328_10043022 | |||
| 3410 | Ga0265320_10073544 | |||
| 3411 | Ga0265325_10000110 | |||
| 3412 | Ga0265339_10221934 | |||
| 3413 | Ga0265331_10002297 | |||
| 3414 | Ga0265331_10002426 | |||
| 3415 | Ga0265331_10005458 | |||
| 3416 | Ga0265331_10120852 | |||
| 3417 | Ga0265327_10000588 | |||
| 3418 | Ga0265327_10000809 | |||
| 3419 | Ga0265327_10002222 | |||
| 3420 | Ga0265327_10045923 | |||
| 3421 | Ga0265327_10056979 | |||
| 3422 | Ga0265316_10075296 | |||
| 3423 | Ga0265316_10101868 | |||
| 3424 | Ga0265316_10119684 | |||
| 3425 | Ga0307513_11043829 | |||
| 3426 | Ga0307509_10536082 | |||
| 3427 | Ga0307408_100002707 | |||
| 3428 | Ga0307408_100022174 | |||
| 3429 | Ga0307408_100103451 | |||
| 3430 | Ga0307408_100646686 | |||
| 3431 | Ga0307408_100792260 | |||
| 3432 | Ga0265313_10168109 | |||
| 3433 | Ga0316575_10011355 | |||
| 3434 | Ga0265314_10000245 | |||
| 3435 | Ga0265314_10009646 | |||
| 3436 | Ga0265314_10016544 | |||
| 3437 | Ga0265314_10126042 | |||
| 3438 | Ga0265342_10473914 | |||
| 3439 | Ga0316576_10303711 | |||
| 3440 | Ga0316576_10915028 | |||
| 3441 | Ga0307516_10755847 | |||
| 3442 | Ga0307405_10247730 | |||
| 3443 | Ga0307405_10881972 | |||
| 3444 | Ga0307518_10117882 | |||
| 3445 | Ga0307406_10573976 | |||
| 3446 | Ga0307406_10584348 | |||
| 3447 | Ga0307406_11398175 | |||
| 3448 | Ga0307406_12066410 | |||
| 3449 | Ga0307407_11198047 | |||
| 3450 | Ga0307412_10965583 | |||
| 3451 | Ga0307412_11289824 | |||
| 3452 | Ga0307416_100022459 | |||
| 3453 | Ga0307416_100667029 | |||
| 3454 | Ga0307416_101485459 | |||
| 3455 | Ga0307416_102545616 | |||
| 3456 | Ga0307414_10030059 | |||
| 3457 | Ga0307411_10185351 | |||
| 3458 | Ga0307411_11409969 | |||
| 3459 | Ga0307411_11426161 | |||
| 3460 | Ga0307415_101193524 | |||
| 3461 | Ga0307415_101367772 | |||
| 3462 | Ga0316583_10062422 | |||
| 3463 | Ga0307507_10104184 | |||
| 3464 | Ga0373950_0117658 | |||
| 3465 | Ga0373929_0086328 | |||
| 3466 | Ga0373934_0176786 | |||
| 3467 | Ga0373940_0030517 | |||
| 3468 | Ga0373944_0001197 | |||
| 3469 | Ga0373944_0069188 | |||
| 3470 | Ga0373949_0037050 | |||
| 3471 | Ga0373949_0135114 | |||
| 3472 | Ga0373951_0015446 | |||
| 3473 | Ga0373952_0226126 | |||
| 3474 | Ga0373952_0294254 | |||
| 3475 | Ga0373923_0066800 | |||
| 3476 | Ga0373932_0001629 | |||
| 3477 | Ga0373932_0130555 | |||
| 3478 | Ga0373936_0003926 | |||
| 3479 | Ga0373936_0014734 | |||
| 3480 | Ga0373936_0110541 | |||
| 3481 | Ga0373936_0111839 | |||
| 3482 | Ga0373936_0545757 | |||
| 3483 | Ga0373939_0041526 | |||
| 3484 | Ga0373939_0189054 | |||
| 3485 | Ga0373939_0439442 | |||
| 3486 | Ga0373941_0076465 | |||
| 3487 | Ga0373941_0172249 | |||
| 3488 | Ga0373941_0270086 | |||
| 3489 | Ga0373945_0025125 | |||
| 3490 | Ga0373945_0240091 | |||
| 3491 | Ga0373953_0022608 | |||
| 3492 | Ga0373953_0054507 | |||
| 3493 | Ga0373953_0198630 | |||
| 3494 | Ga0373954_0024099 | |||
| 3495 | Ga0373954_0345868 | |||
| 3496 | Ga0373956_0025761 | |||
| 3497 | Ga0373956_0079120 | |||
| 3498 | Ga0373956_0109451 | |||
| 3499 | Ga0373957_0157691 | |||
| 3500 | Ga0373960_0091904 | |||
| 3501 | Ga0373943_0021046 | |||
| 3502 | Ga0373943_0038187 | |||
| 3503 | Ga0373943_0046400 | |||
| 3504 | Ga0373943_0138726 | |||
| 3505 | Ga0373943_0175304 | |||
| 3506 | Ga0373943_0574636 | |||
| 3507 | Ga0373946_0074089 | |||
| 3508 | Ga0373946_0086439 | |||
| 3509 | Ga0373946_0144620 | |||
| 3510 | Ga0373946_0187562 | |||
| 3511 | Ga0373946_0220506 | |||
| 3512 | Ga0373955_0045169 | |||
| 3513 | Ga0373955_0144808 | |||
| 3514 | Ga0373955_0196502 | |||
| 3515 | Ga0373955_0227939 | |||
| 3516 | Ga0373955_0310073 | |||
| 3517 | Ga0373955_0475990 | |||
| 3518 | Ga0373942_0029303 | |||
| 3519 | Ga0373942_0092566 | |||
| 3520 | Ga0373942_0190317 | |||
| 3521 | Ga0373962_0226282 | |||
| 3522 | Ga0373962_0243852 | |||
| 3523 | Ga0316574_0000854 | |||
| 3524 | Ga0316574_0002988 | |||
| 3525 | Ga0373924_0043068 | |||
| 3526 | Ga0373924_0161259 | |||
| 3527 | Ga0373924_0185598 | |||
| 3528 | Ga0373924_0388207 | |||
| 3529 | Ga0373931_0000424 | |||
| 3530 | Ga0373931_0018892 | |||
| 3531 | Ga0373931_0109568 | |||
| 3532 | Ga0373931_0406430 | |||
| 3533 | Ga0373935_0008550 | |||
| 3534 | Ga0373935_0027021 | |||
| 3535 | Ga0373935_0686211 | |||
| 3536 | Ga0373935_0726761 | |||
| 3537 | Ga0373935_0863263 | |||
| 3538 | Ga0373927_0002911 | |||
| 3539 | Ga0373927_0016489 | |||
| 3540 | Ga0373927_0017456 | |||
| 3541 | Ga0373927_0444198 | |||
| 3542 | Ga0373927_0536273 | |||
| 3543 | Ga0373933_0005103 | |||
| 3544 | Ga0373933_0060834 | |||
| 3545 | Ga0373933_0061327 | |||
| 3546 | Ga0373933_0236829 | |||
| 3547 | Ga0373933_0238831 | |||
| 3548 | Ga0373933_0307873 | |||
| 3549 | Ga0373933_0890428 | |||
| 3550 | Ga0373947_0012180 | |||
| 3551 | Ga0373947_0054393 | |||
| 3552 | Ga0373947_0187151 | |||
| 3553 | Ga0373947_0239003 | |||
| 3554 | Ga0373947_0300938 | |||
| 3555 | Ga0373947_0525852 | |||
| 3556 | Ga0373937_0107343 | |||
| 3557 | Ga0373937_0216611 | |||
| 3558 | Ga0373937_0487814 | |||
| 3559 | Ga0373937_0657684 | |||
| 3560 | Ga0373937_0726714 | |||
| 3561 | Ga0316582_0162139 | |||
| 3562 | Ga0373925_0012636 | |||
| 3563 | Ga0373925_0068651 | |||
| 3564 | Ga0373925_0074773 | |||
| 3565 | Ga0373925_0228787 | |||
| 3566 | Ga0373925_0273745 | |||
| 3567 | Ga0373925_0293246 | |||
| 3568 | Ga0373925_0874968 | |||
| 3569 | Ga0395899_0000505 | |||
| 3570 | Ga0395899_0003409 | |||
| 3571 | Ga0395899_0234206 | |||
| 3572 | Ga0395900_0006268 | |||
| 3573 | Ga0395900_0206565 | |||
| 3574 | Ga0395900_1289413 | |||
| 3575 | Ga0395898_0536946 | |||
| 3576 | Ga0395898_0946296 | |||
| 3577 | Ga0395898_1150299 | |||
| 3578 | Ga0395905_0008791 | |||
| 3579 | Ga0395905_0067029 | |||
| 3580 | Ga0395905_0155785 | |||
| 3581 | Ga0395905_0365479 | |||
| 3582 | Ga0395905_0467096 | |||
| 3583 | Ga0395901_0000182 | |||
| 3584 | Ga0395901_0230027 | |||
| 3585 | Ga0395901_0346653 | |||
| 3586 | Ga0395901_0796187 | |||
| 3587 | Ga0395901_0879150 | |||
| 3588 | Ga0400490_47983 | |||
| 3589 | Ga0242420_095243 | |||
| 3590 | Ga0400483_225090 | |||
| 3591 | Ga0436365_0581961 | |||
| 3592 | Ga0436365_1017355 | |||
| 3593 | Ga0436360_0570562 | |||
| 3594 | Ga0436360_1263300 | |||
| 3595 | Ga0436361_0009988 | |||
| 3596 | Ga0436361_0200247 | |||
| 3597 | Ga0436361_0514914 | |||
| 3598 | Ga0436361_0521959 | |||
| 3599 | Ga0436361_0687444 | |||
| 3600 | Ga0436361_0928362 | |||
| 3601 | Ga0436363_0091266 | |||
| 3602 | Ga0436363_0620330 | |||
| 3603 | Ga0439461_0012185 | |||
| 3604 | Ga0439465_0232265 | |||
| 3605 | Ga0451789_1216037 | |||
| 3606 | Ga0451797_1582190 | |||
| 3607 | Ga0451804_0575511 | |||
| 3608 | Ga0451835_0475987 | |||
| 3609 | Ga0451839_0318377 | |||
| 3610 | Ga0451853_3182744 | |||
| 3611 | Ga0439433_0023110 | |||
| 3612 | Ga0439433_0099279 | |||
| 3613 | Ga0439441_006635 | |||
| 3614 | Ga0439441_176546 | |||
| 3615 | Ga0439449_0024567 | |||
| 3616 | Ga0439450_003397 | |||
| 3617 | Ga0439450_212025 | |||
| 3618 | Ga0439451_034850 | |||
| 3619 | Ga0439454_074802 | |||
| 3620 | Ga0450911_025560 | |||
| 3621 | Ga0450917_019401 | |||
| 3622 | Ga0450897_007065 | |||
| 3623 | Ga0450898_018404 | |||
| 3624 | Ga0450898_023425 | |||
| 3625 | Ga0450904_000933 | |||
| 3626 | Ga0439446_0004083 | |||
| 3627 | Ga0439458_0010675 | |||
| 3628 | Ga0439434_0000207 | |||
| 3629 | Ga0439435_0000263 | |||
| 3630 | Ga0439435_0002006 | |||
| 3631 | Ga0439460_0005416 | |||
| 3632 | Ga0439460_0006906 | |||
| 3633 | Ga0450893_0007475 | |||
| 3634 | Ga0451577_0009550 | |||
| 3635 | Ga0451577_0341078 | |||
| 3636 | Ga0451577_0387767 | |||
| 3637 | Ga0451577_0826646 | |||
| 3638 | Ga0466969_0432385 | |||
| 3639 | Ga0466972_0000070 | |||
| 3640 | Ga0466972_0246959 | |||
| 3641 | Ga0466972_0390617 | |||
| 3642 | Ga0466982_0359842 | |||
| 3643 | Ga0453683_0258207 | |||
| 3644 | Ga0453683_0401251 | |||
| 3645 | Ga0466965_0006917 | |||
| 3646 | Ga0466965_0057320 | |||
| 3647 | Ga0466965_0113751 | |||
| 3648 | Ga0466965_0282826 | |||
| 3649 | Ga0466966_0195263 | |||
| 3650 | Ga0466966_0385009 | |||
| 3651 | Ga0466961_0157343 | |||
| 3652 | Ga0466961_0338418 | |||
| 3653 | Ga0466963_0298143 | |||
| 3654 | Ga0466964_0019249 | |||
| 3655 | Ga0466964_0242455 | |||
| 3656 | Ga0453684_0000237 | |||
| 3657 | Ga0453684_0796826 | |||
| 3658 | Ga0453684_2306124 | |||
| 3659 | Ga0466970_0022377 | |||
| 3660 | Ga0466970_0114882 | |||
| 3661 | Ga0466970_0276104 | |||
| 3662 | Ga0466957_0091828 | |||
| 3663 | Ga0466960_0180323 | |||
| 3664 | Ga0466960_0228618 | |||
| 3665 | Ga0466960_0299615 | |||
| 3666 | Ga0451576_0000034 | |||
| 3667 | Ga0451576_0000906 | |||
| 3668 | Ga0451576_0001076 | |||
| 3669 | Ga0451576_0002763 | |||
| 3670 | Ga0451576_0005425 | |||
| 3671 | Ga0451576_0031091 | |||
| 3672 | Ga0451576_0038069 | |||
| 3673 | Ga0451576_0284224 | |||
| 3674 | Ga0451576_0568075 | |||
| 3675 | Ga0466958_0138819 | |||
| 3676 | Ga0466967_0119186 | |||
| 3677 | Ga0495617_000037 | |||
| 3678 | Ga0495617_000039 | |||
| 3679 | Ga0495617_000940 | |||
| 3680 | Ga0495617_029977 | |||
| 3681 | Ga0495617_065190 | |||
| 3682 | Ga0495617_149382 | |||
| 3683 | Ga0495627_000008 | |||
| 3684 | Ga0495627_015998 | |||
| 3685 | Ga0495627_018004 | |||
| 3686 | Ga0495627_020896 | |||
| 3687 | Ga0495627_122687 | |||
| 3688 | Ga0495592_0051886 | |||
| 3689 | Ga0495592_0075221 | |||
| 3690 | Ga0495603_0006152 | |||
| 3691 | Ga0495603_0043579 | |||
| 3692 | Ga0495603_0047463 | |||
| 3693 | Ga0495603_0093673 | |||
| 3694 | Ga0495603_0152350 | |||
| 3695 | Ga0495590_0000089 | |||
| 3696 | Ga0495590_0000256 | |||
| 3697 | Ga0495590_0002299 | |||
| 3698 | Ga0495590_0008133 | |||
| 3699 | Ga0495590_0131777 | |||
| 3700 | Ga0495629_0142860 | |||
| 3701 | Ga0495629_0280428 | |||
| 3702 | Ga0495629_0491197 | |||
| 3703 | Ga0495629_0555635 | |||
| 3704 | Ga0495629_0558981 | |||
| 3705 | Ga0495638_0000329 | |||
| 3706 | Ga0495638_0010359 | |||
| 3707 | Ga0495638_0017274 | |||
| 3708 | Ga0495638_0078869 | |||
| 3709 | Ga0495638_0161272 | |||
| 3710 | Ga0495638_0186403 | |||
| 3711 | Ga0495638_0458401 | |||
| 3712 | Ga0495641_0057113 | |||
| 3713 | Ga0495641_0068108 | |||
| 3714 | Ga0495651_0026064 | |||
| 3715 | Ga0495651_0248309 | |||
| 3716 | Ga0495651_0858063 | |||
| 3717 | Ga0495653_0000038 | |||
| 3718 | Ga0495653_0021439 | |||
| 3719 | Ga0495653_0033733 | |||
| 3720 | Ga0495653_0045738 | |||
| 3721 | Ga0495653_0062116 | |||
| 3722 | Ga0495653_0073237 | |||
| 3723 | Ga0495653_0286533 | |||
| 3724 | Ga0495653_0659477 | |||
| 3725 | Ga0495650_0000048 | |||
| 3726 | Ga0495650_0001026 | |||
| 3727 | Ga0495650_0003518 | |||
| 3728 | Ga0495650_0010456 | |||
| 3729 | Ga0495650_0059767 | |||
| 3730 | Ga0495650_0059820 | |||
| 3731 | Ga0495650_0162181 | |||
| 3732 | Ga0495650_0224807 | |||
| 3733 | Ga0495580_0002487 | |||
| 3734 | Ga0495580_0072315 | |||
| 3735 | Ga0495580_0371054 | |||
| 3736 | Ga0495580_0420938 | |||
| 3737 | Ga0495580_0946361 | |||
| 3738 | Ga0495582_0008768 | |||
| 3739 | Ga0495582_0009830 | |||
| 3740 | Ga0495582_0015683 | |||
| 3741 | Ga0495582_0032967 | |||
| 3742 | Ga0495582_0110455 | |||
| 3743 | Ga0495582_0456930 | |||
| 3744 | Ga0495605_0002030 | |||
| 3745 | Ga0495605_0016179 | |||
| 3746 | Ga0495605_0018129 | |||
| 3747 | Ga0495605_0038869 | |||
| 3748 | Ga0495605_0042704 | |||
| 3749 | Ga0495605_0083768 | |||
| 3750 | Ga0495605_0115435 | |||
| 3751 | Ga0495639_0001363 | |||
| 3752 | Ga0495639_0015247 | |||
| 3753 | Ga0495639_0016761 | |||
| 3754 | Ga0495639_0036360 | |||
| 3755 | Ga0495639_0230513 | |||
| 3756 | Ga0495662_0003932 | |||
| 3757 | Ga0495662_0014304 | |||
| 3758 | Ga0495662_0018247 | |||
| 3759 | Ga0495662_0202882 | |||
| 3760 | Ga0495664_0096519 | |||
| 3761 | Ga0495664_0178081 | |||
| 3762 | Ga0495664_0553842 | |||
| 3763 | Ga0495584_0000006 | |||
| 3764 | Ga0495584_0000679 | |||
| 3765 | Ga0495584_0004790 | |||
| 3766 | Ga0495584_0008034 | |||
| 3767 | Ga0495584_0045789 | |||
| 3768 | Ga0495584_0111483 | |||
| 3769 | Ga0495584_0298359 | |||
| 3770 | Ga0495584_0334524 | |||
| 3771 | Ga0495585_0011506 | |||
| 3772 | Ga0495585_0012995 | |||
| 3773 | Ga0495585_0089092 | |||
| 3774 | Ga0495585_0103811 | |||
| 3775 | Ga0495585_0114472 | |||
| 3776 | Ga0495585_0125801 | |||
| 3777 | Ga0495585_0132197 | |||
| 3778 | Ga0495585_0141740 | |||
| 3779 | Ga0495585_0174688 | |||
| 3780 | Ga0495585_0199213 | |||
| 3781 | Ga0495585_0246622 | |||
| 3782 | Ga0495585_0265905 | |||
| 3783 | Ga0495594_0006812 | |||
| 3784 | Ga0495594_0011294 | |||
| 3785 | Ga0495594_0025057 | |||
| 3786 | Ga0495594_0038079 | |||
| 3787 | Ga0495594_0061269 | |||
| 3788 | Ga0495594_0086172 | |||
| 3789 | Ga0495594_0091226 | |||
| 3790 | Ga0495594_0121769 | |||
| 3791 | Ga0495594_0182800 | |||
| 3792 | Ga0495596_0001262 | |||
| 3793 | Ga0495596_0002979 | |||
| 3794 | Ga0495596_0016589 | |||
| 3795 | Ga0495596_0110255 | |||
| 3796 | Ga0495607_0000146 | |||
| 3797 | Ga0495607_0012687 | |||
| 3798 | Ga0495607_0043832 | |||
| 3799 | Ga0495607_0047575 | |||
| 3800 | Ga0495607_0108759 | |||
| 3801 | Ga0495607_0131367 | |||
| 3802 | Ga0495607_0151172 | |||
| 3803 | Ga0495607_0161243 | |||
| 3804 | Ga0495607_0173846 | |||
| 3805 | Ga0495607_0463128 | |||
| 3806 | Ga0495583_0000035 | |||
| 3807 | Ga0495583_0000464 | |||
| 3808 | Ga0495583_0000515 | |||
| 3809 | Ga0495583_0000941 | |||
| 3810 | Ga0495583_0025532 | |||
| 3811 | Ga0495583_0026085 | |||
| 3812 | Ga0495583_0037110 | |||
| 3813 | Ga0495606_0000011 | |||
| 3814 | Ga0495606_0000064 | |||
| 3815 | Ga0495606_0008212 | |||
| 3816 | Ga0495606_0015425 | |||
| 3817 | Ga0495606_0015437 | |||
| 3818 | Ga0495606_0031884 | |||
| 3819 | Ga0495606_0041980 | |||
| 3820 | Ga0495606_0076629 | |||
| 3821 | Ga0495606_0079664 | |||
| 3822 | Ga0495606_0087399 | |||
| 3823 | Ga0495606_0107100 | |||
| 3824 | Ga0495606_0225456 | |||
| 3825 | Ga0495606_0258014 | |||
| 3826 | Ga0495606_0585633 | |||
| 3827 | Ga0495608_0060034 | |||
| 3828 | Ga0495608_0243247 | |||
| 3829 | Ga0495608_0307552 | |||
| 3830 | Ga0495610_0000003 | |||
| 3831 | Ga0495610_0000147 | |||
| 3832 | Ga0495610_0020763 | |||
| 3833 | Ga0495610_0030292 | |||
| 3834 | Ga0495610_0075901 | |||
| 3835 | Ga0495610_0111465 | |||
| 3836 | Ga0495610_0269380 | |||
| 3837 | Ga0495616_0005111 | |||
| 3838 | Ga0495616_0010998 | |||
| 3839 | Ga0495616_0033526 | |||
| 3840 | Ga0495616_0068125 | |||
| 3841 | Ga0495616_0081978 | |||
| 3842 | Ga0495616_0090764 | |||
| 3843 | Ga0495616_0093850 | |||
| 3844 | Ga0495616_0103929 | |||
| 3845 | Ga0495616_0103962 | |||
| 3846 | Ga0495616_0138043 | |||
| 3847 | Ga0495618_0059440 | |||
| 3848 | Ga0495620_0005610 | |||
| 3849 | Ga0495628_0001929 | |||
| 3850 | Ga0495628_1053217 | |||
| 3851 | Ga0495630_0011239 | |||
| 3852 | Ga0495630_0016385 | |||
| 3853 | Ga0495630_0104553 | |||
| 3854 | Ga0495630_0214172 | |||
| 3855 | Ga0495630_0356463 | |||
| 3856 | Ga0495630_0589118 | |||
| 3857 | Ga0495631_0011492 | |||
| 3858 | Ga0495631_0025302 | |||
| 3859 | Ga0495631_0059603 | |||
| 3860 | Ga0495631_0086696 | |||
| 3861 | Ga0495631_0117343 | |||
| 3862 | Ga0495631_0253159 | |||
| 3863 | Ga0495631_0326922 | |||
| 3864 | Ga0495632_0000250 | |||
| 3865 | Ga0495632_0019797 | |||
| 3866 | Ga0495632_0046632 | |||
| 3867 | Ga0495632_0055038 | |||
| 3868 | Ga0495632_0275491 | |||
| 3869 | Ga0495637_0000004 | |||
| 3870 | Ga0495637_0002614 | |||
| 3871 | Ga0495637_0020216 | |||
| 3872 | Ga0495643_0000933 | |||
| 3873 | Ga0495643_0006906 | |||
| 3874 | Ga0495643_0031051 | |||
| 3875 | Ga0495643_0045226 | |||
| 3876 | Ga0495643_0045455 | |||
| 3877 | Ga0495643_0099955 | |||
| 3878 | Ga0495643_0100936 | |||
| 3879 | Ga0495643_0116765 | |||
| 3880 | Ga0495643_0254848 | |||
| 3881 | Ga0495644_0005823 | |||
| 3882 | Ga0495644_0011056 | |||
| 3883 | Ga0495644_0012807 | |||
| 3884 | Ga0495644_0039079 | |||
| 3885 | Ga0495644_0052182 | |||
| 3886 | Ga0495644_0059009 | |||
| 3887 | Ga0495644_0064010 | |||
| 3888 | Ga0495644_0082189 | |||
| 3889 | Ga0495644_0094584 | |||
| 3890 | Ga0495644_0173745 | |||
| 3891 | Ga0495644_0350380 | |||
| 3892 | Ga0495644_0445199 | |||
| 3893 | Ga0495648_0000001 | |||
| 3894 | Ga0495648_0002588 | |||
| 3895 | Ga0495648_0007597 | |||
| 3896 | Ga0495648_0026333 | |||
| 3897 | Ga0495648_0035961 | |||
| 3898 | Ga0495648_0041230 | |||
| 3899 | Ga0495648_0058058 | |||
| 3900 | Ga0495648_0065957 | |||
| 3901 | Ga0495648_0072601 | |||
| 3902 | Ga0495648_0077815 | |||
| 3903 | Ga0495648_0093764 | |||
| 3904 | Ga0495648_0096077 | |||
| 3905 | Ga0495648_0381431 | |||
| 3906 | Ga0495663_0018551 | |||
| 3907 | Ga0495663_0058761 | |||
| 3908 | Ga0495663_0095728 | |||
| 3909 | Ga0495666_0002752 | |||
| 3910 | Ga0495666_0006205 | |||
| 3911 | Ga0495666_0011231 | |||
| 3912 | Ga0495666_0012973 | |||
| 3913 | Ga0495666_0060314 | |||
| 3914 | Ga0495666_0157285 | |||
| 3915 | Ga0495666_0186219 | |||
| 3916 | Ga0495666_0205407 | |||
| 3917 | Ga0495666_0447872 | |||
| 3918 | Ga0495642_0000366 | |||
| 3919 | Ga0495642_0037261 | |||
| 3920 | Ga0495642_0043210 | |||
| 3921 | Ga0495642_0051391 | |||
| 3922 | Ga0495642_0113555 | |||
| 3923 | Ga0495642_0121583 | |||
| 3924 | Ga0495642_0136233 | |||
| 3925 | Ga0495642_0197240 | |||
| 3926 | Ga0495642_0268587 | |||
| 3927 | Ga0495652_0029810 | |||
| 3928 | Ga0495652_0456531 | |||
| 3929 | Ga0495652_0681737 | |||
| 3930 | Ga0495654_0000028 | |||
| 3931 | Ga0495654_0038980 | |||
| 3932 | Ga0495654_0052592 | |||
| 3933 | Ga0495654_0066092 | |||
| 3934 | Ga0495654_0068091 | |||
| 3935 | Ga0495654_0079581 | |||
| 3936 | Ga0495654_0094274 | |||
| 3937 | Ga0495654_0112433 | |||
| 3938 | Ga0495654_0338477 | |||
| 3939 | Ga0495665_0005600 | |||
| 3940 | Ga0495665_0031234 | |||
| 3941 | Ga0495665_0037697 | |||
| 3942 | Ga0495665_0050815 | |||
| 3943 | Ga0495665_0070023 | |||
| 3944 | Ga0495665_0311788 | |||
| 3945 | Ga0495665_0571292 | |||
| 3946 | Ga0495640_0000332 | |||
| 3947 | Ga0495640_0040721 | |||
| 3948 | Ga0495640_0042765 | |||
| 3949 | Ga0495640_0054180 | |||
| 3950 | Ga0495640_0263223 | |||
| 3951 | Ga0495640_0316478 | |||
| 3952 | Ga0495586_0001612 | |||
| 3953 | Ga0495586_0002680 | |||
| 3954 | Ga0495586_0047882 | |||
| 3955 | Ga0495586_0057896 | |||
| 3956 | Ga0495586_0126869 | |||
| 3957 | Ga0495586_0133520 | |||
| 3958 | Ga0495587_0013600 | |||
| 3959 | Ga0495587_0054498 | |||
| 3960 | Ga0495587_0120716 | |||
| 3961 | Ga0495587_0162193 | |||
| 3962 | Ga0495587_0519753 | |||
| 3963 | Ga0495587_0633605 | |||
| 3964 | Ga0495598_0039369 | |||
| 3965 | Ga0495598_0051470 | |||
| 3966 | Ga0495598_0235033 | |||
| 3967 | Ga0495609_0000202 | |||
| 3968 | Ga0495609_0000632 | |||
| 3969 | Ga0495609_0000731 | |||
| 3970 | Ga0495609_0005004 | |||
| 3971 | Ga0495609_0011146 | |||
| 3972 | Ga0495609_0019147 | |||
| 3973 | Ga0495609_0050578 | |||
| 3974 | Ga0495609_0093344 | |||
| 3975 | Ga0495609_0148567 | |||
| 3976 | Ga0495609_0199620 | |||
| 3977 | Ga0495621_0010474 | |||
| 3978 | Ga0495621_0011182 | |||
| 3979 | Ga0495621_0013172 | |||
| 3980 | Ga0495621_0107235 | |||
| 3981 | Ga0495621_0164068 | |||
| 3982 | Ga0495597_0010170 | |||
| 3983 | Ga0495597_0022198 | |||
| 3984 | Ga0495597_0043912 | |||
| 3985 | Ga0495597_0049650 | |||
| 3986 | Ga0495597_0054930 | |||
| 3987 | Ga0495597_0069719 | |||
| 3988 | Ga0495597_0081127 | |||
| 3989 | Ga0495597_0081891 | |||
| 3990 | Ga0495597_0151049 | |||
| 3991 | Ga0495597_0205414 | |||
| 3992 | Ga0495597_0235955 | |||
| 3993 | Ga0495597_0345635 | |||
| 3994 | Ga0495645_0196737 | |||
| 3995 | Ga0495645_0280617 | |||
| 3996 | Ga0495622_0000068 | |||
| 3997 | Ga0495622_0006132 | |||
| 3998 | Ga0495622_0029717 | |||
| 3999 | Ga0495622_0061892 | |||
| 4000 | Ga0495622_0104183 | |||
| 4001 | Ga0495622_0105294 | |||
| 4002 | Ga0495622_0122940 | |||
| 4003 | Ga0495622_0167628 | |||
| 4004 | Ga0495622_0184950 | |||
| 4005 | Ga0495633_0006613 | |||
| 4006 | Ga0495633_0007375 | |||
| 4007 | Ga0495633_0008653 | |||
| 4008 | Ga0495633_0034176 | |||
| 4009 | Ga0495633_0034661 | |||
| 4010 | Ga0495633_0093371 | |||
| 4011 | Ga0495633_0100650 | |||
| 4012 | Ga0495633_0121004 | |||
| 4013 | Ga0495633_0135146 | |||
| 4014 | Ga0495633_0147848 | |||
| 4015 | Ga0495633_0153652 | |||
| 4016 | Ga0495633_0168545 | |||
| 4017 | Ga0495633_0196114 | |||
| 4018 | Ga0495633_0243807 | |||
| 4019 | Ga0495633_0480125 | |||
| 4020 | Ga0495667_0008831 | |||
| 4021 | Ga0495667_0025952 | |||
| 4022 | Ga0495667_0339598 | |||
| 4023 | Ga0495656_0153543 | |||
| 4024 | Ga0495656_0160500 | |||
| 4025 | Ga0495656_0191516 | |||
| 4026 | Ga0495656_0203451 | |||
| 4027 | Ga0495656_0295141 | |||
| 4028 | Ga0495656_0691904 | |||
| 4029 | Ga0495656_0791185 | |||
| 4030 | Ga0495668_0000048 | |||
| 4031 | Ga0495668_0001049 | |||
| 4032 | Ga0495668_0001239 | |||
| 4033 | Ga0495668_0012767 | |||
| 4034 | Ga0495668_0015049 | |||
| 4035 | Ga0495668_0024042 | |||
| 4036 | Ga0495668_0074781 | |||
| 4037 | Ga0495668_0103640 | |||
| 4038 | Ga0495668_0133401 | |||
| 4039 | Ga0495668_0135939 | |||
| 4040 | Ga0495668_0408171 | |||
| 4041 | Ga0495634_0019021 | |||
| 4042 | Ga0495634_0141276 | |||
| 4043 | Ga0495634_0225284 | |||
| 4044 | Ga0495634_0343268 | |||
| 4045 | Ga0495611_0001880 | |||
| 4046 | Ga0495611_0010338 | |||
| 4047 | Ga0495611_0024049 | |||
| 4048 | Ga0495611_0039658 | |||
| 4049 | Ga0495611_0088858 | |||
| 4050 | Ga0495611_0220431 | |||
| 4051 | Ga0495625_0005736 | |||
| 4052 | Ga0495625_0008141 | |||
| 4053 | Ga0495625_0013178 | |||
| 4054 | Ga0495625_0019706 | |||
| 4055 | Ga0495625_0033686 | |||
| 4056 | Ga0495625_0080087 | |||
| 4057 | Ga0495625_0154224 | |||
| 4058 | Ga0495625_0186460 | |||
| 4059 | Ga0495625_0212373 | |||
| 4060 | Ga0495625_0384700 | |||
| 4061 | Ga0495625_0624382 | |||
| 4062 | Ga0495635_0013701 | |||
| 4063 | Ga0495635_0019832 | |||
| 4064 | Ga0495635_0030213 | |||
| 4065 | Ga0495635_0061139 | |||
| 4066 | Ga0495635_0526042 | |||
| 4067 | Ga0495635_0584544 | |||
| 4068 | Ga0495659_0001303 | |||
| 4069 | Ga0495659_0003422 | |||
| 4070 | Ga0495659_0023879 | |||
| 4071 | Ga0495659_0025638 | |||
| 4072 | Ga0495661_0000894 | |||
| 4073 | Ga0495661_0027661 | |||
| 4074 | Ga0495661_0037675 | |||
| 4075 | Ga0495661_0040131 | |||
| 4076 | Ga0495661_0047776 | |||
| 4077 | Ga0495661_0066666 | |||
| 4078 | Ga0495661_0092034 | |||
| 4079 | Ga0495661_0110406 | |||
| 4080 | Ga0495661_0144680 | |||
| 4081 | Ga0495661_0182630 | |||
| 4082 | Ga0495661_0274760 | |||
| 4083 | Ga0495661_0307386 | |||
| 4084 | Ga0495588_0000174 | |||
| 4085 | Ga0495588_0013191 | |||
| 4086 | Ga0495588_0017660 | |||
| 4087 | Ga0495588_0028280 | |||
| 4088 | Ga0495588_0028920 | |||
| 4089 | Ga0495588_0036538 | |||
| 4090 | Ga0495588_0085138 | |||
| 4091 | Ga0495588_0094769 | |||
| 4092 | Ga0495588_0113679 | |||
| 4093 | Ga0495588_0145496 | |||
| 4094 | Ga0495588_0248952 | |||
| 4095 | Ga0495588_0452445 | |||
| 4096 | Ga0495588_0544026 | |||
| 4097 | Ga0495657_0061543 | |||
| 4098 | Ga0495599_0070371 | |||
| 4099 | Ga0495599_0212083 | |||
| 4100 | Ga0495623_0062383 | |||
| 4101 | Ga0495623_0088447 | |||
| 4102 | Ga0495623_0126919 | |||
| 4103 | Ga0495646_0117109 | |||
| 4104 | Ga0495646_0171456 | |||
| 4105 | Ga0495646_0256228 | |||
| 4106 | Ga0495647_0018160 | |||
| 4107 | Ga0495647_0019605 | |||
| 4108 | Ga0495647_0032169 | |||
| 4109 | Ga0495647_0441362 | |||
| 4110 | Ga0495658_0013899 | |||
| 4111 | Ga0495658_0023459 | |||
| 4112 | Ga0495658_0059219 | |||
| 4113 | Ga0495658_0277342 | |||
| 4114 | Ga0495658_0318448 | |||
| 4115 | Ga0495669_0007067 | |||
| 4116 | Ga0495669_0030462 | |||
| 4117 | Ga0495669_0032428 | |||
| 4118 | Ga0495669_0102634 | |||
| 4119 | Ga0495669_0122337 | |||
| 4120 | Ga0495669_0312111 | |||
| 4121 | Ga0495613_0006401 | |||
| 4122 | Ga0495613_0012801 | |||
| 4123 | Ga0495613_0206651 | |||
| 4124 | Ga0495624_0098156 | |||
| 4125 | Ga0495624_0113806 | |||
| 4126 | Ga0495624_0200579 | |||
| 4127 | Ga0495624_0574798 | |||
| 4128 | Ga0495670_0007032 | |||
| 4129 | Ga0495670_0009786 | |||
| 4130 | Ga0495670_0011696 | |||
| 4131 | Ga0495670_0106314 | |||
| 4132 | Ga0495670_0227423 | |||
| 4133 | Ga0495670_0244567 | |||
| 4134 | Ga0495670_0262056 | |||
| 4135 | Ga0495670_0392516 | |||
| 4136 | Ga0495670_0815647 | |||
| 4137 | Ga0495671_0000001 | |||
| 4138 | Ga0495671_0019237 | |||
| 4139 | Ga0495671_0043851 | |||
| 4140 | Ga0495671_0057396 | |||
| 4141 | Ga0495671_0068086 | |||
| 4142 | Ga0495671_0128812 | |||
| 4143 | Ga0495649_0086174 | |||
| 4144 | Ga0495649_0089196 | |||
| 4145 | Ga0495649_0111267 | |||
| 4146 | Ga0495649_0136693 | |||
| 4147 | Ga0495649_0164836 | |||
| 4148 | Ga0495649_0196964 | |||
| 4149 | Ga0495649_0407926 | |||
| 4150 | Ga0495589_0005458 | |||
| 4151 | Ga0495589_0016939 | |||
| 4152 | Ga0495589_0038017 | |||
| 4153 | Ga0495589_0074369 | |||
| 4154 | Ga0495589_0075171 | |||
| 4155 | Ga0495589_0106592 | |||
| 4156 | Ga0495589_0189849 | |||
| 4157 | Ga0495589_0275352 | |||
| 4158 | Ga0495589_0448607 | |||
| 4159 | Ga0495589_0526539 | |||
| 4160 | Ga0495600_0001395 | |||
| 4161 | Ga0495600_0003020 | |||
| 4162 | Ga0495600_0009571 | |||
| 4163 | Ga0495660_0000157 | |||
| 4164 | Ga0495660_0008377 | |||
| 4165 | Ga0495660_0011707 | |||
| 4166 | Ga0495660_0019417 | |||
| 4167 | Ga0495660_0021276 | |||
| 4168 | Ga0495660_0034095 | |||
| 4169 | Ga0495660_0041115 | |||
| 4170 | Ga0495660_0144672 | |||
| 4171 | Ga0495660_0184876 | |||
| 4172 | Ga0495660_0203368 | |||
| 4173 | Ga0495581_0029270 | |||
| 4174 | Ga0495581_0061774 | |||
| 4175 | Ga0495581_0077497 | |||
| 4176 | Ga0495581_0089854 | |||
| 4177 | Ga0495581_0399830 | |||
| 4178 | Ga0495604_0013374 | |||
| 4179 | Ga0495604_0025790 | |||
| 4180 | Ga0495604_0070450 | |||
| 4181 | Ga0495604_0215863 | |||
| 4182 | Ga0495636_0013522 | |||
| 4183 | Ga0495636_0028161 | |||
| 4184 | Ga0495636_0030003 | |||
| 4185 | Ga0495636_0030241 | |||
| 4186 | Ga0495636_0190048 | |||
| 4187 | Ga0495636_0318890 | |||
| 4188 | Ga0495636_0328059 | |||
| 4189 | Ga0495636_0334901 | |||
| 4190 | Ga0495636_0581236 | |||
| 4191 | Ga0495674_0047498 | |||
| 4192 | Ga0495674_0085356 | |||
| 4193 | Ga0495674_0940357 | |||
| 4194 | Ga0495672_0000097 | |||
| 4195 | Ga0495672_0000126 | |||
| 4196 | Ga0495672_0000259 | |||
| 4197 | Ga0495672_0000302 | |||
| 4198 | Ga0495672_0014901 | |||
| 4199 | Ga0495672_0016317 | |||
| 4200 | Ga0495672_0054303 | |||
| 4201 | Ga0495672_0064756 | |||
| 4202 | Ga0495672_0127119 | |||
| 4203 | Ga0495676_0024464 | |||
| 4204 | Ga0495676_0040241 | |||
| 4205 | Ga0495676_0061436 | |||
| 4206 | Ga0495676_0116285 | |||
| 4207 | Ga0495676_0320558 | |||
| 4208 | Ga0495680_0001868 | |||
| 4209 | Ga0495680_0021668 | |||
| 4210 | Ga0495680_0192327 | |||
| 4211 | Ga0495680_0235599 | |||
| 4212 | Ga0495680_0248495 | |||
| 4213 | Ga0495683_0004993 | |||
| 4214 | Ga0495683_0008550 | |||
| 4215 | Ga0495683_0050632 | |||
| 4216 | Ga0495683_0094864 | |||
| 4217 | Ga0495683_0164529 | |||
| 4218 | Ga0495683_0324519 | |||
| 4219 | Ga0495687_000002 | |||
| 4220 | Ga0495687_000457 | |||
| 4221 | Ga0495687_000702 | |||
| 4222 | Ga0495687_000994 | |||
| 4223 | Ga0495687_006365 | |||
| 4224 | Ga0495687_008955 | |||
| 4225 | Ga0495687_010475 | |||
| 4226 | Ga0495687_014535 | |||
| 4227 | Ga0495687_066666 | |||
| 4228 | Ga0495675_0007368 | |||
| 4229 | Ga0495675_0106251 | |||
| 4230 | Ga0495675_0184835 | |||
| 4231 | Ga0495675_0236560 | |||
| 4232 | Ga0495675_0408643 | |||
| 4233 | Ga0495675_0436126 | |||
| 4234 | Ga0495677_0001656 | |||
| 4235 | Ga0495677_0004036 | |||
| 4236 | Ga0495677_0056792 | |||
| 4237 | Ga0495677_0093616 | |||
| 4238 | Ga0495677_0096683 | |||
| 4239 | Ga0495677_0116460 | |||
| 4240 | Ga0495677_0116588 | |||
| 4241 | Ga0495677_0133294 | |||
| 4242 | Ga0495677_0163324 | |||
| 4243 | Ga0495677_0171047 | |||
| 4244 | Ga0495677_0260767 | |||
| 4245 | Ga0495677_0280720 | |||
| 4246 | Ga0495679_001915 | |||
| 4247 | Ga0495679_002551 | |||
| 4248 | Ga0495679_009967 | |||
| 4249 | Ga0495679_015702 | |||
| 4250 | Ga0495679_205866 | |||
| 4251 | Ga0495685_000019 | |||
| 4252 | Ga0495685_004108 | |||
| 4253 | Ga0495685_027283 | |||
| 4254 | Ga0495685_030523 | |||
| 4255 | Ga0495685_051327 | |||
| 4256 | Ga0495685_059272 | |||
| 4257 | Ga0495673_0000097 | |||
| 4258 | Ga0495673_0000100 | |||
| 4259 | Ga0495673_0017896 | |||
| 4260 | Ga0495673_0135162 | |||
| 4261 | Ga0495673_0224214 | |||
| 4262 | Ga0495681_0040152 | |||
| 4263 | Ga0495681_0044744 | |||
| 4264 | Ga0495681_0049709 | |||
| 4265 | Ga0495681_0073885 | |||
| 4266 | Ga0495681_0126294 | |||
| 4267 | Ga0495681_0137367 | |||
| 4268 | Ga0495681_0199071 | |||
| 4269 | Ga0495681_0336725 | |||
| 4270 | Ga0495684_0098504 | |||
| 4271 | Ga0495686_0005033 | |||
| 4272 | Ga0495686_0018140 | |||
| 4273 | Ga0495686_0018201 | |||
| 4274 | Ga0495686_0064771 | |||
| 4275 | Ga0495686_0140863 | |||
| 4276 | Ga0495686_0213745 | |||
| 4277 | Ga0495686_0220372 | |||
| 4278 | Ga0495593_0026048 | |||
| 4279 | Ga0495593_0030667 | |||
| 4280 | Ga0495593_0063593 | |||
| 4281 | Ga0495593_0083801 | |||
| 4282 | Ga0495593_0087694 | |||
| 4283 | Ga0495593_0313336 | |||
| 4284 | Ga0495593_0400699 | |||
| 4285 | Ga0495602_0034817 | |||
| 4286 | Ga0495602_0146972 | |||
| 4287 | Ga0495602_0216990 | |||
| 4288 | Ga0495602_0254281 | |||
| 4289 | Ga0495602_0527923 | |||
| 4290 | Ga0495614_0133794 | |||
| 4291 | Ga0495614_0157033 | |||
| 4292 | Ga0495614_0158387 | |||
| 4293 | Ga0495614_0603571 | |||
| 4294 | Ga0495615_0008199 | |||
| 4295 | Ga0495615_0039914 | |||
| 4296 | Ga0495615_0090517 | |||
| 4297 | Ga0495615_0101707 | |||
| 4298 | Ga0495626_0000016 | |||
| 4299 | Ga0495626_0000026 | |||
| 4300 | Ga0495626_0002931 | |||
| 4301 | Ga0495626_0007918 | |||
| 4302 | Ga0495626_0009392 | |||
| 4303 | Ga0495626_0039663 | |||
| 4304 | Ga0495626_0059472 | |||
| 4305 | Ga0495626_0063508 | |||
| 4306 | Ga0495626_0328037 | |||
| 4307 | Ga0496100_0007351 | |||
| 4308 | Ga0496100_0505931 | |||
| 4309 | Ga0496100_0512356 | |||
| 4310 | Ga0496101_0021065 | |||
| 4311 | Ga0496101_0663724 | |||
| 4312 | Ga0496101_0721375 | |||
| 4313 | Ga0496101_1011655 | |||
| 4314 | Ga0496101_1264700 | |||
| 4315 | Ga0496101_1544142 | |||
| 4316 | Ga0496102_0001202 | |||
| 4317 | Ga0496102_0229748 | |||
| 4318 | Ga0496102_0273261 | |||
| 4319 | Ga0496102_0436832 | |||
| 4320 | Ga0496102_0596621 | |||
| 4321 | Ga0496102_0850748 | |||
| 4322 | Ga0496102_1406222 | |||
| 4323 | Ga0496103_0011633 | |||
| 4324 | Ga0496103_0033010 | |||
| 4325 | Ga0496103_0052491 | |||
| 4326 | Ga0496103_0223449 | |||
| 4327 | Ga0496103_0436650 | |||
| 4328 | Ga0496103_0643335 | |||
| 4329 | Ga0496104_0338190 | |||
| 4330 | Ga0496104_0470315 | |||
| 4331 | Ga0496104_0490806 | |||
| 4332 | Ga0496105_0214483 | |||
| 4333 | Ga0496105_0262170 | |||
| 4334 | Ga0496105_0424723 | |||
| 4335 | Ga0496105_0790792 | |||
| 4336 | Ga0496106_0283638 | |||
| 4337 | Ga0496106_0325348 | |||
| 4338 | Ga0496106_0663760 | |||
| 4339 | Ga0496107_0023356 | |||
| 4340 | Ga0496107_0114465 | |||
| 4341 | Ga0496107_0358940 | |||
| 4342 | Ga0496107_0424302 | |||
| 4343 | Ga0496107_0462972 | |||
| 4344 | Ga0496107_1170906 | |||
| 4345 | Ga0496108_0024232 | |||
| 4346 | Ga0496108_0448377 | |||
| 4347 | Ga0496108_0664557 | |||
| 4348 | Ga0496108_0992952 | |||
| 4349 | Ga0496109_0133179 | |||
| 4350 | Ga0496109_0984215 | |||
| 4351 | Ga0496110_0137215 | |||
| 4352 | Ga0496110_0711128 | |||
| 4353 | Ga0496111_0198780 | |||
| 4354 | Ga0496111_0373526 | |||
| 4355 | Ga0496111_0413525 | |||
| 4356 | Ga0496111_1218834 | |||
| 4357 | Ga0496112_0005841 | |||
| 4358 | Ga0496112_0164242 | |||
| 4359 | Ga0496112_0346973 | |||
| 4360 | Ga0496112_1111606 | |||
| 4361 | Ga0496113_0147492 | |||
| 4362 | Ga0496114_0106830 | |||
| 4363 | Ga0496114_0113531 | |||
| 4364 | Ga0496114_0273592 | |||
| 4365 | Ga0496114_0288596 | |||
| 4366 | Ga0496114_1053278 | |||
| 4367 | Ga0496115_0001055 | |||
| 4368 | Ga0496115_0276137 | |||
| 4369 | Ga0496115_0663026 | |||
| 4370 | Ga0496115_0665170 | |||
| 4371 | Ga0496115_0856686 | |||
| 4372 | Ga0496116_0069056 | |||
| 4373 | Ga0496116_0088689 | |||
| 4374 | Ga0496116_0121005 | |||
| 4375 | Ga0496116_0170227 | |||
| 4376 | Ga0496117_0000001 | |||
| 4377 | Ga0496117_0001602 | |||
| 4378 | Ga0496117_0030143 | |||
| 4379 | Ga0496118_0000002 | |||
| 4380 | Ga0496118_0004742 | |||
| 4381 | Ga0496118_0030437 | |||
| 4382 | Ga0496118_0485019 | |||
| 4383 | Ga0496119_0124513 | |||
| 4384 | Ga0496119_0332915 | |||
| 4385 | Ga0496120_0087336 | |||
| 4386 | Ga0496121_0000001 | |||
| 4387 | Ga0496121_0015019 | |||
| 4388 | Ga0496121_0030639 | |||
| 4389 | Ga0496121_0099689 | |||
| 4390 | Ga0496121_0186736 | |||
| 4391 | Ga0496121_0267654 | |||
| 4392 | Ga0496122_0138190 | |||
| 4393 | Ga0496122_0158809 | |||
| 4394 | Ga0496122_0202223 | |||
| 4395 | Ga0496122_0301213 | |||
| 4396 | Ga0496123_0013346 | |||
| 4397 | Ga0496123_0018581 | |||
| 4398 | Ga0496123_0264373 | |||
| 4399 | Ga0496124_0009480 | |||
| 4400 | Ga0496124_0028304 | |||
| 4401 | Ga0496124_0034796 | |||
| 4402 | Ga0496124_0127088 | |||
| 4403 | Ga0496124_0161584 | |||
| 4404 | Ga0496124_0179046 | |||
| 4405 | Ga0496124_0208501 | |||
| 4406 | Ga0496124_0311278 | |||
| 4407 | Ga0496124_0680300 | |||
| 4408 | Ga0496124_0767445 | |||
| 4409 | Ga0496125_0000001 | |||
| 4410 | Ga0496125_0014630 | |||
| 4411 | Ga0496126_0000034 | |||
| 4412 | Ga0496126_0014001 | |||
| 4413 | Ga0496126_0452947 | |||
| 4414 | Ga0496126_0510864 | |||
| 4415 | Ga0496126_0555819 | |||
| 4416 | Ga0496126_0625220 | |||
| 4417 | Ga0496126_0691004 | |||
| 4418 | Ga0466983_0814339 | |||
| 4419 | Ga0501306_023443 | |||
| 4420 | Ga0501306_094074 | |||
| 4421 | Ga0501308_000043 | |||
| 4422 | Ga0501308_004623 | |||
| 4423 | Ga0501309_002926 | |||
| 4424 | Ga0501309_010747 | |||
| 4425 | Ga0501310_000314 | |||
| 4426 | Ga0501310_023165 | |||
| 4427 | Ga0501304_000103 | |||
| 4428 | Ga0501304_010860 | |||
| 4429 | Ga0501307_004362 | |||
| 4430 | Ga0501307_009157 | |||
| 4431 | Ga0501307_013604 | |||
| 4432 | Ga0495678_000128 | |||
| 4433 | Ga0495678_004908 | |||
| 4434 | Ga0495678_009158 | |||
| 4435 | Ga0495678_017087 | |||
| 4436 | Ga0495678_022689 | |||
| 4437 | Ga0495678_025494 | |||
| 4438 | Ga0495678_067621 | |||
| 4439 | Ga0495682_0007646 | |||
| 4440 | Ga0495682_0046808 | |||
| 4441 | Ga0495682_0059187 | |||
| 4442 | Ga0495682_0315331 | |||
| 4443 | Ga0501291_052603 | |||
| 4444 | Ga0501298_097590 | |||
| 4445 | Ga0501299_014456 | |||
| 4446 | Ga0501303_009692 | |||
| 4447 | Ga0501311_001467 | |||
| 4448 | Ga0501311_005169 | |||
| 4449 | Ga0501311_104620 | |||
| 4450 | Ga0501312_015087 | |||
| 4451 | Ga0501312_107741 | |||
| 4452 | Ga0501313_006566 | |||
| 4453 | Ga0501314_013894 | |||
| 4454 | Ga0501315_003168 | |||
| 4455 | Ga0501315_008242 | |||
| 4456 | Ga0501315_018201 | |||
| 4457 | Ga0501315_058801 | |||
| 4458 | Ga0501316_002918 | |||
| 4459 | Ga0501316_003463 | |||
| 4460 | Ga0501318_007306 | |||
| 4461 | Ga0501319_021994 | |||
| 4462 | Ga0501320_010242 | |||
| 4463 | Ga0501320_019732 | |||
| 4464 | Ga0501320_021934 | |||
| 4465 | Ga0501321_007332 | |||
| 4466 | Ga0501322_001671 | |||
| 4467 | Ga0501322_017103 | |||
| 4468 | Ga0501323_002866 | |||
| 4469 | Ga0501323_013157 | |||
| 4470 | Ga0501323_043258 | |||
| 4471 | Ga0501324_004785 | |||
| 4472 | Ga0501325_017223 | |||
| 4473 | Ga0501326_02490 | |||
| 4474 | Ga0501326_09563 | |||
| 4475 | Ga0501335_006342 | |||
| 4476 | Ga0501031_0047354 | |||
| 4477 | Ga0501032_0088596 | |||
| 4478 | Ga0501033_0002051 | |||
| 4479 | Ga0501034_0005225 | |||
| 4480 | Ga0501036_0003558 | |||
| 4481 | Ga0501036_0371290 | |||
| 4482 | Ga0501036_0714024 | |||
| 4483 | Ga0501036_1385522 | |||
| 4484 | Ga0501037_0019590 | |||
| 4485 | Ga0501037_0292291 | |||
| 4486 | Ga0501038_0000564 | |||
| 4487 | Ga0501038_0758494 | |||
| 4488 | Ga0501039_0000137 | |||
| 4489 | Ga0501039_0024770 | |||
| 4490 | Ga0501039_0396181 | |||
| 4491 | Ga0501039_0861283 | |||
| 4492 | Ga0501040_0000301 | |||
| 4493 | Ga0501040_0152623 | |||
| 4494 | Ga0501040_0613662 | |||
| 4495 | Ga0501040_0638417 | |||
| 4496 | Ga0501041_0000043 | |||
| 4497 | Ga0501041_0047018 | |||
| 4498 | Ga0501041_0241653 | |||
| 4499 | Ga0501042_0000604 | |||
| 4500 | Ga0501042_0263106 | |||
| 4501 | Ga0501042_0525467 | |||
| 4502 | Ga0501042_1052716 | |||
| 4503 | Ga0501043_0425944 | |||
| 4504 | Ga0501043_1263034 | |||
| 4505 | Ga0501046_0000328 | |||
| 4506 | Ga0501046_0707038 | |||
| 4507 | Ga0501048_0001946 | |||
| 4508 | Ga0501048_0069740 | |||
| 4509 | Ga0501048_0212479 | |||
| 4510 | Ga0501048_0333054 | |||
| 4511 | Ga0501068_0008756 | |||
| 4512 | Ga0501068_0321198 | |||
| 4513 | Ga0501069_0673430 | |||
| 4514 | Ga0501069_0914522 | |||
| 4515 | Ga0501069_1004263 | |||
| 4516 | Ga0501070_0191012 | |||
| 4517 | Ga0501070_0312293 | |||
| 4518 | Ga0501070_0895039 | |||
| 4519 | Ga0501070_1360618 | |||
| 4520 | Ga0501071_0017983 | |||
| 4521 | Ga0501071_1201881 | |||
| 4522 | Ga0501072_0000555 | |||
| 4523 | Ga0501072_0002944 | |||
| 4524 | Ga0501072_0204103 | |||
| 4525 | Ga0501072_0451307 | |||
| 4526 | Ga0501073_0000117 | |||
| 4527 | Ga0501073_0630446 | |||
| 4528 | Ga0501073_0994509 | |||
| 4529 | Ga0501074_0011250 | |||
| 4530 | Ga0501074_0315689 | |||
| 4531 | Ga0501074_0493033 | |||
| 4532 | Ga0501075_0003437 | |||
| 4533 | Ga0501075_0062124 | |||
| 4534 | Ga0501076_0000284 | |||
| 4535 | Ga0501076_0218443 | |||
| 4536 | Ga0501076_1698990 | |||
| 4537 | Ga0501077_0000236 | |||
| 4538 | Ga0501077_0715745 | |||
| 4539 | Ga0501202_170050 | |||
| 4540 | Ga0501227_003010 | |||
| 4541 | Ga0501238_000630 | |||
| 4542 | Ga0501249_020941 | |||
| 4543 | Ga0501253_051963 | |||
| 4544 | Ga0501257_037433 | |||
| 4545 | Ga0501079_0005362 | |||
| 4546 | Ga0501079_0014496 | |||
| 4547 | Ga0501079_0495653 | |||
| 4548 | Ga0501080_0000743 | |||
| 4549 | Ga0501080_0267888 | |||
| 4550 | Ga0501080_0663173 | |||
| 4551 | Ga0501080_0678475 | |||
| 4552 | Ga0501080_1080765 | |||
| 4553 | Ga0501081_0000621 | |||
| 4554 | Ga0501083_0522610 | |||
| 4555 | Ga0501083_0523133 | |||
| 4556 | Ga0501241_038231 | |||
| 4557 | Ga0501269_000234 | |||
| 4558 | Ga0501279_012469 | |||
| 4559 | Ga0501279_021347 | |||
| 4560 | Ga0501280_000570 | |||
| 4561 | Ga0501035_0147039 | |||
| 4562 | Ga0501035_0216993 | |||
| 4563 | Ga0501035_0306964 | |||
| 4564 | Ga0501035_0873524 | |||
| 4565 | Ga0501035_1040808 | |||
| 4566 | Ga0501045_0018761 | |||
| 4567 | nmdc:mga03683_3602_c1 | |||
| 4568 | nmdc:mga03683_44815_c1 | |||
| 4569 | nmdc:mga03n38_46902_c1 | |||
| 4570 | nmdc:mga00v17_242948_c1 | |||
| 4571 | nmdc:mga00v17_55062_c1 | |||
| 4572 | nmdc:mga00v17_68635_c1 | |||
| 4573 | nmdc:mga0yw44_187786_c1 | |||
| 4574 | nmdc:mga0k408_1337_c1 | |||
| 4575 | nmdc:mga0k408_234616_c1 | |||
| 4576 | nmdc:mga0k408_44254_c1 | |||
| 4577 | nmdc:mga0k408_729910_c1 | |||
| 4578 | nmdc:mga06z11_27247_c1 | |||
| 4579 | nmdc:mga06z11_790959_c1 | |||
| 4580 | nmdc:mga04h51_49073_c1 | |||
| 4581 | nmdc:mga07m45_8520_c1 | |||
| 4582 | nmdc:mga05p37_114_c1 | |||
| 4583 | nmdc:mga05p37_1353913_c1 | |||
| 4584 | nmdc:mga05p37_411155_c1 | |||
| 4585 | nmdc:mga05p37_733178_c1 | |||
| 4586 | nmdc:mga09592_273648_c1 | |||
| 4587 | nmdc:mga09592_3662_c1 | |||
| 4588 | nmdc:mga0qj67_1051544_c1 | |||
| 4589 | nmdc:mga0qj67_210782_c1 | |||
| 4590 | nmdc:mga0qj67_726061_c1 | |||
| 4591 | nmdc:mga06r32_391648_c1 | |||
| 4592 | nmdc:mga06r32_97009_c1 | |||
| 4593 | nmdc:mga08y16_150766_c1 | |||
| 4594 | nmdc:mga08y16_15466_c1 | |||
| 4595 | nmdc:mga08y16_54698_c1 | |||
| 4596 | nmdc:mga08y16_54862_c1 | |||
| 4597 | nmdc:mga08y16_563594_c1 | |||
| 4598 | nmdc:mga08y16_67290_c1 | |||
| 4599 | nmdc:mga0n895_1305518_c1 | |||
| 4600 | nmdc:mga0n895_632826_c1 | |||
| 4601 | nmdc:mga0n895_9031_c1 | |||
| 4602 | nmdc:mga0n895_96963_c1 | |||
| 4603 | nmdc:mga0rr50_2846_c1 | |||
| 4604 | nmdc:mga0rr50_376197_c1 | |||
| 4605 | nmdc:mga0rr50_414384_c1 | |||
| 4606 | nmdc:mga0rr50_688253_c1 | |||
| 4607 | nmdc:mga08x19_19018_c1 | |||
| 4608 | nmdc:mga08x19_190761_c1 | |||
| 4609 | nmdc:mga08x19_2760_c1 | |||
| 4610 | nmdc:mga08x19_299758_c1 | |||
| 4611 | nmdc:mga0a205_1305498_c1 | |||
| 4612 | nmdc:mga0a205_1465299_c1 | |||
| 4613 | nmdc:mga0a205_215246_c1 | |||
| 4614 | nmdc:mga0a205_5446_c3 | |||
| 4615 | nmdc:mga0sz30_22870_c1 | |||
| 4616 | nmdc:mga0sz30_68027_c1 | |||
| 4617 | Ga0495601_0015794 | |||
| 4618 | Ga0495601_0235787 | |||
| 4619 | Ga0495601_0237000 | |||
| 4620 | Ga0495612_0148845 | |||
| 4621 | Ga0495595_0005218 | |||
| 4622 | Ga0495619_0010461 | |||
| 4623 | Ga0495619_0098728 | |||
| 4624 | Ga0500646_0027739 | |||
| 4625 | Ga0500583_0139275 | |||
| 4626 | Ga0500566_0348121 | |||
| 4627 | Ga0500566_0463779 | |||
| 4628 | Ga0500650_0126388 | |||
| 4629 | Ga0500594_0170832 | |||
| 4630 | Ga0500618_001153 | |||
| 4631 | Ga0500618_014656 | |||
| 4632 | Ga0500618_026153 | |||
| 4633 | Ga0500559_0240280 | |||
| 4634 | Ga0500559_0296255 | |||
| 4635 | Ga0500568_0173286 | |||
| 4636 | Ga0500586_051917 | |||
| 4637 | Ga0500586_104605 | |||
| 4638 | Ga0500604_0067134 | |||
| 4639 | Ga0500637_0279950 | |||
| 4640 | Ga0500637_0551044 | |||
| 4641 | Ga0500552_019037 | |||
| 4642 | Ga0501084_0013751 | |||
| 4643 | Ga0501084_0206426 | |||
| 4644 | Ga0501084_0373441 | |||
| 4645 | Ga0501084_1135141 | |||
| 4646 | Ga0590071_012073 | |||
| 4647 | Ga0590074_022298 | |||
| 4648 | Ga0590075_053262 | |||
| 4649 | Ga0587066_003481 | |||
| 4650 | Ga0587066_041096 | |||
| 4651 | Ga0587070_006668 | |||
| 4652 | Ga0587077_007430 | |||
| 4653 | Ga0587077_011691 | |||
| 4654 | Ga0587077_119379 | |||
| 4655 | Ga0587080_003759 | |||
| 4656 | Ga0587080_093142 | |||
| 4657 | Ga0587083_0025865 | |||
| 4658 | Ga0587083_0117552 | |||
| 4659 | Ga0587090_019409 | |||
| 4660 | Ga0587091_049512 | |||
| 4661 | Ga0587098_010079 | |||
| 4662 | Ga0587106_033341 | |||
| 4663 | Ga0587125_050587 | |||
| 4664 | Ga0587109_123270 | |||
| 4665 | Ga0587067_006206 | |||
| 4666 | Ga0587068_000149 | |||
| 4667 | Ga0587068_069828 | |||
| 4668 | Ga0587072_038719 | |||
| 4669 | Ga0587075_054888 | |||
| 4670 | Ga0587076_002189 | |||
| 4671 | Ga0587079_001531 | |||
| 4672 | Ga0587102_000546 | |||
| 4673 | Ga0587105_000829 | |||
| 4674 | Ga0587107_053588 | |||
| 4675 | Ga0587124_036669 | |||
| 4676 | Ga0587071_012908 | |||
| 4677 | Ga0587111_0052221 | |||
| 4678 | Ga0587111_0154241 | |||
| 4679 | Ga0501082_0001199 | |||
| 4680 | Ga0501082_1852334 | |||
| 4681 | Ga0466962_0059050 | |||
| 4682 | Ga0466962_0069487 | |||
| 4683 | Ga0530510_0000177 | |||
| 4684 | Ga0530510_1152037 | |||
| 4685 | 2511250887 | |||
| 4686 | 2513953027 | |||
| 4687 | 2514043870 | |||
| 4688 | 2526211213 | |||
| 4689 | 2550692653 | |||
| 4690 | 2599738353 | |||
| 4691 | 2599746475 | |||
| 4692 | 2600208381 | |||
| 4693 | 2601667525 | |||
| 4694 | 2643787150 | |||
| 4695 | 2643802178 | |||
| 4696 | 2644215763 | |||
| 4697 | 2644254240 | |||
| 4698 | 2644358095 | |||
| 4699 | 2644475687 | |||
| 4700 | 2676745341 | |||
| 4701 | 2723877067 | |||
| 4702 | 2738741059 | |||
| 4703 | 2738845518 | |||
| 4704 | 2739276573 | |||
| 4705 | 2739345617 | |||
| 4706 | 2808971981 | |||
| 4707 | 2808981618 | |||
| 4708 | 2809006810 | |||
| 4709 | 2809013948 | |||
| 4710 | 2809129201 | |||
| 4711 | 2809145243 | |||
| 4712 | 2809148821 | |||
| 4713 | 2819591584 | |||
| 4714 | 2819633520 | |||
| 4715 | 2842714226 | |||
| 4716 | 2852621359 | |||
| 4717 | 2857551753 | |||
| 4718 | 2857554307 | |||
| 4719 | 2857559916 | |||
| 4720 | 2857578614 | |||
| 4721 | 2863425695 | |||
| 4722 | 2870070704 | |||
| 4723 | 2884812849 | |||
| 4724 | 2884837394 | |||
| 4725 | 2884853685 | |||
| 4726 | 2885085589 | |||
| 4727 | 2896155198 | |||
| 4728 | 2904426204 | |||
| 4729 | 2904483438 | |||
| 4730 | 2904569900 | |||
| 4731 | 2904577080 | |||
| 4732 | 2919478573 | |||
| 4733 | 2928161639 | |||
| 4734 | 2928168467 | |||
| 4735 | 2928174806 | |||
| 4736 | 2928542470 | |||
| 4737 | 2932411136 | |||
| 4738 | 2932419297 | |||
| 4739 | 2981993627 | |||
| 4740 | 642415144 | |||
| 4741 | 644747359 | |||
| 4742 | 8018850889 | |||
| 4743 | 8020940982 | |||
| 4744 | 8020952343 | |||
| 4745 | 8020958404 | |||
| 4746 | 8021125189 | |||
| 4747 | 8039103490 | |||
| 4748 | 8047673970 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8e73-assembly1.cif.gz_4L | vigna radiata supercomplex i+iii2 (full bridge) | 0.8784 | 4 | 96 |
| 7a24-assembly1.cif.gz_K | assembly intermediate of the plant mitochondrial complex i | 0.8781 | 4 | 86 |
| 7zmh-assembly1.cif.gz_L | cryoem structure of mitochondrial complex i from chaetomium thermophilum (state 1) - membrane arm | 0.8777 | 10 | 94 |
| 6x89-assembly1.cif.gz_4L | vigna radiata mitochondrial complex i* | 0.8701 | 4 | 86 |
| 7ar7-assembly1.cif.gz_K | cryo-em structure of arabidopsis thaliana complex-i (open conformation) | 0.8609 | 4 | 88 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A3B6U9Q8_4_99_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9087 | 7 | 94 | 1.10.287.3510 |
| af_A0A2P2CLH7_4_99_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8991 | 7 | 94 | 1.10.287.3510 |
| af_Q6R9N1_4_99_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8825 | 7 | 96 | 1.10.287.3510 |
| af_P18934_2_96_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8579 | 4 | 97 | 1.10.287.3510 |
| af_P34651_608_792_1.20.120.1900 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Gamma-tubulin complex, C-terminal domain | 0.8491 | 35 | 80 | 1.20.120.1900 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A368F7W0-F1-model_v4 | NADH-ubiquinone oxidoreductase chain 4L (NADH dehydrogenase subunit 4L) (NADH dehydrogenase subunit 5) (NADH-ubiquinone oxidoreductase chain 5) | 0.9476 | 9 | 89 |
GO:0003954
GO:0008137 GO:0015990 GO:0016020 GO:0042773 |
| AF-A0A349TCF6-F1-model_v4 | NADH-quinone oxidoreductase subunit NuoK | 0.9402 | 1 | 62 |
GO:0016651
GO:0030964 GO:0042773 |
| AF-A0A367IZW3-F1-model_v4 | NADH dehydrogenase subunit 4 | 0.939 | 4 | 93 |
GO:0003954
GO:0008137 GO:0015990 GO:0016020 GO:0042773 GO:0048039 |
| AF-A0A2E2YBK6-F1-model_v4 | NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) | 0.931 | 1 | 87 |
GO:0005886
GO:0030964 GO:0042773 GO:0048038 GO:0050136 |
| AF-Q6U7Y2-F1-model_v4 | NADH-ubiquinone oxidoreductase chain 4L (EC 7.1.1.2) (NADH dehydrogenase subunit 4L) | 0.9279 | 10 | 86 |
GO:0005743
GO:0008137 GO:0030964 GO:0042773 |