F496763

General Info

Members Datasets Scaffolds Average Seq Length
2385 948 1956 358

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0000202|Ga0495650_0000202_117090_118187
Length 355
Sequence VNPSTDDLRIRAITPLSAPAEVMRDCAASVHAVHTVLAGEDDRLAVVIGPCSIHDTRAALEYAGRLAAQRKQHAGELEIVMRVYFEKPRTTVGWKGLINDPGLDGSFRIDQGLRLARGLLRDINELGVPAGCEFLDMITPQYIADLVAWGAIGARTTESQVHRELASGLSCPVGFKNGTDGNVKIAVDAVNAASQPHHFMAVTKDGHTAIAATTGNEDCHLILRGGKTPNYDAASVDAACIAIAKGGQLPRVMIDASHANSDKRPENQPRVIDDIAAQLSAGEQRIVGVMVESHLVGGRQDLVEGQSLRYGQSITDGCIDWETSLQVLDRLAEAVRARRVARTAAQRTARTGCLG

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
5 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
6 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
7 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
8 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
9 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
10 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
11 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
12 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
13 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
14 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
15 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
16 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
17 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
18 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
19 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
20 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
21 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
22 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
23 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
24 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
25 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
26 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
27 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
28 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
29 2519103095 Burkholderia sp. KJ006 Isolate Nodule
30 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
31 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
32 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
33 2547132374 Acidovorax radicis N35 Isolate Unclassified
34 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
35 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
36 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
37 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
38 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
39 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
40 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
41 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
42 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
43 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
44 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
45 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
46 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
47 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
48 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
49 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
50 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
51 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
52 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
53 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
54 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
55 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
56 2643221556 Massilia sp. Root1485 Isolate Unclassified
57 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
58 2643221569 Achromobacter sp. Root565 Isolate Unclassified
59 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
60 2643221583 Caulobacter sp. Root655 Isolate Unclassified
61 2643221584 Caulobacter sp. Root656 Isolate Unclassified
62 2643221594 Achromobacter sp. Root170 Isolate Unclassified
63 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
64 2643221599 Rhizobium sp. Root708 Isolate Unclassified
65 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
66 2643221621 Achromobacter sp. Root83 Isolate Unclassified
67 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
68 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
69 2643221645 Massilia sp. Root351 Isolate Unclassified
70 2643221664 Massilia sp. Root418 Isolate Unclassified
71 2643221684 Massilia sp. Root133 Isolate Unclassified
72 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
73 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
74 2643221717 Acidovorax sp. Root267 Isolate Unclassified
75 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
76 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
77 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
78 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
79 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
80 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
81 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
82 2721755523 Delftia sp. HK171 Isolate Unclassified
83 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
84 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
85 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
86 2738541280 Massilia sp. GV090 Isolate Unclassified
87 2738541293 Rhizobium sp. GV031 Isolate Unclassified
88 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
89 2738541297 Duganella sp. GV083 Isolate Unclassified
90 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
91 2738541300 Massilia sp. GV016 Isolate Unclassified
92 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
93 2738541357 Duganella sp. GV053 Isolate Unclassified
94 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
95 2738543003 Duganella sp. GV066 Isolate Unclassified
96 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
97 2738543018 Massilia sp. GV045 Isolate Unclassified
98 2738543026 Duganella sp. GV089 Isolate Unclassified
99 2738543029 Duganella sp. GV039 Isolate Unclassified
100 2738543030 Massilia sp. GV097 Isolate Unclassified
101 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
102 2739367700 Dyella sp. YR388 Isolate Unclassified
103 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
104 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
105 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
106 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
107 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
108 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
109 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
110 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
111 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
112 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
113 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
114 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
115 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
116 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
117 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
118 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
119 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
120 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
121 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
122 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
123 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
124 2818991435 Caulobacter henricii 536 Isolate Unclassified
125 2818991436 Collimonas arenae 515 Isolate Unclassified
126 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
127 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
128 2818991450 Burkholderia sp. 604 Isolate Unclassified
129 2818991452 Burkholderia cepacia 561 Isolate Unclassified
130 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
131 2821131069 Duganella sp. 1224 Isolate Unclassified
132 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
133 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
134 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
135 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
136 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
137 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
138 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
139 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
140 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
141 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
142 2849560528 Caulobacter zeae 410 Isolate Unclassified
143 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
144 2851153111 Caulobacter radicis 736 Isolate Unclassified
145 2855730933 Achromobacter sp. HZ28 Isolate Nodule
146 2855767633 Achromobacter sp. HZ34 Isolate Nodule
147 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
148 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
149 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
150 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
151 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
152 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
153 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
154 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
155 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
156 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
157 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
158 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
159 2857553236 Duganella sp. R-74557 Isolate Unclassified
160 2857558681 Duganella sp. R-74565 Isolate Unclassified
161 2857564685 Duganella sp. R-74599 Isolate Unclassified
162 2858950400 Achromobacter sp. K91 Isolate Unclassified
163 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
164 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
165 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
166 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
167 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
168 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
169 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
170 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
171 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
172 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
173 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
174 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
175 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
176 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
177 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
178 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
179 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
180 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
181 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
182 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
183 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
184 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
185 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
186 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
187 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
188 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
189 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
190 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
191 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
192 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
193 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
194 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
195 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
196 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
197 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
198 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
199 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
200 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
201 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
202 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
203 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
204 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
205 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
206 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
207 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
208 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
209 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
210 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
211 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
212 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
213 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
214 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
215 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
216 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
217 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
218 2884411467 Dyella sp. AD56 Isolate Rhizosphere
219 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
220 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
221 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
222 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
223 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
224 2885266251 Ralstonia sp. SET104 Isolate Nodule
225 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
226 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
227 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
228 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
229 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
230 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
231 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
232 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
233 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
234 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
235 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
236 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
237 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
238 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
239 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
240 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
241 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
242 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
243 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
244 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
245 2904424332 Duganella sp. 1411 Isolate Rhizosphere
246 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
247 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
248 2904564687 Burkholderia sp. 571 Isolate Unclassified
249 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
250 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
251 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
252 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
253 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
254 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
255 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
256 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
257 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
258 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
259 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
260 2909042592 Labrys sp. LIt4 Isolate Nodule
261 2919476304 Duganella sp. 3397 Isolate Unclassified
262 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
263 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
264 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
265 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
266 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
267 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
268 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
269 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
270 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
271 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
272 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
273 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
274 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
275 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
276 2928058823 Ralstonia sp. 1138 Isolate Unclassified
277 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
278 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
279 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
280 2928163908 Burkholderia sp. 567 Isolate Unclassified
281 2928170801 Burkholderia sp. 572 Isolate Unclassified
282 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
283 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
284 2928536128 Burkholderia sola 565 Isolate Unclassified
285 2928963466 Dyella japonica 1073 Isolate Unclassified
286 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
287 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
288 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
289 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
290 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
291 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
292 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
293 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
294 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
295 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
296 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
297 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
298 2941479691
299 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
300 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
301 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
302 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
303 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
304 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
305 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
306 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
307 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
308 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
309 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
310 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
311 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
312 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
313 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
314 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
315 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
316 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
317 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
318 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
319 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
320 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
321 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
322 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
323 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
324 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
325 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
326 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
327 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
328 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
329 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
330 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
331 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
332 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
333 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
334 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
335 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
336 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
337 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
338 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
339 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
340 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
341 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
342 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
343 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
344 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
345 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
346 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
347 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
348 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
349 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
350 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
351 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
352 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
353 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
354 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
355 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
356 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
357 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
358 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
359 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
360 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
361 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
362 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
363 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
364 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
365 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
366 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
367 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
368 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
369 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
370 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
371 3004167301 Mesorhizobium loti 582 Isolate Unclassified
372 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
373 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
374 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
375 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
376 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
377 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
378 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
379 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
380 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
381 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
382 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
383 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
384 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
385 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
386 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
387 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
388 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
389 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
390 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
391 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
392 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
393 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
394 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
395 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
396 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
397 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
398 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
399 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
400 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
401 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
402 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
403 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
404 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
405 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
407 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
408 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
409 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
410 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
411 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
412 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
413 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
414 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
415 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
416 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
417 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
418 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
419 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
420 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
421 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
422 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
423 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
424 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
425 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
426 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
427 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
428 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
429 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
430 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
431 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
432 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
433 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
434 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
435 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
436 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
437 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
438 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
439 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
440 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
441 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
442 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
443 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
444 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
445 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
446 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
447 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
448 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
449 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
450 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
451 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
452 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
453 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
454 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
455 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
456 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
457 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
458 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
459 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
460 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
461 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
462 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
463 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
464 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
465 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
466 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
467 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
468 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
469 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
470 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
471 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
472 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
473 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
474 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
475 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
476 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
477 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
478 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
479 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
480 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
481 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
482 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
483 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
484 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
485 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
486 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
487 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
488 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
489 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
490 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
491 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
492 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
493 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
494 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
495 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
496 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
497 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
498 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
499 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
500 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
501 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
502 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
503 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
504 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
505 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
506 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
507 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
508 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
509 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
510 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
511 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
512 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
513 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
514 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
515 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
516 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
517 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
518 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
519 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
520 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
521 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
522 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
523 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
524 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
525 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
526 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
527 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
528 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
529 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
530 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
531 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
532 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
533 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
534 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
535 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
536 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
537 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
538 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
539 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
540 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
541 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
542 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
543 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
544 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
545 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
546 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
547 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
548 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
549 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
550 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
551 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
552 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
553 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
554 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
555 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
556 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
557 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
558 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
559 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
560 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
561 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
562 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
563 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
564 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
565 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
566 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
567 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
568 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
569 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
570 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
571 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
572 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
573 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
574 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
575 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
576 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
577 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
578 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
579 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
580 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
581 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
582 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
583 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
584 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
585 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
586 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
587 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
588 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
589 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
590 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
591 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
592 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
593 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
594 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
595 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
596 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
597 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
598 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
599 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
600 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
601 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
602 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
603 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
604 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
605 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
606 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
607 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
608 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
609 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
610 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
611 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
612 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
613 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
614 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
615 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
616 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
617 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
618 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
619 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
620 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
621 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
622 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
623 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
624 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
625 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
626 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
627 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
628 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
629 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
630 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
631 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
632 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
633 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
634 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
635 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
636 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
637 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
638 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
639 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
640 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
641 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
642 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
643 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
644 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
645 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
646 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
647 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
648 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
649 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
650 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
651 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
652 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
653 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
654 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
655 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
656 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
657 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
658 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
659 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
660 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
661 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
662 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
663 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
664 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
665 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
666 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
667 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
668 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
669 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
670 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
671 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
672 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
673 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
674 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
675 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
676 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
677 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
678 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
679 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
680 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
681 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
682 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
683 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
684 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
685 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
686 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
687 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
688 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
689 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
690 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
691 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
692 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
693 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
694 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
695 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
696 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
697 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
698 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
699 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
700 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
701 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
702 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
703 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
704 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
705 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
706 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
707 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
708 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
709 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
710 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
711 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
712 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
713 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
714 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
715 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
716 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
717 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
718 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
719 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
720 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
721 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
722 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
723 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
724 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
725 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
726 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
727 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
728 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
729 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
730 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
731 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
732 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
733 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
734 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
735 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
736 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
737 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
738 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
739 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
740 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
741 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
742 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
743 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
744 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
745 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
746 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
747 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
748 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
749 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
750 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
751 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
752 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
753 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
754 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
755 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
756 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
757 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
758 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
759 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
760 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
761 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
762 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
763 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
764 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
765 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
766 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
767 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
768 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
769 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
770 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
771 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
772 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
773 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
774 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
775 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
776 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
777 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
778 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
779 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
780 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
781 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
782 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
783 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
784 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
785 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
786 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
787 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
788 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
789 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
790 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
791 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
792 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
793 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
794 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
795 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
796 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
797 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
798 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
799 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
800 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
801 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
802 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
803 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
804 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
805 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
806 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
807 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
808 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
809 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
810 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
811 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
812 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
813 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
814 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
815 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
816 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
817 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
818 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
819 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
820 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
821 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
822 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
823 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
824 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
825 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
826 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
827 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
828 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
829 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
830 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
831 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
832 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
833 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
834 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
835 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
836 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
837 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
838 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
839 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
840 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
841 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
842 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
843 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
844 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
845 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
846 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
847 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
848 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
849 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
850 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
851 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
852 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
853 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
854 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
855 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
856 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
857 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
858 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
859 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
860 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
861 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
862 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
863 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
864 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
865 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
866 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
867 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
868 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
869 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
870 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
871 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
872 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
873 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
874 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
875 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
876 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
877 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
878 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
879 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
880 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
881 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
882 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
883 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
884 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
885 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
886 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
887 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
888 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
889 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
890 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
891 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
892 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
893 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
894 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
895 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
896 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
897 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
898 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
899 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
900 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
901 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
902 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
903 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
904 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
905 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
906 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
907 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
908 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
909 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
910 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
911 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
912 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
913 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
914 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
915 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
916 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
917 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
918 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
919 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
920 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
921 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
922 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
923 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
924 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
925 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
926 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
927 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
928 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
929 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
930 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
931 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
932 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
933 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
934 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
935 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
936 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
937 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
938 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
939 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
940 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
941 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
942 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
943 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
944 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
945 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
946 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
947 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
948 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.72
Metatranscriptomes 0.29
Isolates 17.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.17
Nodule 9.48
Rhizoplane 2.47
Rhizosphere 62.1
Stem 0
Stem Tuber 0
Unclassified 11.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1008787 3300001904 Bacteria 1675
2 JGI24741J21665_1001384 3300001915 Bacteria 6976
3 JGI24740J21852_10000383 3300001979 Bacteria 18927
4 JGI24740J21852_10002698 3300001979 Bacteria 7968
5 JGI24740J21852_10009194 3300001979 Bacteria 3885
6 JGI24740J21852_10018412 3300001979 Bacteria 2477
7 JGI24739J22299_10000112 3300001989 Bacteria 25198
8 JGI24737J22298_10004508 3300001990 Bacteria 4848
9 JGI24737J22298_10012640 3300001990 Bacteria 2751
10 JGI24735J21928_10001297 3300002067 Bacteria 8864
11 JGI24735J21928_10002662 3300002067 Bacteria 6177
12 JGI24735J21928_10005255 3300002067 Bacteria 4302
13 JGI24738J21930_10001513 3300002075 Bacteria 6436
14 JGI25156J39149_1000088 3300002705 Bacteria 68470
15 JGI25156J39149_1000170 3300002705 Bacteria 47634
16 JGI25156J39149_1000214 3300002705 Bacteria 40310
17 JGI25156J39149_1000504 3300002705 Bacteria 22869
18 JGI25156J39149_1001469 3300002705 Bacteria 9906
19 JGI25156J39149_1003017 3300002705 Bacteria 5710
20 JGI25162J39368_1000026 3300002737 Bacteria 227710
21 JGI25162J39368_1000027 3300002737 Bacteria 223163
22 JGI25162J39368_1000138 3300002737 Bacteria 78713
23 JGI25162J39368_1000443 3300002737 Bacteria 32916
24 JGI25162J39368_1001136 3300002737 Bacteria 16004
25 JGI25154J39366_1000351 3300002738 Bacteria 26227
26 JGI25154J39366_1000415 3300002738 Bacteria 22969
27 JGI25154J39366_1000934 3300002738 Bacteria 12193
28 JGI25154J39366_1001101 3300002738 Bacteria 10545
29 JGI25154J39366_1001281 3300002738 Bacteria 9371
30 JGI25158J39367_1002014 3300002739 Bacteria 3417
31 JGI25157J39369_1000116 3300002741 Bacteria 68339
32 JGI25157J39369_1000170 3300002741 Bacteria 54809
33 JGI25157J39369_1000253 3300002741 Bacteria 39977
34 JGI25157J39369_1000586 3300002741 Bacteria 21510
35 JGI25157J39369_1001059 3300002741 Bacteria 12472
36 JGI25164J39214_1000170 3300002772 Bacteria 60952
37 JGI25164J39214_1000310 3300002772 Bacteria 32075
38 JGI25152J39213_1000264 3300002773 Bacteria 35056
39 JGI25152J39213_1001636 3300002773 Bacteria 9344
40 JGI25150J39212_1000664 3300002774 Bacteria 12684
41 JGI25150J39212_1002302 3300002774 Bacteria 4817
42 JGI25150J39212_1002952 3300002774 Bacteria 4102
43 JGI25159J45721_1001644 3300002987 Bacteria 9087
44 JGI25159J45721_1002080 3300002987 Bacteria 7889
45 JGI25159J45721_1003979 3300002987 Bacteria 5034
46 JGI25151J46595_10000316 3300003187 Bacteria 52522
47 JGI25151J46595_10000426 3300003187 Bacteria 42122
48 JGI25151J46595_10003113 3300003187 Bacteria 9344
49 JGI25151J46595_10005216 3300003187 Bacteria 6740
50 JGI25165J46597_1000031 3300003214 Bacteria 296858
51 JGI25165J46597_1000224 3300003214 Bacteria 78713
52 JGI25165J46597_1000580 3300003214 Bacteria 32075
53 JGI25165J46597_1001003 3300003214 Bacteria 18718
54 JGI25153J46596_10003120 3300003215 Bacteria 9344
55 JGI25153J46596_10012158 3300003215 Bacteria 3740
56 JGI25153J46596_10041786 3300003215 Bacteria 1406
57 JGI25160J50197_1000171 3300003354 Bacteria 55915
58 JGI25160J50197_1000998 3300003354 Bacteria 14667
59 JGI25161J50226_1002233 3300003374 Bacteria 5105
60 JGI25161J50226_1002267 3300003374 Bacteria 5034
61 Ga0007409J51694_1027127 3300003575 Bacteria 4390
62 Ga0006562J51391_1056992 3300003578 Bacteria 2993
63 Ga0006562J51391_1077234 3300003578 Bacteria 3550
64 Ga0006562J51391_1077235 3300003578 Bacteria 3204
65 Ga0032354_1049916 3300003693 Bacteria 4916
66 Ga0055538_1000013 3300003751 Bacteria 348596
67 Ga0055538_1000018 3300003751 Bacteria 296858
68 Ga0055538_1003777 3300003751 Bacteria 1839
69 Ga0055539_1000018 3300003752 Bacteria 348596
70 Ga0055539_1000023 3300003752 Bacteria 296858
71 Ga0055539_1000097 3300003752 Bacteria 100955
72 Ga0055539_1001714 3300003752 Bacteria 3862
73 Ga0055533_1000022 3300003756 Bacteria 348596
74 Ga0055533_1000031 3300003756 Bacteria 296858
75 Ga0055533_1000345 3300003756 Bacteria 20323
76 Ga0055533_1000743 3300003756 Bacteria 10479
77 Ga0055533_1001543 3300003756 Bacteria 6000
78 Ga0055533_1005313 3300003756 Bacteria 2092
79 Ga0055532_1000001 3300003758 Bacteria 1119836
80 Ga0055532_1000008 3300003758 Bacteria 404753
81 Ga0055532_1000017 3300003758 Bacteria 306880
82 Ga0055525_1000006 3300003759 Bacteria 642912
83 Ga0055525_1000024 3300003759 Bacteria 348596
84 Ga0055525_1000039 3300003759 Bacteria 296858
85 Ga0055525_1000192 3300003759 Bacteria 72944
86 Ga0055525_1000377 3300003759 Bacteria 29259
87 Ga0055527_1000014 3300003760 Bacteria 289449
88 Ga0055527_1000041 3300003760 Bacteria 116981
89 Ga0055527_1000234 3300003760 Bacteria 34826
90 Ga0055527_1002108 3300003760 Bacteria 3552
91 Ga0055535_1000001 3300003761 Bacteria 1119836
92 Ga0055535_1000006 3300003761 Bacteria 404753
93 Ga0055535_1000193 3300003761 Bacteria 64634
94 Ga0055535_1000216 3300003761 Bacteria 60912
95 Ga0055535_1000457 3300003761 Bacteria 37713
96 Ga0055535_1000502 3300003761 Bacteria 34740
97 Ga0055535_1001000 3300003761 Bacteria 18231
98 Ga0055542_1000001 3300003762 Bacteria 1119836
99 Ga0055542_1000136 3300003762 Bacteria 93218
100 Ga0055542_1000152 3300003762 Bacteria 87561
101 Ga0055542_1000179 3300003762 Bacteria 78713
102 Ga0055542_1000183 3300003762 Bacteria 77794
103 Ga0055542_1000496 3300003762 Bacteria 36150
104 Ga0055542_1000520 3300003762 Bacteria 34740
105 Ga0055542_1001263 3300003762 Bacteria 13787
106 Ga0055542_1001356 3300003762 Bacteria 12612
107 Ga0055529_1000001 3300003763 Bacteria 826680
108 Ga0055529_1000025 3300003763 Bacteria 304757
109 Ga0055529_1000116 3300003763 Bacteria 117929
110 Ga0055529_1000189 3300003763 Bacteria 84123
111 Ga0055529_1000246 3300003763 Bacteria 66899
112 Ga0055529_1000254 3300003763 Bacteria 64036
113 Ga0055529_1000675 3300003763 Bacteria 23666
114 Ga0055529_1001711 3300003763 Bacteria 5617
115 Ga0055526_1000174 3300003771 Bacteria 57076
116 Ga0055526_1000446 3300003771 Bacteria 32840
117 Ga0055526_1003458 3300003771 Bacteria 10018
118 Ga0055526_1005757 3300003771 Bacteria 6990
119 Ga0055526_1006720 3300003771 Bacteria 6163
120 Ga0055526_1010012 3300003771 Bacteria 4472
121 Ga0055526_1011333 3300003771 Bacteria 4028
122 Ga0055526_1011446 3300003771 Bacteria 3992
123 Ga0055526_1019970 3300003771 Bacteria 2411
124 Ga0055537_1000131 3300003773 Bacteria 57003
125 Ga0055537_1001783 3300003773 Bacteria 7847
126 Ga0055524_1000076 3300003775 Bacteria 121769
127 Ga0055524_1002142 3300003775 Bacteria 10386
128 Ga0055524_1006457 3300003775 Bacteria 5083
129 Ga0055524_1007893 3300003775 Bacteria 4472
130 Ga0055524_1008866 3300003775 Bacteria 4141
131 Ga0055524_1018349 3300003775 Bacteria 2433
132 Ga0055536_1000130 3300003781 Bacteria 64676
133 Ga0055536_1003608 3300003781 Bacteria 8263
134 Ga0055536_1003817 3300003781 Bacteria 7936
135 Ga0055534_1000076 3300003784 Bacteria 76452
136 Ga0055534_1000214 3300003784 Bacteria 42830
137 Ga0055534_1001221 3300003784 Bacteria 10762
138 Ga0055534_1001738 3300003784 Bacteria 8221
139 Ga0055528_1000288 3300003790 Bacteria 43118
140 Ga0055528_1001135 3300003790 Bacteria 17377
141 Ga0055528_1006318 3300003790 Bacteria 5389
142 Ga0055530_10003587 3300003791 Bacteria 8718
143 Ga0055530_10011871 3300003791 Bacteria 3087
144 Ga0055530_10019201 3300003791 Bacteria 2077
145 Ga0055531_10000871 3300003794 Bacteria 24738
146 Ga0055531_10004874 3300003794 Bacteria 7997
147 Ga0055541_1000013 3300003841 Bacteria 348596
148 Ga0055541_1000016 3300003841 Bacteria 296861
149 Ga0055543_1000300 3300004625 Bacteria 35207
150 Ga0065165_1000003 3300005262 Bacteria 390701
151 Ga0065165_1000643 3300005262 Bacteria 50544
152 Ga0065165_1000790 3300005262 Bacteria 42379
153 Ga0065165_1001333 3300005262 Bacteria 27419
154 Ga0065165_1001400 3300005262 Bacteria 26315
155 Ga0065712_10000440 3300005290 Bacteria 13842
156 Ga0065712_10112393 3300005290 Bacteria 1801
157 Ga0065715_10003605 3300005293 Bacteria 3928
158 Ga0065707_10000712 3300005295 Bacteria 14668
159 Ga0065707_10093577 3300005295 Bacteria 3608
160 Ga0070658_10009631 3300005327 Bacteria 7756
161 Ga0070658_10062666 3300005327 Bacteria 3030
162 Ga0070658_10112139 3300005327 Bacteria 2260
163 Ga0070658_10153966 3300005327 Bacteria 1926
164 Ga0070683_100055113 3300005329 Bacteria 3688
165 Ga0070683_100171159 3300005329 Bacteria 2062
166 Ga0070690_100021139 3300005330 Bacteria 3971
167 Ga0070690_100133735 3300005330 Bacteria 1677
168 Ga0070670_100002016 3300005331 Bacteria 16607
169 Ga0070670_100014611 3300005331 Bacteria 6739
170 Ga0070670_100039584 3300005331 Bacteria 4053
171 Ga0070670_100058743 3300005331 Bacteria 3302
172 Ga0070677_10019464 3300005333 Bacteria 2459
173 Ga0068869_100061622 3300005334 Bacteria 2752
174 Ga0070666_10001769 3300005335 Bacteria 13169
175 Ga0070666_10139324 3300005335 Bacteria 1689
176 Ga0070666_10143901 3300005335 Bacteria 1661
177 Ga0070680_100031008 3300005336 Bacteria 4296
178 Ga0070680_100086077 3300005336 Bacteria 2597
179 Ga0070680_100108713 3300005336 Bacteria 2307
180 Ga0070680_100194710 3300005336 Bacteria 1708
181 Ga0070682_100000901 3300005337 Bacteria 17351
182 Ga0070682_100005988 3300005337 Bacteria 6807
183 Ga0070682_100042485 3300005337 Bacteria 2806
184 Ga0070682_100128597 3300005337 Bacteria 1711
185 Ga0068868_100009956 3300005338 Bacteria 6867
186 Ga0070660_100000032 3300005339 Bacteria 85304
187 Ga0070660_100001473 3300005339 Bacteria 16113
188 Ga0070660_100013616 3300005339 Bacteria 5843
189 Ga0070660_100062005 3300005339 Bacteria 2904
190 Ga0070660_100081645 3300005339 Bacteria 2538
191 Ga0070660_100198144 3300005339 Bacteria 1628
192 Ga0070660_100211791 3300005339 Bacteria 1573
193 Ga0070689_100000337 3300005340 Bacteria 27384
194 Ga0070689_100001668 3300005340 Bacteria 14172
195 Ga0070689_100187713 3300005340 Bacteria 1682
196 Ga0070691_10006100 3300005341 Bacteria 5500
197 Ga0070661_100000408 3300005344 Bacteria 33248
198 Ga0070661_100001171 3300005344 Bacteria 18507
199 Ga0070661_100014741 3300005344 Bacteria 5512
200 Ga0070661_100017191 3300005344 Bacteria 5127
201 Ga0070661_100051218 3300005344 Bacteria 3021
202 Ga0070661_100134901 3300005344 Bacteria 1856
203 Ga0070668_100000034 3300005347 Bacteria 82494
204 Ga0070668_100008505 3300005347 Bacteria 7625
205 Ga0070668_100097604 3300005347 Bacteria 2324
206 Ga0070668_100309516 3300005347 Bacteria 1327
207 Ga0070669_100229284 3300005353 Bacteria 1471
208 Ga0070675_100000590 3300005354 Bacteria 24895
209 Ga0070675_100018162 3300005354 Bacteria 5597
210 Ga0070675_100339404 3300005354 Bacteria 1330
211 Ga0070671_100000118 3300005355 Bacteria 51419
212 Ga0070671_100018068 3300005355 Bacteria 5722
213 Ga0070671_100166590 3300005355 Bacteria 1863
214 Ga0070674_100200360 3300005356 Bacteria 1541
215 Ga0070673_100080420 3300005364 Bacteria 2640
216 Ga0070673_100087675 3300005364 Bacteria 2537
217 Ga0070673_100162626 3300005364 Bacteria 1899
218 Ga0070673_100162804 3300005364 Bacteria 1898
219 Ga0070659_100000035 3300005366 Bacteria 115022
220 Ga0070659_100000288 3300005366 Bacteria 39378
221 Ga0070659_100010887 3300005366 Bacteria 6708
222 Ga0070659_100054988 3300005366 Bacteria 3136
223 Ga0070667_100004868 3300005367 Bacteria 11250
224 Ga0070667_100020903 3300005367 Bacteria 5437
225 Ga0070667_100036940 3300005367 Bacteria 4096
226 Ga0070667_100093296 3300005367 Bacteria 2592
227 Ga0070714_100000030 3300005435 Bacteria 136610
228 Ga0070701_10130213 3300005438 Bacteria 1428
229 Ga0070705_100022249 3300005440 Bacteria 3386
230 Ga0070705_100080496 3300005440 Bacteria 1999
231 Ga0070700_100041701 3300005441 Bacteria 2815
232 Ga0070700_100128236 3300005441 Bacteria 1708
233 Ga0070694_100005250 3300005444 Bacteria 7828
234 Ga0070708_100135204 3300005445 Bacteria 2283
235 Ga0070663_100000014 3300005455 Bacteria 134657
236 Ga0070663_100000222 3300005455 Bacteria 28738
237 Ga0070663_100009958 3300005455 Bacteria 5909
238 Ga0070663_100039065 3300005455 Bacteria 3315
239 Ga0070663_100044054 3300005455 Bacteria 3143
240 Ga0070663_100070431 3300005455 Bacteria 2543
241 Ga0070678_100132688 3300005456 Bacteria 1981
242 Ga0070662_100003378 3300005457 Bacteria 9946
243 Ga0070681_10006343 3300005458 Bacteria 11502
244 Ga0070681_10011800 3300005458 Bacteria 8662
245 Ga0070681_10015907 3300005458 Bacteria 7501
246 Ga0070681_10038251 3300005458 Bacteria 4810
247 Ga0070681_10076885 3300005458 Bacteria 3296
248 Ga0068867_100000827 3300005459 Bacteria 20846
249 Ga0068867_100051634 3300005459 Bacteria 3033
250 Ga0068867_100118904 3300005459 Bacteria 2039
251 Ga0070685_10000500 3300005466 Bacteria 22705
252 Ga0070685_10001648 3300005466 Bacteria 11733
253 Ga0070706_100046942 3300005467 Bacteria 3986
254 Ga0070707_100059142 3300005468 Bacteria 3677
255 Ga0070679_100004573 3300005530 Bacteria 12778
256 Ga0070679_100005646 3300005530 Bacteria 11594
257 Ga0070679_100212332 3300005530 Bacteria 1899
258 Ga0070679_100324917 3300005530 Bacteria 1487
259 Ga0070679_100328704 3300005530 Bacteria 1477
260 Ga0070684_100001718 3300005535 Bacteria 15952
261 Ga0070684_100168798 3300005535 Bacteria 1987
262 Ga0070684_100229751 3300005535 Bacteria 1694
263 Ga0068853_100008980 3300005539 Bacteria 8051
264 Ga0070672_100031753 3300005543 Bacteria 3979
265 Ga0070672_100115033 3300005543 Bacteria 2196
266 Ga0070672_100148679 3300005543 Bacteria 1937
267 Ga0070686_100042602 3300005544 Bacteria 2844
268 Ga0070686_100160481 3300005544 Bacteria 1583
269 Ga0070695_100041704 3300005545 Bacteria 2910
270 Ga0070696_100101659 3300005546 Bacteria 2061
271 Ga0070693_100053606 3300005547 Bacteria 2316
272 Ga0070665_100002293 3300005548 Bacteria 21277
273 Ga0070665_100006460 3300005548 Bacteria 11931
274 Ga0070665_100006629 3300005548 Bacteria 11769
275 Ga0070665_100009501 3300005548 Bacteria 9835
276 Ga0070665_100326102 3300005548 Bacteria 1540
277 Ga0070704_100018709 3300005549 Bacteria 4437
278 Ga0070704_100137972 3300005549 Bacteria 1900
279 Ga0068855_100000444 3300005563 Bacteria 51224
280 Ga0068855_100002283 3300005563 Bacteria 23679
281 Ga0068855_100003098 3300005563 Bacteria 20357
282 Ga0068855_100005973 3300005563 Bacteria 14856
283 Ga0068855_100009108 3300005563 Bacteria 11992
284 Ga0068855_100023171 3300005563 Bacteria 7439
285 Ga0068855_100024379 3300005563 Bacteria 7238
286 Ga0068855_100034435 3300005563 Bacteria 6040
287 Ga0068855_100083526 3300005563 Bacteria 3699
288 Ga0068855_100092619 3300005563 Bacteria 3485
289 Ga0068855_100112990 3300005563 Bacteria 3117
290 Ga0070664_100000001 3300005564 Bacteria 551832
291 Ga0070664_100000397 3300005564 Bacteria 32538
292 Ga0070664_100007156 3300005564 Bacteria 8995
293 Ga0070664_100023204 3300005564 Bacteria 5124
294 Ga0068857_100000319 3300005577 Bacteria 33193
295 Ga0068857_100000420 3300005577 Bacteria 30011
296 Ga0068857_100007163 3300005577 Bacteria 9608
297 Ga0068857_100028028 3300005577 Bacteria 4968
298 Ga0068857_100054907 3300005577 Bacteria 3535
299 Ga0068857_100318459 3300005577 Bacteria 1436
300 Ga0068854_100000009 3300005578 Bacteria 181432
301 Ga0068854_100001263 3300005578 Bacteria 15187
302 Ga0068854_100004257 3300005578 Bacteria 9012
303 Ga0068854_100004998 3300005578 Bacteria 8362
304 Ga0068854_100014248 3300005578 Bacteria 5237
305 Ga0068854_100020282 3300005578 Bacteria 4495
306 Ga0068854_100062360 3300005578 Bacteria 2703
307 Ga0068854_100113219 3300005578 Bacteria 2049
308 Ga0068856_100000007 3300005614 Bacteria 213669
309 Ga0068856_100000020 3300005614 Bacteria 146775
310 Ga0068856_100009005 3300005614 Bacteria 9711
311 Ga0068856_100009147 3300005614 Bacteria 9630
312 Ga0068856_100021310 3300005614 Bacteria 6298
313 Ga0068856_100035872 3300005614 Bacteria 4861
314 Ga0068856_100094661 3300005614 Bacteria 2974
315 Ga0068856_100123276 3300005614 Bacteria 2594
316 Ga0068856_100161199 3300005614 Bacteria 2253
317 Ga0068852_100003738 3300005616 Bacteria 10675
318 Ga0068852_100018178 3300005616 Bacteria 5534
319 Ga0068852_100026936 3300005616 Bacteria 4680
320 Ga0068852_100028831 3300005616 Bacteria 4548
321 Ga0068852_100029913 3300005616 Bacteria 4478
322 Ga0068852_100038100 3300005616 Bacteria 4038
323 Ga0068852_100042162 3300005616 Bacteria 3862
324 Ga0068852_100045883 3300005616 Bacteria 3720
325 Ga0068852_100123257 3300005616 Bacteria 2376
326 Ga0068852_100210710 3300005616 Bacteria 1843
327 Ga0068852_100315632 3300005616 Bacteria 1516
328 Ga0068859_100001635 3300005617 Bacteria 22899
329 Ga0068859_100001918 3300005617 Bacteria 21209
330 Ga0068859_100020544 3300005617 Bacteria 6627
331 Ga0068859_100069886 3300005617 Bacteria 3547
332 Ga0068859_100105469 3300005617 Bacteria 2878
333 Ga0068864_100000673 3300005618 Bacteria 28561
334 Ga0068866_10132473 3300005718 Bacteria 1420
335 Ga0068861_100099330 3300005719 Bacteria 2312
336 Ga0068861_100202373 3300005719 Bacteria 1667
337 Ga0068861_100229584 3300005719 Bacteria 1573
338 Ga0068851_10053624 3300005834 Bacteria 2053
339 Ga0068851_10082123 3300005834 Bacteria 1685
340 Ga0068870_10017423 3300005840 Bacteria 3450
341 Ga0068870_10017463 3300005840 Bacteria 3447
342 Ga0068863_100000020 3300005841 Bacteria 198519
343 Ga0068863_100000998 3300005841 Bacteria 28350
344 Ga0068863_100049098 3300005841 Bacteria 4001
345 Ga0068863_100307254 3300005841 Bacteria 1539
346 Ga0068858_100000646 3300005842 Bacteria 36308
347 Ga0068858_100001914 3300005842 Bacteria 21231
348 Ga0068858_100002832 3300005842 Bacteria 17433
349 Ga0068858_100008295 3300005842 Bacteria 9989
350 Ga0068858_100034781 3300005842 Bacteria 4674
351 Ga0068858_100104493 3300005842 Bacteria 2643
352 Ga0068860_100007072 3300005843 Bacteria 11232
353 Ga0068860_100016516 3300005843 Bacteria 7199
354 Ga0068860_100047260 3300005843 Bacteria 4102
355 Ga0068860_100122674 3300005843 Bacteria 2489
356 Ga0068862_100000542 3300005844 Bacteria 39532
357 Ga0068862_100001632 3300005844 Bacteria 20403
358 Ga0068862_100017753 3300005844 Bacteria 5922
359 Ga0081455_10000519 3300005937 Bacteria 50012
360 Ga0081455_10088179 3300005937 Bacteria 2522
361 Ga0075365_10007236 3300006038 Bacteria 6201
362 Ga0075365_10009102 3300006038 Bacteria 5684
363 Ga0075365_10051784 3300006038 Bacteria 2713
364 Ga0075363_100025812 3300006048 Bacteria 3001
365 Ga0075363_100056073 3300006048 Bacteria 2112
366 Ga0075364_10000025 3300006051 Bacteria 51908
367 Ga0075364_10020120 3300006051 Bacteria 4197
368 Ga0075364_10033566 3300006051 Bacteria 3306
369 Ga0075364_10064285 3300006051 Bacteria 2408
370 Ga0075364_10109846 3300006051 Bacteria 1839
371 Ga0075369_10039412 3300006186 Bacteria 2018
372 Ga0075369_10072088 3300006186 Bacteria 1522
373 Ga0075366_10022514 3300006195 Bacteria 3666
374 Ga0097621_100097220 3300006237 Bacteria 2472
375 Ga0075370_10157647 3300006353 Bacteria 1331
376 Ga0068871_100003774 3300006358 Bacteria 10433
377 Ga0068871_100204242 3300006358 Bacteria 1707
378 Ga0075428_100000382 3300006844 Bacteria 43854
379 Ga0075428_100001855 3300006844 Bacteria 22644
380 Ga0075428_100004272 3300006844 Bacteria 15725
381 Ga0075428_100008063 3300006844 Bacteria 11697
382 Ga0075428_100171767 3300006844 Bacteria 2349
383 Ga0075428_100339942 3300006844 Bacteria 1612
384 Ga0075430_100005806 3300006846 Bacteria 10412
385 Ga0075430_100009226 3300006846 Bacteria 8339
386 Ga0075430_100075796 3300006846 Bacteria 2819
387 Ga0075430_100081741 3300006846 Bacteria 2707
388 Ga0075430_100097020 3300006846 Bacteria 2463
389 Ga0075431_100000837 3300006847 Bacteria 26929
390 Ga0075431_100006719 3300006847 Bacteria 11422
391 Ga0075431_100021183 3300006847 Bacteria 6643
392 Ga0075433_10008606 3300006852 Bacteria 8142
393 Ga0075433_10011384 3300006852 Bacteria 7162
394 Ga0075433_10018150 3300006852 Bacteria 5843
395 Ga0075433_10043319 3300006852 Bacteria 3906
396 Ga0075433_10191285 3300006852 Bacteria 1820
397 Ga0075434_100002298 3300006871 Bacteria 16722
398 Ga0075434_100007875 3300006871 Bacteria 9871
399 Ga0075434_100138894 3300006871 Bacteria 2449
400 Ga0075434_100159484 3300006871 Bacteria 2276
401 Ga0075434_100319933 3300006871 Bacteria 1572
402 Ga0075429_100002408 3300006880 Bacteria 15757
403 Ga0075429_100010168 3300006880 Bacteria 8146
404 Ga0075429_100018546 3300006880 Bacteria 6026
405 Ga0075429_100020928 3300006880 Bacteria 5676
406 Ga0075429_100067695 3300006880 Bacteria 3108
407 Ga0075429_100097781 3300006880 Bacteria 2561
408 Ga0075429_100173818 3300006880 Bacteria 1887
409 Ga0068865_100076126 3300006881 Bacteria 2394
410 Ga0068865_100189574 3300006881 Bacteria 1589
411 Ga0097620_100001635 3300006931 Bacteria 22899
412 Ga0097620_100001918 3300006931 Bacteria 21209
413 Ga0097620_100020544 3300006931 Bacteria 6627
414 Ga0097620_100069886 3300006931 Bacteria 3547
415 Ga0097620_100105470 3300006931 Bacteria 2878
416 Ga0079104_1004361 3300006946 Bacteria 6101
417 Ga0099826_10000004 3300006948 Bacteria 802669
418 Ga0099826_10000005 3300006948 Bacteria 465206
419 Ga0075435_100007208 3300007076 Bacteria 7909
420 Ga0075435_100014270 3300007076 Bacteria 5932
421 Ga0075435_100205356 3300007076 Bacteria 1670
422 Ga0105244_10000928 3300009036 Bacteria 24754
423 Ga0105244_10002005 3300009036 Bacteria 15689
424 Ga0105244_10039266 3300009036 Bacteria 2464
425 Ga0105250_10010510 3300009092 Bacteria 3856
426 Ga0105250_10021971 3300009092 Bacteria 2574
427 Ga0105240_10000229 3300009093 Bacteria 111182
428 Ga0105240_10000254 3300009093 Bacteria 106067
429 Ga0105240_10000656 3300009093 Bacteria 63756
430 Ga0105240_10001308 3300009093 Bacteria 42956
431 Ga0105240_10002163 3300009093 Bacteria 32091
432 Ga0105240_10002233 3300009093 Bacteria 31504
433 Ga0105240_10006637 3300009093 Bacteria 16983
434 Ga0105240_10012613 3300009093 Bacteria 11654
435 Ga0105240_10020159 3300009093 Bacteria 8900
436 Ga0105240_10022318 3300009093 Bacteria 8395
437 Ga0105240_10041003 3300009093 Bacteria 5914
438 Ga0105240_10075724 3300009093 Bacteria 4150
439 Ga0111539_10000720 3300009094 Bacteria 43010
440 Ga0111539_10006149 3300009094 Bacteria 15500
441 Ga0111539_10007063 3300009094 Bacteria 14405
442 Ga0111539_10031120 3300009094 Bacteria 6484
443 Ga0111539_10091403 3300009094 Bacteria 3576
444 Ga0111539_10097749 3300009094 Unclassified 3449
445 Ga0111539_10241292 3300009094 Bacteria 2104
446 Ga0111539_10456819 3300009094 Bacteria 1487
447 Ga0105245_10055393 3300009098 Bacteria 3562
448 Ga0105247_10000114 3300009101 Bacteria 80795
449 Ga0114129_10007216 3300009147 Bacteria 15821
450 Ga0114129_10168265 3300009147 Bacteria 2990
451 Ga0105243_10035511 3300009148 Bacteria 3865
452 Ga0105241_10004164 3300009174 Bacteria 10682
453 Ga0105241_10017102 3300009174 Bacteria 5325
454 Ga0105241_10087592 3300009174 Bacteria 2451
455 Ga0105241_10156983 3300009174 Bacteria 1867
456 Ga0105242_10001320 3300009176 Bacteria 19562
457 Ga0105248_10001405 3300009177 Bacteria 26896
458 Ga0105248_10088363 3300009177 Bacteria 3488
459 Ga0105248_10092670 3300009177 Bacteria 3403
460 Ga0105248_10450483 3300009177 Bacteria 1450
461 Ga0105237_10000307 3300009545 Bacteria 68076
462 Ga0105237_10009871 3300009545 Bacteria 10201
463 Ga0105237_10016987 3300009545 Bacteria 7551
464 Ga0105237_10045290 3300009545 Bacteria 4427
465 Ga0105237_10047220 3300009545 Bacteria 4329
466 Ga0105237_10116981 3300009545 Bacteria 2659
467 Ga0105237_10171812 3300009545 Bacteria 2167
468 Ga0105237_10191491 3300009545 Bacteria 2045
469 Ga0105237_10247322 3300009545 Bacteria 1785
470 Ga0105237_10329821 3300009545 Bacteria 1530
471 Ga0105238_10001282 3300009551 Bacteria 25241
472 Ga0105238_10005465 3300009551 Bacteria 12560
473 Ga0105238_10016507 3300009551 Bacteria 7473
474 Ga0105238_10017551 3300009551 Bacteria 7278
475 Ga0105238_10069608 3300009551 Bacteria 3519
476 Ga0105238_10073033 3300009551 Bacteria 3425
477 Ga0105238_10094579 3300009551 Bacteria 2976
478 Ga0105238_10096527 3300009551 Bacteria 2942
479 Ga0105238_10240598 3300009551 Bacteria 1787
480 Ga0105249_10016732 3300009553 Bacteria 6508
481 Ga0105249_10072664 3300009553 Bacteria 3180
482 Ga0105249_10081597 3300009553 Bacteria 3006
483 Ga0105249_10183521 3300009553 Bacteria 2037
484 Ga0105249_10197266 3300009553 Bacteria 1968
485 Ga0105249_10279409 3300009553 Bacteria 1667
486 Ga0105239_10000020 3300010375 Bacteria 264435
487 Ga0105239_10011929 3300010375 Bacteria 9691
488 Ga0105239_10020983 3300010375 Bacteria 7209
489 Ga0105239_10027882 3300010375 Bacteria 6214
490 Ga0105239_10028575 3300010375 Bacteria 6131
491 Ga0105239_10071210 3300010375 Bacteria 3820
492 Ga0105239_10493183 3300010375 Bacteria 1392
493 Ga0105246_10086217 3300011119 Bacteria 2251
494 Ga0105246_10147659 3300011119 Bacteria 1776
495 Ga0157314_1000121 3300012500 Bacteria 8518
496 Ga0157373_10012939 3300013100 Bacteria 6127
497 Ga0157373_10050665 3300013100 Bacteria 2957
498 Ga0157371_10000038 3300013102 Bacteria 214783
499 Ga0157371_10008891 3300013102 Bacteria 7954
500 Ga0157371_10071002 3300013102 Bacteria 2465
501 Ga0157371_10128417 3300013102 Bacteria 1803
502 Ga0157370_10000328 3300013104 Bacteria 59681
503 Ga0157370_10001149 3300013104 Bacteria 32991
504 Ga0157370_10001151 3300013104 Bacteria 32983
505 Ga0157370_10020669 3300013104 Bacteria 6570
506 Ga0157370_10205838 3300013104 Bacteria 1824
507 Ga0157369_10000206 3300013105 Bacteria 81958
508 Ga0157369_10009615 3300013105 Bacteria 11056
509 Ga0157369_10010338 3300013105 Bacteria 10643
510 Ga0157369_10019076 3300013105 Bacteria 7678
511 Ga0157369_10093835 3300013105 Bacteria 3203
512 Ga0157374_10000370 3300013296 Bacteria 41402
513 Ga0157374_10035618 3300013296 Bacteria 4554
514 Ga0157374_10111291 3300013296 Bacteria 2634
515 Ga0157374_10195135 3300013296 Bacteria 1981
516 Ga0157378_10313052 3300013297 Bacteria 1523
517 Ga0163162_10000004 3300013306 Bacteria 505593
518 Ga0163162_10005686 3300013306 Bacteria 12048
519 Ga0163162_10018051 3300013306 Bacteria 6903
520 Ga0163162_10035420 3300013306 Bacteria 4972
521 Ga0163162_10039378 3300013306 Bacteria 4723
522 Ga0163162_10044415 3300013306 Bacteria 4451
523 Ga0163162_10055315 3300013306 Bacteria 3994
524 Ga0157372_10000033 3300013307 Bacteria 177348
525 Ga0157372_10002456 3300013307 Bacteria 20081
526 Ga0157372_10069469 3300013307 Bacteria 3962
527 Ga0157372_10091273 3300013307 Bacteria 3464
528 Ga0157375_10080580 3300013308 Bacteria 3294
529 Ga0157375_10393264 3300013308 Bacteria 1553
530 Ga0163163_10000628 3300014325 Bacteria 30437
531 Ga0163163_10027524 3300014325 Bacteria 5448
532 Ga0157380_10023141 3300014326 Bacteria 4685
533 Ga0182008_10015969 3300014497 Bacteria 3909
534 Ga0182008_10039390 3300014497 Bacteria 2362
535 Ga0157377_10008093 3300014745 Bacteria 5115
536 Ga0157379_10021656 3300014968 Bacteria 5692
537 Ga0157379_10093252 3300014968 Bacteria 2701
538 Ga0157379_10228963 3300014968 Bacteria 1685
539 Ga0157376_10032500 3300014969 Bacteria 4191
540 Ga0157376_10144192 3300014969 Bacteria 2140
541 Ga0157376_10148712 3300014969 Bacteria 2110
542 Ga0157376_10446857 3300014969 Bacteria 1260
543 Ga0182006_1000004 3300015261 Bacteria 622190
544 Ga0182006_1000019 3300015261 Bacteria 294192
545 Ga0182006_1013526 3300015261 Bacteria 3539
546 Ga0182006_1076062 3300015261 Bacteria 1234
547 Ga0182007_10000028 3300015262 Bacteria 167122
548 Ga0182007_10000583 3300015262 Bacteria 21488
549 Ga0182007_10017000 3300015262 Bacteria 2668
550 Ga0182005_1000005 3300015265 Bacteria 537378
551 Ga0182005_1000011 3300015265 Bacteria 420605
552 Ga0182005_1000726 3300015265 Bacteria 15119
553 Ga0182005_1007785 3300015265 Bacteria 3191
554 Ga0183369_1006 3300015685 Bacteria 449058
555 Ga0183368_1003 3300015687 Bacteria 1276390
556 Ga0183361_10012 3300016635 Bacteria 203395
557 Ga0163161_10182339 3300017792 Bacteria 1610
558 Ga0206353_10536292 3300020082 Bacteria 2454
559 Ga0213872_10000017 3300021361 Bacteria 178787
560 Ga0213872_10002691 3300021361 Bacteria 10256
561 Ga0213872_10034549 3300021361 Bacteria 2314
562 Ga0224712_10001677 3300022467 Bacteria 5232
563 Ga0209435_100015 3300025206 Bacteria 321177
564 Ga0209435_100161 3300025206 Bacteria 21397
565 Ga0209435_103042 3300025206 Bacteria 1928
566 Ga0209436_100088 3300025208 Bacteria 45867
567 Ga0209436_101828 3300025208 Bacteria 6899
568 Ga0209436_112621 3300025208 Bacteria 1425
569 Ga0209784_100005 3300025224 Bacteria 1040422
570 Ga0209784_100027 3300025224 Bacteria 363933
571 Ga0209784_100068 3300025224 Bacteria 152526
572 Ga0209784_100122 3300025224 Bacteria 82119
573 Ga0209784_100805 3300025224 Bacteria 7367
574 Ga0209566_100005 3300025225 Bacteria 1040422
575 Ga0209566_100027 3300025225 Bacteria 363933
576 Ga0209566_100048 3300025225 Bacteria 241570
577 Ga0209566_100216 3300025225 Bacteria 57945
578 Ga0209566_100394 3300025225 Bacteria 35228
579 Ga0209566_100800 3300025225 Bacteria 16449
580 Ga0209674_100005 3300025226 Bacteria 1708125
581 Ga0209674_100009 3300025226 Bacteria 1040422
582 Ga0209674_100012 3300025226 Bacteria 950162
583 Ga0209674_100044 3300025226 Bacteria 363933
584 Ga0209674_100071 3300025226 Bacteria 241568
585 Ga0209674_100092 3300025226 Bacteria 172272
586 Ga0209674_100201 3300025226 Bacteria 61586
587 Ga0209674_101175 3300025226 Bacteria 7553
588 Ga0209672_100001 3300025228 Bacteria 2828210
589 Ga0209672_100005 3300025228 Bacteria 1069303
590 Ga0209672_100028 3300025228 Bacteria 341962
591 Ga0209672_100038 3300025228 Bacteria 286731
592 Ga0209672_100045 3300025228 Bacteria 264926
593 Ga0209672_100100 3300025228 Bacteria 108785
594 Ga0209672_100350 3300025228 Bacteria 29469
595 Ga0209672_100971 3300025228 Bacteria 12707
596 Ga0209147_100001 3300025229 Bacteria 2384371
597 Ga0209147_100002 3300025229 Bacteria 2158988
598 Ga0209147_100004 3300025229 Bacteria 1371850
599 Ga0209147_100091 3300025229 Bacteria 168353
600 Ga0209147_100163 3300025229 Bacteria 90494
601 Ga0209563_100012 3300025230 Bacteria 1040422
602 Ga0209563_100022 3300025230 Bacteria 643318
603 Ga0209563_100023 3300025230 Bacteria 636844
604 Ga0209563_100048 3300025230 Bacteria 363933
605 Ga0209563_100085 3300025230 Bacteria 186579
606 Ga0207427_100139 3300025231 Bacteria 84807
607 Ga0207427_100140 3300025231 Bacteria 84637
608 Ga0207427_100369 3300025231 Bacteria 27439
609 Ga0207427_102015 3300025231 Bacteria 6164
610 Ga0207427_106452 3300025231 Bacteria 1485
611 Ga0209437_100045 3300025233 Bacteria 429809
612 Ga0209437_100055 3300025233 Bacteria 363933
613 Ga0209437_100147 3300025233 Bacteria 161997
614 Ga0209437_100462 3300025233 Bacteria 32102
615 Ga0209437_100463 3300025233 Bacteria 32076
616 Ga0209437_102850 3300025233 Bacteria 3246
617 Ga0209437_107529 3300025233 Bacteria 1767
618 Ga0209258_100001 3300025242 Bacteria 2384269
619 Ga0209258_100002 3300025242 Bacteria 2158988
620 Ga0209258_100006 3300025242 Bacteria 1069303
621 Ga0209258_100024 3300025242 Bacteria 542096
622 Ga0209258_100109 3300025242 Bacteria 203881
623 Ga0209258_100111 3300025242 Bacteria 197019
624 Ga0209258_100112 3300025242 Bacteria 192884
625 Ga0209258_100200 3300025242 Bacteria 123379
626 Ga0209258_100226 3300025242 Bacteria 106588
627 Ga0209258_100360 3300025242 Bacteria 61533
628 Ga0209258_100626 3300025242 Bacteria 28032
629 Ga0209258_101855 3300025242 Bacteria 6388
630 Ga0209258_103686 3300025242 Bacteria 3191
631 Ga0207425_1000015 3300025245 Bacteria 466368
632 Ga0207425_1000106 3300025245 Bacteria 78155
633 Ga0207425_1000253 3300025245 Bacteria 40277
634 Ga0207425_1002630 3300025245 Bacteria 6205
635 Ga0209646_1000020 3300025246 Bacteria 462204
636 Ga0209646_1000035 3300025246 Bacteria 363209
637 Ga0209646_1000040 3300025246 Bacteria 347867
638 Ga0209646_1000162 3300025246 Bacteria 90787
639 Ga0209646_1000267 3300025246 Bacteria 49297
640 Ga0209646_1000448 3300025246 Bacteria 21870
641 Ga0209646_1000896 3300025246 Bacteria 9713
642 Ga0209026_1000004 3300025250 Bacteria 949012
643 Ga0209026_1000034 3300025250 Bacteria 306953
644 Ga0209026_1000037 3300025250 Bacteria 282562
645 Ga0209026_1000074 3300025250 Bacteria 203820
646 Ga0209026_1000099 3300025250 Bacteria 161750
647 Ga0209026_1000737 3300025250 Bacteria 18882
648 Ga0209026_1002614 3300025250 Bacteria 6594
649 Ga0209026_1005576 3300025250 Bacteria 3343
650 Ga0209026_1005597 3300025250 Bacteria 3327
651 Ga0209677_100006 3300025253 Bacteria 1040422
652 Ga0209677_100028 3300025253 Bacteria 363933
653 Ga0209677_100040 3300025253 Bacteria 241568
654 Ga0209677_100176 3300025253 Bacteria 54441
655 Ga0209677_103002 3300025253 Bacteria 5834
656 Ga0209148_1000002 3300025254 Bacteria 2399500
657 Ga0209148_1000003 3300025254 Bacteria 2384288
658 Ga0209148_1000009 3300025254 Bacteria 1395625
659 Ga0209148_1000010 3300025254 Bacteria 1265567
660 Ga0209148_1000012 3300025254 Bacteria 1069303
661 Ga0209148_1000032 3300025254 Bacteria 557660
662 Ga0209148_1000045 3300025254 Bacteria 448076
663 Ga0209148_1000077 3300025254 Bacteria 298133
664 Ga0209148_1000081 3300025254 Bacteria 273676
665 Ga0209148_1000099 3300025254 Bacteria 227713
666 Ga0209148_1000844 3300025254 Bacteria 21726
667 Ga0209148_1007474 3300025254 Bacteria 2269
668 Ga0209759_1000003 3300025256 Bacteria 792130
669 Ga0209759_1000049 3300025256 Bacteria 221692
670 Ga0209759_1000053 3300025256 Bacteria 212789
671 Ga0209759_1000074 3300025256 Bacteria 177152
672 Ga0209759_1000110 3300025256 Bacteria 144917
673 Ga0209759_1000247 3300025256 Bacteria 80850
674 Ga0209759_1000357 3300025256 Bacteria 59208
675 Ga0209759_1000601 3300025256 Bacteria 34849
676 Ga0209759_1000605 3300025256 Bacteria 34670
677 Ga0209759_1010121 3300025256 Bacteria 2787
678 Ga0209759_1010316 3300025256 Bacteria 2746
679 Ga0209759_1017311 3300025256 Bacteria 1781
680 Ga0209129_1000126 3300025258 Bacteria 133335
681 Ga0209129_1000193 3300025258 Bacteria 81616
682 Ga0209129_1003076 3300025258 Bacteria 7530
683 Ga0209129_1003515 3300025258 Bacteria 6769
684 Ga0209233_1000009 3300025261 Bacteria 1265567
685 Ga0209233_1000016 3300025261 Bacteria 907830
686 Ga0209233_1000070 3300025261 Bacteria 363933
687 Ga0209233_1000251 3300025261 Bacteria 84807
688 Ga0209565_1000018 3300025263 Bacteria 460940
689 Ga0209565_1000217 3300025263 Bacteria 65539
690 Ga0209565_1000385 3300025263 Bacteria 37408
691 Ga0209565_1001696 3300025263 Bacteria 9096
692 Ga0209565_1002148 3300025263 Bacteria 7435
693 Ga0209565_1005248 3300025263 Bacteria 3796
694 Ga0209565_1016522 3300025263 Bacteria 1639
695 Ga0209455_1000001 3300025272 Bacteria 2384278
696 Ga0209455_1000008 3300025272 Bacteria 1069303
697 Ga0209455_1000009 3300025272 Bacteria 1042273
698 Ga0209455_1000029 3300025272 Bacteria 542096
699 Ga0209455_1000035 3300025272 Bacteria 479071
700 Ga0209455_1000050 3300025272 Bacteria 373239
701 Ga0209455_1000085 3300025272 Bacteria 247601
702 Ga0209455_1000086 3300025272 Bacteria 244650
703 Ga0209455_1000187 3300025272 Bacteria 94529
704 Ga0209455_1009786 3300025272 Bacteria 2489
705 Ga0209455_1014006 3300025272 Bacteria 1834
706 Ga0209673_1000006 3300025273 Bacteria 650600
707 Ga0209673_1000038 3300025273 Bacteria 312957
708 Ga0209673_1010648 3300025273 Bacteria 3857
709 Ga0209673_1016158 3300025273 Bacteria 2803
710 Ga0209130_1000204 3300025284 Bacteria 79798
711 Ga0209130_1000595 3300025284 Bacteria 35219
712 Ga0209130_1000734 3300025284 Bacteria 28905
713 Ga0209130_1000942 3300025284 Bacteria 23166
714 Ga0209675_1000005 3300025291 Bacteria 849192
715 Ga0209675_1000125 3300025291 Bacteria 105527
716 Ga0209675_1000242 3300025291 Bacteria 54636
717 Ga0209675_1000466 3300025291 Bacteria 31068
718 Ga0209675_1001143 3300025291 Bacteria 16181
719 Ga0209675_1005516 3300025291 Bacteria 5280
720 Ga0209675_1022824 3300025291 Bacteria 1635
721 Ga0209676_1000014 3300025292 Bacteria 793514
722 Ga0209676_1000467 3300025292 Bacteria 67659
723 Ga0209676_1000560 3300025292 Bacteria 56233
724 Ga0209025_1000002 3300025294 Bacteria 1393142
725 Ga0209025_1000057 3300025294 Bacteria 314601
726 Ga0209025_1000379 3300025294 Bacteria 92457
727 Ga0209025_1000423 3300025294 Bacteria 84180
728 Ga0209025_1000772 3300025294 Bacteria 53069
729 Ga0209025_1000811 3300025294 Bacteria 50182
730 Ga0209564_1000028 3300025295 Bacteria 510986
731 Ga0209564_1000032 3300025295 Bacteria 464041
732 Ga0209564_1000144 3300025295 Bacteria 175328
733 Ga0209564_1000377 3300025295 Bacteria 81824
734 Ga0209564_1000691 3300025295 Bacteria 49482
735 Ga0209564_1000723 3300025295 Bacteria 47441
736 Ga0209564_1000905 3300025295 Bacteria 38846
737 Ga0209564_1000928 3300025295 Bacteria 38079
738 Ga0209564_1001161 3300025295 Bacteria 30619
739 Ga0209564_1003063 3300025295 Bacteria 11871
740 Ga0209564_1028062 3300025295 Bacteria 1810
741 Ga0209758_1000003 3300025297 Bacteria 1398533
742 Ga0209758_1000276 3300025297 Bacteria 102362
743 Ga0209758_1000353 3300025297 Bacteria 83330
744 Ga0209758_1000427 3300025297 Bacteria 71188
745 Ga0209758_1001455 3300025297 Bacteria 27802
746 Ga0209758_1024248 3300025297 Bacteria 2709
747 Ga0209050_1000403 3300025298 Bacteria 80774
748 Ga0209050_1000461 3300025298 Bacteria 72912
749 Ga0209050_1000835 3300025298 Bacteria 42531
750 Ga0209050_1001568 3300025298 Bacteria 23778
751 Ga0209050_1003403 3300025298 Bacteria 11793
752 Ga0209050_1009261 3300025298 Bacteria 5073
753 Ga0209256_1000090 3300025299 Bacteria 212541
754 Ga0209256_1000325 3300025299 Bacteria 81358
755 Ga0209256_1000645 3300025299 Bacteria 47440
756 Ga0209256_1000930 3300025299 Bacteria 35622
757 Ga0209256_1001047 3300025299 Bacteria 32187
758 Ga0209256_1001803 3300025299 Bacteria 20177
759 Ga0209256_1002042 3300025299 Bacteria 17926
760 Ga0209256_1002408 3300025299 Bacteria 15343
761 Ga0209256_1002895 3300025299 Bacteria 13003
762 Ga0207426_1000037 3300025302 Bacteria 442735
763 Ga0207426_1000066 3300025302 Bacteria 351182
764 Ga0207426_1000570 3300025302 Bacteria 49882
765 Ga0207426_1004322 3300025302 Bacteria 7000
766 Ga0209051_1000696 3300025303 Bacteria 37048
767 Ga0209051_1002223 3300025303 Bacteria 14319
768 Ga0209051_1018885 3300025303 Bacteria 3033
769 Ga0209051_1020826 3300025303 Bacteria 2811
770 Ga0209257_1000123 3300025304 Bacteria 219092
771 Ga0209257_1000710 3300025304 Bacteria 51515
772 Ga0209257_1001256 3300025304 Bacteria 31336
773 Ga0209257_1002232 3300025304 Bacteria 19902
774 Ga0209257_1006222 3300025304 Bacteria 7827
775 Ga0207656_10008602 3300025321 Bacteria 3762
776 Ga0207696_1008768 3300025711 Bacteria 3830
777 Ga0207655_1013046 3300025728 Bacteria 4797
778 Ga0207655_1013584 3300025728 Bacteria 4663
779 Ga0207713_1000305 3300025735 Bacteria 56170
780 Ga0207713_1006791 3300025735 Bacteria 6904
781 Ga0207682_10034484 3300025893 Bacteria 2040
782 Ga0207710_10000184 3300025900 Bacteria 61696
783 Ga0207688_10069731 3300025901 Bacteria 1993
784 Ga0207680_10002298 3300025903 Bacteria 8912
785 Ga0207647_10001292 3300025904 Bacteria 19267
786 Ga0207647_10001421 3300025904 Bacteria 18369
787 Ga0207647_10007692 3300025904 Bacteria 7762
788 Ga0207647_10008418 3300025904 Bacteria 7398
789 Ga0207647_10012861 3300025904 Bacteria 5814
790 Ga0207647_10016163 3300025904 Bacteria 5097
791 Ga0207647_10021486 3300025904 Bacteria 4308
792 Ga0207645_10078398 3300025907 Bacteria 2117
793 Ga0207645_10093784 3300025907 Bacteria 1932
794 Ga0207705_10000708 3300025909 Bacteria 27547
795 Ga0207705_10002855 3300025909 Bacteria 13220
796 Ga0207705_10020319 3300025909 Bacteria 4748
797 Ga0207705_10031214 3300025909 Bacteria 3801
798 Ga0207705_10042342 3300025909 Bacteria 3269
799 Ga0207705_10044674 3300025909 Bacteria 3184
800 Ga0207705_10124121 3300025909 Bacteria 1918
801 Ga0207705_10179573 3300025909 Bacteria 1597
802 Ga0207705_10279304 3300025909 Bacteria 1278
803 Ga0207684_10083418 3300025910 Bacteria 2722
804 Ga0207654_10004285 3300025911 Bacteria 7196
805 Ga0207654_10209832 3300025911 Bacteria 1287
806 Ga0207707_10000480 3300025912 Bacteria 41364
807 Ga0207707_10014162 3300025912 Bacteria 6949
808 Ga0207707_10050883 3300025912 Bacteria 3607
809 Ga0207707_10076539 3300025912 Bacteria 2920
810 Ga0207707_10095891 3300025912 Bacteria 2592
811 Ga0207707_10138592 3300025912 Bacteria 2127
812 Ga0207707_10274520 3300025912 Bacteria 1461
813 Ga0207707_10302020 3300025912 Bacteria 1384
814 Ga0207707_10310006 3300025912 Bacteria 1364
815 Ga0207695_10000219 3300025913 Bacteria 153492
816 Ga0207695_10000268 3300025913 Bacteria 130752
817 Ga0207695_10000408 3300025913 Bacteria 95748
818 Ga0207695_10001145 3300025913 Bacteria 45972
819 Ga0207695_10001341 3300025913 Bacteria 41772
820 Ga0207695_10002857 3300025913 Bacteria 25113
821 Ga0207695_10003147 3300025913 Bacteria 23559
822 Ga0207695_10006037 3300025913 Bacteria 15822
823 Ga0207695_10007411 3300025913 Bacteria 13980
824 Ga0207695_10008177 3300025913 Bacteria 13142
825 Ga0207695_10009807 3300025913 Bacteria 11772
826 Ga0207695_10024144 3300025913 Bacteria 6848
827 Ga0207695_10025905 3300025913 Bacteria 6555
828 Ga0207695_10048152 3300025913 Bacteria 4504
829 Ga0207695_10097511 3300025913 Bacteria 2941
830 Ga0207671_10000031 3300025914 Bacteria 247030
831 Ga0207671_10013085 3300025914 Bacteria 6630
832 Ga0207671_10015117 3300025914 Bacteria 6065
833 Ga0207671_10023037 3300025914 Bacteria 4700
834 Ga0207671_10024641 3300025914 Bacteria 4520
835 Ga0207671_10024923 3300025914 Bacteria 4495
836 Ga0207671_10040441 3300025914 Bacteria 3452
837 Ga0207671_10049405 3300025914 Bacteria 3114
838 Ga0207660_10006191 3300025917 Bacteria 7774
839 Ga0207660_10034918 3300025917 Bacteria 3488
840 Ga0207660_10125850 3300025917 Bacteria 1946
841 Ga0207662_10000523 3300025918 Bacteria 17038
842 Ga0207657_10000051 3300025919 Bacteria 109129
843 Ga0207657_10000131 3300025919 Bacteria 75479
844 Ga0207657_10007473 3300025919 Bacteria 11196
845 Ga0207657_10014832 3300025919 Bacteria 7586
846 Ga0207657_10029267 3300025919 Bacteria 5015
847 Ga0207657_10042292 3300025919 Bacteria 4022
848 Ga0207657_10081048 3300025919 Bacteria 2727
849 Ga0207649_10000246 3300025920 Bacteria 43912
850 Ga0207649_10009879 3300025920 Bacteria 5231
851 Ga0207649_10022066 3300025920 Bacteria 3675
852 Ga0207649_10052947 3300025920 Bacteria 2520
853 Ga0207649_10072073 3300025920 Bacteria 2209
854 Ga0207649_10096052 3300025920 Bacteria 1951
855 Ga0207649_10142385 3300025920 Bacteria 1642
856 Ga0207652_10003672 3300025921 Bacteria 12624
857 Ga0207652_10006250 3300025921 Bacteria 9613
858 Ga0207652_10047258 3300025921 Bacteria 3676
859 Ga0207652_10276673 3300025921 Bacteria 1514
860 Ga0207646_10004371 3300025922 Bacteria 15391
861 Ga0207694_10001114 3300025924 Bacteria 23252
862 Ga0207694_10003153 3300025924 Bacteria 13178
863 Ga0207694_10008640 3300025924 Bacteria 7690
864 Ga0207694_10017034 3300025924 Bacteria 5489
865 Ga0207694_10018922 3300025924 Bacteria 5207
866 Ga0207694_10031609 3300025924 Bacteria 4045
867 Ga0207694_10038687 3300025924 Bacteria 3668
868 Ga0207694_10043166 3300025924 Bacteria 3480
869 Ga0207694_10088043 3300025924 Bacteria 2447
870 Ga0207694_10088421 3300025924 Bacteria 2442
871 Ga0207694_10244040 3300025924 Bacteria 1468
872 Ga0207694_10262112 3300025924 Bacteria 1416
873 Ga0207650_10021547 3300025925 Bacteria 4554
874 Ga0207650_10026465 3300025925 Bacteria 4138
875 Ga0207650_10037388 3300025925 Bacteria 3537
876 Ga0207650_10040790 3300025925 Bacteria 3399
877 Ga0207659_10003387 3300025926 Bacteria 9557
878 Ga0207687_10249049 3300025927 Bacteria 1411
879 Ga0207700_10015921 3300025928 Bacteria 4979
880 Ga0207664_10000026 3300025929 Bacteria 194571
881 Ga0207664_10003572 3300025929 Bacteria 10391
882 Ga0207644_10000085 3300025931 Bacteria 68347
883 Ga0207644_10009366 3300025931 Bacteria 6431
884 Ga0207644_10076073 3300025931 Bacteria 2468
885 Ga0207690_10000034 3300025932 Bacteria 149574
886 Ga0207690_10000210 3300025932 Bacteria 45010
887 Ga0207690_10002130 3300025932 Bacteria 12122
888 Ga0207690_10008096 3300025932 Bacteria 6239
889 Ga0207690_10025631 3300025932 Bacteria 3705
890 Ga0207690_10053552 3300025932 Bacteria 2708
891 Ga0207690_10110861 3300025932 Bacteria 1976
892 Ga0207706_10002628 3300025933 Bacteria 17488
893 Ga0207706_10014682 3300025933 Bacteria 7094
894 Ga0207706_10090601 3300025933 Bacteria 2689
895 Ga0207686_10019961 3300025934 Bacteria 3822
896 Ga0207686_10051867 3300025934 Bacteria 2557
897 Ga0207709_10006448 3300025935 Bacteria 6588
898 Ga0207670_10001036 3300025936 Bacteria 14669
899 Ga0207670_10140188 3300025936 Bacteria 1782
900 Ga0207670_10149196 3300025936 Bacteria 1733
901 Ga0207670_10154993 3300025936 Bacteria 1704
902 Ga0207704_10028757 3300025938 Bacteria 3089
903 Ga0207691_10024108 3300025940 Bacteria 5722
904 Ga0207691_10034675 3300025940 Bacteria 4691
905 Ga0207691_10042998 3300025940 Bacteria 4165
906 Ga0207711_10009166 3300025941 Bacteria 8269
907 Ga0207711_10045231 3300025941 Bacteria 3762
908 Ga0207689_10005367 3300025942 Bacteria 11475
909 Ga0207689_10076474 3300025942 Bacteria 2752
910 Ga0207689_10221417 3300025942 Bacteria 1563
911 Ga0207661_10143706 3300025944 Bacteria 2056
912 Ga0207661_10419782 3300025944 Bacteria 1215
913 Ga0207679_10000003 3300025945 Bacteria 597553
914 Ga0207679_10054534 3300025945 Bacteria 2943
915 Ga0207679_10057572 3300025945 Bacteria 2875
916 Ga0207679_10186551 3300025945 Bacteria 1720
917 Ga0207667_10000078 3300025949 Bacteria 165061
918 Ga0207667_10000082 3300025949 Bacteria 157749
919 Ga0207667_10000313 3300025949 Bacteria 67227
920 Ga0207667_10003897 3300025949 Bacteria 18346
921 Ga0207667_10008318 3300025949 Bacteria 12343
922 Ga0207667_10009027 3300025949 Bacteria 11791
923 Ga0207667_10010642 3300025949 Bacteria 10738
924 Ga0207667_10025545 3300025949 Bacteria 6464
925 Ga0207667_10033114 3300025949 Bacteria 5560
926 Ga0207667_10178025 3300025949 Bacteria 2184
927 Ga0207667_10213767 3300025949 Bacteria 1976
928 Ga0207667_10453966 3300025949 Bacteria 1302
929 Ga0207667_10574513 3300025949 Bacteria 1138
930 Ga0207651_10006946 3300025960 Bacteria 5987
931 Ga0207651_10056539 3300025960 Bacteria 2701
932 Ga0207712_10000066 3300025961 Bacteria 132251
933 Ga0207712_10046950 3300025961 Bacteria 2996
934 Ga0207712_10191355 3300025961 Bacteria 1615
935 Ga0207668_10000085 3300025972 Bacteria 70401
936 Ga0207668_10009742 3300025972 Bacteria 5769
937 Ga0207668_10304035 3300025972 Bacteria 1317
938 Ga0207640_10000018 3300025981 Bacteria 193664
939 Ga0207640_10000217 3300025981 Bacteria 40501
940 Ga0207640_10000667 3300025981 Bacteria 20069
941 Ga0207640_10002267 3300025981 Bacteria 10358
942 Ga0207640_10002909 3300025981 Bacteria 9196
943 Ga0207640_10042528 3300025981 Bacteria 2898
944 Ga0207640_10099517 3300025981 Bacteria 2035
945 Ga0207640_10180376 3300025981 Bacteria 1583
946 Ga0207658_10146336 3300025986 Bacteria 1919
947 Ga0207658_10170335 3300025986 Bacteria 1793
948 Ga0207658_10170541 3300025986 Bacteria 1792
949 Ga0207658_10315345 3300025986 Bacteria 1352
950 Ga0207677_10166298 3300026023 Bacteria 1719
951 Ga0207703_10000389 3300026035 Bacteria 47154
952 Ga0207703_10000397 3300026035 Bacteria 46725
953 Ga0207703_10001403 3300026035 Bacteria 21946
954 Ga0207703_10073205 3300026035 Bacteria 2834
955 Ga0207703_10203332 3300026035 Bacteria 1761
956 Ga0207639_10000780 3300026041 Bacteria 21664
957 Ga0207639_10010769 3300026041 Bacteria 6337
958 Ga0207639_10014615 3300026041 Bacteria 5527
959 Ga0207639_10282023 3300026041 Bacteria 1461
960 Ga0207678_10000052 3300026067 Bacteria 89433
961 Ga0207678_10002893 3300026067 Bacteria 15586
962 Ga0207678_10004514 3300026067 Bacteria 12516
963 Ga0207678_10009903 3300026067 Bacteria 8367
964 Ga0207678_10025599 3300026067 Bacteria 5150
965 Ga0207678_10051671 3300026067 Bacteria 3548
966 Ga0207678_10090803 3300026067 Bacteria 2611
967 Ga0207678_10109857 3300026067 Bacteria 2352
968 Ga0207708_10014845 3300026075 Bacteria 5830
969 Ga0207708_10077093 3300026075 Bacteria 2558
970 Ga0207708_10139678 3300026075 Bacteria 1899
971 Ga0207702_10000110 3300026078 Bacteria 95353
972 Ga0207702_10000126 3300026078 Bacteria 90550
973 Ga0207702_10003986 3300026078 Bacteria 13256
974 Ga0207702_10005090 3300026078 Bacteria 11553
975 Ga0207702_10034011 3300026078 Bacteria 4260
976 Ga0207702_10044808 3300026078 Bacteria 3719
977 Ga0207702_10075545 3300026078 Bacteria 2911
978 Ga0207702_10130312 3300026078 Bacteria 2262
979 Ga0207702_10251088 3300026078 Bacteria 1661
980 Ga0207702_10259518 3300026078 Bacteria 1635
981 Ga0207641_10000001 3300026088 Bacteria 1180841
982 Ga0207641_10001912 3300026088 Bacteria 19980
983 Ga0207641_10009012 3300026088 Bacteria 8240
984 Ga0207641_10202057 3300026088 Bacteria 1833
985 Ga0207648_10012019 3300026089 Bacteria 8122
986 Ga0207648_10031048 3300026089 Bacteria 4726
987 Ga0207648_10044276 3300026089 Bacteria 3905
988 Ga0207648_10073465 3300026089 Bacteria 2980
989 Ga0207648_10138316 3300026089 Bacteria 2146
990 Ga0207674_10000397 3300026116 Bacteria 56299
991 Ga0207674_10009479 3300026116 Bacteria 11118
992 Ga0207674_10010840 3300026116 Bacteria 10276
993 Ga0207674_10048813 3300026116 Bacteria 4331
994 Ga0207674_10090827 3300026116 Bacteria 3045
995 Ga0207674_10195488 3300026116 Bacteria 1972
996 Ga0207674_10273317 3300026116 Bacteria 1637
997 Ga0207674_10289616 3300026116 Bacteria 1586
998 Ga0207674_10336298 3300026116 Bacteria 1460
999 Ga0207675_100000884 3300026118 Bacteria 29908
1000 Ga0207675_100047861 3300026118 Bacteria 3991
1001 Ga0207675_100064318 3300026118 Bacteria 3429
1002 Ga0207675_100187960 3300026118 Bacteria 1980
1003 Ga0207675_100265272 3300026118 Bacteria 1665
1004 Ga0207683_10131859 3300026121 Bacteria 2248
1005 Ga0207698_10014523 3300026142 Bacteria 5239
1006 Ga0207698_10023380 3300026142 Bacteria 4316
1007 Ga0207698_10090341 3300026142 Bacteria 2504
1008 Ga0207698_10151450 3300026142 Bacteria 2014
1009 Ga0207698_10246362 3300026142 Bacteria 1632
1010 Ga0207698_10297193 3300026142 Bacteria 1501
1011 Ga0207698_10463212 3300026142 Bacteria 1226
1012 Ga0209281_1000002 3300027111 Bacteria 1924012
1013 Ga0209371_1000090 3300027312 Bacteria 173119
1014 Ga0209969_1002539 3300027360 Bacteria 2527
1015 Ga0209995_1002095 3300027471 Bacteria 3137
1016 Ga0209970_1004272 3300027614 Bacteria 2376
1017 Ga0209282_1000003 3300027666 Bacteria 856377
1018 Ga0209282_1000015 3300027666 Bacteria 206531
1019 Ga0209974_10012453 3300027876 Bacteria 2844
1020 Ga0207428_10013577 3300027907 Bacteria 7108
1021 Ga0207428_10018863 3300027907 Bacteria 5885
1022 Ga0207428_10037005 3300027907 Bacteria 3974
1023 Ga0207428_10045632 3300027907 Bacteria 3528
1024 Ga0207428_10079853 3300027907 Bacteria 2557
1025 Ga0207428_10114348 3300027907 Bacteria 2074
1026 Ga0268266_10000008 3300028379 Bacteria 1161875
1027 Ga0268266_10002569 3300028379 Bacteria 19254
1028 Ga0268266_10008091 3300028379 Bacteria 9387
1029 Ga0268266_10048944 3300028379 Bacteria 3623
1030 Ga0268266_10076733 3300028379 Bacteria 2905
1031 Ga0268266_10276063 3300028379 Bacteria 1561
1032 Ga0268265_10004973 3300028380 Bacteria 9134
1033 Ga0268265_10010687 3300028380 Bacteria 6197
1034 Ga0268265_10038816 3300028380 Bacteria 3505
1035 Ga0268265_10304832 3300028380 Bacteria 1436
1036 Ga0268264_10000151 3300028381 Bacteria 158241
1037 Ga0268264_10010327 3300028381 Bacteria 7724
1038 Ga0268264_10011135 3300028381 Bacteria 7430
1039 Ga0265334_10008152 3300028573 Bacteria 4462
1040 Ga0265318_10007936 3300028577 Bacteria 4760
1041 Ga0307515_10005264 3300028794 Bacteria 26301
1042 Ga0307515_10159783 3300028794 Bacteria 2305
1043 Ga0307515_10193947 3300028794 Bacteria 1931
1044 Ga0265338_10000113 3300028800 Bacteria 150993
1045 Ga0265338_10000928 3300028800 Bacteria 49449
1046 Ga0265338_10009934 3300028800 Bacteria 11252
1047 Ga0265324_10006892 3300029957 Bacteria 4681
1048 Ga0265324_10010580 3300029957 Bacteria 3549
1049 Ga0268256_1000115 3300030500 Bacteria 116918
1050 Ga0316182_1100720 3300030745 Bacteria 3697
1051 Ga0265330_10035895 3300031235 Bacteria 2211
1052 Ga0265332_10001923 3300031238 Bacteria 10998
1053 Ga0265332_10071486 3300031238 Bacteria 1477
1054 Ga0265328_10000088 3300031239 Bacteria 47638
1055 Ga0265328_10053065 3300031239 Bacteria 1487
1056 Ga0265325_10042218 3300031241 Bacteria 2386
1057 Ga0265325_10061549 3300031241 Bacteria 1903
1058 Ga0265340_10072548 3300031247 Bacteria 1630
1059 Ga0265339_10000425 3300031249 Bacteria 33388
1060 Ga0265331_10003718 3300031250 Bacteria 9702
1061 Ga0265327_10000240 3300031251 Bacteria 109753
1062 Ga0265316_10014153 3300031344 Bacteria 7037
1063 Ga0265316_10065577 3300031344 Bacteria 2812
1064 Ga0307513_10076186 3300031456 Bacteria 3480
1065 Ga0307509_10000056 3300031507 Bacteria 157836
1066 Ga0307509_10148862 3300031507 Bacteria 2261
1067 Ga0307408_100000215 3300031548 Bacteria 61499
1068 Ga0307408_100000897 3300031548 Bacteria 23410
1069 Ga0307408_100001085 3300031548 Bacteria 20806
1070 Ga0307408_100031208 3300031548 Bacteria 3709
1071 Ga0307408_100036643 3300031548 Bacteria 3450
1072 Ga0307408_100044184 3300031548 Bacteria 3174
1073 Ga0307408_100125032 3300031548 Bacteria 1998
1074 Ga0265313_10000107 3300031595 Bacteria 83816
1075 Ga0265313_10022868 3300031595 Bacteria 3381
1076 Ga0307508_10056301 3300031616 Bacteria 3482
1077 Ga0307508_10067707 3300031616 Bacteria 3140
1078 Ga0265314_10021422 3300031711 Bacteria 4969
1079 Ga0265314_10025956 3300031711 Bacteria 4410
1080 Ga0265314_10036468 3300031711 Bacteria 3573
1081 Ga0265314_10146390 3300031711 Bacteria 1454
1082 Ga0265342_10043935 3300031712 Bacteria 2695
1083 Ga0265342_10064246 3300031712 Bacteria 2155
1084 Ga0307516_10000116 3300031730 Bacteria 92895
1085 Ga0307405_10017479 3300031731 Bacteria 3936
1086 Ga0307413_10063317 3300031824 Bacteria 2292
1087 Ga0307413_10090059 3300031824 Bacteria 1995
1088 Ga0307518_10058553 3300031838 Bacteria 2798
1089 Ga0307410_10124490 3300031852 Bacteria 1885
1090 Ga0307410_10248928 3300031852 Bacteria 1381
1091 Ga0307406_10020505 3300031901 Bacteria 3894
1092 Ga0307407_10268602 3300031903 Bacteria 1176
1093 Ga0307412_10000051 3300031911 Bacteria 150433
1094 Ga0307412_10002198 3300031911 Bacteria 10830
1095 Ga0307409_100454994 3300031995 Bacteria 1236
1096 Ga0307416_100113194 3300032002 Bacteria 2397
1097 Ga0307416_100360116 3300032002 Bacteria 1476
1098 Ga0307416_100436653 3300032002 Bacteria 1358
1099 Ga0307414_10056385 3300032004 Bacteria 2756
1100 Ga0307415_100013107 3300032126 Bacteria 4825
1101 Ga0307415_100073830 3300032126 Bacteria 2408
1102 Ga0307510_10000003 3300033180 Bacteria 756654
1103 Ga0307510_10019107 3300033180 Bacteria 8039
1104 Ga0373930_0003117 3300034816 Bacteria 2611
1105 Ga0373939_0039177 3300035114 Bacteria 1417
1106 Ga0373946_0088496 3300035171 Bacteria 1368
1107 Ga0373946_0128266 3300035171 Bacteria 1165
1108 Ga0373931_0024848 3300035691 Bacteria 3040
1109 Ga0373931_0165020 3300035691 Bacteria 1301
1110 Ga0373927_0061161 3300035695 Bacteria 2437
1111 Ga0373937_0075411 3300036401 Bacteria 3113
1112 Ga0373937_0077812 3300036401 Bacteria 3065
1113 Ga0373925_0060338 3300037068 Bacteria 2848
1114 Ga0395899_0000008 3300037312 Bacteria 567572
1115 Ga0395899_0000098 3300037312 Bacteria 151953
1116 Ga0395899_0000369 3300037312 Bacteria 54244
1117 Ga0395899_0000753 3300037312 Bacteria 32064
1118 Ga0395899_0006931 3300037312 Bacteria 8778
1119 Ga0395899_0037373 3300037312 Bacteria 3640
1120 Ga0395899_0064808 3300037312 Bacteria 2685
1121 Ga0395899_0072210 3300037312 Bacteria 2525
1122 Ga0395899_0187002 3300037312 Bacteria 1451
1123 Ga0395899_0222313 3300037312 Bacteria 1307
1124 Ga0395900_0000055 3300037418 Bacteria 219875
1125 Ga0395900_0000916 3300037418 Bacteria 38759
1126 Ga0395900_0002362 3300037418 Bacteria 20872
1127 Ga0395900_0012971 3300037418 Bacteria 8514
1128 Ga0395900_0036141 3300037418 Bacteria 5091
1129 Ga0395900_0127431 3300037418 Bacteria 2610
1130 Ga0395900_0154772 3300037418 Bacteria 2341
1131 Ga0395900_0401029 3300037418 Bacteria 1335
1132 Ga0395898_0000119 3300037466 Bacteria 209937
1133 Ga0395898_0000305 3300037466 Bacteria 116565
1134 Ga0395898_0000526 3300037466 Bacteria 73315
1135 Ga0395898_0103351 3300037466 Bacteria 2734
1136 Ga0395898_0204580 3300037466 Bacteria 1884
1137 Ga0395905_0000168 3300037471 Bacteria 107034
1138 Ga0395905_0000905 3300037471 Bacteria 38512
1139 Ga0395905_0010198 3300037471 Bacteria 9156
1140 Ga0395905_0060955 3300037471 Bacteria 3528
1141 Ga0395905_0202549 3300037471 Bacteria 1860
1142 Ga0395905_0232870 3300037471 Bacteria 1722
1143 Ga0395905_0363741 3300037471 Bacteria 1339
1144 Ga0395901_0000003 3300038443 Bacteria 701538
1145 Ga0395901_0000180 3300038443 Bacteria 81881
1146 Ga0395901_0000356 3300038443 Bacteria 55523
1147 Ga0395901_0000887 3300038443 Bacteria 32901
1148 Ga0395901_0008987 3300038443 Bacteria 10115
1149 Ga0395901_0045690 3300038443 Bacteria 4546
1150 Ga0395901_0046846 3300038443 Bacteria 4492
1151 Ga0395901_0047914 3300038443 Bacteria 4437
1152 Ga0395901_0092508 3300038443 Bacteria 3166
1153 Ga0395901_0103697 3300038443 Bacteria 2984
1154 Ga0436365_0415708 3300039437 Bacteria 5391
1155 Ga0436365_1114258 3300039437 Bacteria 2878
1156 Ga0436361_0256918 3300039447 Bacteria 6769
1157 Ga0436361_0350031 3300039447 Bacteria 10261
1158 Ga0436361_0384951 3300039447 Bacteria 1850
1159 Ga0436361_0605639 3300039447 Bacteria 2129
1160 Ga0436361_0636093 3300039447 Bacteria 1473
1161 Ga0436361_0746602 3300039447 Bacteria 58377
1162 Ga0436361_0911021 3300039447 Bacteria 4941
1163 Ga0451807_0338754 3300041486 Bacteria 2473
1164 Ga0439431_0020056 3300041997 Bacteria 1594
1165 Ga0439441_005187 3300042001 Bacteria 2010
1166 Ga0439448_0000631 3300042005 Bacteria 8305
1167 Ga0439448_0006508 3300042005 Bacteria 3363
1168 Ga0439450_012729 3300042008 Bacteria 1675
1169 Ga0450904_000579 3300042139 Bacteria 6852
1170 Ga0439434_0025853 3300042435 Bacteria 1773
1171 Ga0439459_0006415 3300042438 Bacteria 1959
1172 Ga0451577_0000345 3300042876 Bacteria 87020
1173 Ga0451577_0015801 3300042876 Bacteria 7005
1174 Ga0451577_0057999 3300042876 Bacteria 3451
1175 Ga0451577_0419034 3300042876 Bacteria 1216
1176 Ga0466969_0000424 3300044656 Bacteria 23084
1177 Ga0466969_0001151 3300044656 Bacteria 14248
1178 Ga0466969_0008755 3300044656 Bacteria 5363
1179 Ga0466969_0008822 3300044656 Bacteria 5345
1180 Ga0466969_0009116 3300044656 Bacteria 5262
1181 Ga0466969_0014590 3300044656 Bacteria 4130
1182 Ga0466972_0000111 3300044658 Bacteria 70764
1183 Ga0466972_0031456 3300044658 Bacteria 2609
1184 Ga0466972_0102628 3300044658 Bacteria 1353
1185 Ga0466989_0116279 3300044663 Bacteria 1636
1186 Ga0466982_0000004 3300044672 Bacteria 386724
1187 Ga0466982_0082218 3300044672 Bacteria 1995
1188 Ga0453683_0000611 3300044673 Bacteria 39117
1189 Ga0466965_0002035 3300044683 Bacteria 8471
1190 Ga0466965_0008216 3300044683 Bacteria 4820
1191 Ga0466965_0054440 3300044683 Bacteria 1989
1192 Ga0466966_0002831 3300044684 Bacteria 11416
1193 Ga0466966_0003802 3300044684 Bacteria 9957
1194 Ga0466966_0014518 3300044684 Bacteria 5213
1195 Ga0466966_0019158 3300044684 Bacteria 4504
1196 Ga0466966_0030085 3300044684 Bacteria 3528
1197 Ga0466966_0081290 3300044684 Bacteria 2017
1198 Ga0466966_0153083 3300044684 Bacteria 1405
1199 Ga0466961_0000063 3300044693 Bacteria 64438
1200 Ga0466961_0001025 3300044693 Bacteria 17250
1201 Ga0466961_0001718 3300044693 Bacteria 13622
1202 Ga0466961_0002804 3300044693 Bacteria 10838
1203 Ga0466961_0003495 3300044693 Bacteria 9795
1204 Ga0466961_0006712 3300044693 Bacteria 7323
1205 Ga0466961_0009045 3300044693 Bacteria 6353
1206 Ga0466961_0016012 3300044693 Bacteria 4813
1207 Ga0466961_0148196 3300044693 Bacteria 1466
1208 Ga0466963_0002167 3300044694 Bacteria 10844
1209 Ga0466964_0000834 3300044706 Bacteria 10087
1210 Ga0466964_0006952 3300044706 Bacteria 4228
1211 Ga0453684_0000029 3300044712 Bacteria 757969
1212 Ga0453684_0000065 3300044712 Bacteria 468481
1213 Ga0453684_0205688 3300044712 Bacteria 2291
1214 Ga0466971_0081427 3300044719 Bacteria 1476
1215 Ga0466968_0029647 3300044735 Bacteria 2263
1216 Ga0466968_0062903 3300044735 Bacteria 1603
1217 Ga0466970_0005868 3300044765 Bacteria 6113
1218 Ga0466970_0006560 3300044765 Bacteria 5816
1219 Ga0466970_0011697 3300044765 Bacteria 4476
1220 Ga0466970_0052556 3300044765 Bacteria 2175
1221 Ga0466970_0054143 3300044765 Bacteria 2143
1222 Ga0466970_0056656 3300044765 Bacteria 2094
1223 Ga0466970_0133261 3300044765 Bacteria 1366
1224 Ga0466957_0011252 3300044842 Bacteria 5153
1225 Ga0466957_0037293 3300044842 Bacteria 2926
1226 Ga0466960_0099149 3300044901 Bacteria 1497
1227 Ga0466959_0012272 3300045049 Bacteria 6184
1228 Ga0466959_0014087 3300045049 Bacteria 5805
1229 Ga0466959_0017018 3300045049 Bacteria 5321
1230 Ga0466959_0037546 3300045049 Bacteria 3580
1231 Ga0466959_0043885 3300045049 Bacteria 3295
1232 Ga0466959_0062636 3300045049 Bacteria 2702
1233 Ga0466959_0069281 3300045049 Bacteria 2556
1234 Ga0466959_0096243 3300045049 Bacteria 2123
1235 Ga0466959_0138345 3300045049 Bacteria 1722
1236 Ga0466959_0154517 3300045049 Bacteria 1615
1237 Ga0451576_0007632 3300045051 Bacteria 12867
1238 Ga0451576_0008493 3300045051 Bacteria 12048
1239 Ga0451576_0031274 3300045051 Bacteria 5678
1240 Ga0451576_0367927 3300045051 Bacteria 1506
1241 Ga0466958_0001624 3300045836 Bacteria 10811
1242 Ga0466967_0108189 3300045976 Bacteria 2551
1243 Ga0495617_000014 3300046452 Bacteria 286979
1244 Ga0495617_000388 3300046452 Bacteria 24290
1245 Ga0495617_000402 3300046452 Bacteria 23959
1246 Ga0495617_011283 3300046452 Bacteria 3049
1247 Ga0495627_000033 3300046453 Bacteria 220621
1248 Ga0495627_000768 3300046453 Bacteria 23862
1249 Ga0495627_030432 3300046453 Bacteria 1710
1250 Ga0495592_0053492 3300046454 Bacteria 2994
1251 Ga0495592_0061664 3300046454 Bacteria 2755
1252 Ga0495603_0004733 3300046455 Bacteria 8130
1253 Ga0495603_0013901 3300046455 Bacteria 4870
1254 Ga0495603_0074633 3300046455 Bacteria 1991
1255 Ga0495590_0000019 3300046457 Bacteria 213272
1256 Ga0495590_0000063 3300046457 Bacteria 81777
1257 Ga0495590_0000583 3300046457 Bacteria 17230
1258 Ga0495590_0001195 3300046457 Bacteria 11354
1259 Ga0495590_0002879 3300046457 Bacteria 7084
1260 Ga0495590_0004217 3300046457 Bacteria 5813
1261 Ga0495590_0048218 3300046457 Bacteria 1486
1262 Ga0495591_000391 3300046458 Bacteria 36958
1263 Ga0495591_031800 3300046458 Bacteria 1579
1264 Ga0495629_0000369 3300046459 Bacteria 38164
1265 Ga0495629_0001732 3300046459 Bacteria 17109
1266 Ga0495629_0002022 3300046459 Bacteria 15772
1267 Ga0495629_0019989 3300046459 Bacteria 4779
1268 Ga0495629_0088581 3300046459 Bacteria 2159
1269 Ga0495629_0148519 3300046459 Bacteria 1629
1270 Ga0495638_0000007 3300046460 Bacteria 602783
1271 Ga0495638_0000080 3300046460 Bacteria 155967
1272 Ga0495638_0000194 3300046460 Bacteria 88601
1273 Ga0495638_0000213 3300046460 Bacteria 81547
1274 Ga0495638_0000630 3300046460 Bacteria 38937
1275 Ga0495638_0001012 3300046460 Bacteria 27974
1276 Ga0495641_0074103 3300046461 Bacteria 1527
1277 Ga0495651_0021665 3300046462 Bacteria 4996
1278 Ga0495651_0090443 3300046462 Bacteria 2296
1279 Ga0495651_0119778 3300046462 Bacteria 1935
1280 Ga0495651_0165718 3300046462 Bacteria 1578
1281 Ga0495653_0000008 3300046463 Bacteria 307868
1282 Ga0495653_0001073 3300046463 Bacteria 21089
1283 Ga0495653_0013796 3300046463 Bacteria 6584
1284 Ga0495653_0015094 3300046463 Bacteria 6295
1285 Ga0495653_0020707 3300046463 Bacteria 5327
1286 Ga0495653_0022928 3300046463 Bacteria 5048
1287 Ga0495653_0121766 3300046463 Bacteria 1858
1288 Ga0495650_0000142 3300046471 Bacteria 168326
1289 Ga0495650_0000202 3300046471 Bacteria 129910
1290 Ga0495650_0000260 3300046471 Bacteria 101837
1291 Ga0495650_0000441 3300046471 Bacteria 66713
1292 Ga0495650_0000619 3300046471 Bacteria 48090
1293 Ga0495650_0000661 3300046471 Bacteria 45124
1294 Ga0495650_0000794 3300046471 Bacteria 38671
1295 Ga0495650_0002502 3300046471 Bacteria 14753
1296 Ga0495650_0008713 3300046471 Bacteria 5873
1297 Ga0495650_0023993 3300046471 Bacteria 2890
1298 Ga0495650_0033479 3300046471 Bacteria 2287
1299 Ga0495580_0012174 3300046472 Bacteria 6612
1300 Ga0495580_0018128 3300046472 Bacteria 5245
1301 Ga0495580_0021261 3300046472 Bacteria 4788
1302 Ga0495580_0071262 3300046472 Bacteria 2427
1303 Ga0495580_0145884 3300046472 Bacteria 1640
1304 Ga0495582_0005153 3300046473 Bacteria 7315
1305 Ga0495582_0093805 3300046473 Bacteria 1675
1306 Ga0495605_0000010 3300046474 Bacteria 319487
1307 Ga0495605_0000265 3300046474 Bacteria 59855
1308 Ga0495605_0000329 3300046474 Bacteria 47910
1309 Ga0495605_0001429 3300046474 Bacteria 15661
1310 Ga0495605_0002857 3300046474 Bacteria 10503
1311 Ga0495605_0005746 3300046474 Bacteria 7193
1312 Ga0495605_0009499 3300046474 Bacteria 5462
1313 Ga0495605_0025286 3300046474 Bacteria 3095
1314 Ga0495605_0092422 3300046474 Bacteria 1400
1315 Ga0495662_0031130 3300046476 Bacteria 2577
1316 Ga0495664_0011074 3300046477 Bacteria 5074
1317 Ga0495664_0013672 3300046477 Bacteria 4606
1318 Ga0495584_0000015 3300046491 Bacteria 169335
1319 Ga0495584_0000744 3300046491 Bacteria 21510
1320 Ga0495584_0001039 3300046491 Bacteria 17327
1321 Ga0495584_0003653 3300046491 Bacteria 8390
1322 Ga0495584_0004275 3300046491 Bacteria 7697
1323 Ga0495584_0007236 3300046491 Bacteria 5791
1324 Ga0495584_0012578 3300046491 Bacteria 4320
1325 Ga0495584_0092134 3300046491 Bacteria 1528
1326 Ga0495584_0093470 3300046491 Bacteria 1517
1327 Ga0495585_0000934 3300046492 Bacteria 24637
1328 Ga0495585_0001705 3300046492 Bacteria 16750
1329 Ga0495585_0005136 3300046492 Bacteria 8320
1330 Ga0495585_0007927 3300046492 Bacteria 6457
1331 Ga0495585_0014225 3300046492 Bacteria 4640
1332 Ga0495585_0041492 3300046492 Bacteria 2580
1333 Ga0495585_0148703 3300046492 Bacteria 1222
1334 Ga0495594_0007446 3300046499 Bacteria 5631
1335 Ga0495594_0116316 3300046499 Bacteria 1510
1336 Ga0495594_0184909 3300046499 Bacteria 1186
1337 Ga0495596_0000131 3300046500 Bacteria 51880
1338 Ga0495596_0001179 3300046500 Bacteria 15303
1339 Ga0495596_0022086 3300046500 Bacteria 2592
1340 Ga0495596_0022278 3300046500 Bacteria 2579
1341 Ga0495596_0033704 3300046500 Bacteria 2037
1342 Ga0495607_0002493 3300046501 Bacteria 14911
1343 Ga0495607_0010144 3300046501 Bacteria 6339
1344 Ga0495607_0012133 3300046501 Bacteria 5698
1345 Ga0495607_0014831 3300046501 Bacteria 5064
1346 Ga0495607_0034897 3300046501 Bacteria 3048
1347 Ga0495583_0000057 3300046506 Bacteria 200688
1348 Ga0495583_0000064 3300046506 Bacteria 192380
1349 Ga0495583_0000664 3300046506 Bacteria 45084
1350 Ga0495583_0001002 3300046506 Bacteria 32330
1351 Ga0495583_0001232 3300046506 Bacteria 27204
1352 Ga0495583_0001355 3300046506 Bacteria 25382
1353 Ga0495583_0002267 3300046506 Bacteria 16886
1354 Ga0495583_0002401 3300046506 Bacteria 16094
1355 Ga0495583_0006866 3300046506 Bacteria 7326
1356 Ga0495583_0007478 3300046506 Bacteria 6849
1357 Ga0495583_0013734 3300046506 Bacteria 4497
1358 Ga0495583_0060211 3300046506 Bacteria 1698
1359 Ga0495606_0000004 3300046507 Bacteria 406209
1360 Ga0495606_0000492 3300046507 Bacteria 64591
1361 Ga0495606_0000855 3300046507 Bacteria 45752
1362 Ga0495606_0001151 3300046507 Bacteria 37509
1363 Ga0495606_0003053 3300046507 Bacteria 18247
1364 Ga0495606_0008529 3300046507 Bacteria 8882
1365 Ga0495606_0011389 3300046507 Bacteria 7258
1366 Ga0495606_0021227 3300046507 Bacteria 4760
1367 Ga0495606_0033343 3300046507 Bacteria 3552
1368 Ga0495606_0059705 3300046507 Bacteria 2445
1369 Ga0495606_0083294 3300046507 Bacteria 1983
1370 Ga0495606_0130087 3300046507 Bacteria 1497
1371 Ga0495606_0158943 3300046507 Bacteria 1320
1372 Ga0495608_0025813 3300046511 Bacteria 4010
1373 Ga0495608_0089959 3300046511 Bacteria 1986
1374 Ga0495610_0000007 3300046512 Bacteria 820919
1375 Ga0495610_0001088 3300046512 Bacteria 24861
1376 Ga0495610_0001328 3300046512 Bacteria 21959
1377 Ga0495610_0014790 3300046512 Bacteria 4568
1378 Ga0495610_0014947 3300046512 Bacteria 4535
1379 Ga0495616_0000273 3300046513 Bacteria 41880
1380 Ga0495616_0000884 3300046513 Bacteria 21745
1381 Ga0495616_0003127 3300046513 Bacteria 10698
1382 Ga0495616_0005103 3300046513 Bacteria 8159
1383 Ga0495616_0005215 3300046513 Bacteria 8032
1384 Ga0495616_0010944 3300046513 Bacteria 5221
1385 Ga0495616_0023428 3300046513 Bacteria 3320
1386 Ga0495616_0063896 3300046513 Bacteria 1798
1387 Ga0495618_0007782 3300046514 Bacteria 6484
1388 Ga0495620_0018320 3300046515 Bacteria 3469
1389 Ga0495620_0042858 3300046515 Bacteria 1974
1390 Ga0495620_0082844 3300046515 Bacteria 1296
1391 Ga0495628_0000452 3300046516 Bacteria 37463
1392 Ga0495628_0067174 3300046516 Bacteria 2800
1393 Ga0495628_0093529 3300046516 Bacteria 2325
1394 Ga0495628_0193999 3300046516 Bacteria 1533
1395 Ga0495630_0113068 3300046517 Bacteria 2056
1396 Ga0495631_0000335 3300046518 Bacteria 32331
1397 Ga0495631_0002223 3300046518 Bacteria 11158
1398 Ga0495631_0005710 3300046518 Bacteria 6488
1399 Ga0495631_0006702 3300046518 Bacteria 5914
1400 Ga0495631_0015249 3300046518 Bacteria 3687
1401 Ga0495631_0015644 3300046518 Bacteria 3629
1402 Ga0495631_0081817 3300046518 Bacteria 1393
1403 Ga0495632_0000172 3300046519 Bacteria 66341
1404 Ga0495632_0000503 3300046519 Bacteria 36843
1405 Ga0495632_0001133 3300046519 Bacteria 22770
1406 Ga0495632_0002116 3300046519 Bacteria 15504
1407 Ga0495632_0004199 3300046519 Bacteria 9848
1408 Ga0495632_0008651 3300046519 Bacteria 6215
1409 Ga0495632_0019432 3300046519 Bacteria 3701
1410 Ga0495632_0044331 3300046519 Bacteria 2220
1411 Ga0495632_0063450 3300046519 Bacteria 1788
1412 Ga0495632_0078081 3300046519 Bacteria 1582
1413 Ga0495637_0000011 3300046520 Bacteria 337279
1414 Ga0495643_0000546 3300046522 Bacteria 46609
1415 Ga0495643_0001377 3300046522 Bacteria 22754
1416 Ga0495643_0002137 3300046522 Bacteria 16286
1417 Ga0495643_0009472 3300046522 Bacteria 6052
1418 Ga0495643_0034805 3300046522 Bacteria 2776
1419 Ga0495643_0040501 3300046522 Bacteria 2545
1420 Ga0495643_0044239 3300046522 Bacteria 2420
1421 Ga0495644_0003192 3300046523 Bacteria 6476
1422 Ga0495644_0010856 3300046523 Bacteria 3509
1423 Ga0495644_0011824 3300046523 Bacteria 3358
1424 Ga0495644_0018921 3300046523 Bacteria 2628
1425 Ga0495644_0021150 3300046523 Bacteria 2481
1426 Ga0495644_0028360 3300046523 Bacteria 2118
1427 Ga0495648_0000010 3300046524 Bacteria 307259
1428 Ga0495648_0000136 3300046524 Bacteria 87034
1429 Ga0495648_0003686 3300046524 Bacteria 13391
1430 Ga0495648_0006786 3300046524 Bacteria 9257
1431 Ga0495648_0010053 3300046524 Bacteria 7252
1432 Ga0495648_0042216 3300046524 Bacteria 2871
1433 Ga0495648_0050175 3300046524 Bacteria 2552
1434 Ga0495666_0000664 3300046526 Bacteria 15535
1435 Ga0495666_0005726 3300046526 Bacteria 6263
1436 Ga0495666_0005909 3300046526 Bacteria 6167
1437 Ga0495666_0016331 3300046526 Bacteria 3698
1438 Ga0495666_0019306 3300046526 Bacteria 3384
1439 Ga0495642_0000626 3300046528 Bacteria 17715
1440 Ga0495642_0011959 3300046528 Bacteria 3342
1441 Ga0495642_0026348 3300046528 Bacteria 2308
1442 Ga0495652_0051789 3300046529 Bacteria 3503
1443 Ga0495652_0143781 3300046529 Bacteria 1872
1444 Ga0495652_0211735 3300046529 Bacteria 1462
1445 Ga0495654_0000138 3300046530 Bacteria 75976
1446 Ga0495654_0005496 3300046530 Bacteria 7344
1447 Ga0495665_0002601 3300046531 Bacteria 9732
1448 Ga0495665_0034527 3300046531 Bacteria 2704
1449 Ga0495640_0017424 3300046533 Bacteria 5355
1450 Ga0495640_0024613 3300046533 Bacteria 4378
1451 Ga0495586_0006105 3300046535 Bacteria 6440
1452 Ga0495586_0012925 3300046535 Bacteria 4426
1453 Ga0495586_0043186 3300046535 Bacteria 2428
1454 Ga0495586_0050708 3300046535 Bacteria 2245
1455 Ga0495586_0154863 3300046535 Bacteria 1290
1456 Ga0495587_0033202 3300046536 Bacteria 3116
1457 Ga0495587_0069740 3300046536 Bacteria 2046
1458 Ga0495609_0001322 3300046538 Bacteria 16826
1459 Ga0495609_0001761 3300046538 Bacteria 13899
1460 Ga0495609_0004412 3300046538 Bacteria 7704
1461 Ga0495609_0027561 3300046538 Bacteria 2595
1462 Ga0495609_0029425 3300046538 Bacteria 2501
1463 Ga0495609_0054660 3300046538 Bacteria 1772
1464 Ga0495609_0109267 3300046538 Bacteria 1194
1465 Ga0495597_0000585 3300046542 Bacteria 30148
1466 Ga0495597_0000970 3300046542 Bacteria 22196
1467 Ga0495597_0001130 3300046542 Bacteria 20141
1468 Ga0495597_0001277 3300046542 Bacteria 18559
1469 Ga0495597_0004344 3300046542 Bacteria 7815
1470 Ga0495597_0011733 3300046542 Bacteria 4244
1471 Ga0495597_0013021 3300046542 Bacteria 3994
1472 Ga0495645_0026831 3300046543 Bacteria 4183
1473 Ga0495645_0141464 3300046543 Bacteria 1678
1474 Ga0495622_0000138 3300046557 Bacteria 62442
1475 Ga0495622_0004708 3300046557 Bacteria 6325
1476 Ga0495622_0017848 3300046557 Bacteria 3304
1477 Ga0495622_0036691 3300046557 Bacteria 2284
1478 Ga0495633_0000806 3300046558 Bacteria 27878
1479 Ga0495633_0001664 3300046558 Bacteria 16767
1480 Ga0495633_0008051 3300046558 Bacteria 5992
1481 Ga0495633_0020740 3300046558 Bacteria 3300
1482 Ga0495667_0144583 3300046559 Bacteria 1532
1483 Ga0495656_0016056 3300046615 Bacteria 2837
1484 Ga0495656_0024436 3300046615 Bacteria 2386
1485 Ga0495668_0000030 3300046616 Bacteria 262663
1486 Ga0495668_0000042 3300046616 Bacteria 229361
1487 Ga0495668_0000156 3300046616 Bacteria 103647
1488 Ga0495668_0000813 3300046616 Bacteria 35763
1489 Ga0495668_0001480 3300046616 Bacteria 22498
1490 Ga0495668_0001800 3300046616 Bacteria 19552
1491 Ga0495668_0001939 3300046616 Bacteria 18419
1492 Ga0495668_0002158 3300046616 Bacteria 16893
1493 Ga0495668_0009428 3300046616 Bacteria 5997
1494 Ga0495668_0012880 3300046616 Bacteria 4951
1495 Ga0495668_0025466 3300046616 Bacteria 3361
1496 Ga0495668_0038630 3300046616 Bacteria 2666
1497 Ga0495668_0042037 3300046616 Bacteria 2544
1498 Ga0495668_0045466 3300046616 Bacteria 2441
1499 Ga0495634_0027058 3300046642 Bacteria 3994
1500 Ga0495634_0069035 3300046642 Bacteria 2333
1501 Ga0495611_0000502 3300046648 Bacteria 23257
1502 Ga0495611_0003647 3300046648 Bacteria 6751
1503 Ga0495611_0004405 3300046648 Bacteria 6092
1504 Ga0495611_0014732 3300046648 Bacteria 3343
1505 Ga0495611_0018021 3300046648 Bacteria 3025
1506 Ga0495611_0091762 3300046648 Bacteria 1404
1507 Ga0495625_0000230 3300046660 Bacteria 88194
1508 Ga0495625_0002735 3300046660 Bacteria 18688
1509 Ga0495625_0003018 3300046660 Bacteria 17327
1510 Ga0495625_0018007 3300046660 Bacteria 5520
1511 Ga0495625_0026421 3300046660 Bacteria 4387
1512 Ga0495625_0032374 3300046660 Bacteria 3877
1513 Ga0495635_0024052 3300046663 Bacteria 4246
1514 Ga0495635_0025333 3300046663 Bacteria 4131
1515 Ga0495659_0005040 3300046664 Bacteria 4150
1516 Ga0495659_0034292 3300046664 Bacteria 1784
1517 Ga0495661_0001601 3300046665 Bacteria 18599
1518 Ga0495661_0001662 3300046665 Bacteria 18118
1519 Ga0495661_0002270 3300046665 Bacteria 14873
1520 Ga0495661_0022366 3300046665 Bacteria 4113
1521 Ga0495661_0045472 3300046665 Bacteria 2684
1522 Ga0495661_0059203 3300046665 Bacteria 2280
1523 Ga0495588_0000190 3300046674 Bacteria 66733
1524 Ga0495588_0034693 3300046674 Bacteria 2553
1525 Ga0495588_0063380 3300046674 Bacteria 1917
1526 Ga0495599_0016515 3300046678 Bacteria 4583
1527 Ga0495599_0031771 3300046678 Bacteria 3314
1528 Ga0495623_0008543 3300046679 Bacteria 6651
1529 Ga0495623_0014392 3300046679 Bacteria 5120
1530 Ga0495623_0033945 3300046679 Bacteria 3273
1531 Ga0495646_0016028 3300046680 Bacteria 4756
1532 Ga0495646_0077132 3300046680 Bacteria 1949
1533 Ga0495646_0137098 3300046680 Bacteria 1372
1534 Ga0495647_0096854 3300046681 Bacteria 1217
1535 Ga0495669_0005169 3300046684 Bacteria 5427
1536 Ga0495669_0005310 3300046684 Bacteria 5369
1537 Ga0495613_0023290 3300046689 Bacteria 4613
1538 Ga0495613_0068070 3300046689 Bacteria 2597
1539 Ga0495624_0009205 3300046690 Bacteria 6843
1540 Ga0495624_0055550 3300046690 Bacteria 2493
1541 Ga0495670_0002937 3300046691 Bacteria 8402
1542 Ga0495670_0003059 3300046691 Bacteria 8252
1543 Ga0495670_0013254 3300046691 Bacteria 4055
1544 Ga0495670_0022504 3300046691 Bacteria 3111
1545 Ga0495670_0052760 3300046691 Bacteria 2036
1546 Ga0495670_0076333 3300046691 Bacteria 1702
1547 Ga0495671_0000009 3300046692 Bacteria 369875
1548 Ga0495671_0000783 3300046692 Bacteria 22850
1549 Ga0495649_0000308 3300046694 Bacteria 42949
1550 Ga0495649_0001493 3300046694 Bacteria 17572
1551 Ga0495649_0007267 3300046694 Bacteria 6776
1552 Ga0495649_0027003 3300046694 Bacteria 3187
1553 Ga0495649_0032167 3300046694 Bacteria 2891
1554 Ga0495649_0040578 3300046694 Bacteria 2548
1555 Ga0495649_0051480 3300046694 Bacteria 2232
1556 Ga0495589_0000268 3300046794 Bacteria 42231
1557 Ga0495589_0000556 3300046794 Bacteria 25767
1558 Ga0495589_0000950 3300046794 Bacteria 17773
1559 Ga0495589_0010560 3300046794 Bacteria 4801
1560 Ga0495589_0019930 3300046794 Bacteria 3430
1561 Ga0495589_0020790 3300046794 Bacteria 3355
1562 Ga0495589_0022926 3300046794 Bacteria 3182
1563 Ga0495600_0000669 3300046809 Bacteria 17848
1564 Ga0495600_0009442 3300046809 Bacteria 6026
1565 Ga0495600_0036734 3300046809 Bacteria 3183
1566 Ga0495600_0083988 3300046809 Bacteria 2078
1567 Ga0495660_0000228 3300046810 Bacteria 55386
1568 Ga0495660_0000434 3300046810 Bacteria 35063
1569 Ga0495660_0014157 3300046810 Bacteria 4618
1570 Ga0495660_0026344 3300046810 Bacteria 3297
1571 Ga0495660_0099301 3300046810 Bacteria 1500
1572 Ga0495660_0104040 3300046810 Bacteria 1457
1573 Ga0495581_0009319 3300047315 Bacteria 5682
1574 Ga0495581_0024799 3300047315 Bacteria 3475
1575 Ga0495604_0005844 3300047317 Bacteria 9753
1576 Ga0495604_0013780 3300047317 Bacteria 6446
1577 Ga0495604_0016126 3300047317 Bacteria 5968
1578 Ga0495604_0025632 3300047317 Bacteria 4696
1579 Ga0495604_0156408 3300047317 Bacteria 1614
1580 Ga0495604_0191096 3300047317 Bacteria 1426
1581 Ga0495636_0002722 3300047318 Bacteria 6816
1582 Ga0495674_0026221 3300047319 Bacteria 5334
1583 Ga0495674_0031744 3300047319 Bacteria 4795
1584 Ga0495674_0063328 3300047319 Bacteria 3217
1585 Ga0495674_0119296 3300047319 Bacteria 2229
1586 Ga0495674_0124040 3300047319 Bacteria 2180
1587 Ga0495674_0182961 3300047319 Bacteria 1744
1588 Ga0495672_0000005 3300047320 Bacteria 593294
1589 Ga0495672_0000307 3300047320 Bacteria 65630
1590 Ga0495672_0000478 3300047320 Bacteria 47432
1591 Ga0495672_0001397 3300047320 Bacteria 23769
1592 Ga0495672_0002512 3300047320 Bacteria 16771
1593 Ga0495672_0004558 3300047320 Bacteria 11273
1594 Ga0495672_0007005 3300047320 Bacteria 8566
1595 Ga0495672_0012960 3300047320 Bacteria 5778
1596 Ga0495676_0026138 3300047321 Bacteria 5029
1597 Ga0495680_0014185 3300047322 Bacteria 6913
1598 Ga0495680_0095146 3300047322 Bacteria 2227
1599 Ga0495680_0098210 3300047322 Bacteria 2185
1600 Ga0495680_0133702 3300047322 Bacteria 1820
1601 Ga0495683_0000463 3300047323 Bacteria 31770
1602 Ga0495683_0001047 3300047323 Bacteria 19247
1603 Ga0495683_0001779 3300047323 Bacteria 13595
1604 Ga0495683_0004756 3300047323 Bacteria 7629
1605 Ga0495683_0021351 3300047323 Bacteria 3336
1606 Ga0495683_0030704 3300047323 Bacteria 2740
1607 Ga0495683_0033762 3300047323 Bacteria 2602
1608 Ga0495683_0044623 3300047323 Bacteria 2229
1609 Ga0495683_0048814 3300047323 Bacteria 2121
1610 Ga0495683_0050537 3300047323 Bacteria 2080
1611 Ga0495683_0062177 3300047323 Bacteria 1847
1612 Ga0495683_0085366 3300047323 Bacteria 1535
1613 Ga0495687_000011 3300047443 Bacteria 397225
1614 Ga0495687_000501 3300047443 Bacteria 47229
1615 Ga0495687_000553 3300047443 Bacteria 44387
1616 Ga0495687_000953 3300047443 Bacteria 29700
1617 Ga0495687_001634 3300047443 Bacteria 20166
1618 Ga0495687_004979 3300047443 Bacteria 8682
1619 Ga0495687_013679 3300047443 Bacteria 4218
1620 Ga0495687_022194 3300047443 Bacteria 3053
1621 Ga0495687_027761 3300047443 Bacteria 2644
1622 Ga0495687_080218 3300047443 Bacteria 1280
1623 Ga0495675_0001035 3300047444 Bacteria 16891
1624 Ga0495675_0003175 3300047444 Bacteria 9871
1625 Ga0495675_0007425 3300047444 Bacteria 6751
1626 Ga0495675_0057385 3300047444 Bacteria 2468
1627 Ga0495675_0081127 3300047444 Bacteria 2042
1628 Ga0495677_0003135 3300047445 Bacteria 6446
1629 Ga0495677_0004229 3300047445 Bacteria 5530
1630 Ga0495677_0007326 3300047445 Bacteria 4126
1631 Ga0495677_0007873 3300047445 Bacteria 3965
1632 Ga0495677_0012256 3300047445 Bacteria 3128
1633 Ga0495677_0043170 3300047445 Bacteria 1652
1634 Ga0495679_000109 3300047446 Bacteria 74134
1635 Ga0495679_002394 3300047446 Bacteria 9582
1636 Ga0495679_004223 3300047446 Bacteria 6685
1637 Ga0495679_005307 3300047446 Bacteria 5735
1638 Ga0495679_015689 3300047446 Bacteria 2762
1639 Ga0495685_000457 3300047447 Bacteria 12733
1640 Ga0495685_001471 3300047447 Bacteria 7226
1641 Ga0495685_062294 3300047447 Bacteria 1256
1642 Ga0495673_0000031 3300047469 Bacteria 447868
1643 Ga0495673_0000032 3300047469 Bacteria 375856
1644 Ga0495673_0000083 3300047469 Bacteria 198298
1645 Ga0495673_0000327 3300047469 Bacteria 61352
1646 Ga0495673_0007069 3300047469 Bacteria 6510
1647 Ga0495673_0021483 3300047469 Bacteria 3185
1648 Ga0495673_0028713 3300047469 Bacteria 2632
1649 Ga0495681_0000761 3300047470 Bacteria 24853
1650 Ga0495681_0030241 3300047470 Bacteria 2760
1651 Ga0495681_0047434 3300047470 Bacteria 2043
1652 Ga0495686_0000014 3300047472 Bacteria 474014
1653 Ga0495686_0000755 3300047472 Bacteria 42641
1654 Ga0495686_0000977 3300047472 Bacteria 35016
1655 Ga0495686_0001018 3300047472 Bacteria 33917
1656 Ga0495686_0007445 3300047472 Bacteria 8208
1657 Ga0495686_0009435 3300047472 Bacteria 7029
1658 Ga0495686_0011007 3300047472 Bacteria 6398
1659 Ga0495686_0030229 3300047472 Bacteria 3519
1660 Ga0495686_0081525 3300047472 Bacteria 1975
1661 Ga0495686_0089942 3300047472 Bacteria 1865
1662 Ga0495686_0125096 3300047472 Bacteria 1529
1663 Ga0495593_0007804 3300047673 Bacteria 6238
1664 Ga0495593_0011155 3300047673 Bacteria 5166
1665 Ga0495593_0018797 3300047673 Bacteria 3879
1666 Ga0495602_0014017 3300048088 Bacteria 8158
1667 Ga0495602_0014087 3300048088 Bacteria 8132
1668 Ga0495602_0032795 3300048088 Bacteria 4885
1669 Ga0495602_0097348 3300048088 Bacteria 2424
1670 Ga0495602_0155554 3300048088 Bacteria 1790
1671 Ga0495614_0036590 3300048089 Bacteria 2107
1672 Ga0495626_0000050 3300048091 Bacteria 160905
1673 Ga0495626_0000418 3300048091 Bacteria 43563
1674 Ga0495626_0002775 3300048091 Bacteria 11743
1675 Ga0495626_0004385 3300048091 Bacteria 8684
1676 Ga0495626_0004864 3300048091 Bacteria 8082
1677 Ga0495626_0005212 3300048091 Bacteria 7693
1678 Ga0495626_0073264 3300048091 Bacteria 1534
1679 Ga0495626_0114498 3300048091 Bacteria 1164
1680 Ga0496100_0002540 3300048903 Bacteria 9300
1681 Ga0496100_0144844 3300048903 Bacteria 1688
1682 Ga0496101_0002266 3300048904 Bacteria 11752
1683 Ga0496101_0009354 3300048904 Bacteria 6440
1684 Ga0496101_0011612 3300048904 Bacteria 5850
1685 Ga0496101_0268121 3300048904 Bacteria 1333
1686 Ga0496102_0000195 3300048905 Bacteria 82956
1687 Ga0496102_0000280 3300048905 Bacteria 65060
1688 Ga0496102_0014162 3300048905 Bacteria 6929
1689 Ga0496102_0097093 3300048905 Bacteria 2732
1690 Ga0496102_0102880 3300048905 Bacteria 2655
1691 Ga0496102_0480819 3300048905 Bacteria 1163
1692 Ga0496103_0003274 3300048906 Bacteria 9919
1693 Ga0496103_0027373 3300048906 Bacteria 3454
1694 Ga0496104_0105944 3300048907 Bacteria 2694
1695 Ga0496104_0203621 3300048907 Bacteria 1891
1696 Ga0496105_0025274 3300048908 Bacteria 4833
1697 Ga0496105_0028899 3300048908 Bacteria 4536
1698 Ga0496105_0171506 3300048908 Bacteria 1778
1699 Ga0496106_0000031 3300048909 Bacteria 135370
1700 Ga0496106_0001378 3300048909 Bacteria 18213
1701 Ga0496107_0000539 3300048910 Bacteria 21157
1702 Ga0496107_0015987 3300048910 Bacteria 5265
1703 Ga0496107_0022836 3300048910 Bacteria 4423
1704 Ga0496107_0077551 3300048910 Bacteria 2420
1705 Ga0496108_0000501 3300048911 Bacteria 30958
1706 Ga0496109_0003612 3300048912 Bacteria 12932
1707 Ga0496109_0016209 3300048912 Bacteria 6513
1708 Ga0496110_0000035 3300048913 Bacteria 64945
1709 Ga0496110_0044382 3300048913 Bacteria 3882
1710 Ga0496110_0055980 3300048913 Bacteria 3471
1711 Ga0496110_0187292 3300048913 Bacteria 1879
1712 Ga0496111_0015892 3300048914 Bacteria 5176
1713 Ga0496112_0042549 3300048915 Bacteria 4444
1714 Ga0496112_0068558 3300048915 Bacteria 3503
1715 Ga0496112_0219560 3300048915 Bacteria 1857
1716 Ga0496114_0028544 3300048917 Bacteria 4579
1717 Ga0496114_0152361 3300048917 Bacteria 2006
1718 Ga0496114_0388479 3300048917 Bacteria 1236
1719 Ga0496115_0000337 3300048918 Bacteria 39950
1720 Ga0496115_0000901 3300048918 Bacteria 21555
1721 Ga0496115_0004887 3300048918 Bacteria 9732
1722 Ga0496115_0064497 3300048918 Bacteria 2957
1723 Ga0496115_0091199 3300048918 Bacteria 2490
1724 Ga0496115_0173856 3300048918 Bacteria 1781
1725 Ga0496116_0001838 3300048919 Bacteria 22937
1726 Ga0496116_0024501 3300048919 Bacteria 4461
1727 Ga0496116_0063852 3300048919 Bacteria 2370
1728 Ga0496117_0000011 3300048920 Bacteria 610930
1729 Ga0496117_0000186 3300048920 Bacteria 127231
1730 Ga0496117_0009914 3300048920 Bacteria 8765
1731 Ga0496117_0011258 3300048920 Bacteria 8028
1732 Ga0496117_0055028 3300048920 Bacteria 2783
1733 Ga0496117_0069839 3300048920 Bacteria 2363
1734 Ga0496117_0071176 3300048920 Bacteria 2332
1735 Ga0496117_0094300 3300048920 Bacteria 1916
1736 Ga0496117_0097590 3300048920 Bacteria 1871
1737 Ga0496117_0101077 3300048920 Bacteria 1825
1738 Ga0496118_0000003 3300048921 Bacteria 773148
1739 Ga0496118_0000010 3300048921 Bacteria 610930
1740 Ga0496118_0002651 3300048921 Bacteria 23694
1741 Ga0496118_0004033 3300048921 Bacteria 17845
1742 Ga0496118_0005494 3300048921 Bacteria 14387
1743 Ga0496118_0008090 3300048921 Bacteria 10961
1744 Ga0496118_0032027 3300048921 Bacteria 4342
1745 Ga0496118_0034121 3300048921 Bacteria 4160
1746 Ga0496118_0039108 3300048921 Bacteria 3790
1747 Ga0496118_0044801 3300048921 Bacteria 3460
1748 Ga0496118_0075311 3300048921 Bacteria 2408
1749 Ga0496118_0082346 3300048921 Bacteria 2255
1750 Ga0496119_0000058 3300048922 Bacteria 173131
1751 Ga0496119_0003751 3300048922 Bacteria 15551
1752 Ga0496119_0006080 3300048922 Bacteria 11310
1753 Ga0496120_0000165 3300048923 Bacteria 111625
1754 Ga0496120_0000184 3300048923 Bacteria 106643
1755 Ga0496120_0000335 3300048923 Bacteria 78595
1756 Ga0496120_0005744 3300048923 Bacteria 9760
1757 Ga0496120_0019413 3300048923 Bacteria 4349
1758 Ga0496121_0000127 3300048924 Bacteria 168545
1759 Ga0496121_0000369 3300048924 Bacteria 92541
1760 Ga0496121_0002089 3300048924 Bacteria 31528
1761 Ga0496121_0003505 3300048924 Bacteria 22313
1762 Ga0496121_0013556 3300048924 Bacteria 8742
1763 Ga0496121_0013665 3300048924 Bacteria 8703
1764 Ga0496121_0021200 3300048924 Bacteria 6378
1765 Ga0496121_0027911 3300048924 Bacteria 5272
1766 Ga0496121_0037406 3300048924 Bacteria 4311
1767 Ga0496121_0097986 3300048924 Bacteria 2270
1768 Ga0496121_0164432 3300048924 Bacteria 1619
1769 Ga0496122_0000601 3300048925 Bacteria 74140
1770 Ga0496122_0003659 3300048925 Bacteria 19965
1771 Ga0496122_0004949 3300048925 Bacteria 16153
1772 Ga0496122_0039228 3300048925 Bacteria 3779
1773 Ga0496122_0144195 3300048925 Bacteria 1483
1774 Ga0496123_0001435 3300048926 Bacteria 33260
1775 Ga0496123_0002533 3300048926 Bacteria 22405
1776 Ga0496123_0014396 3300048926 Bacteria 6558
1777 Ga0496123_0019863 3300048926 Bacteria 5274
1778 Ga0496124_0000346 3300048927 Bacteria 84852
1779 Ga0496124_0015311 3300048927 Bacteria 7360
1780 Ga0496124_0049982 3300048927 Bacteria 3564
1781 Ga0496124_0061995 3300048927 Bacteria 3131
1782 Ga0496124_0082036 3300048927 Bacteria 2648
1783 Ga0496124_0104772 3300048927 Bacteria 2286
1784 Ga0496124_0112228 3300048927 Bacteria 2192
1785 Ga0496124_0113733 3300048927 Bacteria 2174
1786 Ga0496125_0000011 3300048928 Bacteria 655895
1787 Ga0496125_0000491 3300048928 Bacteria 69262
1788 Ga0496125_0000499 3300048928 Bacteria 68475
1789 Ga0496125_0015735 3300048928 Bacteria 7294
1790 Ga0496125_0052440 3300048928 Bacteria 3354
1791 Ga0496125_0060297 3300048928 Bacteria 3051
1792 Ga0496126_0003165 3300048929 Bacteria 21194
1793 Ga0496126_0004283 3300048929 Bacteria 17159
1794 Ga0496126_0005275 3300048929 Bacteria 14845
1795 Ga0496126_0005474 3300048929 Bacteria 14475
1796 Ga0496126_0008206 3300048929 Bacteria 11293
1797 Ga0496126_0044716 3300048929 Bacteria 4076
1798 Ga0496126_0044835 3300048929 Bacteria 4069
1799 Ga0496126_0060887 3300048929 Bacteria 3393
1800 Ga0496126_0077273 3300048929 Bacteria 2952
1801 Ga0496126_0079861 3300048929 Bacteria 2895
1802 Ga0496126_0111168 3300048929 Bacteria 2386
1803 Ga0495678_000001 3300049459 Bacteria 1060340
1804 Ga0495678_000252 3300049459 Bacteria 60083
1805 Ga0495678_000472 3300049459 Bacteria 40059
1806 Ga0495678_001092 3300049459 Bacteria 22889
1807 Ga0495678_001569 3300049459 Bacteria 17545
1808 Ga0495678_002039 3300049459 Bacteria 14459
1809 Ga0495678_021910 3300049459 Bacteria 2804
1810 Ga0495682_0005224 3300049460 Bacteria 5423
1811 Ga0501031_0000002 3300049568 Bacteria 217588
1812 Ga0501031_0102824 3300049568 Bacteria 1864
1813 Ga0501032_0000004 3300049569 Bacteria 310855
1814 Ga0501032_0042553 3300049569 Bacteria 3080
1815 Ga0501032_0058512 3300049569 Bacteria 2587
1816 Ga0501033_0000016 3300049570 Bacteria 217458
1817 Ga0501033_0024224 3300049570 Bacteria 4579
1818 Ga0501033_0044867 3300049570 Bacteria 3290
1819 Ga0501033_0132332 3300049570 Bacteria 1806
1820 Ga0501034_0000011 3300049571 Bacteria 310855
1821 Ga0501034_0000805 3300049571 Bacteria 46664
1822 Ga0501034_0006289 3300049571 Bacteria 12778
1823 Ga0501034_0012191 3300049571 Bacteria 8890
1824 Ga0501034_0029990 3300049571 Bacteria 5528
1825 Ga0501034_0085482 3300049571 Bacteria 3156
1826 Ga0501034_0373051 3300049571 Bacteria 1353
1827 Ga0501036_0000001 3300049572 Bacteria 310855
1828 Ga0501036_0050734 3300049572 Bacteria 3513
1829 Ga0501036_0139240 3300049572 Bacteria 2048
1830 Ga0501036_0177149 3300049572 Bacteria 1795
1831 Ga0501036_0196163 3300049572 Bacteria 1698
1832 Ga0501037_0000006 3300049573 Bacteria 217461
1833 Ga0501037_0010816 3300049573 Bacteria 6704
1834 Ga0501037_0147848 3300049573 Bacteria 1680
1835 Ga0501038_0000003 3300049574 Bacteria 310855
1836 Ga0501038_0017457 3300049574 Bacteria 6487
1837 Ga0501038_0040752 3300049574 Bacteria 4052
1838 Ga0501038_0113022 3300049574 Bacteria 2247
1839 Ga0501039_0000004 3300049575 Bacteria 310855
1840 Ga0501039_0158175 3300049575 Bacteria 1780
1841 Ga0501040_0007583 3300049576 Bacteria 7020
1842 Ga0501041_0001993 3300049577 Bacteria 11481
1843 Ga0501043_0000765 3300049579 Bacteria 28587
1844 Ga0501043_0030429 3300049579 Bacteria 4243
1845 Ga0501043_0065086 3300049579 Bacteria 2863
1846 Ga0501043_0125744 3300049579 Bacteria 2010
1847 Ga0501046_0016578 3300049580 Bacteria 6164
1848 Ga0501046_0059048 3300049580 Bacteria 3006
1849 Ga0501046_0063647 3300049580 Bacteria 2879
1850 Ga0501047_0007626 3300049581 Bacteria 10188
1851 Ga0501047_0051023 3300049581 Bacteria 3995
1852 Ga0501047_0093114 3300049581 Bacteria 2892
1853 Ga0501048_0007377 3300049582 Bacteria 8331
1854 Ga0501070_0052974 3300049586 Bacteria 3367
1855 Ga0501070_0090904 3300049586 Bacteria 2526
1856 Ga0501072_0072811 3300049588 Bacteria 2716
1857 Ga0501073_0152519 3300049589 Bacteria 1601
1858 Ga0501074_0192872 3300049590 Bacteria 1452
1859 Ga0501075_0000550 3300049591 Bacteria 22769
1860 Ga0501075_0024743 3300049591 Bacteria 4407
1861 Ga0501076_0004981 3300049592 Bacteria 9512
1862 Ga0501077_0177793 3300049593 Bacteria 1352
1863 Ga0501209_002279 3300049656 Bacteria 2915
1864 Ga0501238_000341 3300049671 Bacteria 6006
1865 Ga0501079_0000373 3300049741 Bacteria 28806
1866 Ga0501079_0037723 3300049741 Bacteria 3725
1867 Ga0501080_0004667 3300049742 Bacteria 12225
1868 Ga0501080_0062171 3300049742 Bacteria 3475
1869 Ga0501081_0015828 3300049743 Bacteria 4978
1870 Ga0501083_0022007 3300049744 Bacteria 4426
1871 Ga0501083_0137267 3300049744 Bacteria 1602
1872 Ga0501269_000052 3300049766 Bacteria 35683
1873 Ga0501035_0000009 3300049822 Bacteria 310827
1874 Ga0501035_0008747 3300049822 Bacteria 9424
1875 Ga0501035_0035268 3300049822 Bacteria 4540
1876 Ga0501035_0036810 3300049822 Bacteria 4434
1877 Ga0501035_0055684 3300049822 Bacteria 3530
1878 Ga0501035_0063941 3300049822 Bacteria 3271
1879 Ga0501035_0087791 3300049822 Bacteria 2740
1880 Ga0501044_0000005 3300049823 Bacteria 310855
1881 Ga0501044_0012397 3300049823 Bacteria 9229
1882 Ga0501044_0016974 3300049823 Bacteria 7809
1883 Ga0501044_0019689 3300049823 Bacteria 7212
1884 Ga0501044_0176069 3300049823 Bacteria 2108
1885 Ga0501045_0009512 3300049824 Bacteria 6801
1886 Ga0501045_0012160 3300049824 Bacteria 6060
1887 Ga0501045_0168468 3300049824 Bacteria 1631
1888 nmdc:mga03683_61515_c1 3300050489 Bacteria 1588
1889 nmdc:mga03n38_3350_c1 3300050490 Bacteria 4213
1890 nmdc:mga00v17_13175_c1 3300050491 Bacteria 4582
1891 nmdc:mga00v17_1915_c1 3300050491 Bacteria 10752
1892 nmdc:mga00v17_25_c1 3300050491 Bacteria 101679
1893 nmdc:mga00v17_51587_c1 3300050491 Bacteria 2501
1894 nmdc:mga00v17_53344_c1 3300050491 Bacteria 2464
1895 nmdc:mga06z11_142973_c1 3300050494 Bacteria 1354
1896 nmdc:mga05p37_102212_c1 3300050507 Bacteria 3530
1897 nmdc:mga05p37_12026_c2 3300050507 Bacteria 5353
1898 nmdc:mga05p37_131559_c1 3300050507 Bacteria 3070
1899 nmdc:mga09592_17751_c1 3300050508 Bacteria 5832
1900 nmdc:mga09592_209637_c1 3300050508 Bacteria 1688
1901 nmdc:mga09592_3493_c1 3300050508 Bacteria 12683
1902 nmdc:mga09592_35669_c1 3300050508 Bacteria 4164
1903 nmdc:mga09592_9281_c1 3300050508 Bacteria 7995
1904 nmdc:mga0qj67_33296_c1 3300050509 Bacteria 4020
1905 nmdc:mga0qj67_8245_c1 3300050509 Bacteria 7724
1906 nmdc:mga06r32_35660_c1 3300050510 Bacteria 4694
1907 nmdc:mga06r32_6743_c1 3300050510 Bacteria 10321
1908 nmdc:mga06r32_6843_c1 3300050510 Bacteria 10245
1909 nmdc:mga06r32_7005_c2 3300050510 Bacteria 7988
1910 nmdc:mga08y16_115030_c1 3300050511 Bacteria 2800
1911 nmdc:mga08y16_1674_c1 3300050511 Bacteria 22477
1912 nmdc:mga08y16_17450_c1 3300050511 Bacteria 7560
1913 nmdc:mga08y16_30394_c1 3300050511 Bacteria 5686
1914 nmdc:mga08y16_33755_c1 3300050511 Bacteria 5374
1915 nmdc:mga08y16_459936_c1 3300050511 Bacteria 1297
1916 nmdc:mga08y16_60018_c1 3300050511 Bacteria 3973
1917 nmdc:mga08y16_60566_c1 3300050511 Bacteria 3953
1918 nmdc:mga08y16_65480_c1 3300050511 Bacteria 3794
1919 nmdc:mga08y16_95638_c1 3300050511 Unclassified 3094
1920 nmdc:mga0n895_147725_c1 3300050512 Bacteria 2380
1921 nmdc:mga0n895_17549_c1 3300050512 Bacteria 6599
1922 nmdc:mga0n895_196469_c1 3300050512 Bacteria 2048
1923 nmdc:mga0n895_48882_c1 3300050512 Bacteria 4142
1924 nmdc:mga0n895_748_c1 3300050512 Bacteria 22925
1925 nmdc:mga0n895_77648_c1 3300050512 Bacteria 3303
1926 nmdc:mga0n895_8520_c1 3300050512 Bacteria 8885
1927 nmdc:mga0rr50_40729_c1 3300050513 Bacteria 3379
1928 nmdc:mga0rr50_4774_c1 3300050513 Bacteria 7996
1929 nmdc:mga08x19_166250_c1 3300050514 Bacteria 1500
1930 nmdc:mga0a205_20510_c1 3300050515 Bacteria 6238
1931 nmdc:mga0a205_342235_c1 3300050515 Bacteria 1364
1932 nmdc:mga0a205_98646_c1 3300050515 Bacteria 2820
1933 Ga0500635_0003783 3300053080 Bacteria 3835
1934 Ga0500651_0000151 3300053093 Bacteria 44350
1935 Ga0500651_0041290 3300053093 Bacteria 2908
1936 Ga0500651_0062449 3300053093 Bacteria 2326
1937 Ga0500554_001407 3300053102 Bacteria 4654
1938 Ga0500554_001976 3300053102 Bacteria 3978
1939 Ga0500608_000071 3300053122 Bacteria 43385
1940 Ga0500618_000076 3300053125 Bacteria 80917
1941 Ga0500618_002259 3300053125 Bacteria 7489
1942 Ga0500559_0096154 3300053136 Bacteria 1360
1943 Ga0500616_0000016 3300053153 Bacteria 627087
1944 Ga0500622_0002525 3300053156 Bacteria 13140
1945 Ga0500636_0083800 3300053177 Bacteria 1834
1946 Ga0500637_0003531 3300053178 Bacteria 7244
1947 Ga0500576_062120 3300053725 Bacteria 1631
1948 Ga0501084_0117827 3300054114 Bacteria 2232
1949 Ga0501084_0236191 3300054114 Bacteria 1543
1950 Ga0501084_0339531 3300054114 Bacteria 1269
1951 Ga0501082_0247291 3300060353 Bacteria 1552
1952 Ga0466962_0001245 3300061719 Bacteria 11734
1953 Ga0466962_0001841 3300061719 Bacteria 9973
1954 Ga0466962_0004777 3300061719 Bacteria 6517
1955 Ga0530510_0099239 3300061734 Bacteria 2129
1956 Ga0530510_0150369 3300061734 Bacteria 1719

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025254 Ga0209148_1007474 Ga0209148_10074742 343
2 3300002737 JGI25162J39368_1000443 JGI25162J39368_100044315 344
3 3300003762 Ga0055542_1000136 Ga0055542_100013646 344
4 3300005340 Ga0070689_100001668 Ga0070689_1000016689 344
5 3300025231 Ga0207427_106452 Ga0207427_1064522 344
6 3300025233 Ga0209437_100463 Ga0209437_1004638 344
7 3300025242 Ga0209258_101855 Ga0209258_1018553 344
8 3300025250 Ga0209026_1002614 Ga0209026_10026144 344
9 3300025254 Ga0209148_1000002 Ga0209148_10000021395 344
10 3300025936 Ga0207670_10001036 Ga0207670_100010367 344
11 3300048917 Ga0496114_0152361 Ga0496114_0152361_308_1405 344
12 3300001979 JGI24740J21852_10009194 JGI24740J21852_100091942 345
13 3300001989 JGI24739J22299_10000112 JGI24739J22299_1000011216 345
14 3300001990 JGI24737J22298_10004508 JGI24737J22298_100045084 345
15 3300003578 Ga0006562J51391_1077234 Ga0006562J51391_10772343 345
16 3300003578 Ga0006562J51391_1077235 Ga0006562J51391_10772352 345
17 3300003762 Ga0055542_1001263 Ga0055542_10012635 345
18 3300003762 Ga0055542_1001356 Ga0055542_100135612 345
19 3300005563 Ga0068855_100009108 Ga0068855_1000091085 345
20 3300005577 Ga0068857_100000319 Ga0068857_1000003194 345
21 3300005578 Ga0068854_100004257 Ga0068854_1000042579 345
22 3300005842 Ga0068858_100104493 Ga0068858_1001044932 345
23 3300009093 Ga0105240_10006637 Ga0105240_1000663716 345
24 3300009545 Ga0105237_10000307 Ga0105237_1000030722 345
25 3300010375 Ga0105239_10011929 Ga0105239_1001192912 345
26 3300012500 Ga0157314_1000121 Ga0157314_10001216 345
27 3300025254 Ga0209148_1000032 Ga0209148_1000032494 345
28 3300025258 Ga0209129_1003076 Ga0209129_10030767 345
29 3300025272 Ga0209455_1000085 Ga0209455_1000085178 345
30 3300025297 Ga0209758_1000276 Ga0209758_100027655 345
31 3300025904 Ga0207647_10012861 Ga0207647_100128616 345
32 3300025913 Ga0207695_10000408 Ga0207695_1000040855 345
33 3300025914 Ga0207671_10000031 Ga0207671_1000003178 345
34 3300025924 Ga0207694_10088043 Ga0207694_100880433 345
35 3300025949 Ga0207667_10000313 Ga0207667_1000031313 345
36 3300025981 Ga0207640_10000667 Ga0207640_1000066712 345
37 3300026035 Ga0207703_10073205 Ga0207703_100732052 345
38 3300026116 Ga0207674_10000397 Ga0207674_1000039737 345
39 3300026142 Ga0207698_10463212 Ga0207698_104632121 345
40 3300046616 Ga0495668_0045466 Ga0495668_0045466_1183_2316 345
41 3300048928 Ga0496125_0000499 Ga0496125_0000499_33205_34302 345
42 3300003781 Ga0055536_1003817 Ga0055536_10038171 346
43 3300003791 Ga0055530_10019201 Ga0055530_100192012 346
44 3300003794 Ga0055531_10004874 Ga0055531_100048741 346
45 3300005339 Ga0070660_100198144 Ga0070660_1001981441 346
46 3300005616 Ga0068852_100315632 Ga0068852_1003156322 346
47 3300006038 Ga0075365_10051784 Ga0075365_100517842 346
48 3300025292 Ga0209676_1000560 Ga0209676_10005606 346
49 3300025298 Ga0209050_1001568 Ga0209050_100156820 346
50 3300025304 Ga0209257_1001256 Ga0209257_100125627 346
51 3300025919 Ga0207657_10081048 Ga0207657_100810481 346
52 3300046460 Ga0495638_0000194 Ga0495638_0000194_66277_67374 346
53 3300046471 Ga0495650_0000202 Ga0495650_0000202_117090_118187 346
54 3300046522 Ga0495643_0040501 Ga0495643_0040501_714_1811 346
55 3300046616 Ga0495668_0000042 Ga0495668_0000042_148383_149513 346
56 3300047320 Ga0495672_0007005 Ga0495672_0007005_4584_5681 346
57 3300050494 nmdc:mga06z11_142973_c1 nmdc:mga06z11_142973_c1_238_1329 346
58 3300006852 Ga0075433_10008606 Ga0075433_100086068 347
59 3300006871 Ga0075434_100138894 Ga0075434_1001388942 347
60 3300007076 Ga0075435_100014270 Ga0075435_1000142704 347
61 3300027907 Ga0207428_10018863 Ga0207428_100188632 347
62 3300050512 nmdc:mga0n895_17549_c1 nmdc:mga0n895_17549_c1_3228_4307 347
63 3300050514 nmdc:mga08x19_166250_c1 nmdc:mga08x19_166250_c1_81_1160 347
64 3300049568 Ga0501031_0102824 Ga0501031_0102824_74_1144 348
65 3300049572 Ga0501036_0050734 Ga0501036_0050734_46_1116 348
66 3300049573 Ga0501037_0010816 Ga0501037_0010816_2364_3434 348
67 3300049574 Ga0501038_0017457 Ga0501038_0017457_1332_2402 348
68 3300049822 Ga0501035_0035268 Ga0501035_0035268_2540_3610 348
69 3300005336 Ga0070680_100086077 Ga0070680_1000860772 349
70 3300005549 Ga0070704_100018709 Ga0070704_1000187093 349
71 3300006871 Ga0075434_100007875 Ga0075434_1000078755 349
72 3300007076 Ga0075435_100007208 Ga0075435_1000072083 349
73 3300009094 Ga0111539_10456819 Ga0111539_104568192 349
74 3300025917 Ga0207660_10125850 Ga0207660_101258502 349
75 3300027907 Ga0207428_10079853 Ga0207428_100798532 349
76 3300050511 nmdc:mga08y16_115030_c1 nmdc:mga08y16_115030_c1_1475_2554 349
77 3300050512 nmdc:mga0n895_8520_c1 nmdc:mga0n895_8520_c1_5688_6767 349
78 3300050513 nmdc:mga0rr50_4774_c1 nmdc:mga0rr50_4774_c1_2574_3653 349
79 iso_pu_bacteria 2643221556 2643796727 349
80 iso_pu_bacteria 2643221603 2644027736 349
81 iso_pu_bacteria 2643221645 2644250043 349
82 iso_pu_bacteria 2643221664 2644358735 349
83 iso_pu_bacteria 2643221684 2644470168 349
84 iso_pu_bacteria 2734482258 2735816191 349
85 iso_pu_bacteria 2738541280 2738739644 349
86 iso_pu_bacteria 2738541300 2738846903 349
87 iso_pu_bacteria 2738543018 2739277892 349
88 iso_pu_bacteria 2738543030 2739346935 349
89 iso_pu_bacteria 2808606418 2809141920 349
90 iso_pu_bacteria 8047673197 8047677011 349
91 3300031730 Ga0307516_10000116 Ga0307516_1000011623 350
92 iso_pu_bacteria 2511231026 2511385354 350
93 iso_pu_bacteria 2548876994 2550693266 350
94 iso_pu_bacteria 2599185239 2599741512 350
95 iso_pu_bacteria 2599185240 2599746741 350
96 iso_pu_bacteria 2599185355 2600208647 350
97 iso_pu_bacteria 2600255292 2601669309 350
98 iso_pu_bacteria 2675903129 2676744303 350
99 iso_pu_bacteria 2738541297 2738827457 350
100 iso_pu_bacteria 2738541357 2739151253 350
101 iso_pu_bacteria 2738543003 2739193173 350
102 iso_pu_bacteria 2738543026 2739319649 350
103 iso_pu_bacteria 2738543029 2739337890 350
104 iso_pu_bacteria 2765235838 2765568476 350
105 iso_pu_bacteria 2808606386 2808981217 350
106 iso_pu_bacteria 2808606415 2809131729 350
107 iso_pu_bacteria 2808606419 2809151459 350
108 iso_pu_bacteria 2818991436 2819543198 350
109 iso_pu_bacteria 2818991445 2819592033 350
110 iso_pu_bacteria 2818991452 2819630811 350
111 iso_pu_bacteria 2821131069 2821134797 350
112 iso_pu_bacteria 2857553236 2857555479 350
113 iso_pu_bacteria 2857558681 2857560748 350
114 iso_pu_bacteria 2857564685 2857569104 350
115 iso_pu_bacteria 2884811622 2884812906 350
116 iso_pu_bacteria 2884836552 2884840551 350
117 iso_pu_bacteria 2884852848 2884855808 350
118 iso_pu_bacteria 2885080285 2885084950 350
119 iso_pu_bacteria 2896154374 2896157267 350
120 iso_pu_bacteria 2904424332 2904430141 350
121 iso_pu_bacteria 2904564687 2904568580 350
122 iso_pu_bacteria 2904571731 2904575622 350
123 iso_pu_bacteria 2919476304 2919479473 350
124 iso_pu_bacteria 2928170801 2928172532 350
125 iso_pu_bacteria 2928536128 2928540643 350
126 iso_pu_bacteria 2932410948 2932414568 350
127 iso_pu_bacteria 2932416698 2932420911 350
128 iso_pu_bacteria 2958108152 2958112519 350
129 iso_pu_bacteria 8018845410 8018846785 350
130 iso_pu_bacteria 8021120328 8021128039 350
131 3300009094 Ga0111539_10006149 Ga0111539_100061494 351
132 3300014969 Ga0157376_10032500 Ga0157376_100325005 351
133 3300027907 Ga0207428_10045632 Ga0207428_100456322 351
134 3300031507 Ga0307509_10148862 Ga0307509_101488623 351
135 3300036401 Ga0373937_0075411 Ga0373937_0075411_2029_3084 351
136 3300046519 Ga0495632_0002116 Ga0495632_0002116_462_1517 351
137 3300046681 Ga0495647_0096854 Ga0495647_0096854_103_1158 351
138 3300047472 Ga0495686_0011007 Ga0495686_0011007_5097_6182 351
139 3300048918 Ga0496115_0064497 Ga0496115_0064497_492_1583 351
140 3300050509 nmdc:mga0qj67_33296_c1 nmdc:mga0qj67_33296_c1_2224_3279 351
141 3300050510 nmdc:mga06r32_6843_c1 nmdc:mga06r32_6843_c1_6089_7156 351
142 3300050511 nmdc:mga08y16_17450_c1 nmdc:mga08y16_17450_c1_4970_6025 351
143 3300053125 Ga0500618_002259 Ga0500618_002259_1304_2359 351
144 3300053153 Ga0500616_0000016 Ga0500616_0000016_293453_294535 351
145 iso_pu_bacteria 2521172590 2521557353 351
146 iso_pu_bacteria 2537561836 2538832224 351
147 iso_pu_bacteria 2551306416 2553005299 351
148 iso_pu_bacteria 2643221545 2643750015 351
149 iso_pu_bacteria 2643221562 2643830234 351
150 iso_pu_bacteria 2643221691 2644510830 351
151 iso_pu_bacteria 2802429605 2805925728 351
152 iso_pu_bacteria 2818991449 2819617657 351
153 iso_pu_bacteria 2842192696 2842194488 351
154 iso_pu_bacteria 2857542790 2857546774 351
155 iso_pu_bacteria 2857547612 2857549436 351
156 iso_pu_bacteria 2928531327 2928533401 351
157 iso_pu_bacteria 2939611941 2939612567 351
158 3300002739 JGI25158J39367_1002014 JGI25158J39367_10020143 352
159 3300002773 JGI25152J39213_1000264 JGI25152J39213_10002648 352
160 3300002774 JGI25150J39212_1000664 JGI25150J39212_10006648 352
161 3300002774 JGI25150J39212_1002952 JGI25150J39212_10029521 352
162 3300002987 JGI25159J45721_1001644 JGI25159J45721_10016442 352
163 3300002987 JGI25159J45721_1002080 JGI25159J45721_10020803 352
164 3300002987 JGI25159J45721_1003979 JGI25159J45721_10039793 352
165 3300003215 JGI25153J46596_10012158 JGI25153J46596_100121582 352
166 3300003354 JGI25160J50197_1000998 JGI25160J50197_10009985 352
167 3300003374 JGI25161J50226_1002233 JGI25161J50226_10022331 352
168 3300003374 JGI25161J50226_1002267 JGI25161J50226_10022671 352
169 3300003771 Ga0055526_1003458 Ga0055526_10034585 352
170 3300003771 Ga0055526_1005757 Ga0055526_10057574 352
171 3300003771 Ga0055526_1010012 Ga0055526_10100121 352
172 3300003773 Ga0055537_1000131 Ga0055537_100013116 352
173 3300003775 Ga0055524_1000076 Ga0055524_100007612 352
174 3300003775 Ga0055524_1002142 Ga0055524_10021421 352
175 3300003775 Ga0055524_1006457 Ga0055524_10064572 352
176 3300003775 Ga0055524_1007893 Ga0055524_10078931 352
177 3300003775 Ga0055524_1008866 Ga0055524_10088662 352
178 3300003781 Ga0055536_1003608 Ga0055536_10036085 352
179 3300003784 Ga0055534_1000076 Ga0055534_100007616 352
180 3300003784 Ga0055534_1001221 Ga0055534_10012214 352
181 3300003790 Ga0055528_1000288 Ga0055528_10002887 352
182 3300003790 Ga0055528_1001135 Ga0055528_10011351 352
183 3300003790 Ga0055528_1006318 Ga0055528_10063182 352
184 3300003791 Ga0055530_10003587 Ga0055530_100035875 352
185 3300003791 Ga0055530_10011871 Ga0055530_100118711 352
186 3300004625 Ga0055543_1000300 Ga0055543_100030011 352
187 3300005262 Ga0065165_1000003 Ga0065165_100000366 352
188 3300005262 Ga0065165_1000643 Ga0065165_100064314 352
189 3300005262 Ga0065165_1001333 Ga0065165_10013337 352
190 3300005330 Ga0070690_100021139 Ga0070690_1000211391 352
191 3300005331 Ga0070670_100058743 Ga0070670_1000587432 352
192 3300005337 Ga0070682_100128597 Ga0070682_1001285972 352
193 3300005340 Ga0070689_100000337 Ga0070689_10000033722 352
194 3300005347 Ga0070668_100000034 Ga0070668_1000000345 352
195 3300005347 Ga0070668_100309516 Ga0070668_1003095161 352
196 3300005354 Ga0070675_100000590 Ga0070675_1000005903 352
197 3300005355 Ga0070671_100000118 Ga0070671_1000001182 352
198 3300005364 Ga0070673_100087675 Ga0070673_1000876751 352
199 3300005367 Ga0070667_100036940 Ga0070667_1000369403 352
200 3300005440 Ga0070705_100022249 Ga0070705_1000222491 352
201 3300005441 Ga0070700_100041701 Ga0070700_1000417012 352
202 3300005459 Ga0068867_100000827 Ga0068867_1000008274 352
203 3300005466 Ga0070685_10001648 Ga0070685_100016482 352
204 3300005535 Ga0070684_100001718 Ga0070684_1000017186 352
205 3300005543 Ga0070672_100031753 Ga0070672_1000317532 352
206 3300005564 Ga0070664_100000397 Ga0070664_10000039712 352
207 3300005577 Ga0068857_100007163 Ga0068857_1000071636 352
208 3300005577 Ga0068857_100054907 Ga0068857_1000549072 352
209 3300005614 Ga0068856_100000020 Ga0068856_100000020107 352
210 3300005617 Ga0068859_100001635 Ga0068859_10000163514 352
211 3300005617 Ga0068859_100020544 Ga0068859_1000205442 352
212 3300005618 Ga0068864_100000673 Ga0068864_10000067315 352
213 3300005719 Ga0068861_100229584 Ga0068861_1002295841 352
214 3300005840 Ga0068870_10017463 Ga0068870_100174631 352
215 3300005841 Ga0068863_100000020 Ga0068863_10000002056 352
216 3300005841 Ga0068863_100000998 Ga0068863_1000009989 352
217 3300005843 Ga0068860_100007072 Ga0068860_1000070725 352
218 3300005843 Ga0068860_100122674 Ga0068860_1001226742 352
219 3300005844 Ga0068862_100001632 Ga0068862_1000016325 352
220 3300006237 Ga0097621_100097220 Ga0097621_1000972202 352
221 3300006871 Ga0075434_100159484 Ga0075434_1001594842 352
222 3300006880 Ga0075429_100067695 Ga0075429_1000676953 352
223 3300006881 Ga0068865_100189574 Ga0068865_1001895741 352
224 3300006931 Ga0097620_100001635 Ga0097620_10000163510 352
225 3300006931 Ga0097620_100020544 Ga0097620_1000205442 352
226 3300006948 Ga0099826_10000005 Ga0099826_10000005433 352
227 3300009148 Ga0105243_10035511 Ga0105243_100355113 352
228 3300009177 Ga0105248_10001405 Ga0105248_1000140515 352
229 3300009553 Ga0105249_10072664 Ga0105249_100726642 352
230 3300013306 Ga0163162_10018051 Ga0163162_100180518 352
231 3300013308 Ga0157375_10080580 Ga0157375_100805803 352
232 3300014325 Ga0163163_10000628 Ga0163163_1000062811 352
233 3300014745 Ga0157377_10008093 Ga0157377_100080933 352
234 3300017792 Ga0163161_10182339 Ga0163161_101823392 352
235 3300025208 Ga0209436_100088 Ga0209436_10008814 352
236 3300025208 Ga0209436_101828 Ga0209436_1018282 352
237 3300025208 Ga0209436_112621 Ga0209436_1126212 352
238 3300025245 Ga0207425_1000106 Ga0207425_100010618 352
239 3300025245 Ga0207425_1000253 Ga0207425_100025311 352
240 3300025258 Ga0209129_1000193 Ga0209129_100019319 352
241 3300025258 Ga0209129_1003515 Ga0209129_10035152 352
242 3300025263 Ga0209565_1000018 Ga0209565_1000018328 352
243 3300025263 Ga0209565_1000385 Ga0209565_100038511 352
244 3300025263 Ga0209565_1001696 Ga0209565_10016962 352
245 3300025263 Ga0209565_1005248 Ga0209565_10052482 352
246 3300025263 Ga0209565_1016522 Ga0209565_10165222 352
247 3300025273 Ga0209673_1000006 Ga0209673_1000006444 352
248 3300025273 Ga0209673_1010648 Ga0209673_10106481 352
249 3300025284 Ga0209130_1000204 Ga0209130_100020410 352
250 3300025284 Ga0209130_1000595 Ga0209130_100059511 352
251 3300025284 Ga0209130_1000734 Ga0209130_100073412 352
252 3300025291 Ga0209675_1000005 Ga0209675_1000005328 352
253 3300025291 Ga0209675_1000466 Ga0209675_100046611 352
254 3300025291 Ga0209675_1001143 Ga0209675_10011437 352
255 3300025292 Ga0209676_1000467 Ga0209676_10004676 352
256 3300025295 Ga0209564_1000144 Ga0209564_100014466 352
257 3300025295 Ga0209564_1000377 Ga0209564_100037712 352
258 3300025295 Ga0209564_1000723 Ga0209564_100072311 352
259 3300025295 Ga0209564_1003063 Ga0209564_10030634 352
260 3300025295 Ga0209564_1028062 Ga0209564_10280622 352
261 3300025297 Ga0209758_1000353 Ga0209758_100035341 352
262 3300025298 Ga0209050_1000403 Ga0209050_100040315 352
263 3300025298 Ga0209050_1000461 Ga0209050_100046165 352
264 3300025298 Ga0209050_1000835 Ga0209050_100083511 352
265 3300025298 Ga0209050_1009261 Ga0209050_10092611 352
266 3300025299 Ga0209256_1000090 Ga0209256_100009083 352
267 3300025299 Ga0209256_1000325 Ga0209256_100032522 352
268 3300025299 Ga0209256_1000645 Ga0209256_100064511 352
269 3300025299 Ga0209256_1000930 Ga0209256_100093012 352
270 3300025299 Ga0209256_1001047 Ga0209256_10010476 352
271 3300025299 Ga0209256_1002042 Ga0209256_100204210 352
272 3300025299 Ga0209256_1002408 Ga0209256_10024087 352
273 3300025302 Ga0207426_1000570 Ga0207426_100057011 352
274 3300025303 Ga0209051_1002223 Ga0209051_10022235 352
275 3300025303 Ga0209051_1018885 Ga0209051_10188852 352
276 3300025304 Ga0209257_1000123 Ga0209257_100012338 352
277 3300025304 Ga0209257_1002232 Ga0209257_10022321 352
278 3300025304 Ga0209257_1006222 Ga0209257_10062221 352
279 3300025918 Ga0207662_10000523 Ga0207662_100005238 352
280 3300025920 Ga0207649_10022066 Ga0207649_100220663 352
281 3300025925 Ga0207650_10040790 Ga0207650_100407902 352
282 3300025926 Ga0207659_10003387 Ga0207659_100033878 352
283 3300025931 Ga0207644_10000085 Ga0207644_100000855 352
284 3300025938 Ga0207704_10028757 Ga0207704_100287571 352
285 3300025940 Ga0207691_10042998 Ga0207691_100429983 352
286 3300025941 Ga0207711_10045231 Ga0207711_100452312 352
287 3300025942 Ga0207689_10005367 Ga0207689_100053678 352
288 3300025960 Ga0207651_10006946 Ga0207651_100069463 352
289 3300025972 Ga0207668_10000085 Ga0207668_1000008548 352
290 3300025972 Ga0207668_10304035 Ga0207668_103040351 352
291 3300025986 Ga0207658_10170541 Ga0207658_101705412 352
292 3300026078 Ga0207702_10000126 Ga0207702_1000012641 352
293 3300026088 Ga0207641_10000001 Ga0207641_100000011005 352
294 3300026089 Ga0207648_10012019 Ga0207648_100120196 352
295 3300026116 Ga0207674_10010840 Ga0207674_100108402 352
296 3300026116 Ga0207674_10090827 Ga0207674_100908273 352
297 3300026121 Ga0207683_10131859 Ga0207683_101318592 352
298 3300027666 Ga0209282_1000003 Ga0209282_1000003371 352
299 3300028379 Ga0268266_10276063 Ga0268266_102760632 352
300 3300028380 Ga0268265_10004973 Ga0268265_100049738 352
301 3300028380 Ga0268265_10038816 Ga0268265_100388162 352
302 3300028381 Ga0268264_10010327 Ga0268264_100103272 352
303 3300031548 Ga0307408_100000897 Ga0307408_10000089712 352
304 3300031548 Ga0307408_100031208 Ga0307408_1000312082 352
305 3300031548 Ga0307408_100044184 Ga0307408_1000441842 352
306 3300031616 Ga0307508_10067707 Ga0307508_100677072 352
307 3300031711 Ga0265314_10025956 Ga0265314_100259566 352
308 3300031712 Ga0265342_10064246 Ga0265342_100642462 352
309 3300031838 Ga0307518_10058553 Ga0307518_100585531 352
310 3300032002 Ga0307416_100113194 Ga0307416_1001131942 352
311 3300033180 Ga0307510_10019107 Ga0307510_100191076 352
312 3300037312 Ga0395899_0037373 Ga0395899_0037373_243_1301 352
313 3300037471 Ga0395905_0202549 Ga0395905_0202549_317_1375 352
314 3300037471 Ga0395905_0363741 Ga0395905_0363741_152_1210 352
315 3300039447 Ga0436361_0350031 Ga0436361_0350031_7148_8206 352
316 3300042435 Ga0439434_0025853 Ga0439434_0025853_378_1442 352
317 3300044765 Ga0466970_0052556 Ga0466970_0052556_908_1966 352
318 3300045049 Ga0466959_0043885 Ga0466959_0043885_1399_2478 352
319 3300045051 Ga0451576_0007632 Ga0451576_0007632_9441_10499 352
320 3300046452 Ga0495617_000014 Ga0495617_000014_22211_23269 352
321 3300046453 Ga0495627_000768 Ga0495627_000768_19106_20164 352
322 3300046453 Ga0495627_030432 Ga0495627_030432_212_1270 352
323 3300046455 Ga0495603_0004733 Ga0495603_0004733_4792_5862 352
324 3300046457 Ga0495590_0000063 Ga0495590_0000063_15688_16746 352
325 3300046457 Ga0495590_0002879 Ga0495590_0002879_24_1082 352
326 3300046458 Ga0495591_000391 Ga0495591_000391_20185_21243 352
327 3300046458 Ga0495591_031800 Ga0495591_031800_493_1551 352
328 3300046471 Ga0495650_0000260 Ga0495650_0000260_22137_23195 352
329 3300046474 Ga0495605_0000329 Ga0495605_0000329_20901_21959 352
330 3300046474 Ga0495605_0001429 Ga0495605_0001429_14479_15537 352
331 3300046474 Ga0495605_0025286 Ga0495605_0025286_1812_2870 352
332 3300046491 Ga0495584_0000744 Ga0495584_0000744_15693_16751 352
333 3300046491 Ga0495584_0004275 Ga0495584_0004275_2853_3911 352
334 3300046491 Ga0495584_0012578 Ga0495584_0012578_1452_2510 352
335 3300046491 Ga0495584_0092134 Ga0495584_0092134_436_1494 352
336 3300046492 Ga0495585_0007927 Ga0495585_0007927_707_1765 352
337 3300046492 Ga0495585_0041492 Ga0495585_0041492_1309_2367 352
338 3300046492 Ga0495585_0148703 Ga0495585_0148703_15_1073 352
339 3300046500 Ga0495596_0001179 Ga0495596_0001179_4427_5485 352
340 3300046500 Ga0495596_0022086 Ga0495596_0022086_263_1321 352
341 3300046501 Ga0495607_0012133 Ga0495607_0012133_386_1444 352
342 3300046501 Ga0495607_0034897 Ga0495607_0034897_1233_2291 352
343 3300046506 Ga0495583_0000664 Ga0495583_0000664_26058_27116 352
344 3300046506 Ga0495583_0001002 Ga0495583_0001002_13457_14515 352
345 3300046506 Ga0495583_0001232 Ga0495583_0001232_5672_6730 352
346 3300046506 Ga0495583_0007478 Ga0495583_0007478_5558_6616 352
347 3300046506 Ga0495583_0060211 Ga0495583_0060211_57_1115 352
348 3300046507 Ga0495606_0000855 Ga0495606_0000855_16634_17692 352
349 3300046507 Ga0495606_0021227 Ga0495606_0021227_3683_4741 352
350 3300046507 Ga0495606_0083294 Ga0495606_0083294_165_1223 352
351 3300046512 Ga0495610_0001328 Ga0495610_0001328_14098_15156 352
352 3300046513 Ga0495616_0000273 Ga0495616_0000273_18040_19098 352
353 3300046513 Ga0495616_0005215 Ga0495616_0005215_1381_2439 352
354 3300046513 Ga0495616_0010944 Ga0495616_0010944_3743_4801 352
355 3300046518 Ga0495631_0000335 Ga0495631_0000335_18316_19374 352
356 3300046518 Ga0495631_0005710 Ga0495631_0005710_4726_5784 352
357 3300046518 Ga0495631_0006702 Ga0495631_0006702_2755_3813 352
358 3300046519 Ga0495632_0000172 Ga0495632_0000172_14996_16054 352
359 3300046519 Ga0495632_0000503 Ga0495632_0000503_14923_15981 352
360 3300046519 Ga0495632_0001133 Ga0495632_0001133_14652_15710 352
361 3300046519 Ga0495632_0063450 Ga0495632_0063450_345_1403 352
362 3300046519 Ga0495632_0078081 Ga0495632_0078081_469_1527 352
363 3300046520 Ga0495637_0000011 Ga0495637_0000011_233949_235007 352
364 3300046522 Ga0495643_0001377 Ga0495643_0001377_14793_15851 352
365 3300046522 Ga0495643_0009472 Ga0495643_0009472_52_1110 352
366 3300046522 Ga0495643_0034805 Ga0495643_0034805_396_1454 352
367 3300046522 Ga0495643_0044239 Ga0495643_0044239_834_1892 352
368 3300046523 Ga0495644_0003192 Ga0495644_0003192_2461_3519 352
369 3300046523 Ga0495644_0010856 Ga0495644_0010856_2424_3482 352
370 3300046523 Ga0495644_0028360 Ga0495644_0028360_417_1475 352
371 3300046524 Ga0495648_0003686 Ga0495648_0003686_8488_9546 352
372 3300046526 Ga0495666_0016331 Ga0495666_0016331_2232_3290 352
373 3300046528 Ga0495642_0000626 Ga0495642_0000626_16598_17656 352
374 3300046528 Ga0495642_0011959 Ga0495642_0011959_2225_3283 352
375 3300046528 Ga0495642_0026348 Ga0495642_0026348_1223_2281 352
376 3300046530 Ga0495654_0005496 Ga0495654_0005496_3619_4677 352
377 3300046538 Ga0495609_0001322 Ga0495609_0001322_4763_5821 352
378 3300046538 Ga0495609_0004412 Ga0495609_0004412_3816_4874 352
379 3300046538 Ga0495609_0027561 Ga0495609_0027561_771_1829 352
380 3300046538 Ga0495609_0109267 Ga0495609_0109267_120_1178 352
381 3300046542 Ga0495597_0000970 Ga0495597_0000970_20690_21748 352
382 3300046557 Ga0495622_0036691 Ga0495622_0036691_464_1522 352
383 3300046616 Ga0495668_0000030 Ga0495668_0000030_228051_229109 352
384 3300046616 Ga0495668_0000813 Ga0495668_0000813_20036_21094 352
385 3300046616 Ga0495668_0001480 Ga0495668_0001480_17768_18826 352
386 3300046616 Ga0495668_0001800 Ga0495668_0001800_16445_17503 352
387 3300046616 Ga0495668_0009428 Ga0495668_0009428_772_1830 352
388 3300046616 Ga0495668_0025466 Ga0495668_0025466_2091_3149 352
389 3300046648 Ga0495611_0000502 Ga0495611_0000502_20376_21434 352
390 3300046648 Ga0495611_0003647 Ga0495611_0003647_84_1142 352
391 3300046648 Ga0495611_0014732 Ga0495611_0014732_1561_2619 352
392 3300046660 Ga0495625_0003018 Ga0495625_0003018_9199_10257 352
393 3300046665 Ga0495661_0001601 Ga0495661_0001601_8931_9989 352
394 3300046665 Ga0495661_0045472 Ga0495661_0045472_1599_2657 352
395 3300046665 Ga0495661_0059203 Ga0495661_0059203_707_1765 352
396 3300046674 Ga0495588_0034693 Ga0495588_0034693_1015_2073 352
397 3300046684 Ga0495669_0005169 Ga0495669_0005169_3739_4797 352
398 3300046684 Ga0495669_0005310 Ga0495669_0005310_3078_4136 352
399 3300046691 Ga0495670_0076333 Ga0495670_0076333_198_1256 352
400 3300046692 Ga0495671_0000783 Ga0495671_0000783_18314_19372 352
401 3300046694 Ga0495649_0000308 Ga0495649_0000308_40645_41703 352
402 3300046694 Ga0495649_0051480 Ga0495649_0051480_191_1249 352
403 3300046794 Ga0495589_0000556 Ga0495589_0000556_17431_18489 352
404 3300046794 Ga0495589_0000950 Ga0495589_0000950_13143_14201 352
405 3300046810 Ga0495660_0026344 Ga0495660_0026344_427_1485 352
406 3300046810 Ga0495660_0099301 Ga0495660_0099301_45_1103 352
407 3300047320 Ga0495672_0000307 Ga0495672_0000307_32887_33945 352
408 3300047320 Ga0495672_0004558 Ga0495672_0004558_3674_4732 352
409 3300047320 Ga0495672_0012960 Ga0495672_0012960_855_1913 352
410 3300047323 Ga0495683_0001047 Ga0495683_0001047_15676_16734 352
411 3300047323 Ga0495683_0050537 Ga0495683_0050537_899_1957 352
412 3300047323 Ga0495683_0062177 Ga0495683_0062177_361_1419 352
413 3300047443 Ga0495687_000501 Ga0495687_000501_18773_19831 352
414 3300047443 Ga0495687_000553 Ga0495687_000553_24436_25494 352
415 3300047443 Ga0495687_001634 Ga0495687_001634_4439_5497 352
416 3300047443 Ga0495687_080218 Ga0495687_080218_140_1198 352
417 3300047445 Ga0495677_0004229 Ga0495677_0004229_2178_3236 352
418 3300047445 Ga0495677_0007326 Ga0495677_0007326_1949_3007 352
419 3300047447 Ga0495685_000457 Ga0495685_000457_3542_4600 352
420 3300047447 Ga0495685_062294 Ga0495685_062294_43_1101 352
421 3300047469 Ga0495673_0007069 Ga0495673_0007069_3429_4523 352
422 3300047469 Ga0495673_0028713 Ga0495673_0028713_1435_2493 352
423 3300047470 Ga0495681_0000761 Ga0495681_0000761_13058_14116 352
424 3300047470 Ga0495681_0047434 Ga0495681_0047434_711_1769 352
425 3300047472 Ga0495686_0000977 Ga0495686_0000977_2345_3403 352
426 3300047472 Ga0495686_0001018 Ga0495686_0001018_11593_12651 352
427 3300047472 Ga0495686_0009435 Ga0495686_0009435_4815_5873 352
428 3300047472 Ga0495686_0081525 Ga0495686_0081525_70_1128 352
429 3300048091 Ga0495626_0002775 Ga0495626_0002775_9972_11030 352
430 3300048091 Ga0495626_0004864 Ga0495626_0004864_3763_4821 352
431 3300048091 Ga0495626_0114498 Ga0495626_0114498_57_1115 352
432 3300048904 Ga0496101_0002266 Ga0496101_0002266_2442_3500 352
433 3300048905 Ga0496102_0000195 Ga0496102_0000195_63969_65027 352
434 3300048905 Ga0496102_0000280 Ga0496102_0000280_17637_18695 352
435 3300048905 Ga0496102_0097093 Ga0496102_0097093_1598_2656 352
436 3300048910 Ga0496107_0015987 Ga0496107_0015987_3289_4347 352
437 3300048912 Ga0496109_0016209 Ga0496109_0016209_1487_2545 352
438 3300048913 Ga0496110_0000035 Ga0496110_0000035_20927_21985 352
439 3300048913 Ga0496110_0055980 Ga0496110_0055980_842_1900 352
440 3300048917 Ga0496114_0388479 Ga0496114_0388479_148_1206 352
441 3300048927 Ga0496124_0015311 Ga0496124_0015311_4863_5921 352
442 3300048929 Ga0496126_0005275 Ga0496126_0005275_4006_5076 352
443 3300048929 Ga0496126_0008206 Ga0496126_0008206_4825_5928 352
444 3300049459 Ga0495678_000252 Ga0495678_000252_18370_19428 352
445 3300049459 Ga0495678_000472 Ga0495678_000472_21011_22069 352
446 3300049459 Ga0495678_001092 Ga0495678_001092_11560_12618 352
447 3300049459 Ga0495678_001569 Ga0495678_001569_11001_12059 352
448 3300049459 Ga0495678_002039 Ga0495678_002039_5044_6102 352
449 3300049460 Ga0495682_0005224 Ga0495682_0005224_1426_2484 352
450 3300049671 Ga0501238_000341 Ga0501238_000341_3427_4527 352
451 3300050512 nmdc:mga0n895_196469_c1 nmdc:mga0n895_196469_c1_442_1500 352
452 3300053080 Ga0500635_0003783 Ga0500635_0003783_1463_2533 352
453 3300053102 Ga0500554_001407 Ga0500554_001407_3558_4628 352
454 3300053122 Ga0500608_000071 Ga0500608_000071_94_1188 352
455 3300053177 Ga0500636_0083800 Ga0500636_0083800_207_1295 352
456 3300053178 Ga0500637_0003531 Ga0500637_0003531_2204_3274 352
457 iso_pu_bacteria 2503198000 2503198483 352
458 iso_pu_bacteria 2508501123 2509114026 352
459 iso_pu_bacteria 2509276018 2509368550 352
460 iso_pu_bacteria 2509276022 2509393529 352
461 iso_pu_bacteria 2510065059 2510314830 352
462 iso_pu_bacteria 2512875016 2512934053 352
463 iso_pu_bacteria 2513237150 2513952969 352
464 iso_pu_bacteria 2513237164 2514038698 352
465 iso_pu_bacteria 2513237165 2514042484 352
466 iso_pu_bacteria 2513237305 2514418243 352
467 iso_pu_bacteria 2547132374 2548501508 352
468 iso_pu_bacteria 2582581299 2585229853 352
469 iso_pu_bacteria 2588253730 2588520193 352
470 iso_pu_bacteria 2596583598 2597029623 352
471 iso_pu_bacteria 2597489875 2597810387 352
472 iso_pu_bacteria 2599185178 2599446576 352
473 iso_pu_bacteria 2599185292 2599906179 352
474 iso_pu_bacteria 2599185301 2599935264 352
475 iso_pu_bacteria 2643221551 2643777570 352
476 iso_pu_bacteria 2643221555 2643796018 352
477 iso_pu_bacteria 2643221569 2643861961 352
478 iso_pu_bacteria 2643221577 2643893943 352
479 iso_pu_bacteria 2643221594 2643980995 352
480 iso_pu_bacteria 2643221595 2643983771 352
481 iso_pu_bacteria 2643221599 2644003918 352
482 iso_pu_bacteria 2643221621 2644122459 352
483 iso_pu_bacteria 2643221627 2644155904 352
484 iso_pu_bacteria 2643221634 2644192560 352
485 iso_pu_bacteria 2643221685 2644476162 352
486 iso_pu_bacteria 2643221717 2644645222 352
487 iso_pu_bacteria 2687453130 2687583446 352
488 iso_pu_bacteria 2687453392 2688595804 352
489 iso_pu_bacteria 2693429783 2694627980 352
490 iso_pu_bacteria 2693429784 2694636229 352
491 iso_pu_bacteria 2721755523 2722885270 352
492 iso_pu_bacteria 2721755686 2723573048 352
493 iso_pu_bacteria 2738541293 2738804099 352
494 iso_pu_bacteria 2739367655 2739613323 352
495 iso_pu_bacteria 2739367700 2739732015 352
496 iso_pu_bacteria 2747842501 2748017455 352
497 iso_pu_bacteria 2756170246 2756674876 352
498 iso_pu_bacteria 2791355123 2792746993 352
499 iso_pu_bacteria 2808606395 2809031679 352
500 iso_pu_bacteria 2834641062 2834641766 352
501 iso_pu_bacteria 2839138175 2839142071 352
502 iso_pu_bacteria 2841734538 2841736227 352
503 iso_pu_bacteria 2844002411 2844003647 352
504 iso_pu_bacteria 2844009547 2844010612 352
505 iso_pu_bacteria 2855730933 2855731165 352
506 iso_pu_bacteria 2855767633 2855767893 352
507 iso_pu_bacteria 2856320880 2856322231 352
508 iso_pu_bacteria 2856328259 2856332710 352
509 iso_pu_bacteria 2856334872 2856340697 352
510 iso_pu_bacteria 2856356410 2856356521 352
511 iso_pu_bacteria 2856364286 2856369981 352
512 iso_pu_bacteria 2857367948 2857369254 352
513 iso_pu_bacteria 2857504554 2857507047 352
514 iso_pu_bacteria 2857537821 2857540779 352
515 iso_pu_bacteria 2858950400 2858956499 352
516 iso_pu_bacteria 2869169390 2869173699 352
517 iso_pu_bacteria 2869234852 2869236956 352
518 iso_pu_bacteria 2869242130 2869245187 352
519 iso_pu_bacteria 2869249662 2869255859 352
520 iso_pu_bacteria 2869256925 2869260060 352
521 iso_pu_bacteria 2869264136 2869265110 352
522 iso_pu_bacteria 2869271264 2869277356 352
523 iso_pu_bacteria 2869278585 2869284673 352
524 iso_pu_bacteria 2869285874 2869290788 352
525 iso_pu_bacteria 2871429161 2871433070 352
526 iso_pu_bacteria 2871451962 2871452182 352
527 iso_pu_bacteria 2871459585 2871465918 352
528 iso_pu_bacteria 2871466892 2871472936 352
529 iso_pu_bacteria 2871474448 2871475647 352
530 iso_pu_bacteria 2871481445 2871484386 352
531 iso_pu_bacteria 2871488783 2871489646 352
532 iso_pu_bacteria 2871495908 2871502294 352
533 iso_pu_bacteria 2874109183 2874109486 352
534 iso_pu_bacteria 2874116593 2874122024 352
535 iso_pu_bacteria 2874123672 2874124231 352
536 iso_pu_bacteria 2874131515 2874138686 352
537 iso_pu_bacteria 2874139085 2874143006 352
538 iso_pu_bacteria 2874146452 2874153769 352
539 iso_pu_bacteria 2874155637 2874161034 352
540 iso_pu_bacteria 2874162495 2874168332 352
541 iso_pu_bacteria 2874168670 2874172217 352
542 iso_pu_bacteria 2876363079 2876363689 352
543 iso_pu_bacteria 2876369609 2876376017 352
544 iso_pu_bacteria 2876386047 2876386053 352
545 iso_pu_bacteria 2876392853 2876397141 352
546 iso_pu_bacteria 2876399893 2876403784 352
547 iso_pu_bacteria 2876406927 2876407919 352
548 iso_pu_bacteria 2876413966 2876419074 352
549 iso_pu_bacteria 2876420981 2876424488 352
550 iso_pu_bacteria 2878730984 2878731913 352
551 iso_pu_bacteria 2878738818 2878740925 352
552 iso_pu_bacteria 2878745973 2878750683 352
553 iso_pu_bacteria 2878753008 2878754318 352
554 iso_pu_bacteria 2878760144 2878766185 352
555 iso_pu_bacteria 2878767105 2878773386 352
556 iso_pu_bacteria 2878774303 2878778241 352
557 iso_pu_bacteria 2878781027 2878785545 352
558 iso_pu_bacteria 2878788777 2878794779 352
559 iso_pu_bacteria 2881147464 2881148232 352
560 iso_pu_bacteria 2881155292 2881159184 352
561 iso_pu_bacteria 2881161766 2881164881 352
562 iso_pu_bacteria 2881412998 2881414708 352
563 iso_pu_bacteria 2881845957 2881851367 352
564 iso_pu_bacteria 2881853255 2881856294 352
565 iso_pu_bacteria 2881927736 2881930751 352
566 iso_pu_bacteria 2882632389 2882634586 352
567 iso_pu_bacteria 2882912400 2882913256 352
568 iso_pu_bacteria 2884411467 2884413844 352
569 iso_pu_bacteria 2885266251 2885269629 352
570 iso_pu_bacteria 2885312484 2885314310 352
571 iso_pu_bacteria 2885318864 2885323616 352
572 iso_pu_bacteria 2885326080 2885332991 352
573 iso_pu_bacteria 2885342637 2885344599 352
574 iso_pu_bacteria 2885350715 2885355671 352
575 iso_pu_bacteria 2887375801 2887378398 352
576 iso_pu_bacteria 2888337043 2888343444 352
577 iso_pu_bacteria 2888343758 2888344185 352
578 iso_pu_bacteria 2888350351 2888353055 352
579 iso_pu_bacteria 2889010040 2889014800 352
580 iso_pu_bacteria 2900577576 2900578883 352
581 iso_pu_bacteria 2903448605 2903454226 352
582 iso_pu_bacteria 2903492973 2903496290 352
583 iso_pu_bacteria 2903492973 2903497367 352
584 iso_pu_bacteria 2903521522 2903523250 352
585 iso_pu_bacteria 2903528002 2903529289 352
586 iso_pu_bacteria 2903540706 2903547231 352
587 iso_pu_bacteria 2904659560 2904663895 352
588 iso_pu_bacteria 2906308376 2906313608 352
589 iso_pu_bacteria 2906321335 2906326317 352
590 iso_pu_bacteria 2906363423 2906369753 352
591 iso_pu_bacteria 2906370794 2906372839 352
592 iso_pu_bacteria 2906393657 2906394008 352
593 iso_pu_bacteria 2906401398 2906407729 352
594 iso_pu_bacteria 2906427513 2906433335 352
595 iso_pu_bacteria 2906626472 2906629899 352
596 iso_pu_bacteria 2909042592 2909044289 352
597 iso_pu_bacteria 2922130491 2922132604 352
598 iso_pu_bacteria 2922172374 2922174384 352
599 iso_pu_bacteria 2922178524 2922181925 352
600 iso_pu_bacteria 2922185730 2922193609 352
601 iso_pu_bacteria 2924710171 2924710586 352
602 iso_pu_bacteria 2924718760 2924723593 352
603 iso_pu_bacteria 2924733363 2924736506 352
604 iso_pu_bacteria 2924741084 2924745483 352
605 iso_pu_bacteria 2924748358 2924748628 352
606 iso_pu_bacteria 2924754689 2924756976 352
607 iso_pu_bacteria 2924776078 2924778526 352
608 iso_pu_bacteria 2924784321 2924788667 352
609 iso_pu_bacteria 2928058823 2928061638 352
610 iso_pu_bacteria 2928963466 2928964708 352
611 iso_pu_bacteria 2937813078 2937820087 352
612 iso_pu_bacteria 2937822353 2937826497 352
613 iso_pu_bacteria 2937836603 2937840597 352
614 iso_pu_bacteria 2937848649 2937849567 352
615 iso_pu_bacteria 2937868953 2937872204 352
616 iso_pu_bacteria 2937877337 2937878840 352
617 iso_pu_bacteria 2937972304 2937974379 352
618 iso_pu_bacteria 2937994558 2938001094 352
619 iso_pu_bacteria 2938014810 2938019698 352
620 iso_pu_bacteria 2941479691 2941482317 352
621 iso_pu_bacteria 2958034702 2958041471 352
622 iso_pu_bacteria 2958041894 2958042446 352
623 iso_pu_bacteria 2958064165 2958069531 352
624 iso_pu_bacteria 2958071322 2958077188 352
625 iso_pu_bacteria 2958084443 2958085991 352
626 iso_pu_bacteria 2958122699 2958123247 352
627 iso_pu_bacteria 2958130278 2958135188 352
628 iso_pu_bacteria 2958144490 2958147318 352
629 iso_pu_bacteria 2958158011 2958160651 352
630 iso_pu_bacteria 2958165035 2958171360 352
631 iso_pu_bacteria 2958179912 2958184217 352
632 iso_pu_bacteria 2961077736 2961082272 352
633 iso_pu_bacteria 2961114664 2961118965 352
634 iso_pu_bacteria 2961127735 2961129661 352
635 iso_pu_bacteria 2961136820 2961142305 352
636 iso_pu_bacteria 2961163497 2961169801 352
637 iso_pu_bacteria 2961170736 2961176372 352
638 iso_pu_bacteria 2961183825 2961190673 352
639 iso_pu_bacteria 2963644680 2963645149 352
640 iso_pu_bacteria 2965018300 2965024561 352
641 iso_pu_bacteria 2965025482 2965030159 352
642 iso_pu_bacteria 2965032056 2965038628 352
643 iso_pu_bacteria 2965040258 2965044014 352
644 iso_pu_bacteria 2965047637 2965054735 352
645 iso_pu_bacteria 2965089291 2965096598 352
646 iso_pu_bacteria 2965102966 2965105618 352
647 iso_pu_bacteria 2965110997 2965116673 352
648 iso_pu_bacteria 2967996073 2967996710 352
649 iso_pu_bacteria 2968003550 2968004772 352
650 iso_pu_bacteria 2968016561 2968022992 352
651 iso_pu_bacteria 2968083720 2968089952 352
652 iso_pu_bacteria 2968110612 2968115034 352
653 iso_pu_bacteria 2968138860 2968139168 352
654 iso_pu_bacteria 2968171901 2968178193 352
655 iso_pu_bacteria 2970469710 2970475576 352
656 iso_pu_bacteria 2970489779 2970492397 352
657 iso_pu_bacteria 2970503327 2970509043 352
658 iso_pu_bacteria 2970510686 2970510875 352
659 iso_pu_bacteria 2970524798 2970525896 352
660 iso_pu_bacteria 2970540015 2970544443 352
661 iso_pu_bacteria 2970547951 2970550139 352
662 iso_pu_bacteria 2970554993 2970561039 352
663 iso_pu_bacteria 2970593180 2970599285 352
664 iso_pu_bacteria 2970627176 2970628681 352
665 iso_pu_bacteria 2977821940 2977823532 352
666 iso_pu_bacteria 2977828996 2977835402 352
667 iso_pu_bacteria 2977843712 2977850369 352
668 iso_pu_bacteria 2977851361 2977855237 352
669 iso_pu_bacteria 2977864932 2977871692 352
670 iso_pu_bacteria 2977872689 2977873635 352
671 iso_pu_bacteria 2977898635 2977905707 352
672 iso_pu_bacteria 2977922695 2977925721 352
673 iso_pu_bacteria 2977935797 2977938203 352
674 iso_pu_bacteria 2977950692 2977954490 352
675 iso_pu_bacteria 2977957713 2977965266 352
676 iso_pu_bacteria 2977986579 2977987139 352
677 iso_pu_bacteria 2979764755 2979769030 352
678 iso_pu_bacteria 2979772303 2979774341 352
679 iso_pu_bacteria 2979793036 2979799697 352
680 iso_pu_bacteria 2979808191 2979813722 352
681 iso_pu_bacteria 2987645492 2987648162 352
682 iso_pu_bacteria 2987652177 2987656402 352
683 iso_pu_bacteria 2987659509 2987666025 352
684 iso_pu_bacteria 2987673487 2987675258 352
685 iso_pu_bacteria 2996310559 2996313985 352
686 iso_pu_bacteria 2996348954 2996355814 352
687 iso_pu_bacteria 2996386984 2996387509 352
688 iso_pu_bacteria 3000135777 3000137174 352
689 iso_pu_bacteria 3004167301 3004173040 352
690 iso_pu_bacteria 3004188549 3004195048 352
691 iso_pu_bacteria 3004195979 3004202817 352
692 iso_pu_bacteria 3004203850 3004210228 352
693 iso_pu_bacteria 3004211236 3004217259 352
694 iso_pu_bacteria 3004218560 3004220475 352
695 iso_pu_bacteria 3004232784 3004233458 352
696 iso_pu_bacteria 3004268573 3004275394 352
697 iso_pu_bacteria 3004275668 3004282240 352
698 iso_pu_bacteria 3004334049 3004337586 352
699 iso_pu_bacteria 3005452660 3005454405 352
700 iso_pu_bacteria 637000159 637077203 352
701 iso_pu_bacteria 644736347 644747417 352
702 iso_pu_bacteria 649633066 649870371 352
703 iso_pu_bacteria 8002392321 8002394900 352
704 iso_pu_bacteria 8003400568 8003404690 352
705 iso_pu_bacteria 8004300914 8004302675 352
706 iso_pu_bacteria 8004312739 8004315500 352
707 iso_pu_bacteria 8004361976 8004364818 352
708 iso_pu_bacteria 8004374579 8004375894 352
709 iso_pu_bacteria 8004387939 8004393077 352
710 iso_pu_bacteria 8004633249 8004638406 352
711 iso_pu_bacteria 8004640170 8004641565 352
712 iso_pu_bacteria 8004695233 8004696654 352
713 iso_pu_bacteria 8004714634 8004719864 352
714 iso_pu_bacteria 8004727605 8004734833 352
715 iso_pu_bacteria 8048746797 8048747855 352
716 iso_pu_bacteria 8055225921 8055228346 352
717 iso_pu_bacteria 8055617313 8055617710 352
718 3300003759 Ga0055525_1000006 Ga0055525_1000006370 353
719 3300003771 Ga0055526_1019970 Ga0055526_10199701 353
720 3300003794 Ga0055531_10000871 Ga0055531_100008717 353
721 3300005336 Ga0070680_100194710 Ga0070680_1001947101 353
722 3300005355 Ga0070671_100018068 Ga0070671_1000180684 353
723 3300005367 Ga0070667_100020903 Ga0070667_1000209032 353
724 3300005530 Ga0070679_100212332 Ga0070679_1002123322 353
725 3300005544 Ga0070686_100160481 Ga0070686_1001604812 353
726 3300005548 Ga0070665_100006629 Ga0070665_1000066295 353
727 3300005616 Ga0068852_100210710 Ga0068852_1002107101 353
728 3300005617 Ga0068859_100001918 Ga0068859_10000191811 353
729 3300005841 Ga0068863_100049098 Ga0068863_1000490985 353
730 3300005842 Ga0068858_100002832 Ga0068858_1000028329 353
731 3300005843 Ga0068860_100047260 Ga0068860_1000472602 353
732 3300006186 Ga0075369_10039412 Ga0075369_100394122 353
733 3300006931 Ga0097620_100001918 Ga0097620_1000019189 353
734 3300009092 Ga0105250_10021971 Ga0105250_100219712 353
735 3300009093 Ga0105240_10000229 Ga0105240_1000022981 353
736 3300009098 Ga0105245_10055393 Ga0105245_100553933 353
737 3300009101 Ga0105247_10000114 Ga0105247_1000011455 353
738 3300009174 Ga0105241_10004164 Ga0105241_100041645 353
739 3300009177 Ga0105248_10092670 Ga0105248_100926703 353
740 3300013306 Ga0163162_10039378 Ga0163162_100393785 353
741 3300014325 Ga0163163_10027524 Ga0163163_100275242 353
742 3300014968 Ga0157379_10021656 Ga0157379_100216565 353
743 3300015262 Ga0182007_10000583 Ga0182007_100005835 353
744 3300025225 Ga0209566_100394 Ga0209566_10039414 353
745 3300025229 Ga0209147_100091 Ga0209147_10009115 353
746 3300025230 Ga0209563_100022 Ga0209563_100022368 353
747 3300025253 Ga0209677_103002 Ga0209677_1030022 353
748 3300025295 Ga0209564_1000928 Ga0209564_100092816 353
749 3300025297 Ga0209758_1001455 Ga0209758_100145511 353
750 3300025304 Ga0209257_1000710 Ga0209257_100071034 353
751 3300025900 Ga0207710_10000184 Ga0207710_100001849 353
752 3300025909 Ga0207705_10020319 Ga0207705_100203192 353
753 3300025911 Ga0207654_10004285 Ga0207654_100042852 353
754 3300025913 Ga0207695_10000268 Ga0207695_1000026894 353
755 3300025914 Ga0207671_10040441 Ga0207671_100404412 353
756 3300025931 Ga0207644_10009366 Ga0207644_100093665 353
757 3300025932 Ga0207690_10053552 Ga0207690_100535521 353
758 3300025935 Ga0207709_10006448 Ga0207709_100064482 353
759 3300025942 Ga0207689_10221417 Ga0207689_102214172 353
760 3300025945 Ga0207679_10057572 Ga0207679_100575722 353
761 3300025949 Ga0207667_10033114 Ga0207667_100331143 353
762 3300026035 Ga0207703_10000397 Ga0207703_100003979 353
763 3300026078 Ga0207702_10259518 Ga0207702_102595181 353
764 3300026088 Ga0207641_10009012 Ga0207641_100090124 353
765 3300026116 Ga0207674_10289616 Ga0207674_102896161 353
766 3300026118 Ga0207675_100064318 Ga0207675_1000643183 353
767 3300026142 Ga0207698_10297193 Ga0207698_102971931 353
768 3300028381 Ga0268264_10011135 Ga0268264_100111354 353
769 3300028794 Ga0307515_10159783 Ga0307515_101597832 353
770 3300030745 Ga0316182_1100720 Ga0316182_11007203 353
771 3300031548 Ga0307408_100000215 Ga0307408_10000021532 353
772 3300037312 Ga0395899_0000098 Ga0395899_0000098_55035_56096 353
773 3300037312 Ga0395899_0000753 Ga0395899_0000753_13127_14188 353
774 3300037312 Ga0395899_0064808 Ga0395899_0064808_1598_2659 353
775 3300037312 Ga0395899_0072210 Ga0395899_0072210_517_1578 353
776 3300037312 Ga0395899_0187002 Ga0395899_0187002_331_1392 353
777 3300037312 Ga0395899_0222313 Ga0395899_0222313_222_1283 353
778 3300037418 Ga0395900_0012971 Ga0395900_0012971_2093_3154 353
779 3300037418 Ga0395900_0036141 Ga0395900_0036141_1486_2547 353
780 3300037418 Ga0395900_0401029 Ga0395900_0401029_250_1311 353
781 3300037471 Ga0395905_0000905 Ga0395905_0000905_25204_26301 353
782 3300037471 Ga0395905_0060955 Ga0395905_0060955_1373_2434 353
783 3300038443 Ga0395901_0008987 Ga0395901_0008987_8109_9170 353
784 3300038443 Ga0395901_0046846 Ga0395901_0046846_2955_4016 353
785 3300042005 Ga0439448_0006508 Ga0439448_0006508_2106_3167 353
786 3300042008 Ga0439450_012729 Ga0439450_012729_371_1432 353
787 3300042139 Ga0450904_000579 Ga0450904_000579_2379_3482 353
788 3300044684 Ga0466966_0081290 Ga0466966_0081290_27_1088 353
789 3300044684 Ga0466966_0153083 Ga0466966_0153083_30_1091 353
790 3300044706 Ga0466964_0000834 Ga0466964_0000834_5371_6432 353
791 3300046452 Ga0495617_000402 Ga0495617_000402_3856_4953 353
792 3300046457 Ga0495590_0000583 Ga0495590_0000583_14774_15835 353
793 3300046459 Ga0495629_0002022 Ga0495629_0002022_6854_7915 353
794 3300046459 Ga0495629_0019989 Ga0495629_0019989_165_1226 353
795 3300046460 Ga0495638_0000630 Ga0495638_0000630_21502_22599 353
796 3300046460 Ga0495638_0001012 Ga0495638_0001012_26778_27875 353
797 3300046463 Ga0495653_0013796 Ga0495653_0013796_5248_6309 353
798 3300046463 Ga0495653_0015094 Ga0495653_0015094_3965_5026 353
799 3300046463 Ga0495653_0020707 Ga0495653_0020707_3443_4504 353
800 3300046463 Ga0495653_0121766 Ga0495653_0121766_676_1737 353
801 3300046471 Ga0495650_0000441 Ga0495650_0000441_46985_48046 353
802 3300046472 Ga0495580_0071262 Ga0495580_0071262_369_1430 353
803 3300046473 Ga0495582_0005153 Ga0495582_0005153_3629_4690 353
804 3300046474 Ga0495605_0000265 Ga0495605_0000265_17852_18913 353
805 3300046474 Ga0495605_0092422 Ga0495605_0092422_125_1222 353
806 3300046491 Ga0495584_0000015 Ga0495584_0000015_79469_80566 353
807 3300046491 Ga0495584_0001039 Ga0495584_0001039_11883_12944 353
808 3300046491 Ga0495584_0003653 Ga0495584_0003653_596_1693 353
809 3300046491 Ga0495584_0007236 Ga0495584_0007236_234_1295 353
810 3300046491 Ga0495584_0093470 Ga0495584_0093470_336_1433 353
811 3300046492 Ga0495585_0000934 Ga0495585_0000934_8211_9308 353
812 3300046492 Ga0495585_0001705 Ga0495585_0001705_14888_15949 353
813 3300046492 Ga0495585_0005136 Ga0495585_0005136_3982_5043 353
814 3300046492 Ga0495585_0014225 Ga0495585_0014225_119_1180 353
815 3300046499 Ga0495594_0007446 Ga0495594_0007446_3177_4238 353
816 3300046499 Ga0495594_0184909 Ga0495594_0184909_73_1134 353
817 3300046500 Ga0495596_0000131 Ga0495596_0000131_28428_29489 353
818 3300046500 Ga0495596_0022278 Ga0495596_0022278_336_1433 353
819 3300046501 Ga0495607_0002493 Ga0495607_0002493_202_1263 353
820 3300046501 Ga0495607_0010144 Ga0495607_0010144_417_1478 353
821 3300046501 Ga0495607_0014831 Ga0495607_0014831_1159_2220 353
822 3300046506 Ga0495583_0000064 Ga0495583_0000064_32015_33112 353
823 3300046506 Ga0495583_0002267 Ga0495583_0002267_11712_12773 353
824 3300046506 Ga0495583_0006866 Ga0495583_0006866_6126_7223 353
825 3300046507 Ga0495606_0008529 Ga0495606_0008529_1140_2237 353
826 3300046507 Ga0495606_0033343 Ga0495606_0033343_1202_2299 353
827 3300046507 Ga0495606_0059705 Ga0495606_0059705_1239_2300 353
828 3300046507 Ga0495606_0130087 Ga0495606_0130087_79_1140 353
829 3300046513 Ga0495616_0000884 Ga0495616_0000884_1752_2849 353
830 3300046513 Ga0495616_0003127 Ga0495616_0003127_2667_3764 353
831 3300046513 Ga0495616_0005103 Ga0495616_0005103_6907_7968 353
832 3300046513 Ga0495616_0023428 Ga0495616_0023428_978_2039 353
833 3300046513 Ga0495616_0063896 Ga0495616_0063896_338_1399 353
834 3300046515 Ga0495620_0018320 Ga0495620_0018320_2195_3256 353
835 3300046518 Ga0495631_0002223 Ga0495631_0002223_3768_4829 353
836 3300046518 Ga0495631_0015249 Ga0495631_0015249_759_1856 353
837 3300046518 Ga0495631_0015644 Ga0495631_0015644_2229_3326 353
838 3300046519 Ga0495632_0004199 Ga0495632_0004199_5137_6198 353
839 3300046519 Ga0495632_0008651 Ga0495632_0008651_207_1268 353
840 3300046519 Ga0495632_0019432 Ga0495632_0019432_1268_2365 353
841 3300046519 Ga0495632_0044331 Ga0495632_0044331_397_1494 353
842 3300046523 Ga0495644_0011824 Ga0495644_0011824_1315_2376 353
843 3300046523 Ga0495644_0018921 Ga0495644_0018921_968_2029 353
844 3300046524 Ga0495648_0000136 Ga0495648_0000136_8211_9308 353
845 3300046526 Ga0495666_0000664 Ga0495666_0000664_12891_13952 353
846 3300046526 Ga0495666_0019306 Ga0495666_0019306_802_1863 353
847 3300046531 Ga0495665_0002601 Ga0495665_0002601_2951_4012 353
848 3300046531 Ga0495665_0034527 Ga0495665_0034527_409_1470 353
849 3300046535 Ga0495586_0006105 Ga0495586_0006105_3507_4568 353
850 3300046535 Ga0495586_0012925 Ga0495586_0012925_2360_3421 353
851 3300046535 Ga0495586_0050708 Ga0495586_0050708_855_1916 353
852 3300046535 Ga0495586_0154863 Ga0495586_0154863_38_1099 353
853 3300046536 Ga0495587_0069740 Ga0495587_0069740_131_1192 353
854 3300046542 Ga0495597_0000585 Ga0495597_0000585_25489_26586 353
855 3300046542 Ga0495597_0001130 Ga0495597_0001130_9126_10187 353
856 3300046542 Ga0495597_0004344 Ga0495597_0004344_2805_3866 353
857 3300046542 Ga0495597_0013021 Ga0495597_0013021_867_1964 353
858 3300046543 Ga0495645_0141464 Ga0495645_0141464_465_1526 353
859 3300046557 Ga0495622_0017848 Ga0495622_0017848_1974_3035 353
860 3300046558 Ga0495633_0008051 Ga0495633_0008051_1778_2839 353
861 3300046616 Ga0495668_0012880 Ga0495668_0012880_132_1193 353
862 3300046616 Ga0495668_0038630 Ga0495668_0038630_553_1650 353
863 3300046616 Ga0495668_0042037 Ga0495668_0042037_899_1996 353
864 3300046642 Ga0495634_0069035 Ga0495634_0069035_779_1840 353
865 3300046648 Ga0495611_0004405 Ga0495611_0004405_858_1955 353
866 3300046660 Ga0495625_0000230 Ga0495625_0000230_26533_27630 353
867 3300046660 Ga0495625_0026421 Ga0495625_0026421_3280_4377 353
868 3300046663 Ga0495635_0024052 Ga0495635_0024052_441_1502 353
869 3300046665 Ga0495661_0001662 Ga0495661_0001662_3901_4962 353
870 3300046665 Ga0495661_0002270 Ga0495661_0002270_10211_11272 353
871 3300046665 Ga0495661_0022366 Ga0495661_0022366_1111_2172 353
872 3300046674 Ga0495588_0000190 Ga0495588_0000190_21910_22971 353
873 3300046689 Ga0495613_0023290 Ga0495613_0023290_1792_2853 353
874 3300046691 Ga0495670_0002937 Ga0495670_0002937_3899_4960 353
875 3300046691 Ga0495670_0003059 Ga0495670_0003059_4062_5123 353
876 3300046691 Ga0495670_0022504 Ga0495670_0022504_1133_2194 353
877 3300046691 Ga0495670_0052760 Ga0495670_0052760_223_1284 353
878 3300046694 Ga0495649_0001493 Ga0495649_0001493_12751_13812 353
879 3300046794 Ga0495589_0000268 Ga0495589_0000268_22998_24059 353
880 3300046794 Ga0495589_0010560 Ga0495589_0010560_183_1280 353
881 3300046794 Ga0495589_0022926 Ga0495589_0022926_1428_2489 353
882 3300046809 Ga0495600_0009442 Ga0495600_0009442_1766_2827 353
883 3300046809 Ga0495600_0083988 Ga0495600_0083988_462_1523 353
884 3300046810 Ga0495660_0000434 Ga0495660_0000434_17325_18386 353
885 3300046810 Ga0495660_0104040 Ga0495660_0104040_160_1257 353
886 3300047317 Ga0495604_0005844 Ga0495604_0005844_3273_4334 353
887 3300047317 Ga0495604_0016126 Ga0495604_0016126_1367_2428 353
888 3300047318 Ga0495636_0002722 Ga0495636_0002722_780_1841 353
889 3300047320 Ga0495672_0000005 Ga0495672_0000005_323017_324078 353
890 3300047320 Ga0495672_0000478 Ga0495672_0000478_31806_32867 353
891 3300047320 Ga0495672_0001397 Ga0495672_0001397_1400_2461 353
892 3300047322 Ga0495680_0014185 Ga0495680_0014185_2530_3591 353
893 3300047323 Ga0495683_0000463 Ga0495683_0000463_25069_26166 353
894 3300047323 Ga0495683_0021351 Ga0495683_0021351_2070_3131 353
895 3300047323 Ga0495683_0033762 Ga0495683_0033762_1294_2391 353
896 3300047323 Ga0495683_0048814 Ga0495683_0048814_1035_2096 353
897 3300047443 Ga0495687_004979 Ga0495687_004979_169_1230 353
898 3300047444 Ga0495675_0001035 Ga0495675_0001035_8808_9869 353
899 3300047444 Ga0495675_0081127 Ga0495675_0081127_887_1948 353
900 3300047445 Ga0495677_0003135 Ga0495677_0003135_437_1498 353
901 3300047445 Ga0495677_0007873 Ga0495677_0007873_576_1637 353
902 3300047445 Ga0495677_0043170 Ga0495677_0043170_54_1115 353
903 3300047446 Ga0495679_004223 Ga0495679_004223_4796_5857 353
904 3300047446 Ga0495679_005307 Ga0495679_005307_4413_5510 353
905 3300047447 Ga0495685_001471 Ga0495685_001471_6042_7139 353
906 3300047469 Ga0495673_0000083 Ga0495673_0000083_108738_109835 353
907 3300047470 Ga0495681_0030241 Ga0495681_0030241_97_1158 353
908 3300047472 Ga0495686_0000755 Ga0495686_0000755_13153_14214 353
909 3300047472 Ga0495686_0007445 Ga0495686_0007445_5362_6459 353
910 3300048088 Ga0495602_0032795 Ga0495602_0032795_3573_4634 353
911 3300048091 Ga0495626_0000050 Ga0495626_0000050_56859_57920 353
912 3300048091 Ga0495626_0000418 Ga0495626_0000418_16845_17906 353
913 3300048091 Ga0495626_0004385 Ga0495626_0004385_2683_3744 353
914 3300048091 Ga0495626_0005212 Ga0495626_0005212_3786_4847 353
915 3300048905 Ga0496102_0014162 Ga0496102_0014162_5050_6111 353
916 3300048910 Ga0496107_0000539 Ga0496107_0000539_2283_3380 353
917 3300048918 Ga0496115_0004887 Ga0496115_0004887_5533_6594 353
918 3300048918 Ga0496115_0173856 Ga0496115_0173856_535_1596 353
919 3300048924 Ga0496121_0002089 Ga0496121_0002089_11040_12101 353
920 3300048924 Ga0496121_0013665 Ga0496121_0013665_3908_5005 353
921 3300048925 Ga0496122_0039228 Ga0496122_0039228_1540_2601 353
922 3300048925 Ga0496122_0144195 Ga0496122_0144195_344_1405 353
923 3300048926 Ga0496123_0002533 Ga0496123_0002533_19396_20457 353
924 3300048927 Ga0496124_0082036 Ga0496124_0082036_1378_2439 353
925 3300048928 Ga0496125_0015735 Ga0496125_0015735_2255_3316 353
926 3300048928 Ga0496125_0052440 Ga0496125_0052440_40_1137 353
927 3300049574 Ga0501038_0040752 Ga0501038_0040752_360_1553 353
928 3300049581 Ga0501047_0093114 Ga0501047_0093114_513_1601 353
929 3300049822 Ga0501035_0063941 Ga0501035_0063941_676_1764 353
930 3300049823 Ga0501044_0019689 Ga0501044_0019689_1204_2292 353
931 3300053093 Ga0500651_0062449 Ga0500651_0062449_315_1430 353
932 3300053102 Ga0500554_001976 Ga0500554_001976_1195_2292 353
933 3300053125 Ga0500618_000076 Ga0500618_000076_19627_20724 353
934 3300053136 Ga0500559_0096154 Ga0500559_0096154_35_1132 353
935 iso_pu_bacteria 2501025501 2501071000 353
936 iso_pu_bacteria 2501025502 2501078848 353
937 iso_pu_bacteria 2501025504 2501413830 353
938 iso_pu_bacteria 2508501125 2509129375 353
939 iso_pu_bacteria 2510065045 2510249963 353
940 iso_pu_bacteria 2510917013 2511089485 353
941 iso_pu_bacteria 2510917014 2511094900 353
942 iso_pu_bacteria 2510917015 2511104559 353
943 iso_pu_bacteria 2510917020 2511124640 353
944 iso_pu_bacteria 2512047030 2512347510 353
945 iso_pu_bacteria 2513237082 2513551582 353
946 iso_pu_bacteria 2513237083 2513560233 353
947 iso_pu_bacteria 2513237151 2513962469 353
948 iso_pu_bacteria 2513237166 2514046275 353
949 iso_pu_bacteria 2515154122 2515679430 353
950 iso_pu_bacteria 2515154123 2515690468 353
951 iso_pu_bacteria 2515154189 2516016986 353
952 iso_pu_bacteria 2519103095 2519457880 353
953 iso_pu_bacteria 2526164713 2527079131 353
954 iso_pu_bacteria 2562617112 2563061891 353
955 iso_pu_bacteria 2582581280 2585150931 353
956 iso_pu_bacteria 2582581293 2585199282 353
957 iso_pu_bacteria 2582581311 2585295184 353
958 iso_pu_bacteria 2599185239 2599737015 353
959 iso_pu_bacteria 2599185240 2599742873 353
960 iso_pu_bacteria 2599185355 2600204991 353
961 iso_pu_bacteria 2600255067 2600814631 353
962 iso_pu_bacteria 2643221552 2643781860 353
963 iso_pu_bacteria 2643221583 2643925292 353
964 iso_pu_bacteria 2643221584 2643927606 353
965 iso_pu_bacteria 2675903129 2676741980 353
966 iso_pu_bacteria 2711768613 2713478273 353
967 iso_pu_bacteria 2718217991 2719639121 353
968 iso_pu_bacteria 2721755763 2723879418 353
969 iso_pu_bacteria 2734482258 2735816192 353
970 iso_pu_bacteria 2738541296 2738820124 353
971 iso_pu_bacteria 2738541298 2738832604 353
972 iso_pu_bacteria 2738541306 2738874131 353
973 iso_pu_bacteria 2738543002 2739185761 353
974 iso_pu_bacteria 2738543008 2739220729 353
975 iso_pu_bacteria 2744054900 2746092238 353
976 iso_pu_bacteria 2744054901 2746095279 353
977 iso_pu_bacteria 2751185846 2753568815 353
978 iso_pu_bacteria 2791355048 2792458908 353
979 iso_pu_bacteria 2791355137 2792833003 353
980 iso_pu_bacteria 2808606384 2808971590 353
981 iso_pu_bacteria 2808606390 2809006419 353
982 iso_pu_bacteria 2808606391 2809013663 353
983 iso_pu_bacteria 2816332253 2817260062 353
984 iso_pu_bacteria 2816332256 2817277726 353
985 iso_pu_bacteria 2816332286 2817456861 353
986 iso_pu_bacteria 2818991435 2819539549 353
987 iso_pu_bacteria 2818991450 2819620864 353
988 iso_pu_bacteria 2818991452 2819632517 353
989 iso_pu_bacteria 2818991454 2819648757 353
990 iso_pu_bacteria 2842324504 2842331340 353
991 iso_pu_bacteria 2842348783 2842355680 353
992 iso_pu_bacteria 2842454564 2842462016 353
993 iso_pu_bacteria 2843744320 2843749064 353
994 iso_pu_bacteria 2849560528 2849564390 353
995 iso_pu_bacteria 2849573788 2849575261 353
996 iso_pu_bacteria 2851153111 2851155518 353
997 iso_pu_bacteria 2856287931 2856289150 353
998 iso_pu_bacteria 2857357740 2857363479 353
999 iso_pu_bacteria 2863421361 2863421557 353
1000 iso_pu_bacteria 2870068957 2870069018 353
1001 iso_pu_bacteria 2883087390 2883094743 353
1002 iso_pu_bacteria 2884960567 2884962770 353
1003 iso_pu_bacteria 2898329390 2898330882 353
1004 iso_pu_bacteria 2900634093 2900636251 353
1005 iso_pu_bacteria 2902682994 2902683448 353
1006 iso_pu_bacteria 2904434214 2904438410 353
1007 iso_pu_bacteria 2904483920 2904483957 353
1008 iso_pu_bacteria 2904564687 2904565739 353
1009 iso_pu_bacteria 2904571731 2904572782 353
1010 iso_pu_bacteria 2904615490 2904618891 353
1011 iso_pu_bacteria 2919527303 2919529905 353
1012 iso_pu_bacteria 2921643360 2921643735 353
1013 iso_pu_bacteria 2928108538 2928109666 353
1014 iso_pu_bacteria 2928135762 2928136880 353
1015 iso_pu_bacteria 2928157003 2928159864 353
1016 iso_pu_bacteria 2928163908 2928164095 353
1017 iso_pu_bacteria 2928170801 2928173376 353
1018 iso_pu_bacteria 2928503688 2928506408 353
1019 iso_pu_bacteria 2928536128 2928538695 353
1020 iso_pu_bacteria 2945934425 2945935417 353
1021 iso_pu_bacteria 2981990288 2981994303 353
1022 iso_pu_bacteria 2990703756 2990704034 353
1023 iso_pu_bacteria 641736151 642422191 353
1024 iso_pu_bacteria 641736154 642417454 353
1025 iso_pu_bacteria 642555112 642594300 353
1026 iso_pu_bacteria 642555113 642620289 353
1027 iso_pu_bacteria 8003955200 8003957500 353
1028 iso_pu_bacteria 8018845410 8018848975 353
1029 iso_pu_bacteria 8020807995 8020812261 353
1030 iso_pu_bacteria 8020938398 8020944851 353
1031 iso_pu_bacteria 8020945358 8020949724 353
1032 iso_pu_bacteria 8020953355 8020959936 353
1033 iso_pu_bacteria 8021120328 8021126739 353
1034 iso_pu_bacteria 8039098773 8039099196 353
1035 iso_pu_bacteria 8040167225 8040172284 353
1036 iso_pu_bacteria 8040173305 8040175765 353
1037 iso_pu_bacteria 8055266321 8055266713 353
1038 iso_pu_bacteria 8055301274 8055303929 353
1039 3300002705 JGI25156J39149_1000088 JGI25156J39149_100008840 354
1040 3300002705 JGI25156J39149_1000170 JGI25156J39149_100017019 354
1041 3300002737 JGI25162J39368_1000026 JGI25162J39368_1000026175 354
1042 3300002737 JGI25162J39368_1000027 JGI25162J39368_1000027215 354
1043 3300002738 JGI25154J39366_1000351 JGI25154J39366_10003512 354
1044 3300002738 JGI25154J39366_1000415 JGI25154J39366_10004152 354
1045 3300002738 JGI25154J39366_1001101 JGI25154J39366_10011019 354
1046 3300002738 JGI25154J39366_1001281 JGI25154J39366_10012813 354
1047 3300002741 JGI25157J39369_1000116 JGI25157J39369_100011640 354
1048 3300002741 JGI25157J39369_1000170 JGI25157J39369_100017028 354
1049 3300002774 JGI25150J39212_1002302 JGI25150J39212_10023022 354
1050 3300003214 JGI25165J46597_1000031 JGI25165J46597_100003171 354
1051 3300003215 JGI25153J46596_10041786 JGI25153J46596_100417861 354
1052 3300003575 Ga0007409J51694_1027127 Ga0007409J51694_10271274 354
1053 3300003693 Ga0032354_1049916 Ga0032354_10499165 354
1054 3300003751 Ga0055538_1000013 Ga0055538_100001368 354
1055 3300003751 Ga0055538_1000018 Ga0055538_100001871 354
1056 3300003752 Ga0055539_1000018 Ga0055539_100001868 354
1057 3300003752 Ga0055539_1000023 Ga0055539_100002371 354
1058 3300003756 Ga0055533_1000022 Ga0055533_100002268 354
1059 3300003756 Ga0055533_1000031 Ga0055533_1000031223 354
1060 3300003758 Ga0055532_1000017 Ga0055532_1000017130 354
1061 3300003759 Ga0055525_1000024 Ga0055525_100002468 354
1062 3300003759 Ga0055525_1000039 Ga0055525_100003971 354
1063 3300003763 Ga0055529_1000246 Ga0055529_100024633 354
1064 3300003771 Ga0055526_1000174 Ga0055526_100017415 354
1065 3300003771 Ga0055526_1000446 Ga0055526_100044614 354
1066 3300003841 Ga0055541_1000013 Ga0055541_100001368 354
1067 3300003841 Ga0055541_1000016 Ga0055541_100001671 354
1068 3300005329 Ga0070683_100171159 Ga0070683_1001711591 354
1069 3300005331 Ga0070670_100039584 Ga0070670_1000395842 354
1070 3300005337 Ga0070682_100000901 Ga0070682_1000009013 354
1071 3300005366 Ga0070659_100054988 Ga0070659_1000549883 354
1072 3300005445 Ga0070708_100135204 Ga0070708_1001352041 354
1073 3300005455 Ga0070663_100044054 Ga0070663_1000440542 354
1074 3300005458 Ga0070681_10006343 Ga0070681_100063432 354
1075 3300005458 Ga0070681_10011800 Ga0070681_100118002 354
1076 3300005458 Ga0070681_10015907 Ga0070681_100159075 354
1077 3300005458 Ga0070681_10076885 Ga0070681_100768854 354
1078 3300005467 Ga0070706_100046942 Ga0070706_1000469423 354
1079 3300005468 Ga0070707_100059142 Ga0070707_1000591423 354
1080 3300005530 Ga0070679_100004573 Ga0070679_1000045736 354
1081 3300005530 Ga0070679_100005646 Ga0070679_1000056467 354
1082 3300005548 Ga0070665_100002293 Ga0070665_10000229313 354
1083 3300005548 Ga0070665_100009501 Ga0070665_1000095017 354
1084 3300005563 Ga0068855_100000444 Ga0068855_1000004441 354
1085 3300005563 Ga0068855_100023171 Ga0068855_1000231714 354
1086 3300005563 Ga0068855_100083526 Ga0068855_1000835265 354
1087 3300005577 Ga0068857_100000420 Ga0068857_10000042017 354
1088 3300005577 Ga0068857_100318459 Ga0068857_1003184592 354
1089 3300005578 Ga0068854_100020282 Ga0068854_1000202824 354
1090 3300005614 Ga0068856_100009005 Ga0068856_10000900512 354
1091 3300005614 Ga0068856_100094661 Ga0068856_1000946614 354
1092 3300005614 Ga0068856_100123276 Ga0068856_1001232763 354
1093 3300005840 Ga0068870_10017423 Ga0068870_100174232 354
1094 3300005842 Ga0068858_100000646 Ga0068858_10000064619 354
1095 3300005843 Ga0068860_100016516 Ga0068860_1000165161 354
1096 3300005844 Ga0068862_100000542 Ga0068862_10000054222 354
1097 3300005844 Ga0068862_100017753 Ga0068862_1000177533 354
1098 3300005937 Ga0081455_10000519 Ga0081455_100005192 354
1099 3300006358 Ga0068871_100204242 Ga0068871_1002042421 354
1100 3300006844 Ga0075428_100000382 Ga0075428_10000038222 354
1101 3300006844 Ga0075428_100004272 Ga0075428_1000042724 354
1102 3300006844 Ga0075428_100008063 Ga0075428_1000080637 354
1103 3300006846 Ga0075430_100005806 Ga0075430_1000058066 354
1104 3300006847 Ga0075431_100000837 Ga0075431_1000008375 354
1105 3300006847 Ga0075431_100021183 Ga0075431_1000211836 354
1106 3300006871 Ga0075434_100319933 Ga0075434_1003199332 354
1107 3300006880 Ga0075429_100002408 Ga0075429_1000024085 354
1108 3300006880 Ga0075429_100010168 Ga0075429_1000101682 354
1109 3300006880 Ga0075429_100018546 Ga0075429_1000185463 354
1110 3300006946 Ga0079104_1004361 Ga0079104_10043611 354
1111 3300009036 Ga0105244_10000928 Ga0105244_1000092812 354
1112 3300009036 Ga0105244_10002005 Ga0105244_100020058 354
1113 3300009036 Ga0105244_10039266 Ga0105244_100392662 354
1114 3300009093 Ga0105240_10002233 Ga0105240_1000223312 354
1115 3300009093 Ga0105240_10012613 Ga0105240_1001261310 354
1116 3300009093 Ga0105240_10022318 Ga0105240_100223183 354
1117 3300009093 Ga0105240_10041003 Ga0105240_100410034 354
1118 3300009094 Ga0111539_10007063 Ga0111539_100070635 354
1119 3300009094 Ga0111539_10031120 Ga0111539_100311204 354
1120 3300009147 Ga0114129_10007216 Ga0114129_100072166 354
1121 3300009174 Ga0105241_10087592 Ga0105241_100875922 354
1122 3300009174 Ga0105241_10156983 Ga0105241_101569833 354
1123 3300009177 Ga0105248_10088363 Ga0105248_100883633 354
1124 3300009545 Ga0105237_10045290 Ga0105237_100452905 354
1125 3300009545 Ga0105237_10329821 Ga0105237_103298212 354
1126 3300009551 Ga0105238_10005465 Ga0105238_100054657 354
1127 3300009551 Ga0105238_10016507 Ga0105238_100165072 354
1128 3300009551 Ga0105238_10073033 Ga0105238_100730334 354
1129 3300009551 Ga0105238_10240598 Ga0105238_102405982 354
1130 3300009553 Ga0105249_10016732 Ga0105249_100167322 354
1131 3300009553 Ga0105249_10081597 Ga0105249_100815971 354
1132 3300009553 Ga0105249_10197266 Ga0105249_101972662 354
1133 3300009553 Ga0105249_10279409 Ga0105249_102794092 354
1134 3300010375 Ga0105239_10027882 Ga0105239_100278828 354
1135 3300013100 Ga0157373_10050665 Ga0157373_100506652 354
1136 3300013102 Ga0157371_10008891 Ga0157371_100088913 354
1137 3300013104 Ga0157370_10001151 Ga0157370_1000115111 354
1138 3300013105 Ga0157369_10019076 Ga0157369_100190763 354
1139 3300013306 Ga0163162_10055315 Ga0163162_100553152 354
1140 3300013307 Ga0157372_10069469 Ga0157372_100694694 354
1141 3300014968 Ga0157379_10093252 Ga0157379_100932522 354
1142 3300014968 Ga0157379_10228963 Ga0157379_102289632 354
1143 3300014969 Ga0157376_10148712 Ga0157376_101487122 354
1144 3300015261 Ga0182006_1000004 Ga0182006_1000004125 354
1145 3300015261 Ga0182006_1000019 Ga0182006_1000019115 354
1146 3300015261 Ga0182006_1076062 Ga0182006_10760621 354
1147 3300015262 Ga0182007_10000028 Ga0182007_10000028123 354
1148 3300015265 Ga0182005_1000005 Ga0182005_100000593 354
1149 3300015265 Ga0182005_1000011 Ga0182005_1000011252 354
1150 3300015265 Ga0182005_1000726 Ga0182005_100072610 354
1151 3300021361 Ga0213872_10000017 Ga0213872_10000017104 354
1152 3300021361 Ga0213872_10002691 Ga0213872_100026912 354
1153 3300025206 Ga0209435_100015 Ga0209435_100015145 354
1154 3300025206 Ga0209435_100161 Ga0209435_10016120 354
1155 3300025224 Ga0209784_100005 Ga0209784_100005654 354
1156 3300025224 Ga0209784_100027 Ga0209784_10002772 354
1157 3300025225 Ga0209566_100005 Ga0209566_100005654 354
1158 3300025225 Ga0209566_100027 Ga0209566_10002772 354
1159 3300025226 Ga0209674_100009 Ga0209674_100009654 354
1160 3300025226 Ga0209674_100044 Ga0209674_10004472 354
1161 3300025229 Ga0209147_100004 Ga0209147_1000041081 354
1162 3300025230 Ga0209563_100012 Ga0209563_100012654 354
1163 3300025230 Ga0209563_100048 Ga0209563_10004872 354
1164 3300025231 Ga0207427_100369 Ga0207427_10036916 354
1165 3300025233 Ga0209437_100045 Ga0209437_100045390 354
1166 3300025233 Ga0209437_100055 Ga0209437_10005572 354
1167 3300025233 Ga0209437_102850 Ga0209437_1028503 354
1168 3300025233 Ga0209437_107529 Ga0209437_1075291 354
1169 3300025242 Ga0209258_100226 Ga0209258_10022670 354
1170 3300025242 Ga0209258_100626 Ga0209258_10062631 354
1171 3300025245 Ga0207425_1002630 Ga0207425_10026303 354
1172 3300025246 Ga0209646_1000020 Ga0209646_1000020132 354
1173 3300025246 Ga0209646_1000040 Ga0209646_1000040175 354
1174 3300025246 Ga0209646_1000162 Ga0209646_100016256 354
1175 3300025246 Ga0209646_1000267 Ga0209646_10002674 354
1176 3300025250 Ga0209026_1000004 Ga0209026_100000440 354
1177 3300025250 Ga0209026_1000034 Ga0209026_1000034144 354
1178 3300025250 Ga0209026_1005576 Ga0209026_10055763 354
1179 3300025253 Ga0209677_100006 Ga0209677_100006654 354
1180 3300025253 Ga0209677_100028 Ga0209677_10002872 354
1181 3300025253 Ga0209677_100176 Ga0209677_10017653 354
1182 3300025256 Ga0209759_1000003 Ga0209759_1000003687 354
1183 3300025256 Ga0209759_1000049 Ga0209759_100004959 354
1184 3300025256 Ga0209759_1000357 Ga0209759_100035735 354
1185 3300025256 Ga0209759_1010121 Ga0209759_10101212 354
1186 3300025261 Ga0209233_1000070 Ga0209233_100007072 354
1187 3300025272 Ga0209455_1000187 Ga0209455_100018733 354
1188 3300025272 Ga0209455_1014006 Ga0209455_10140062 354
1189 3300025295 Ga0209564_1000028 Ga0209564_100002814 354
1190 3300025295 Ga0209564_1000032 Ga0209564_1000032179 354
1191 3300025297 Ga0209758_1000427 Ga0209758_100042742 354
1192 3300025728 Ga0207655_1013046 Ga0207655_10130462 354
1193 3300025728 Ga0207655_1013584 Ga0207655_10135843 354
1194 3300025910 Ga0207684_10083418 Ga0207684_100834181 354
1195 3300025912 Ga0207707_10000480 Ga0207707_1000048035 354
1196 3300025912 Ga0207707_10076539 Ga0207707_100765392 354
1197 3300025912 Ga0207707_10095891 Ga0207707_100958914 354
1198 3300025912 Ga0207707_10138592 Ga0207707_101385921 354
1199 3300025912 Ga0207707_10310006 Ga0207707_103100062 354
1200 3300025913 Ga0207695_10001341 Ga0207695_1000134126 354
1201 3300025913 Ga0207695_10006037 Ga0207695_100060375 354
1202 3300025913 Ga0207695_10025905 Ga0207695_100259053 354
1203 3300025913 Ga0207695_10048152 Ga0207695_100481523 354
1204 3300025914 Ga0207671_10015117 Ga0207671_100151172 354
1205 3300025914 Ga0207671_10049405 Ga0207671_100494054 354
1206 3300025917 Ga0207660_10006191 Ga0207660_100061913 354
1207 3300025917 Ga0207660_10034918 Ga0207660_100349182 354
1208 3300025921 Ga0207652_10003672 Ga0207652_1000367210 354
1209 3300025921 Ga0207652_10006250 Ga0207652_100062501 354
1210 3300025924 Ga0207694_10008640 Ga0207694_100086405 354
1211 3300025924 Ga0207694_10038687 Ga0207694_100386874 354
1212 3300025924 Ga0207694_10244040 Ga0207694_102440402 354
1213 3300025924 Ga0207694_10262112 Ga0207694_102621121 354
1214 3300025925 Ga0207650_10037388 Ga0207650_100373884 354
1215 3300025932 Ga0207690_10008096 Ga0207690_100080961 354
1216 3300025932 Ga0207690_10025631 Ga0207690_100256313 354
1217 3300025933 Ga0207706_10014682 Ga0207706_100146823 354
1218 3300025944 Ga0207661_10143706 Ga0207661_101437061 354
1219 3300025949 Ga0207667_10008318 Ga0207667_100083188 354
1220 3300025949 Ga0207667_10009027 Ga0207667_1000902712 354
1221 3300025949 Ga0207667_10213767 Ga0207667_102137672 354
1222 3300025961 Ga0207712_10046950 Ga0207712_100469502 354
1223 3300025961 Ga0207712_10191355 Ga0207712_101913551 354
1224 3300025981 Ga0207640_10002909 Ga0207640_100029096 354
1225 3300025981 Ga0207640_10180376 Ga0207640_101803762 354
1226 3300025986 Ga0207658_10146336 Ga0207658_101463362 354
1227 3300026035 Ga0207703_10001403 Ga0207703_100014032 354
1228 3300026041 Ga0207639_10014615 Ga0207639_100146152 354
1229 3300026067 Ga0207678_10025599 Ga0207678_100255995 354
1230 3300026075 Ga0207708_10077093 Ga0207708_100770932 354
1231 3300026078 Ga0207702_10003986 Ga0207702_1000398615 354
1232 3300026078 Ga0207702_10130312 Ga0207702_101303122 354
1233 3300026088 Ga0207641_10001912 Ga0207641_100019124 354
1234 3300026088 Ga0207641_10202057 Ga0207641_102020572 354
1235 3300026116 Ga0207674_10195488 Ga0207674_101954881 354
1236 3300026116 Ga0207674_10336298 Ga0207674_103362982 354
1237 3300026118 Ga0207675_100000884 Ga0207675_1000008849 354
1238 3300027907 Ga0207428_10037005 Ga0207428_100370053 354
1239 3300028379 Ga0268266_10002569 Ga0268266_1000256911 354
1240 3300028379 Ga0268266_10008091 Ga0268266_100080912 354
1241 3300028380 Ga0268265_10010687 Ga0268265_100106877 354
1242 3300028381 Ga0268264_10000151 Ga0268264_1000015112 354
1243 3300028573 Ga0265334_10008152 Ga0265334_100081526 354
1244 3300028794 Ga0307515_10005264 Ga0307515_100052644 354
1245 3300028794 Ga0307515_10193947 Ga0307515_101939471 354
1246 3300031235 Ga0265330_10035895 Ga0265330_100358952 354
1247 3300031238 Ga0265332_10001923 Ga0265332_100019235 354
1248 3300031239 Ga0265328_10053065 Ga0265328_100530652 354
1249 3300031250 Ga0265331_10003718 Ga0265331_100037187 354
1250 3300031456 Ga0307513_10076186 Ga0307513_100761862 354
1251 3300031548 Ga0307408_100036643 Ga0307408_1000366433 354
1252 3300031548 Ga0307408_100125032 Ga0307408_1001250323 354
1253 3300031711 Ga0265314_10036468 Ga0265314_100364682 354
1254 3300031852 Ga0307410_10248928 Ga0307410_102489281 354
1255 3300031901 Ga0307406_10020505 Ga0307406_100205054 354
1256 3300031903 Ga0307407_10268602 Ga0307407_102686021 354
1257 3300033180 Ga0307510_10000003 Ga0307510_10000003266 354
1258 3300035114 Ga0373939_0039177 Ga0373939_0039177_262_1341 354
1259 3300037418 Ga0395900_0127431 Ga0395900_0127431_461_1525 354
1260 3300037466 Ga0395898_0103351 Ga0395898_0103351_457_1521 354
1261 3300037471 Ga0395905_0010198 Ga0395905_0010198_6349_7413 354
1262 3300038443 Ga0395901_0103697 Ga0395901_0103697_1293_2378 354
1263 3300039447 Ga0436361_0256918 Ga0436361_0256918_5152_6216 354
1264 3300039447 Ga0436361_0384951 Ga0436361_0384951_32_1099 354
1265 3300039447 Ga0436361_0605639 Ga0436361_0605639_220_1284 354
1266 3300039447 Ga0436361_0636093 Ga0436361_0636093_192_1256 354
1267 3300039447 Ga0436361_0746602 Ga0436361_0746602_25830_26894 354
1268 3300044656 Ga0466969_0009116 Ga0466969_0009116_4019_5113 354
1269 3300044658 Ga0466972_0000111 Ga0466972_0000111_61035_62108 354
1270 3300044658 Ga0466972_0102628 Ga0466972_0102628_126_1220 354
1271 3300044683 Ga0466965_0054440 Ga0466965_0054440_172_1257 354
1272 3300044684 Ga0466966_0014518 Ga0466966_0014518_2639_3733 354
1273 3300044735 Ga0466968_0029647 Ga0466968_0029647_202_1287 354
1274 3300044765 Ga0466970_0054143 Ga0466970_0054143_136_1230 354
1275 3300045049 Ga0466959_0037546 Ga0466959_0037546_719_1813 354
1276 3300045049 Ga0466959_0069281 Ga0466959_0069281_906_2000 354
1277 3300045049 Ga0466959_0096243 Ga0466959_0096243_543_1634 354
1278 3300046452 Ga0495617_000388 Ga0495617_000388_2243_3322 354
1279 3300046452 Ga0495617_011283 Ga0495617_011283_1526_2605 354
1280 3300046453 Ga0495627_000033 Ga0495627_000033_35028_36107 354
1281 3300046457 Ga0495590_0000019 Ga0495590_0000019_194991_196070 354
1282 3300046457 Ga0495590_0048218 Ga0495590_0048218_50_1114 354
1283 3300046460 Ga0495638_0000080 Ga0495638_0000080_154575_155654 354
1284 3300046462 Ga0495651_0021665 Ga0495651_0021665_759_1844 354
1285 3300046462 Ga0495651_0165718 Ga0495651_0165718_498_1565 354
1286 3300046463 Ga0495653_0000008 Ga0495653_0000008_238333_239412 354
1287 3300046471 Ga0495650_0000142 Ga0495650_0000142_21791_22855 354
1288 3300046471 Ga0495650_0000619 Ga0495650_0000619_13265_14344 354
1289 3300046471 Ga0495650_0000661 Ga0495650_0000661_21595_22674 354
1290 3300046471 Ga0495650_0000794 Ga0495650_0000794_34962_36041 354
1291 3300046474 Ga0495605_0000010 Ga0495605_0000010_292573_293652 354
1292 3300046506 Ga0495583_0000057 Ga0495583_0000057_176444_177523 354
1293 3300046506 Ga0495583_0002401 Ga0495583_0002401_14717_15796 354
1294 3300046507 Ga0495606_0000004 Ga0495606_0000004_381892_382971 354
1295 3300046507 Ga0495606_0000492 Ga0495606_0000492_43674_44753 354
1296 3300046507 Ga0495606_0003053 Ga0495606_0003053_3274_4353 354
1297 3300046507 Ga0495606_0011389 Ga0495606_0011389_4804_5868 354
1298 3300046511 Ga0495608_0025813 Ga0495608_0025813_78_1163 354
1299 3300046512 Ga0495610_0000007 Ga0495610_0000007_253175_254254 354
1300 3300046512 Ga0495610_0001088 Ga0495610_0001088_11909_12988 354
1301 3300046512 Ga0495610_0014947 Ga0495610_0014947_1808_2887 354
1302 3300046516 Ga0495628_0000452 Ga0495628_0000452_4137_5222 354
1303 3300046522 Ga0495643_0000546 Ga0495643_0000546_19873_20973 354
1304 3300046522 Ga0495643_0002137 Ga0495643_0002137_14879_15958 354
1305 3300046523 Ga0495644_0021150 Ga0495644_0021150_875_1954 354
1306 3300046524 Ga0495648_0000010 Ga0495648_0000010_289348_290427 354
1307 3300046524 Ga0495648_0006786 Ga0495648_0006786_3584_4663 354
1308 3300046524 Ga0495648_0010053 Ga0495648_0010053_2268_3347 354
1309 3300046524 Ga0495648_0050175 Ga0495648_0050175_1314_2495 354
1310 3300046529 Ga0495652_0143781 Ga0495652_0143781_196_1263 354
1311 3300046530 Ga0495654_0000138 Ga0495654_0000138_50662_51741 354
1312 3300046538 Ga0495609_0001761 Ga0495609_0001761_9174_10253 354
1313 3300046538 Ga0495609_0029425 Ga0495609_0029425_811_1890 354
1314 3300046538 Ga0495609_0054660 Ga0495609_0054660_130_1209 354
1315 3300046542 Ga0495597_0001277 Ga0495597_0001277_347_1426 354
1316 3300046557 Ga0495622_0000138 Ga0495622_0000138_37821_38885 354
1317 3300046558 Ga0495633_0000806 Ga0495633_0000806_6583_7662 354
1318 3300046558 Ga0495633_0001664 Ga0495633_0001664_14799_15878 354
1319 3300046615 Ga0495656_0024436 Ga0495656_0024436_69_1148 354
1320 3300046616 Ga0495668_0000156 Ga0495668_0000156_25332_26411 354
1321 3300046616 Ga0495668_0001939 Ga0495668_0001939_281_1360 354
1322 3300046616 Ga0495668_0002158 Ga0495668_0002158_3287_4366 354
1323 3300046648 Ga0495611_0018021 Ga0495611_0018021_1229_2308 354
1324 3300046660 Ga0495625_0002735 Ga0495625_0002735_17309_18388 354
1325 3300046660 Ga0495625_0018007 Ga0495625_0018007_828_1892 354
1326 3300046660 Ga0495625_0032374 Ga0495625_0032374_2696_3775 354
1327 3300046664 Ga0495659_0005040 Ga0495659_0005040_1464_2543 354
1328 3300046664 Ga0495659_0034292 Ga0495659_0034292_117_1181 354
1329 3300046679 Ga0495623_0014392 Ga0495623_0014392_3112_4197 354
1330 3300046692 Ga0495671_0000009 Ga0495671_0000009_256136_257215 354
1331 3300046809 Ga0495600_0000669 Ga0495600_0000669_6701_7768 354
1332 3300046810 Ga0495660_0000228 Ga0495660_0000228_15277_16356 354
1333 3300046810 Ga0495660_0014157 Ga0495660_0014157_2948_4018 354
1334 3300047443 Ga0495687_000953 Ga0495687_000953_28519_29598 354
1335 3300047443 Ga0495687_022194 Ga0495687_022194_36_1115 354
1336 3300047445 Ga0495677_0012256 Ga0495677_0012256_811_1890 354
1337 3300047469 Ga0495673_0000031 Ga0495673_0000031_427707_428786 354
1338 3300047469 Ga0495673_0000032 Ga0495673_0000032_47959_49038 354
1339 3300047469 Ga0495673_0000327 Ga0495673_0000327_43736_44815 354
1340 3300047472 Ga0495686_0030229 Ga0495686_0030229_1492_2571 354
1341 3300048088 Ga0495602_0097348 Ga0495602_0097348_96_1181 354
1342 3300048088 Ga0495602_0155554 Ga0495602_0155554_610_1677 354
1343 3300048904 Ga0496101_0268121 Ga0496101_0268121_100_1179 354
1344 3300048908 Ga0496105_0171506 Ga0496105_0171506_234_1313 354
1345 3300048909 Ga0496106_0001378 Ga0496106_0001378_1846_2925 354
1346 3300048910 Ga0496107_0022836 Ga0496107_0022836_1697_2776 354
1347 3300048911 Ga0496108_0000501 Ga0496108_0000501_25897_26976 354
1348 3300048912 Ga0496109_0003612 Ga0496109_0003612_7527_8606 354
1349 3300048913 Ga0496110_0187292 Ga0496110_0187292_150_1229 354
1350 3300048915 Ga0496112_0042549 Ga0496112_0042549_1462_2541 354
1351 3300048920 Ga0496117_0000011 Ga0496117_0000011_158653_159720 354
1352 3300048920 Ga0496117_0000186 Ga0496117_0000186_26807_27871 354
1353 3300048921 Ga0496118_0000003 Ga0496118_0000003_219398_220462 354
1354 3300048921 Ga0496118_0000010 Ga0496118_0000010_451211_452278 354
1355 3300048923 Ga0496120_0000165 Ga0496120_0000165_54856_55968 354
1356 3300048923 Ga0496120_0019413 Ga0496120_0019413_1891_2955 354
1357 3300048924 Ga0496121_0037406 Ga0496121_0037406_616_1680 354
1358 3300048924 Ga0496121_0164432 Ga0496121_0164432_321_1385 354
1359 3300048925 Ga0496122_0003659 Ga0496122_0003659_3702_4766 354
1360 3300048926 Ga0496123_0014396 Ga0496123_0014396_1159_2238 354
1361 3300048927 Ga0496124_0104772 Ga0496124_0104772_22_1086 354
1362 3300048928 Ga0496125_0000491 Ga0496125_0000491_23264_24328 354
1363 3300048929 Ga0496126_0079861 Ga0496126_0079861_127_1191 354
1364 3300049459 Ga0495678_000001 Ga0495678_000001_383459_384538 354
1365 3300049459 Ga0495678_021910 Ga0495678_021910_619_1698 354
1366 3300049570 Ga0501033_0024224 Ga0501033_0024224_3406_4530 354
1367 3300049572 Ga0501036_0139240 Ga0501036_0139240_652_1734 354
1368 3300049766 Ga0501269_000052 Ga0501269_000052_26261_27340 354
1369 3300049823 Ga0501044_0016974 Ga0501044_0016974_5424_6524 354
1370 3300050508 nmdc:mga09592_17751_c1 nmdc:mga09592_17751_c1_2244_3308 354
1371 3300050508 nmdc:mga09592_3493_c1 nmdc:mga09592_3493_c1_7468_8556 354
1372 3300050508 nmdc:mga09592_9281_c1 nmdc:mga09592_9281_c1_6001_7071 354
1373 3300050509 nmdc:mga0qj67_8245_c1 nmdc:mga0qj67_8245_c1_6250_7314 354
1374 3300050510 nmdc:mga06r32_6743_c1 nmdc:mga06r32_6743_c1_4197_5261 354
1375 3300050511 nmdc:mga08y16_33755_c1 nmdc:mga08y16_33755_c1_3970_5040 354
1376 3300050511 nmdc:mga08y16_60018_c1 nmdc:mga08y16_60018_c1_749_1837 354
1377 3300050512 nmdc:mga0n895_147725_c1 nmdc:mga0n895_147725_c1_503_1573 354
1378 3300050512 nmdc:mga0n895_77648_c1 nmdc:mga0n895_77648_c1_1741_2814 354
1379 3300053093 Ga0500651_0041290 Ga0500651_0041290_367_1452 354
1380 3300053156 Ga0500622_0002525 Ga0500622_0002525_11602_12687 354
1381 3300053725 Ga0500576_062120 Ga0500576_062120_394_1458 354
1382 3300005327 Ga0070658_10153966 Ga0070658_101539661 355
1383 3300005329 Ga0070683_100055113 Ga0070683_1000551133 355
1384 3300005331 Ga0070670_100014611 Ga0070670_1000146115 355
1385 3300005335 Ga0070666_10001769 Ga0070666_100017695 355
1386 3300005337 Ga0070682_100005988 Ga0070682_1000059887 355
1387 3300005338 Ga0068868_100009956 Ga0068868_1000099564 355
1388 3300005339 Ga0070660_100211791 Ga0070660_1002117911 355
1389 3300005344 Ga0070661_100001171 Ga0070661_10000117121 355
1390 3300005344 Ga0070661_100014741 Ga0070661_1000147415 355
1391 3300005344 Ga0070661_100017191 Ga0070661_1000171912 355
1392 3300005344 Ga0070661_100051218 Ga0070661_1000512182 355
1393 3300005354 Ga0070675_100018162 Ga0070675_1000181626 355
1394 3300005364 Ga0070673_100080420 Ga0070673_1000804201 355
1395 3300005364 Ga0070673_100162804 Ga0070673_1001628042 355
1396 3300005366 Ga0070659_100010887 Ga0070659_1000108875 355
1397 3300005367 Ga0070667_100093296 Ga0070667_1000932962 355
1398 3300005435 Ga0070714_100000030 Ga0070714_10000003089 355
1399 3300005438 Ga0070701_10130213 Ga0070701_101302131 355
1400 3300005441 Ga0070700_100128236 Ga0070700_1001282362 355
1401 3300005455 Ga0070663_100009958 Ga0070663_1000099584 355
1402 3300005457 Ga0070662_100003378 Ga0070662_1000033786 355
1403 3300005459 Ga0068867_100118904 Ga0068867_1001189042 355
1404 3300005466 Ga0070685_10000500 Ga0070685_100005002 355
1405 3300005530 Ga0070679_100328704 Ga0070679_1003287041 355
1406 3300005535 Ga0070684_100168798 Ga0070684_1001687982 355
1407 3300005535 Ga0070684_100229751 Ga0070684_1002297511 355
1408 3300005539 Ga0068853_100008980 Ga0068853_10000898012 355
1409 3300005543 Ga0070672_100115033 Ga0070672_1001150332 355
1410 3300005547 Ga0070693_100053606 Ga0070693_1000536061 355
1411 3300005549 Ga0070704_100137972 Ga0070704_1001379722 355
1412 3300005563 Ga0068855_100003098 Ga0068855_1000030986 355
1413 3300005563 Ga0068855_100112990 Ga0068855_1001129903 355
1414 3300005578 Ga0068854_100004998 Ga0068854_1000049984 355
1415 3300005578 Ga0068854_100014248 Ga0068854_1000142485 355
1416 3300005578 Ga0068854_100062360 Ga0068854_1000623602 355
1417 3300005614 Ga0068856_100021310 Ga0068856_1000213105 355
1418 3300005616 Ga0068852_100003738 Ga0068852_1000037385 355
1419 3300005616 Ga0068852_100018178 Ga0068852_1000181782 355
1420 3300005616 Ga0068852_100026936 Ga0068852_1000269364 355
1421 3300005616 Ga0068852_100028831 Ga0068852_1000288314 355
1422 3300005616 Ga0068852_100029913 Ga0068852_1000299132 355
1423 3300005616 Ga0068852_100045883 Ga0068852_1000458832 355
1424 3300005617 Ga0068859_100069886 Ga0068859_1000698861 355
1425 3300005617 Ga0068859_100105469 Ga0068859_1001054692 355
1426 3300005719 Ga0068861_100099330 Ga0068861_1000993302 355
1427 3300005719 Ga0068861_100202373 Ga0068861_1002023731 355
1428 3300005834 Ga0068851_10053624 Ga0068851_100536242 355
1429 3300005834 Ga0068851_10082123 Ga0068851_100821232 355
1430 3300005842 Ga0068858_100001914 Ga0068858_1000019146 355
1431 3300005842 Ga0068858_100008295 Ga0068858_1000082953 355
1432 3300005842 Ga0068858_100034781 Ga0068858_1000347814 355
1433 3300006048 Ga0075363_100056073 Ga0075363_1000560733 355
1434 3300006195 Ga0075366_10022514 Ga0075366_100225145 355
1435 3300006358 Ga0068871_100003774 Ga0068871_10000377412 355
1436 3300006844 Ga0075428_100001855 Ga0075428_1000018556 355
1437 3300006852 Ga0075433_10043319 Ga0075433_100433194 355
1438 3300006880 Ga0075429_100020928 Ga0075429_1000209285 355
1439 3300006881 Ga0068865_100076126 Ga0068865_1000761262 355
1440 3300006931 Ga0097620_100069886 Ga0097620_1000698861 355
1441 3300006931 Ga0097620_100105470 Ga0097620_1001054702 355
1442 3300007076 Ga0075435_100205356 Ga0075435_1002053562 355
1443 3300009093 Ga0105240_10001308 Ga0105240_1000130819 355
1444 3300009093 Ga0105240_10075724 Ga0105240_100757244 355
1445 3300009094 Ga0111539_10000720 Ga0111539_100007205 355
1446 3300009174 Ga0105241_10017102 Ga0105241_100171025 355
1447 3300009176 Ga0105242_10001320 Ga0105242_100013206 355
1448 3300009545 Ga0105237_10016987 Ga0105237_100169875 355
1449 3300009545 Ga0105237_10047220 Ga0105237_100472205 355
1450 3300009545 Ga0105237_10191491 Ga0105237_101914912 355
1451 3300009551 Ga0105238_10001282 Ga0105238_100012826 355
1452 3300009551 Ga0105238_10017551 Ga0105238_100175518 355
1453 3300009551 Ga0105238_10094579 Ga0105238_100945792 355
1454 3300009553 Ga0105249_10183521 Ga0105249_101835213 355
1455 3300010375 Ga0105239_10028575 Ga0105239_100285752 355
1456 3300010375 Ga0105239_10071210 Ga0105239_100712102 355
1457 3300010375 Ga0105239_10493183 Ga0105239_104931831 355
1458 3300013102 Ga0157371_10071002 Ga0157371_100710022 355
1459 3300013102 Ga0157371_10128417 Ga0157371_101284172 355
1460 3300013104 Ga0157370_10020669 Ga0157370_100206693 355
1461 3300013296 Ga0157374_10111291 Ga0157374_101112912 355
1462 3300013307 Ga0157372_10091273 Ga0157372_100912734 355
1463 3300014326 Ga0157380_10023141 Ga0157380_100231415 355
1464 3300025250 Ga0209026_1000037 Ga0209026_1000037176 355
1465 3300025321 Ga0207656_10008602 Ga0207656_100086025 355
1466 3300025903 Ga0207680_10002298 Ga0207680_100022983 355
1467 3300025904 Ga0207647_10001421 Ga0207647_1000142115 355
1468 3300025907 Ga0207645_10078398 Ga0207645_100783982 355
1469 3300025909 Ga0207705_10031214 Ga0207705_100312143 355
1470 3300025909 Ga0207705_10042342 Ga0207705_100423422 355
1471 3300025909 Ga0207705_10279304 Ga0207705_102793041 355
1472 3300025912 Ga0207707_10014162 Ga0207707_100141627 355
1473 3300025913 Ga0207695_10000219 Ga0207695_10000219114 355
1474 3300025913 Ga0207695_10007411 Ga0207695_1000741110 355
1475 3300025913 Ga0207695_10009807 Ga0207695_100098075 355
1476 3300025913 Ga0207695_10097511 Ga0207695_100975112 355
1477 3300025914 Ga0207671_10023037 Ga0207671_100230375 355
1478 3300025914 Ga0207671_10024923 Ga0207671_100249232 355
1479 3300025919 Ga0207657_10014832 Ga0207657_100148325 355
1480 3300025919 Ga0207657_10042292 Ga0207657_100422924 355
1481 3300025920 Ga0207649_10009879 Ga0207649_100098794 355
1482 3300025920 Ga0207649_10052947 Ga0207649_100529472 355
1483 3300025920 Ga0207649_10072073 Ga0207649_100720731 355
1484 3300025920 Ga0207649_10096052 Ga0207649_100960523 355
1485 3300025921 Ga0207652_10047258 Ga0207652_100472584 355
1486 3300025922 Ga0207646_10004371 Ga0207646_100043712 355
1487 3300025924 Ga0207694_10001114 Ga0207694_100011142 355
1488 3300025924 Ga0207694_10003153 Ga0207694_100031534 355
1489 3300025924 Ga0207694_10018922 Ga0207694_100189224 355
1490 3300025924 Ga0207694_10031609 Ga0207694_100316093 355
1491 3300025924 Ga0207694_10088421 Ga0207694_100884213 355
1492 3300025925 Ga0207650_10021547 Ga0207650_100215474 355
1493 3300025929 Ga0207664_10000026 Ga0207664_1000002666 355
1494 3300025932 Ga0207690_10002130 Ga0207690_1000213013 355
1495 3300025933 Ga0207706_10002628 Ga0207706_1000262813 355
1496 3300025934 Ga0207686_10019961 Ga0207686_100199612 355
1497 3300025934 Ga0207686_10051867 Ga0207686_100518671 355
1498 3300025936 Ga0207670_10140188 Ga0207670_101401882 355
1499 3300025936 Ga0207670_10154993 Ga0207670_101549931 355
1500 3300025940 Ga0207691_10024108 Ga0207691_100241083 355
1501 3300025949 Ga0207667_10000078 Ga0207667_1000007812 355
1502 3300025949 Ga0207667_10025545 Ga0207667_100255455 355
1503 3300025949 Ga0207667_10453966 Ga0207667_104539661 355
1504 3300025949 Ga0207667_10574513 Ga0207667_105745131 355
1505 3300025961 Ga0207712_10000066 Ga0207712_10000066105 355
1506 3300025981 Ga0207640_10002267 Ga0207640_100022672 355
1507 3300025981 Ga0207640_10042528 Ga0207640_100425282 355
1508 3300025981 Ga0207640_10099517 Ga0207640_100995171 355
1509 3300025986 Ga0207658_10170335 Ga0207658_101703352 355
1510 3300026023 Ga0207677_10166298 Ga0207677_101662982 355
1511 3300026035 Ga0207703_10000389 Ga0207703_1000038933 355
1512 3300026035 Ga0207703_10203332 Ga0207703_102033322 355
1513 3300026041 Ga0207639_10000780 Ga0207639_1000078017 355
1514 3300026041 Ga0207639_10010769 Ga0207639_100107692 355
1515 3300026067 Ga0207678_10002893 Ga0207678_1000289313 355
1516 3300026075 Ga0207708_10014845 Ga0207708_100148452 355
1517 3300026078 Ga0207702_10075545 Ga0207702_100755452 355
1518 3300026078 Ga0207702_10251088 Ga0207702_102510882 355
1519 3300026089 Ga0207648_10031048 Ga0207648_100310482 355
1520 3300026089 Ga0207648_10044276 Ga0207648_100442765 355
1521 3300026116 Ga0207674_10009479 Ga0207674_100094797 355
1522 3300026116 Ga0207674_10273317 Ga0207674_102733172 355
1523 3300026118 Ga0207675_100187960 Ga0207675_1001879603 355
1524 3300026118 Ga0207675_100265272 Ga0207675_1002652722 355
1525 3300026142 Ga0207698_10014523 Ga0207698_100145232 355
1526 3300026142 Ga0207698_10023380 Ga0207698_100233804 355
1527 3300026142 Ga0207698_10090341 Ga0207698_100903414 355
1528 3300026142 Ga0207698_10246362 Ga0207698_102463622 355
1529 3300027111 Ga0209281_1000002 Ga0209281_10000021250 355
1530 3300027907 Ga0207428_10013577 Ga0207428_100135774 355
1531 3300028379 Ga0268266_10000008 Ga0268266_10000008612 355
1532 3300028577 Ga0265318_10007936 Ga0265318_100079363 355
1533 3300028800 Ga0265338_10009934 Ga0265338_100099345 355
1534 3300029957 Ga0265324_10006892 Ga0265324_100068925 355
1535 3300029957 Ga0265324_10010580 Ga0265324_100105802 355
1536 3300031238 Ga0265332_10071486 Ga0265332_100714861 355
1537 3300031241 Ga0265325_10042218 Ga0265325_100422183 355
1538 3300031241 Ga0265325_10061549 Ga0265325_100615492 355
1539 3300031249 Ga0265339_10000425 Ga0265339_1000042517 355
1540 3300031344 Ga0265316_10014153 Ga0265316_100141536 355
1541 3300031344 Ga0265316_10065577 Ga0265316_100655772 355
1542 3300031507 Ga0307509_10000056 Ga0307509_1000005682 355
1543 3300031595 Ga0265313_10000107 Ga0265313_1000010781 355
1544 3300031616 Ga0307508_10056301 Ga0307508_100563012 355
1545 3300031711 Ga0265314_10021422 Ga0265314_100214225 355
1546 3300031711 Ga0265314_10146390 Ga0265314_101463902 355
1547 3300031712 Ga0265342_10043935 Ga0265342_100439354 355
1548 3300034816 Ga0373930_0003117 Ga0373930_0003117_1276_2343 355
1549 3300035691 Ga0373931_0024848 Ga0373931_0024848_921_1991 355
1550 3300035691 Ga0373931_0165020 Ga0373931_0165020_201_1268 355
1551 3300037068 Ga0373925_0060338 Ga0373925_0060338_1570_2637 355
1552 3300037418 Ga0395900_0154772 Ga0395900_0154772_145_1215 355
1553 3300037466 Ga0395898_0204580 Ga0395898_0204580_155_1249 355
1554 3300038443 Ga0395901_0000356 Ga0395901_0000356_16315_17409 355
1555 3300039437 Ga0436365_1114258 Ga0436365_1114258_897_1964 355
1556 3300041997 Ga0439431_0020056 Ga0439431_0020056_378_1457 355
1557 3300042876 Ga0451577_0000345 Ga0451577_0000345_43974_45041 355
1558 3300042876 Ga0451577_0419034 Ga0451577_0419034_106_1173 355
1559 3300044712 Ga0453684_0000065 Ga0453684_0000065_315183_316250 355
1560 3300045049 Ga0466959_0014087 Ga0466959_0014087_2180_3247 355
1561 3300045051 Ga0451576_0031274 Ga0451576_0031274_2757_3824 355
1562 3300048921 Ga0496118_0082346 Ga0496118_0082346_14_1093 355
1563 3300048924 Ga0496121_0027911 Ga0496121_0027911_3616_4686 355
1564 3300048927 Ga0496124_0000346 Ga0496124_0000346_30532_31602 355
1565 3300049568 Ga0501031_0000002 Ga0501031_0000002_173367_174455 355
1566 3300049569 Ga0501032_0000004 Ga0501032_0000004_43168_44256 355
1567 3300049570 Ga0501033_0000016 Ga0501033_0000016_173203_174291 355
1568 3300049571 Ga0501034_0000011 Ga0501034_0000011_43168_44256 355
1569 3300049571 Ga0501034_0012191 Ga0501034_0012191_4623_5708 355
1570 3300049571 Ga0501034_0029990 Ga0501034_0029990_2881_3951 355
1571 3300049571 Ga0501034_0085482 Ga0501034_0085482_858_1961 355
1572 3300049572 Ga0501036_0000001 Ga0501036_0000001_43168_44256 355
1573 3300049573 Ga0501037_0000006 Ga0501037_0000006_173206_174294 355
1574 3300049574 Ga0501038_0000003 Ga0501038_0000003_43168_44256 355
1575 3300049575 Ga0501039_0000004 Ga0501039_0000004_43168_44256 355
1576 3300049576 Ga0501040_0007583 Ga0501040_0007583_1461_2549 355
1577 3300049579 Ga0501043_0000765 Ga0501043_0000765_13120_14208 355
1578 3300049581 Ga0501047_0007626 Ga0501047_0007626_4678_5766 355
1579 3300049586 Ga0501070_0052974 Ga0501070_0052974_1807_2895 355
1580 3300049744 Ga0501083_0022007 Ga0501083_0022007_2909_4165 355
1581 3300049822 Ga0501035_0000009 Ga0501035_0000009_266572_267660 355
1582 3300049822 Ga0501035_0008747 Ga0501035_0008747_4074_5159 355
1583 3300049823 Ga0501044_0000005 Ga0501044_0000005_43168_44256 355
1584 3300049823 Ga0501044_0176069 Ga0501044_0176069_10_1113 355
1585 3300050489 nmdc:mga03683_61515_c1 nmdc:mga03683_61515_c1_178_1248 355
1586 3300050511 nmdc:mga08y16_1674_c1 nmdc:mga08y16_1674_c1_17848_18915 355
1587 3300050515 nmdc:mga0a205_98646_c1 nmdc:mga0a205_98646_c1_131_1198 355
1588 3300054114 Ga0501084_0117827 Ga0501084_0117827_557_1660 355
1589 3300001915 JGI24741J21665_1001384 JGI24741J21665_10013844 356
1590 3300001979 JGI24740J21852_10000383 JGI24740J21852_1000038319 356
1591 3300001979 JGI24740J21852_10018412 JGI24740J21852_100184122 356
1592 3300002067 JGI24735J21928_10002662 JGI24735J21928_100026622 356
1593 3300002705 JGI25156J39149_1000214 JGI25156J39149_100021420 356
1594 3300002737 JGI25162J39368_1000138 JGI25162J39368_100013848 356
1595 3300002737 JGI25162J39368_1001136 JGI25162J39368_10011363 356
1596 3300002738 JGI25154J39366_1000934 JGI25154J39366_10009343 356
1597 3300002741 JGI25157J39369_1000253 JGI25157J39369_10002535 356
1598 3300002741 JGI25157J39369_1000586 JGI25157J39369_10005864 356
1599 3300002741 JGI25157J39369_1001059 JGI25157J39369_10010598 356
1600 3300002772 JGI25164J39214_1000170 JGI25164J39214_100017028 356
1601 3300002772 JGI25164J39214_1000310 JGI25164J39214_100031020 356
1602 3300002773 JGI25152J39213_1001636 JGI25152J39213_10016361 356
1603 3300003187 JGI25151J46595_10000316 JGI25151J46595_1000031638 356
1604 3300003187 JGI25151J46595_10000426 JGI25151J46595_1000042634 356
1605 3300003187 JGI25151J46595_10003113 JGI25151J46595_100031131 356
1606 3300003187 JGI25151J46595_10005216 JGI25151J46595_100052164 356
1607 3300003214 JGI25165J46597_1000224 JGI25165J46597_100022436 356
1608 3300003214 JGI25165J46597_1000580 JGI25165J46597_100058020 356
1609 3300003215 JGI25153J46596_10003120 JGI25153J46596_100031201 356
1610 3300003578 Ga0006562J51391_1056992 Ga0006562J51391_10569922 356
1611 3300003751 Ga0055538_1003777 Ga0055538_10037772 356
1612 3300003752 Ga0055539_1000097 Ga0055539_100009767 356
1613 3300003752 Ga0055539_1001714 Ga0055539_10017143 356
1614 3300003756 Ga0055533_1000743 Ga0055533_10007435 356
1615 3300003756 Ga0055533_1005313 Ga0055533_10053132 356
1616 3300003758 Ga0055532_1000008 Ga0055532_1000008315 356
1617 3300003759 Ga0055525_1000192 Ga0055525_10001929 356
1618 3300003759 Ga0055525_1000377 Ga0055525_100037712 356
1619 3300003760 Ga0055527_1000041 Ga0055527_100004176 356
1620 3300003760 Ga0055527_1000234 Ga0055527_100023415 356
1621 3300003760 Ga0055527_1002108 Ga0055527_10021082 356
1622 3300003761 Ga0055535_1000006 Ga0055535_100000676 356
1623 3300003761 Ga0055535_1000193 Ga0055535_100019354 356
1624 3300003761 Ga0055535_1000216 Ga0055535_100021636 356
1625 3300003761 Ga0055535_1000457 Ga0055535_100045721 356
1626 3300003761 Ga0055535_1000502 Ga0055535_100050224 356
1627 3300003761 Ga0055535_1001000 Ga0055535_100100019 356
1628 3300003762 Ga0055542_1000152 Ga0055542_100015254 356
1629 3300003762 Ga0055542_1000179 Ga0055542_100017936 356
1630 3300003762 Ga0055542_1000183 Ga0055542_100018358 356
1631 3300003762 Ga0055542_1000496 Ga0055542_10004967 356
1632 3300003762 Ga0055542_1000520 Ga0055542_100052024 356
1633 3300003763 Ga0055529_1000025 Ga0055529_100002576 356
1634 3300003763 Ga0055529_1000116 Ga0055529_100011664 356
1635 3300003763 Ga0055529_1000189 Ga0055529_100018936 356
1636 3300003763 Ga0055529_1000254 Ga0055529_100025415 356
1637 3300003763 Ga0055529_1000675 Ga0055529_100067512 356
1638 3300003763 Ga0055529_1001711 Ga0055529_10017113 356
1639 3300003771 Ga0055526_1006720 Ga0055526_10067202 356
1640 3300003771 Ga0055526_1011333 Ga0055526_10113333 356
1641 3300003771 Ga0055526_1011446 Ga0055526_10114463 356
1642 3300003773 Ga0055537_1001783 Ga0055537_10017838 356
1643 3300003775 Ga0055524_1018349 Ga0055524_10183492 356
1644 3300003781 Ga0055536_1000130 Ga0055536_100013048 356
1645 3300003784 Ga0055534_1000214 Ga0055534_10002149 356
1646 3300003784 Ga0055534_1001738 Ga0055534_10017384 356
1647 3300005262 Ga0065165_1000790 Ga0065165_100079036 356
1648 3300005290 Ga0065712_10000440 Ga0065712_100004402 356
1649 3300005290 Ga0065712_10112393 Ga0065712_101123931 356
1650 3300005293 Ga0065715_10003605 Ga0065715_100036054 356
1651 3300005295 Ga0065707_10000712 Ga0065707_100007126 356
1652 3300005295 Ga0065707_10093577 Ga0065707_100935771 356
1653 3300005327 Ga0070658_10112139 Ga0070658_101121391 356
1654 3300005330 Ga0070690_100133735 Ga0070690_1001337351 356
1655 3300005331 Ga0070670_100002016 Ga0070670_1000020161 356
1656 3300005333 Ga0070677_10019464 Ga0070677_100194641 356
1657 3300005334 Ga0068869_100061622 Ga0068869_1000616221 356
1658 3300005335 Ga0070666_10139324 Ga0070666_101393242 356
1659 3300005336 Ga0070680_100031008 Ga0070680_1000310086 356
1660 3300005336 Ga0070680_100108713 Ga0070680_1001087132 356
1661 3300005337 Ga0070682_100042485 Ga0070682_1000424852 356
1662 3300005339 Ga0070660_100013616 Ga0070660_1000136164 356
1663 3300005339 Ga0070660_100062005 Ga0070660_1000620051 356
1664 3300005339 Ga0070660_100081645 Ga0070660_1000816451 356
1665 3300005340 Ga0070689_100187713 Ga0070689_1001877132 356
1666 3300005341 Ga0070691_10006100 Ga0070691_100061004 356
1667 3300005344 Ga0070661_100000408 Ga0070661_1000004084 356
1668 3300005344 Ga0070661_100134901 Ga0070661_1001349013 356
1669 3300005347 Ga0070668_100008505 Ga0070668_1000085054 356
1670 3300005353 Ga0070669_100229284 Ga0070669_1002292841 356
1671 3300005354 Ga0070675_100339404 Ga0070675_1003394041 356
1672 3300005355 Ga0070671_100166590 Ga0070671_1001665902 356
1673 3300005356 Ga0070674_100200360 Ga0070674_1002003602 356
1674 3300005364 Ga0070673_100162626 Ga0070673_1001626262 356
1675 3300005366 Ga0070659_100000288 Ga0070659_10000028822 356
1676 3300005440 Ga0070705_100080496 Ga0070705_1000804961 356
1677 3300005444 Ga0070694_100005250 Ga0070694_1000052505 356
1678 3300005455 Ga0070663_100000014 Ga0070663_10000001473 356
1679 3300005455 Ga0070663_100070431 Ga0070663_1000704311 356
1680 3300005456 Ga0070678_100132688 Ga0070678_1001326881 356
1681 3300005458 Ga0070681_10038251 Ga0070681_100382512 356
1682 3300005459 Ga0068867_100051634 Ga0068867_1000516342 356
1683 3300005530 Ga0070679_100324917 Ga0070679_1003249171 356
1684 3300005543 Ga0070672_100148679 Ga0070672_1001486791 356
1685 3300005544 Ga0070686_100042602 Ga0070686_1000426022 356
1686 3300005545 Ga0070695_100041704 Ga0070695_1000417043 356
1687 3300005546 Ga0070696_100101659 Ga0070696_1001016592 356
1688 3300005548 Ga0070665_100006460 Ga0070665_1000064605 356
1689 3300005548 Ga0070665_100326102 Ga0070665_1003261021 356
1690 3300005563 Ga0068855_100024379 Ga0068855_1000243797 356
1691 3300005563 Ga0068855_100034435 Ga0068855_1000344357 356
1692 3300005563 Ga0068855_100092619 Ga0068855_1000926194 356
1693 3300005564 Ga0070664_100000001 Ga0070664_100000001441 356
1694 3300005564 Ga0070664_100007156 Ga0070664_10000715611 356
1695 3300005577 Ga0068857_100028028 Ga0068857_1000280285 356
1696 3300005578 Ga0068854_100000009 Ga0068854_1000000095 356
1697 3300005578 Ga0068854_100001263 Ga0068854_10000126317 356
1698 3300005578 Ga0068854_100113219 Ga0068854_1001132192 356
1699 3300005614 Ga0068856_100000007 Ga0068856_10000000721 356
1700 3300005614 Ga0068856_100009147 Ga0068856_1000091478 356
1701 3300005614 Ga0068856_100161199 Ga0068856_1001611992 356
1702 3300005616 Ga0068852_100038100 Ga0068852_1000381004 356
1703 3300005616 Ga0068852_100123257 Ga0068852_1001232572 356
1704 3300005718 Ga0068866_10132473 Ga0068866_101324731 356
1705 3300005841 Ga0068863_100307254 Ga0068863_1003072542 356
1706 3300005937 Ga0081455_10088179 Ga0081455_100881793 356
1707 3300006038 Ga0075365_10007236 Ga0075365_100072363 356
1708 3300006038 Ga0075365_10009102 Ga0075365_100091024 356
1709 3300006048 Ga0075363_100025812 Ga0075363_1000258122 356
1710 3300006051 Ga0075364_10000025 Ga0075364_100000257 356
1711 3300006051 Ga0075364_10020120 Ga0075364_100201202 356
1712 3300006051 Ga0075364_10033566 Ga0075364_100335661 356
1713 3300006051 Ga0075364_10064285 Ga0075364_100642852 356
1714 3300006051 Ga0075364_10109846 Ga0075364_101098462 356
1715 3300006186 Ga0075369_10072088 Ga0075369_100720882 356
1716 3300006353 Ga0075370_10157647 Ga0075370_101576471 356
1717 3300006844 Ga0075428_100171767 Ga0075428_1001717672 356
1718 3300006844 Ga0075428_100339942 Ga0075428_1003399421 356
1719 3300006846 Ga0075430_100009226 Ga0075430_1000092265 356
1720 3300006846 Ga0075430_100075796 Ga0075430_1000757962 356
1721 3300006846 Ga0075430_100081741 Ga0075430_1000817413 356
1722 3300006846 Ga0075430_100097020 Ga0075430_1000970201 356
1723 3300006847 Ga0075431_100006719 Ga0075431_1000067195 356
1724 3300006852 Ga0075433_10011384 Ga0075433_100113843 356
1725 3300006852 Ga0075433_10018150 Ga0075433_100181503 356
1726 3300006852 Ga0075433_10191285 Ga0075433_101912852 356
1727 3300006871 Ga0075434_100002298 Ga0075434_1000022988 356
1728 3300006880 Ga0075429_100097781 Ga0075429_1000977812 356
1729 3300006880 Ga0075429_100173818 Ga0075429_1001738182 356
1730 3300006948 Ga0099826_10000004 Ga0099826_10000004519 356
1731 3300009093 Ga0105240_10000254 Ga0105240_1000025491 356
1732 3300009093 Ga0105240_10002163 Ga0105240_1000216326 356
1733 3300009093 Ga0105240_10020159 Ga0105240_100201598 356
1734 3300009094 Ga0111539_10091403 Ga0111539_100914033 356
1735 3300009094 Ga0111539_10097749 Ga0111539_100977492 356
1736 3300009094 Ga0111539_10241292 Ga0111539_102412922 356
1737 3300009147 Ga0114129_10168265 Ga0114129_101682652 356
1738 3300009177 Ga0105248_10450483 Ga0105248_104504831 356
1739 3300010375 Ga0105239_10000020 Ga0105239_1000002010 356
1740 3300011119 Ga0105246_10147659 Ga0105246_101476591 356
1741 3300013102 Ga0157371_10000038 Ga0157371_10000038145 356
1742 3300013296 Ga0157374_10195135 Ga0157374_101951352 356
1743 3300013297 Ga0157378_10313052 Ga0157378_103130521 356
1744 3300013306 Ga0163162_10000004 Ga0163162_10000004213 356
1745 3300013306 Ga0163162_10035420 Ga0163162_100354207 356
1746 3300013306 Ga0163162_10044415 Ga0163162_100444153 356
1747 3300013307 Ga0157372_10000033 Ga0157372_10000033112 356
1748 3300013308 Ga0157375_10393264 Ga0157375_103932641 356
1749 3300014497 Ga0182008_10015969 Ga0182008_100159694 356
1750 3300014969 Ga0157376_10144192 Ga0157376_101441921 356
1751 3300015261 Ga0182006_1013526 Ga0182006_10135263 356
1752 3300015262 Ga0182007_10017000 Ga0182007_100170003 356
1753 3300015265 Ga0182005_1007785 Ga0182005_10077853 356
1754 3300015685 Ga0183369_1006 Ga0183369_1006261 356
1755 3300015687 Ga0183368_1003 Ga0183368_1003789 356
1756 3300025224 Ga0209784_100068 Ga0209784_10006837 356
1757 3300025224 Ga0209784_100122 Ga0209784_10012250 356
1758 3300025224 Ga0209784_100805 Ga0209784_1008052 356
1759 3300025225 Ga0209566_100048 Ga0209566_100048195 356
1760 3300025225 Ga0209566_100800 Ga0209566_1008008 356
1761 3300025226 Ga0209674_100012 Ga0209674_100012540 356
1762 3300025226 Ga0209674_100071 Ga0209674_10007122 356
1763 3300025226 Ga0209674_100201 Ga0209674_10020136 356
1764 3300025226 Ga0209674_101175 Ga0209674_1011755 356
1765 3300025228 Ga0209672_100005 Ga0209672_100005829 356
1766 3300025228 Ga0209672_100045 Ga0209672_10004564 356
1767 3300025228 Ga0209672_100100 Ga0209672_10010085 356
1768 3300025228 Ga0209672_100350 Ga0209672_10035023 356
1769 3300025229 Ga0209147_100002 Ga0209147_100002198 356
1770 3300025230 Ga0209563_100023 Ga0209563_100023494 356
1771 3300025230 Ga0209563_100085 Ga0209563_10008522 356
1772 3300025231 Ga0207427_100139 Ga0207427_10013913 356
1773 3300025231 Ga0207427_100140 Ga0207427_10014037 356
1774 3300025233 Ga0209437_100147 Ga0209437_100147134 356
1775 3300025233 Ga0209437_100462 Ga0209437_10046220 356
1776 3300025242 Ga0209258_100002 Ga0209258_100002198 356
1777 3300025242 Ga0209258_100006 Ga0209258_100006829 356
1778 3300025242 Ga0209258_100024 Ga0209258_10002423 356
1779 3300025242 Ga0209258_100111 Ga0209258_100111108 356
1780 3300025242 Ga0209258_100200 Ga0209258_10020058 356
1781 3300025242 Ga0209258_100360 Ga0209258_10036028 356
1782 3300025242 Ga0209258_103686 Ga0209258_1036863 356
1783 3300025245 Ga0207425_1000015 Ga0207425_100001510 356
1784 3300025246 Ga0209646_1000035 Ga0209646_100003587 356
1785 3300025246 Ga0209646_1000448 Ga0209646_100044816 356
1786 3300025246 Ga0209646_1000896 Ga0209646_10008964 356
1787 3300025250 Ga0209026_1000074 Ga0209026_100007462 356
1788 3300025250 Ga0209026_1000099 Ga0209026_100009937 356
1789 3300025250 Ga0209026_1000737 Ga0209026_100073710 356
1790 3300025250 Ga0209026_1005597 Ga0209026_10055973 356
1791 3300025253 Ga0209677_100040 Ga0209677_100040195 356
1792 3300025254 Ga0209148_1000009 Ga0209148_1000009351 356
1793 3300025254 Ga0209148_1000010 Ga0209148_10000101046 356
1794 3300025254 Ga0209148_1000012 Ga0209148_1000012829 356
1795 3300025254 Ga0209148_1000045 Ga0209148_1000045341 356
1796 3300025254 Ga0209148_1000077 Ga0209148_100007762 356
1797 3300025254 Ga0209148_1000099 Ga0209148_1000099105 356
1798 3300025256 Ga0209759_1000110 Ga0209759_100011062 356
1799 3300025256 Ga0209759_1000247 Ga0209759_100024766 356
1800 3300025256 Ga0209759_1000605 Ga0209759_100060530 356
1801 3300025256 Ga0209759_1017311 Ga0209759_10173111 356
1802 3300025258 Ga0209129_1000126 Ga0209129_1000126109 356
1803 3300025261 Ga0209233_1000009 Ga0209233_1000009124 356
1804 3300025261 Ga0209233_1000251 Ga0209233_100025113 356
1805 3300025263 Ga0209565_1000217 Ga0209565_100021737 356
1806 3300025263 Ga0209565_1002148 Ga0209565_10021483 356
1807 3300025272 Ga0209455_1000008 Ga0209455_1000008829 356
1808 3300025272 Ga0209455_1000009 Ga0209455_100000977 356
1809 3300025272 Ga0209455_1000029 Ga0209455_100002923 356
1810 3300025272 Ga0209455_1000035 Ga0209455_1000035342 356
1811 3300025272 Ga0209455_1000086 Ga0209455_1000086125 356
1812 3300025272 Ga0209455_1009786 Ga0209455_10097862 356
1813 3300025273 Ga0209673_1016158 Ga0209673_10161582 356
1814 3300025284 Ga0209130_1000942 Ga0209130_100094218 356
1815 3300025291 Ga0209675_1000125 Ga0209675_100012584 356
1816 3300025291 Ga0209675_1000242 Ga0209675_100024237 356
1817 3300025291 Ga0209675_1005516 Ga0209675_10055161 356
1818 3300025292 Ga0209676_1000014 Ga0209676_100001416 356
1819 3300025294 Ga0209025_1000002 Ga0209025_1000002908 356
1820 3300025294 Ga0209025_1000057 Ga0209025_100005739 356
1821 3300025294 Ga0209025_1000379 Ga0209025_100037971 356
1822 3300025294 Ga0209025_1000423 Ga0209025_10004234 356
1823 3300025294 Ga0209025_1000772 Ga0209025_100077236 356
1824 3300025294 Ga0209025_1000811 Ga0209025_100081146 356
1825 3300025295 Ga0209564_1000691 Ga0209564_100069146 356
1826 3300025295 Ga0209564_1000905 Ga0209564_10009053 356
1827 3300025295 Ga0209564_1001161 Ga0209564_100116117 356
1828 3300025297 Ga0209758_1000003 Ga0209758_1000003915 356
1829 3300025297 Ga0209758_1024248 Ga0209758_10242482 356
1830 3300025298 Ga0209050_1003403 Ga0209050_10034033 356
1831 3300025299 Ga0209256_1001803 Ga0209256_100180317 356
1832 3300025299 Ga0209256_1002895 Ga0209256_10028953 356
1833 3300025302 Ga0207426_1000066 Ga0207426_1000066107 356
1834 3300025303 Ga0209051_1000696 Ga0209051_100069613 356
1835 3300025303 Ga0209051_1020826 Ga0209051_10208263 356
1836 3300025893 Ga0207682_10034484 Ga0207682_100344842 356
1837 3300025901 Ga0207688_10069731 Ga0207688_100697312 356
1838 3300025907 Ga0207645_10093784 Ga0207645_100937841 356
1839 3300025909 Ga0207705_10002855 Ga0207705_100028558 356
1840 3300025909 Ga0207705_10179573 Ga0207705_101795731 356
1841 3300025911 Ga0207654_10209832 Ga0207654_102098321 356
1842 3300025912 Ga0207707_10050883 Ga0207707_100508834 356
1843 3300025912 Ga0207707_10274520 Ga0207707_102745201 356
1844 3300025912 Ga0207707_10302020 Ga0207707_103020201 356
1845 3300025913 Ga0207695_10001145 Ga0207695_100011456 356
1846 3300025913 Ga0207695_10002857 Ga0207695_1000285726 356
1847 3300025913 Ga0207695_10003147 Ga0207695_1000314726 356
1848 3300025913 Ga0207695_10008177 Ga0207695_1000817714 356
1849 3300025919 Ga0207657_10007473 Ga0207657_100074734 356
1850 3300025919 Ga0207657_10029267 Ga0207657_100292676 356
1851 3300025920 Ga0207649_10000246 Ga0207649_1000024630 356
1852 3300025920 Ga0207649_10142385 Ga0207649_101423851 356
1853 3300025921 Ga0207652_10276673 Ga0207652_102766731 356
1854 3300025925 Ga0207650_10026465 Ga0207650_100264651 356
1855 3300025928 Ga0207700_10015921 Ga0207700_100159212 356
1856 3300025929 Ga0207664_10003572 Ga0207664_1000357211 356
1857 3300025931 Ga0207644_10076073 Ga0207644_100760732 356
1858 3300025932 Ga0207690_10000210 Ga0207690_1000021016 356
1859 3300025932 Ga0207690_10110861 Ga0207690_101108612 356
1860 3300025933 Ga0207706_10090601 Ga0207706_100906012 356
1861 3300025936 Ga0207670_10149196 Ga0207670_101491961 356
1862 3300025940 Ga0207691_10034675 Ga0207691_100346756 356
1863 3300025941 Ga0207711_10009166 Ga0207711_100091668 356
1864 3300025942 Ga0207689_10076474 Ga0207689_100764741 356
1865 3300025944 Ga0207661_10419782 Ga0207661_104197821 356
1866 3300025945 Ga0207679_10000003 Ga0207679_1000000381 356
1867 3300025945 Ga0207679_10186551 Ga0207679_101865511 356
1868 3300025949 Ga0207667_10000082 Ga0207667_10000082106 356
1869 3300025972 Ga0207668_10009742 Ga0207668_100097422 356
1870 3300025981 Ga0207640_10000018 Ga0207640_1000001846 356
1871 3300025981 Ga0207640_10000217 Ga0207640_1000021732 356
1872 3300025986 Ga0207658_10315345 Ga0207658_103153451 356
1873 3300026041 Ga0207639_10282023 Ga0207639_102820232 356
1874 3300026067 Ga0207678_10000052 Ga0207678_1000005234 356
1875 3300026067 Ga0207678_10009903 Ga0207678_100099039 356
1876 3300026067 Ga0207678_10090803 Ga0207678_100908031 356
1877 3300026075 Ga0207708_10139678 Ga0207708_101396781 356
1878 3300026078 Ga0207702_10000110 Ga0207702_100001106 356
1879 3300026078 Ga0207702_10005090 Ga0207702_100050908 356
1880 3300026089 Ga0207648_10073465 Ga0207648_100734653 356
1881 3300026089 Ga0207648_10138316 Ga0207648_101383161 356
1882 3300026116 Ga0207674_10048813 Ga0207674_100488132 356
1883 3300026118 Ga0207675_100047861 Ga0207675_1000478613 356
1884 3300027360 Ga0209969_1002539 Ga0209969_10025393 356
1885 3300027471 Ga0209995_1002095 Ga0209995_10020952 356
1886 3300027614 Ga0209970_1004272 Ga0209970_10042722 356
1887 3300027666 Ga0209282_1000015 Ga0209282_100001525 356
1888 3300027876 Ga0209974_10012453 Ga0209974_100124532 356
1889 3300027907 Ga0207428_10114348 Ga0207428_101143481 356
1890 3300028379 Ga0268266_10048944 Ga0268266_100489442 356
1891 3300028379 Ga0268266_10076733 Ga0268266_100767332 356
1892 3300028380 Ga0268265_10304832 Ga0268265_103048321 356
1893 3300031239 Ga0265328_10000088 Ga0265328_100000882 356
1894 3300031595 Ga0265313_10022868 Ga0265313_100228683 356
1895 3300031824 Ga0307413_10063317 Ga0307413_100633172 356
1896 3300031824 Ga0307413_10090059 Ga0307413_100900592 356
1897 3300031852 Ga0307410_10124490 Ga0307410_101244901 356
1898 3300031911 Ga0307412_10002198 Ga0307412_100021986 356
1899 3300032002 Ga0307416_100436653 Ga0307416_1004366532 356
1900 3300032004 Ga0307414_10056385 Ga0307414_100563851 356
1901 3300032126 Ga0307415_100013107 Ga0307415_1000131072 356
1902 3300032126 Ga0307415_100073830 Ga0307415_1000738302 356
1903 3300035171 Ga0373946_0088496 Ga0373946_0088496_235_1314 356
1904 3300035171 Ga0373946_0128266 Ga0373946_0128266_28_1107 356
1905 3300035695 Ga0373927_0061161 Ga0373927_0061161_119_1198 356
1906 3300036401 Ga0373937_0077812 Ga0373937_0077812_787_1866 356
1907 3300037312 Ga0395899_0000369 Ga0395899_0000369_42141_43217 356
1908 3300037312 Ga0395899_0006931 Ga0395899_0006931_4311_5390 356
1909 3300037418 Ga0395900_0000916 Ga0395900_0000916_26485_27561 356
1910 3300037466 Ga0395898_0000305 Ga0395898_0000305_104462_105538 356
1911 3300037466 Ga0395898_0000526 Ga0395898_0000526_37204_38283 356
1912 3300038443 Ga0395901_0045690 Ga0395901_0045690_3016_4092 356
1913 3300038443 Ga0395901_0047914 Ga0395901_0047914_345_1421 356
1914 3300041486 Ga0451807_0338754 Ga0451807_0338754_1285_2361 356
1915 3300042001 Ga0439441_005187 Ga0439441_005187_708_1781 356
1916 3300042438 Ga0439459_0006415 Ga0439459_0006415_596_1699 356
1917 3300042876 Ga0451577_0015801 Ga0451577_0015801_408_1493 356
1918 3300042876 Ga0451577_0057999 Ga0451577_0057999_2272_3360 356
1919 3300044656 Ga0466969_0000424 Ga0466969_0000424_1179_2255 356
1920 3300044656 Ga0466969_0008755 Ga0466969_0008755_2775_3851 356
1921 3300044658 Ga0466972_0031456 Ga0466972_0031456_63_1160 356
1922 3300044663 Ga0466989_0116279 Ga0466989_0116279_448_1524 356
1923 3300044672 Ga0466982_0000004 Ga0466982_0000004_60802_61899 356
1924 3300044672 Ga0466982_0082218 Ga0466982_0082218_598_1668 356
1925 3300044673 Ga0453683_0000611 Ga0453683_0000611_18892_19983 356
1926 3300044684 Ga0466966_0003802 Ga0466966_0003802_2673_3749 356
1927 3300044693 Ga0466961_0000063 Ga0466961_0000063_6179_7255 356
1928 3300044693 Ga0466961_0001025 Ga0466961_0001025_14408_15598 356
1929 3300044693 Ga0466961_0006712 Ga0466961_0006712_5662_6738 356
1930 3300044693 Ga0466961_0009045 Ga0466961_0009045_4984_6060 356
1931 3300044693 Ga0466961_0016012 Ga0466961_0016012_1075_2151 356
1932 3300044706 Ga0466964_0006952 Ga0466964_0006952_735_1832 356
1933 3300044712 Ga0453684_0000029 Ga0453684_0000029_678440_679510 356
1934 3300044712 Ga0453684_0205688 Ga0453684_0205688_395_1480 356
1935 3300044735 Ga0466968_0062903 Ga0466968_0062903_271_1368 356
1936 3300044765 Ga0466970_0005868 Ga0466970_0005868_3391_4467 356
1937 3300044765 Ga0466970_0006560 Ga0466970_0006560_4234_5331 356
1938 3300044765 Ga0466970_0011697 Ga0466970_0011697_1571_2647 356
1939 3300044842 Ga0466957_0011252 Ga0466957_0011252_3880_4956 356
1940 3300045049 Ga0466959_0017018 Ga0466959_0017018_1256_2332 356
1941 3300045049 Ga0466959_0062636 Ga0466959_0062636_1158_2234 356
1942 3300045049 Ga0466959_0138345 Ga0466959_0138345_265_1341 356
1943 3300045051 Ga0451576_0008493 Ga0451576_0008493_7412_8497 356
1944 3300045051 Ga0451576_0367927 Ga0451576_0367927_324_1403 356
1945 3300045976 Ga0466967_0108189 Ga0466967_0108189_868_1944 356
1946 3300046460 Ga0495638_0000007 Ga0495638_0000007_268234_269334 356
1947 3300046460 Ga0495638_0000213 Ga0495638_0000213_51622_52719 356
1948 3300046499 Ga0495594_0116316 Ga0495594_0116316_385_1464 356
1949 3300046506 Ga0495583_0001355 Ga0495583_0001355_8249_9319 356
1950 3300046507 Ga0495606_0001151 Ga0495606_0001151_29868_30998 356
1951 3300046558 Ga0495633_0020740 Ga0495633_0020740_685_1758 356
1952 3300046615 Ga0495656_0016056 Ga0495656_0016056_743_1813 356
1953 3300046674 Ga0495588_0063380 Ga0495588_0063380_557_1627 356
1954 3300046694 Ga0495649_0027003 Ga0495649_0027003_232_1362 356
1955 3300047472 Ga0495686_0089942 Ga0495686_0089942_227_1345 356
1956 3300048905 Ga0496102_0480819 Ga0496102_0480819_52_1131 356
1957 3300048907 Ga0496104_0203621 Ga0496104_0203621_627_1724 356
1958 3300048908 Ga0496105_0025274 Ga0496105_0025274_2654_3733 356
1959 3300048910 Ga0496107_0077551 Ga0496107_0077551_132_1211 356
1960 3300048915 Ga0496112_0219560 Ga0496112_0219560_301_1380 356
1961 3300048918 Ga0496115_0000337 Ga0496115_0000337_21126_22256 356
1962 3300048918 Ga0496115_0000901 Ga0496115_0000901_17896_18993 356
1963 3300048918 Ga0496115_0091199 Ga0496115_0091199_621_1700 356
1964 3300048919 Ga0496116_0001838 Ga0496116_0001838_21738_22811 356
1965 3300048919 Ga0496116_0024501 Ga0496116_0024501_520_1599 356
1966 3300048920 Ga0496117_0011258 Ga0496117_0011258_3597_4676 356
1967 3300048920 Ga0496117_0094300 Ga0496117_0094300_740_1819 356
1968 3300048920 Ga0496117_0101077 Ga0496117_0101077_711_1784 356
1969 3300048921 Ga0496118_0005494 Ga0496118_0005494_9989_11068 356
1970 3300048921 Ga0496118_0008090 Ga0496118_0008090_6925_7998 356
1971 3300048921 Ga0496118_0032027 Ga0496118_0032027_1769_2848 356
1972 3300048921 Ga0496118_0039108 Ga0496118_0039108_74_1147 356
1973 3300048922 Ga0496119_0000058 Ga0496119_0000058_31099_32178 356
1974 3300048922 Ga0496119_0003751 Ga0496119_0003751_2816_3895 356
1975 3300048922 Ga0496119_0006080 Ga0496119_0006080_8291_9364 356
1976 3300048923 Ga0496120_0000184 Ga0496120_0000184_74459_75538 356
1977 3300048923 Ga0496120_0000335 Ga0496120_0000335_21883_22962 356
1978 3300048923 Ga0496120_0005744 Ga0496120_0005744_5024_6097 356
1979 3300048924 Ga0496121_0000127 Ga0496121_0000127_87239_88312 356
1980 3300048924 Ga0496121_0000369 Ga0496121_0000369_70119_71198 356
1981 3300048924 Ga0496121_0021200 Ga0496121_0021200_168_1247 356
1982 3300048924 Ga0496121_0097986 Ga0496121_0097986_457_1536 356
1983 3300048925 Ga0496122_0000601 Ga0496122_0000601_15158_16231 356
1984 3300048926 Ga0496123_0001435 Ga0496123_0001435_25406_26479 356
1985 3300048927 Ga0496124_0049982 Ga0496124_0049982_545_1618 356
1986 3300048927 Ga0496124_0061995 Ga0496124_0061995_1036_2118 356
1987 3300048927 Ga0496124_0112228 Ga0496124_0112228_543_1613 356
1988 3300048927 Ga0496124_0113733 Ga0496124_0113733_502_1575 356
1989 3300048928 Ga0496125_0000011 Ga0496125_0000011_519816_520889 356
1990 3300048929 Ga0496126_0005474 Ga0496126_0005474_10066_11145 356
1991 3300048929 Ga0496126_0044835 Ga0496126_0044835_629_1759 356
1992 3300048929 Ga0496126_0060887 Ga0496126_0060887_1753_2826 356
1993 3300048929 Ga0496126_0077273 Ga0496126_0077273_1756_2835 356
1994 3300048929 Ga0496126_0111168 Ga0496126_0111168_166_1296 356
1995 3300049569 Ga0501032_0042553 Ga0501032_0042553_703_1794 356
1996 3300049569 Ga0501032_0058512 Ga0501032_0058512_1169_2371 356
1997 3300049570 Ga0501033_0044867 Ga0501033_0044867_503_1594 356
1998 3300049570 Ga0501033_0132332 Ga0501033_0132332_518_1693 356
1999 3300049571 Ga0501034_0000805 Ga0501034_0000805_34455_35534 356
2000 3300049571 Ga0501034_0006289 Ga0501034_0006289_2430_3500 356
2001 3300049571 Ga0501034_0373051 Ga0501034_0373051_198_1274 356
2002 3300049572 Ga0501036_0177149 Ga0501036_0177149_518_1693 356
2003 3300049572 Ga0501036_0196163 Ga0501036_0196163_503_1594 356
2004 3300049573 Ga0501037_0147848 Ga0501037_0147848_510_1610 356
2005 3300049574 Ga0501038_0113022 Ga0501038_0113022_495_1670 356
2006 3300049575 Ga0501039_0158175 Ga0501039_0158175_187_1278 356
2007 3300049577 Ga0501041_0001993 Ga0501041_0001993_5495_6580 356
2008 3300049579 Ga0501043_0030429 Ga0501043_0030429_1313_2398 356
2009 3300049579 Ga0501043_0065086 Ga0501043_0065086_1664_2758 356
2010 3300049579 Ga0501043_0125744 Ga0501043_0125744_50_1252 356
2011 3300049580 Ga0501046_0016578 Ga0501046_0016578_4487_5662 356
2012 3300049580 Ga0501046_0059048 Ga0501046_0059048_814_1896 356
2013 3300049580 Ga0501046_0063647 Ga0501046_0063647_1546_2748 356
2014 3300049581 Ga0501047_0051023 Ga0501047_0051023_1248_2450 356
2015 3300049582 Ga0501048_0007377 Ga0501048_0007377_2601_3776 356
2016 3300049586 Ga0501070_0090904 Ga0501070_0090904_503_1678 356
2017 3300049588 Ga0501072_0072811 Ga0501072_0072811_111_1196 356
2018 3300049589 Ga0501073_0152519 Ga0501073_0152519_485_1576 356
2019 3300049590 Ga0501074_0192872 Ga0501074_0192872_23_1114 356
2020 3300049591 Ga0501075_0000550 Ga0501075_0000550_13810_14895 356
2021 3300049591 Ga0501075_0024743 Ga0501075_0024743_2259_3338 356
2022 3300049592 Ga0501076_0004981 Ga0501076_0004981_5504_6589 356
2023 3300049593 Ga0501077_0177793 Ga0501077_0177793_222_1295 356
2024 3300049656 Ga0501209_002279 Ga0501209_002279_1549_2628 356
2025 3300049741 Ga0501079_0000373 Ga0501079_0000373_6875_7960 356
2026 3300049741 Ga0501079_0037723 Ga0501079_0037723_2512_3591 356
2027 3300049742 Ga0501080_0004667 Ga0501080_0004667_9296_10381 356
2028 3300049742 Ga0501080_0062171 Ga0501080_0062171_1803_2978 356
2029 3300049743 Ga0501081_0015828 Ga0501081_0015828_1374_2459 356
2030 3300049744 Ga0501083_0137267 Ga0501083_0137267_195_1280 356
2031 3300049822 Ga0501035_0036810 Ga0501035_0036810_2120_3190 356
2032 3300049822 Ga0501035_0055684 Ga0501035_0055684_401_1486 356
2033 3300049822 Ga0501035_0087791 Ga0501035_0087791_14_1111 356
2034 3300049823 Ga0501044_0012397 Ga0501044_0012397_6547_7641 356
2035 3300049824 Ga0501045_0009512 Ga0501045_0009512_60_1148 356
2036 3300049824 Ga0501045_0012160 Ga0501045_0012160_2671_3756 356
2037 3300049824 Ga0501045_0168468 Ga0501045_0168468_25_1116 356
2038 3300050490 nmdc:mga03n38_3350_c1 nmdc:mga03n38_3350_c1_28_1128 356
2039 3300050491 nmdc:mga00v17_13175_c1 nmdc:mga00v17_13175_c1_842_1930 356
2040 3300050491 nmdc:mga00v17_1915_c1 nmdc:mga00v17_1915_c1_8970_10043 356
2041 3300050491 nmdc:mga00v17_25_c1 nmdc:mga00v17_25_c1_67409_68485 356
2042 3300050491 nmdc:mga00v17_51587_c1 nmdc:mga00v17_51587_c1_156_1229 356
2043 3300050491 nmdc:mga00v17_53344_c1 nmdc:mga00v17_53344_c1_1284_2357 356
2044 3300050507 nmdc:mga05p37_102212_c1 nmdc:mga05p37_102212_c1_1348_2427 356
2045 3300050507 nmdc:mga05p37_12026_c2 nmdc:mga05p37_12026_c2_35_1138 356
2046 3300050507 nmdc:mga05p37_131559_c1 nmdc:mga05p37_131559_c1_1886_2995 356
2047 3300050508 nmdc:mga09592_209637_c1 nmdc:mga09592_209637_c1_570_1649 356
2048 3300050508 nmdc:mga09592_35669_c1 nmdc:mga09592_35669_c1_636_1709 356
2049 3300050510 nmdc:mga06r32_35660_c1 nmdc:mga06r32_35660_c1_1708_2787 356
2050 3300050510 nmdc:mga06r32_7005_c2 nmdc:mga06r32_7005_c2_4309_5382 356
2051 3300050511 nmdc:mga08y16_30394_c1 nmdc:mga08y16_30394_c1_1342_2421 356
2052 3300050511 nmdc:mga08y16_459936_c1 nmdc:mga08y16_459936_c1_96_1175 356
2053 3300050511 nmdc:mga08y16_60566_c1 nmdc:mga08y16_60566_c1_1448_2518 356
2054 3300050511 nmdc:mga08y16_65480_c1 nmdc:mga08y16_65480_c1_2141_3214 356
2055 3300050511 nmdc:mga08y16_95638_c1 nmdc:mga08y16_95638_c1_1744_2823 356
2056 3300050512 nmdc:mga0n895_48882_c1 nmdc:mga0n895_48882_c1_163_1242 356
2057 3300050512 nmdc:mga0n895_748_c1 nmdc:mga0n895_748_c1_3567_4646 356
2058 3300050513 nmdc:mga0rr50_40729_c1 nmdc:mga0rr50_40729_c1_1105_2184 356
2059 3300050515 nmdc:mga0a205_20510_c1 nmdc:mga0a205_20510_c1_3566_4645 356
2060 3300050515 nmdc:mga0a205_342235_c1 nmdc:mga0a205_342235_c1_240_1319 356
2061 3300053093 Ga0500651_0000151 Ga0500651_0000151_19816_20892 356
2062 3300054114 Ga0501084_0236191 Ga0501084_0236191_105_1178 356
2063 3300054114 Ga0501084_0339531 Ga0501084_0339531_87_1166 356
2064 3300060353 Ga0501082_0247291 Ga0501082_0247291_370_1455 356
2065 3300061719 Ga0466962_0001841 Ga0466962_0001841_8567_9646 356
2066 3300061719 Ga0466962_0004777 Ga0466962_0004777_2871_3968 356
2067 3300061734 Ga0530510_0099239 Ga0530510_0099239_821_1906 356
2068 3300061734 Ga0530510_0150369 Ga0530510_0150369_88_1167 356
2069 3300001904 JGI24736J21556_1008787 JGI24736J21556_10087871 357
2070 3300001979 JGI24740J21852_10002698 JGI24740J21852_100026983 357
2071 3300001990 JGI24737J22298_10012640 JGI24737J22298_100126402 357
2072 3300002067 JGI24735J21928_10001297 JGI24735J21928_100012975 357
2073 3300002067 JGI24735J21928_10005255 JGI24735J21928_100052552 357
2074 3300002075 JGI24738J21930_10001513 JGI24738J21930_100015134 357
2075 3300002705 JGI25156J39149_1000504 JGI25156J39149_100050412 357
2076 3300002705 JGI25156J39149_1001469 JGI25156J39149_10014692 357
2077 3300002705 JGI25156J39149_1003017 JGI25156J39149_10030172 357
2078 3300003214 JGI25165J46597_1001003 JGI25165J46597_10010034 357
2079 3300003354 JGI25160J50197_1000171 JGI25160J50197_100017126 357
2080 3300003756 Ga0055533_1000345 Ga0055533_100034516 357
2081 3300003756 Ga0055533_1001543 Ga0055533_10015431 357
2082 3300003758 Ga0055532_1000001 Ga0055532_1000001967 357
2083 3300003760 Ga0055527_1000014 Ga0055527_100001437 357
2084 3300003761 Ga0055535_1000001 Ga0055535_100000137 357
2085 3300003762 Ga0055542_1000001 Ga0055542_1000001966 357
2086 3300003763 Ga0055529_1000001 Ga0055529_100000137 357
2087 3300005262 Ga0065165_1001400 Ga0065165_10014002 357
2088 3300005327 Ga0070658_10009631 Ga0070658_100096316 357
2089 3300005327 Ga0070658_10062666 Ga0070658_100626662 357
2090 3300005335 Ga0070666_10143901 Ga0070666_101439012 357
2091 3300005339 Ga0070660_100000032 Ga0070660_10000003263 357
2092 3300005339 Ga0070660_100001473 Ga0070660_10000147310 357
2093 3300005347 Ga0070668_100097604 Ga0070668_1000976042 357
2094 3300005366 Ga0070659_100000035 Ga0070659_10000003596 357
2095 3300005367 Ga0070667_100004868 Ga0070667_10000486810 357
2096 3300005455 Ga0070663_100000222 Ga0070663_1000002224 357
2097 3300005455 Ga0070663_100039065 Ga0070663_1000390652 357
2098 3300005563 Ga0068855_100002283 Ga0068855_1000022838 357
2099 3300005563 Ga0068855_100005973 Ga0068855_1000059735 357
2100 3300005564 Ga0070664_100023204 Ga0070664_1000232042 357
2101 3300005614 Ga0068856_100035872 Ga0068856_1000358722 357
2102 3300005616 Ga0068852_100042162 Ga0068852_1000421625 357
2103 3300009092 Ga0105250_10010510 Ga0105250_100105105 357
2104 3300009093 Ga0105240_10000656 Ga0105240_1000065645 357
2105 3300009545 Ga0105237_10009871 Ga0105237_100098713 357
2106 3300009545 Ga0105237_10116981 Ga0105237_101169811 357
2107 3300009545 Ga0105237_10171812 Ga0105237_101718122 357
2108 3300009545 Ga0105237_10247322 Ga0105237_102473222 357
2109 3300009551 Ga0105238_10069608 Ga0105238_100696082 357
2110 3300009551 Ga0105238_10096527 Ga0105238_100965271 357
2111 3300010375 Ga0105239_10020983 Ga0105239_100209834 357
2112 3300011119 Ga0105246_10086217 Ga0105246_100862171 357
2113 3300013100 Ga0157373_10012939 Ga0157373_100129395 357
2114 3300013104 Ga0157370_10000328 Ga0157370_1000032839 357
2115 3300013104 Ga0157370_10001149 Ga0157370_1000114916 357
2116 3300013104 Ga0157370_10205838 Ga0157370_102058382 357
2117 3300013105 Ga0157369_10000206 Ga0157369_1000020654 357
2118 3300013105 Ga0157369_10009615 Ga0157369_1000961511 357
2119 3300013105 Ga0157369_10010338 Ga0157369_100103385 357
2120 3300013105 Ga0157369_10093835 Ga0157369_100938351 357
2121 3300013296 Ga0157374_10000370 Ga0157374_1000037018 357
2122 3300013296 Ga0157374_10035618 Ga0157374_100356181 357
2123 3300013306 Ga0163162_10005686 Ga0163162_1000568610 357
2124 3300013307 Ga0157372_10002456 Ga0157372_100024569 357
2125 3300014497 Ga0182008_10039390 Ga0182008_100393902 357
2126 3300014969 Ga0157376_10446857 Ga0157376_104468571 357
2127 3300016635 Ga0183361_10012 Ga0183361_1001226 357
2128 3300020082 Ga0206353_10536292 Ga0206353_105362922 357
2129 3300021361 Ga0213872_10034549 Ga0213872_100345491 357
2130 3300022467 Ga0224712_10001677 Ga0224712_100016774 357
2131 3300025206 Ga0209435_103042 Ga0209435_1030422 357
2132 3300025225 Ga0209566_100216 Ga0209566_10021634 357
2133 3300025226 Ga0209674_100005 Ga0209674_1000051399 357
2134 3300025226 Ga0209674_100092 Ga0209674_10009251 357
2135 3300025228 Ga0209672_100001 Ga0209672_1000011796 357
2136 3300025228 Ga0209672_100028 Ga0209672_100028168 357
2137 3300025228 Ga0209672_100038 Ga0209672_100038157 357
2138 3300025228 Ga0209672_100971 Ga0209672_1009712 357
2139 3300025229 Ga0209147_100001 Ga0209147_1000011796 357
2140 3300025229 Ga0209147_100163 Ga0209147_10016320 357
2141 3300025231 Ga0207427_102015 Ga0207427_1020154 357
2142 3300025242 Ga0209258_100001 Ga0209258_1000011796 357
2143 3300025242 Ga0209258_100109 Ga0209258_10010919 357
2144 3300025242 Ga0209258_100112 Ga0209258_10011222 357
2145 3300025254 Ga0209148_1000003 Ga0209148_10000031796 357
2146 3300025254 Ga0209148_1000081 Ga0209148_100008170 357
2147 3300025254 Ga0209148_1000844 Ga0209148_100084419 357
2148 3300025256 Ga0209759_1000053 Ga0209759_1000053105 357
2149 3300025256 Ga0209759_1000074 Ga0209759_100007435 357
2150 3300025256 Ga0209759_1000601 Ga0209759_100060116 357
2151 3300025256 Ga0209759_1010316 Ga0209759_10103162 357
2152 3300025261 Ga0209233_1000016 Ga0209233_1000016756 357
2153 3300025272 Ga0209455_1000001 Ga0209455_10000011796 357
2154 3300025272 Ga0209455_1000050 Ga0209455_1000050152 357
2155 3300025273 Ga0209673_1000038 Ga0209673_100003890 357
2156 3300025291 Ga0209675_1022824 Ga0209675_10228242 357
2157 3300025302 Ga0207426_1000037 Ga0207426_1000037184 357
2158 3300025302 Ga0207426_1004322 Ga0207426_10043222 357
2159 3300025711 Ga0207696_1008768 Ga0207696_10087685 357
2160 3300025735 Ga0207713_1000305 Ga0207713_100030512 357
2161 3300025735 Ga0207713_1006791 Ga0207713_10067911 357
2162 3300025904 Ga0207647_10001292 Ga0207647_100012929 357
2163 3300025904 Ga0207647_10007692 Ga0207647_100076924 357
2164 3300025904 Ga0207647_10008418 Ga0207647_100084183 357
2165 3300025904 Ga0207647_10016163 Ga0207647_100161632 357
2166 3300025904 Ga0207647_10021486 Ga0207647_100214861 357
2167 3300025909 Ga0207705_10000708 Ga0207705_100007086 357
2168 3300025909 Ga0207705_10044674 Ga0207705_100446742 357
2169 3300025909 Ga0207705_10124121 Ga0207705_101241211 357
2170 3300025913 Ga0207695_10024144 Ga0207695_100241445 357
2171 3300025914 Ga0207671_10013085 Ga0207671_100130854 357
2172 3300025914 Ga0207671_10024641 Ga0207671_100246414 357
2173 3300025919 Ga0207657_10000051 Ga0207657_1000005160 357
2174 3300025919 Ga0207657_10000131 Ga0207657_1000013125 357
2175 3300025924 Ga0207694_10017034 Ga0207694_100170342 357
2176 3300025924 Ga0207694_10043166 Ga0207694_100431662 357
2177 3300025927 Ga0207687_10249049 Ga0207687_102490491 357
2178 3300025932 Ga0207690_10000034 Ga0207690_1000003495 357
2179 3300025945 Ga0207679_10054534 Ga0207679_100545342 357
2180 3300025949 Ga0207667_10003897 Ga0207667_100038974 357
2181 3300025949 Ga0207667_10010642 Ga0207667_100106424 357
2182 3300025949 Ga0207667_10178025 Ga0207667_101780251 357
2183 3300025960 Ga0207651_10056539 Ga0207651_100565391 357
2184 3300026067 Ga0207678_10004514 Ga0207678_100045144 357
2185 3300026067 Ga0207678_10051671 Ga0207678_100516713 357
2186 3300026067 Ga0207678_10109857 Ga0207678_101098572 357
2187 3300026078 Ga0207702_10034011 Ga0207702_100340112 357
2188 3300026078 Ga0207702_10044808 Ga0207702_100448082 357
2189 3300026142 Ga0207698_10151450 Ga0207698_101514502 357
2190 3300027312 Ga0209371_1000090 Ga0209371_1000090143 357
2191 3300028800 Ga0265338_10000113 Ga0265338_1000011374 357
2192 3300028800 Ga0265338_10000928 Ga0265338_1000092818 357
2193 3300030500 Ga0268256_1000115 Ga0268256_100011590 357
2194 3300031247 Ga0265340_10072548 Ga0265340_100725481 357
2195 3300031251 Ga0265327_10000240 Ga0265327_1000024038 357
2196 3300031548 Ga0307408_100001085 Ga0307408_1000010859 357
2197 3300031731 Ga0307405_10017479 Ga0307405_100174792 357
2198 3300031911 Ga0307412_10000051 Ga0307412_100000515 357
2199 3300031995 Ga0307409_100454994 Ga0307409_1004549941 357
2200 3300032002 Ga0307416_100360116 Ga0307416_1003601161 357
2201 3300037312 Ga0395899_0000008 Ga0395899_0000008_371315_372388 357
2202 3300037418 Ga0395900_0000055 Ga0395900_0000055_23618_24691 357
2203 3300037418 Ga0395900_0002362 Ga0395900_0002362_19785_20858 357
2204 3300037466 Ga0395898_0000119 Ga0395898_0000119_54097_55170 357
2205 3300037471 Ga0395905_0000168 Ga0395905_0000168_37150_38223 357
2206 3300037471 Ga0395905_0232870 Ga0395905_0232870_520_1593 357
2207 3300038443 Ga0395901_0000003 Ga0395901_0000003_503148_504221 357
2208 3300038443 Ga0395901_0000180 Ga0395901_0000180_68900_69973 357
2209 3300038443 Ga0395901_0000887 Ga0395901_0000887_11915_12988 357
2210 3300038443 Ga0395901_0092508 Ga0395901_0092508_259_1332 357
2211 3300039437 Ga0436365_0415708 Ga0436365_0415708_4177_5250 357
2212 3300039447 Ga0436361_0911021 Ga0436361_0911021_571_1665 357
2213 3300042005 Ga0439448_0000631 Ga0439448_0000631_5832_6905 357
2214 3300044656 Ga0466969_0001151 Ga0466969_0001151_702_1775 357
2215 3300044656 Ga0466969_0008822 Ga0466969_0008822_2658_3731 357
2216 3300044656 Ga0466969_0014590 Ga0466969_0014590_1796_2869 357
2217 3300044683 Ga0466965_0002035 Ga0466965_0002035_4385_5458 357
2218 3300044683 Ga0466965_0008216 Ga0466965_0008216_1073_2146 357
2219 3300044684 Ga0466966_0002831 Ga0466966_0002831_6995_8068 357
2220 3300044684 Ga0466966_0019158 Ga0466966_0019158_3123_4196 357
2221 3300044684 Ga0466966_0030085 Ga0466966_0030085_1134_2207 357
2222 3300044693 Ga0466961_0001718 Ga0466961_0001718_11579_12652 357
2223 3300044693 Ga0466961_0002804 Ga0466961_0002804_9024_10097 357
2224 3300044693 Ga0466961_0003495 Ga0466961_0003495_1523_2596 357
2225 3300044693 Ga0466961_0148196 Ga0466961_0148196_38_1111 357
2226 3300044694 Ga0466963_0002167 Ga0466963_0002167_6769_7842 357
2227 3300044719 Ga0466971_0081427 Ga0466971_0081427_293_1366 357
2228 3300044765 Ga0466970_0056656 Ga0466970_0056656_882_1955 357
2229 3300044765 Ga0466970_0133261 Ga0466970_0133261_158_1231 357
2230 3300044842 Ga0466957_0037293 Ga0466957_0037293_1561_2634 357
2231 3300044901 Ga0466960_0099149 Ga0466960_0099149_377_1450 357
2232 3300045049 Ga0466959_0012272 Ga0466959_0012272_3602_4675 357
2233 3300045049 Ga0466959_0154517 Ga0466959_0154517_179_1252 357
2234 3300045836 Ga0466958_0001624 Ga0466958_0001624_2866_4059 357
2235 3300046454 Ga0495592_0053492 Ga0495592_0053492_1777_2850 357
2236 3300046454 Ga0495592_0061664 Ga0495592_0061664_1543_2616 357
2237 3300046455 Ga0495603_0013901 Ga0495603_0013901_676_1749 357
2238 3300046455 Ga0495603_0074633 Ga0495603_0074633_392_1465 357
2239 3300046457 Ga0495590_0001195 Ga0495590_0001195_10230_11303 357
2240 3300046457 Ga0495590_0004217 Ga0495590_0004217_126_1199 357
2241 3300046459 Ga0495629_0000369 Ga0495629_0000369_17683_18768 357
2242 3300046459 Ga0495629_0001732 Ga0495629_0001732_353_1426 357
2243 3300046459 Ga0495629_0088581 Ga0495629_0088581_470_1543 357
2244 3300046459 Ga0495629_0148519 Ga0495629_0148519_350_1423 357
2245 3300046461 Ga0495641_0074103 Ga0495641_0074103_352_1467 357
2246 3300046462 Ga0495651_0090443 Ga0495651_0090443_84_1157 357
2247 3300046462 Ga0495651_0119778 Ga0495651_0119778_559_1632 357
2248 3300046463 Ga0495653_0001073 Ga0495653_0001073_697_1782 357
2249 3300046463 Ga0495653_0022928 Ga0495653_0022928_1573_2646 357
2250 3300046471 Ga0495650_0002502 Ga0495650_0002502_9295_10368 357
2251 3300046471 Ga0495650_0008713 Ga0495650_0008713_4172_5245 357
2252 3300046471 Ga0495650_0023993 Ga0495650_0023993_343_1416 357
2253 3300046471 Ga0495650_0033479 Ga0495650_0033479_174_1247 357
2254 3300046472 Ga0495580_0012174 Ga0495580_0012174_4693_5766 357
2255 3300046472 Ga0495580_0018128 Ga0495580_0018128_270_1343 357
2256 3300046472 Ga0495580_0021261 Ga0495580_0021261_761_1876 357
2257 3300046472 Ga0495580_0145884 Ga0495580_0145884_310_1383 357
2258 3300046473 Ga0495582_0093805 Ga0495582_0093805_340_1413 357
2259 3300046474 Ga0495605_0002857 Ga0495605_0002857_2372_3445 357
2260 3300046474 Ga0495605_0005746 Ga0495605_0005746_46_1119 357
2261 3300046474 Ga0495605_0009499 Ga0495605_0009499_297_1370 357
2262 3300046476 Ga0495662_0031130 Ga0495662_0031130_617_1690 357
2263 3300046477 Ga0495664_0011074 Ga0495664_0011074_565_1638 357
2264 3300046477 Ga0495664_0013672 Ga0495664_0013672_2467_3540 357
2265 3300046500 Ga0495596_0033704 Ga0495596_0033704_899_1972 357
2266 3300046506 Ga0495583_0013734 Ga0495583_0013734_1130_2203 357
2267 3300046507 Ga0495606_0158943 Ga0495606_0158943_159_1232 357
2268 3300046511 Ga0495608_0089959 Ga0495608_0089959_517_1590 357
2269 3300046512 Ga0495610_0014790 Ga0495610_0014790_3399_4472 357
2270 3300046514 Ga0495618_0007782 Ga0495618_0007782_2889_3962 357
2271 3300046515 Ga0495620_0042858 Ga0495620_0042858_415_1488 357
2272 3300046515 Ga0495620_0082844 Ga0495620_0082844_73_1197 357
2273 3300046516 Ga0495628_0067174 Ga0495628_0067174_291_1364 357
2274 3300046516 Ga0495628_0093529 Ga0495628_0093529_576_1649 357
2275 3300046516 Ga0495628_0193999 Ga0495628_0193999_92_1165 357
2276 3300046517 Ga0495630_0113068 Ga0495630_0113068_691_1764 357
2277 3300046518 Ga0495631_0081817 Ga0495631_0081817_73_1146 357
2278 3300046524 Ga0495648_0042216 Ga0495648_0042216_1671_2744 357
2279 3300046526 Ga0495666_0005726 Ga0495666_0005726_2507_3580 357
2280 3300046526 Ga0495666_0005909 Ga0495666_0005909_165_1280 357
2281 3300046529 Ga0495652_0051789 Ga0495652_0051789_994_2067 357
2282 3300046529 Ga0495652_0211735 Ga0495652_0211735_139_1254 357
2283 3300046533 Ga0495640_0017424 Ga0495640_0017424_2994_4067 357
2284 3300046533 Ga0495640_0024613 Ga0495640_0024613_1006_2079 357
2285 3300046535 Ga0495586_0043186 Ga0495586_0043186_11_1126 357
2286 3300046536 Ga0495587_0033202 Ga0495587_0033202_184_1257 357
2287 3300046542 Ga0495597_0011733 Ga0495597_0011733_3069_4142 357
2288 3300046543 Ga0495645_0026831 Ga0495645_0026831_516_1589 357
2289 3300046557 Ga0495622_0004708 Ga0495622_0004708_4131_5204 357
2290 3300046559 Ga0495667_0144583 Ga0495667_0144583_291_1364 357
2291 3300046642 Ga0495634_0027058 Ga0495634_0027058_638_1711 357
2292 3300046648 Ga0495611_0091762 Ga0495611_0091762_199_1314 357
2293 3300046663 Ga0495635_0025333 Ga0495635_0025333_1873_2946 357
2294 3300046678 Ga0495599_0016515 Ga0495599_0016515_3033_4106 357
2295 3300046678 Ga0495599_0031771 Ga0495599_0031771_700_1815 357
2296 3300046679 Ga0495623_0008543 Ga0495623_0008543_987_2060 357
2297 3300046679 Ga0495623_0033945 Ga0495623_0033945_270_1343 357
2298 3300046680 Ga0495646_0016028 Ga0495646_0016028_208_1281 357
2299 3300046680 Ga0495646_0077132 Ga0495646_0077132_559_1632 357
2300 3300046680 Ga0495646_0137098 Ga0495646_0137098_185_1258 357
2301 3300046689 Ga0495613_0068070 Ga0495613_0068070_308_1381 357
2302 3300046690 Ga0495624_0009205 Ga0495624_0009205_1856_2941 357
2303 3300046690 Ga0495624_0055550 Ga0495624_0055550_562_1635 357
2304 3300046691 Ga0495670_0013254 Ga0495670_0013254_2694_3767 357
2305 3300046694 Ga0495649_0007267 Ga0495649_0007267_5472_6596 357
2306 3300046694 Ga0495649_0032167 Ga0495649_0032167_518_1591 357
2307 3300046694 Ga0495649_0040578 Ga0495649_0040578_1447_2520 357
2308 3300046794 Ga0495589_0019930 Ga0495589_0019930_1898_2971 357
2309 3300046794 Ga0495589_0020790 Ga0495589_0020790_463_1536 357
2310 3300046809 Ga0495600_0036734 Ga0495600_0036734_1703_2776 357
2311 3300047315 Ga0495581_0009319 Ga0495581_0009319_301_1374 357
2312 3300047315 Ga0495581_0024799 Ga0495581_0024799_1744_2817 357
2313 3300047317 Ga0495604_0013780 Ga0495604_0013780_1104_2177 357
2314 3300047317 Ga0495604_0025632 Ga0495604_0025632_1799_2872 357
2315 3300047317 Ga0495604_0156408 Ga0495604_0156408_138_1253 357
2316 3300047317 Ga0495604_0191096 Ga0495604_0191096_117_1190 357
2317 3300047319 Ga0495674_0026221 Ga0495674_0026221_1813_2898 357
2318 3300047319 Ga0495674_0031744 Ga0495674_0031744_2773_3846 357
2319 3300047319 Ga0495674_0063328 Ga0495674_0063328_899_1972 357
2320 3300047319 Ga0495674_0119296 Ga0495674_0119296_518_1591 357
2321 3300047319 Ga0495674_0124040 Ga0495674_0124040_33_1148 357
2322 3300047319 Ga0495674_0182961 Ga0495674_0182961_470_1543 357
2323 3300047320 Ga0495672_0002512 Ga0495672_0002512_2338_3411 357
2324 3300047321 Ga0495676_0026138 Ga0495676_0026138_2740_3855 357
2325 3300047322 Ga0495680_0095146 Ga0495680_0095146_341_1456 357
2326 3300047322 Ga0495680_0098210 Ga0495680_0098210_643_1716 357
2327 3300047322 Ga0495680_0133702 Ga0495680_0133702_438_1511 357
2328 3300047323 Ga0495683_0001779 Ga0495683_0001779_8242_9315 357
2329 3300047323 Ga0495683_0004756 Ga0495683_0004756_716_1840 357
2330 3300047323 Ga0495683_0030704 Ga0495683_0030704_630_1703 357
2331 3300047323 Ga0495683_0044623 Ga0495683_0044623_156_1229 357
2332 3300047323 Ga0495683_0085366 Ga0495683_0085366_348_1421 357
2333 3300047443 Ga0495687_000011 Ga0495687_000011_276180_277253 357
2334 3300047443 Ga0495687_013679 Ga0495687_013679_1332_2405 357
2335 3300047443 Ga0495687_027761 Ga0495687_027761_1302_2375 357
2336 3300047444 Ga0495675_0003175 Ga0495675_0003175_6196_7269 357
2337 3300047444 Ga0495675_0007425 Ga0495675_0007425_249_1322 357
2338 3300047444 Ga0495675_0057385 Ga0495675_0057385_58_1131 357
2339 3300047446 Ga0495679_000109 Ga0495679_000109_42388_43461 357
2340 3300047446 Ga0495679_002394 Ga0495679_002394_7178_8293 357
2341 3300047446 Ga0495679_015689 Ga0495679_015689_1034_2107 357
2342 3300047469 Ga0495673_0021483 Ga0495673_0021483_463_1536 357
2343 3300047472 Ga0495686_0000014 Ga0495686_0000014_317000_318073 357
2344 3300047472 Ga0495686_0125096 Ga0495686_0125096_322_1395 357
2345 3300047673 Ga0495593_0007804 Ga0495593_0007804_1695_2768 357
2346 3300047673 Ga0495593_0011155 Ga0495593_0011155_1635_2708 357
2347 3300047673 Ga0495593_0018797 Ga0495593_0018797_1977_3050 357
2348 3300048088 Ga0495602_0014017 Ga0495602_0014017_6980_8053 357
2349 3300048088 Ga0495602_0014087 Ga0495602_0014087_753_1868 357
2350 3300048089 Ga0495614_0036590 Ga0495614_0036590_626_1699 357
2351 3300048091 Ga0495626_0073264 Ga0495626_0073264_26_1099 357
2352 3300048903 Ga0496100_0002540 Ga0496100_0002540_7513_8586 357
2353 3300048903 Ga0496100_0144844 Ga0496100_0144844_272_1345 357
2354 3300048904 Ga0496101_0009354 Ga0496101_0009354_1970_3043 357
2355 3300048904 Ga0496101_0011612 Ga0496101_0011612_1043_2164 357
2356 3300048905 Ga0496102_0102880 Ga0496102_0102880_595_1668 357
2357 3300048906 Ga0496103_0003274 Ga0496103_0003274_8625_9698 357
2358 3300048906 Ga0496103_0027373 Ga0496103_0027373_1759_2874 357
2359 3300048907 Ga0496104_0105944 Ga0496104_0105944_35_1108 357
2360 3300048908 Ga0496105_0028899 Ga0496105_0028899_804_1877 357
2361 3300048909 Ga0496106_0000031 Ga0496106_0000031_53150_54274 357
2362 3300048913 Ga0496110_0044382 Ga0496110_0044382_580_1653 357
2363 3300048914 Ga0496111_0015892 Ga0496111_0015892_18_1091 357
2364 3300048915 Ga0496112_0068558 Ga0496112_0068558_840_1913 357
2365 3300048917 Ga0496114_0028544 Ga0496114_0028544_3202_4275 357
2366 3300048919 Ga0496116_0063852 Ga0496116_0063852_1040_2113 357
2367 3300048920 Ga0496117_0009914 Ga0496117_0009914_7262_8335 357
2368 3300048920 Ga0496117_0055028 Ga0496117_0055028_1301_2374 357
2369 3300048920 Ga0496117_0069839 Ga0496117_0069839_643_1758 357
2370 3300048920 Ga0496117_0071176 Ga0496117_0071176_341_1414 357
2371 3300048920 Ga0496117_0097590 Ga0496117_0097590_212_1285 357
2372 3300048921 Ga0496118_0002651 Ga0496118_0002651_18899_19972 357
2373 3300048921 Ga0496118_0004033 Ga0496118_0004033_9383_10456 357
2374 3300048921 Ga0496118_0034121 Ga0496118_0034121_2411_3526 357
2375 3300048921 Ga0496118_0044801 Ga0496118_0044801_1179_2252 357
2376 3300048921 Ga0496118_0075311 Ga0496118_0075311_152_1225 357
2377 3300048924 Ga0496121_0003505 Ga0496121_0003505_2422_3531 357
2378 3300048924 Ga0496121_0013556 Ga0496121_0013556_2541_3665 357
2379 3300048925 Ga0496122_0004949 Ga0496122_0004949_1499_2572 357
2380 3300048926 Ga0496123_0019863 Ga0496123_0019863_175_1248 357
2381 3300048928 Ga0496125_0060297 Ga0496125_0060297_1461_2534 357
2382 3300048929 Ga0496126_0003165 Ga0496126_0003165_31_1104 357
2383 3300048929 Ga0496126_0004283 Ga0496126_0004283_15260_16333 357
2384 3300048929 Ga0496126_0044716 Ga0496126_0044716_1004_2077 357
2385 3300061719 Ga0466962_0001245 Ga0466962_0001245_10438_11511 357

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00793

DAHP_synth_1

DAHP synthetase I family

19

329

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gg1-assembly1.cif.gz_A crystal structure analysis of dahp synthase in complex with mn2+ and 2-phosphoglycolate 0.9916 8 349
8e0y-assembly1.cif.gz_D dahp (3-deoxy-d-arabinoheptulosonate-7-phosphate) synthase complexed with dahp oxime, pr(iii), and pi in unbound:(bound)2:other conformations 0.9916 8 350
8e0s-assembly1.cif.gz_A dahp (3-deoxy-d-arabinoheptulosonate-7-phosphate) synthase complexed with dahp oxime in unbound:(bound)2:unbound conformations 0.9913 8 350
1qr7-assembly1.cif.gz_C crystal structure of phenylalanine-regulated 3-deoxy-d-arabino-heptulosonate-7-phosphate synthase from escherichia coli complexed with pb2+ and pep 0.9907 9 350
8e0t-assembly1.cif.gz_D dahp (3-deoxy-d-arabinoheptulosonate-7-phosphate) synthase complexed with dahp oxime in unbound:(bound)2:other conformations 0.9902 8 350
ID Description Score Start End Superfamily
6aglB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9721 11 345 3.20.20.70
1ofpA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.962 7 352 3.20.20.70
1of6A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9574 4 352 3.20.20.70
6aglB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9543 11 345 3.20.20.70
1ofpA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9527 7 352 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A4S0L8Z9-F1-model_v4 deleted 1.005 251 343
AF-A0A6H3EG34-F1-model_v4 deleted 1.003 146 248
AF-U7QZE3-F1-model_v4 Phospho-2-dehydro-3-deoxyheptonate aldolase, Trp-sensitive (EC 2.5.1.54) (3-deoxy-D-arabino-heptulosonate 7-phosphate synthase) (DAHP synthase) (Phospho-2-keto-3-deoxyheptonate aldolase) 0.999 234 349 GO:0003849
GO:0005737
GO:0008652
GO:0009073
GO:0009423
AF-D6PKL5-F1-model_v4 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) 0.9987 109 210 GO:0003849
GO:0008652
GO:0009073
AF-A0A447JH88-F1-model_v4 Phospho-2-dehydro-3-deoxyheptonate aldolase, Trp-sensitive (EC 2.5.1.54) (3-deoxy-D-arabino-heptulosonate 7-phosphate synthase) (DAHP synthase) (Phospho-2-keto-3-deoxyheptonate aldolase) 0.9974 239 349 GO:0003849
GO:0005737
GO:0008652
GO:0009073
GO:0009423

Feature Viewer

pLDDT pTM Quality
94.42 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map